F483201

General Info

Members Datasets Scaffolds Average Seq Length
844 517 1688 246

Family's Representative Sequence

Representative Sequence 2162886011|MRS1b_contig_6140270|MRS1b_0787.00000180
Length 277
Sequence MPKRGMSTISLRNQALWIFPATRNKEFTMQQLKDRRAVITGAGSGIGAAIARAYAVEGARLVLGDRDPTNLTKVAEQCRQLGAQVYACVADVGTVEGAQAGVDACVEQFGGIDILVNNAGMLTQARCIDLSIEMWNDMLRVDLTSVFVASQRALPHMLAQRWGRIINVASQLGIKGGAELTHYSAAKAGVIGFTKSLALEVAKDNVLVNAIAPGPIETPLVAGISSAWKTAKAAELPLGRFGLAEEVAPVAVLLGSEPGGNLFVGQTLGPNSGDVMP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
305 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
306 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
317 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
318 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
319 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
320 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
321 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
322 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
323 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
324 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
325 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
326 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
327 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
328 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
329 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
330 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
331 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
332 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
333 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
334 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
335 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
336 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
337 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
338 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
339 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
340 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
341 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
342 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
343 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
344 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
345 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
346 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
347 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
348 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
349 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
350 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
351 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
352 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
353 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
354 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
355 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
356 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
357 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
358 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
359 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
360 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
361 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
362 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
363 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
364 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
365 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
366 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
367 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
368 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
369 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
370 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
371 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
372 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
373 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
374 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
375 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
376 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
377 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
378 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
379 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
380 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
381 2643221618 Ensifer sp. Root231 Isolate Unclassified
382 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
383 2643221626 Ensifer sp. Root31 Isolate Unclassified
384 2643221655 Ensifer sp. Root1252 Isolate Unclassified
385 2643221659 Ensifer sp. Root127 Isolate Unclassified
386 2643221698 Ensifer sp. Root142 Isolate Unclassified
387 2643221712 Ensifer sp. Root258 Isolate Unclassified
388 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
389 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
390 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
391 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
392 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
393 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
394 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
395 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
396 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
397 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
398 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
399 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
400 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
401 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
402 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
403 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
404 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
405 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
406 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
407 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
408 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
409 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
410 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
411 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
412 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
413 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
414 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
415 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
416 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
417 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
418 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
419 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
420 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
421 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
422 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
423 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
424 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
425 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
426 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
427 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
428 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
429 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
430 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
431 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
432 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
433 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
434 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
435 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
436 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
437 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
438 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
439 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
440 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
441 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
442 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
443 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
444 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
445 2844163670 Ensifer sp. 1H6 Isolate Unclassified
446 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
447 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
448 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
449 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
450 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
451 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
452 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
453 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
454 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
455 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
456 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
457 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
458 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
459 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
460 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
461 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
462 2909042592 Labrys sp. LIt4 Isolate Nodule
463 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
464 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
465 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
466 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
467 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
468 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
469 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
470 2920879853 Kocuria salina CV6 Isolate Unclassified
471 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
472 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
473 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
474 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
475 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
476 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
477 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
478 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
479 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
480 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
481 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
482 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
483 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
484 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
485 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
486 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
487 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
488 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
489 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
490 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
491 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
492 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
493 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
494 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
495 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
496 3004167301 Mesorhizobium loti 582 Isolate Unclassified
497 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
498 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
499 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
500 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
501 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
502 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
503 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
504 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
505 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
506 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
507 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
508 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
509 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
510 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
511 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
512 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
513 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
514 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
515 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
516 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
517 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.07
Metatranscriptomes 0.12
Isolates 23.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 9.24
Nodule 6.28
Rhizoplane 6.87
Rhizosphere 59.6
Stem 0
Stem Tuber 0.12
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6140270 2162886011 Bacteria 1955
2 JGI24740J21852_10000003 3300001979 Bacteria 127453
3 JGI24735J21928_10005504 3300002067 Bacteria 4200
4 JGI25162J39368_1000054 3300002737 Bacteria 147779
5 JGI25162J39368_1000102 3300002737 Bacteria 94155
6 JGI25163J39215_1000106 3300002771 Bacteria 35005
7 JGI25164J39214_1000029 3300002772 Bacteria 147779
8 JGI25159J45721_1000219 3300002987 Bacteria 27046
9 JGI25151J46595_10046455 3300003187 Bacteria 1521
10 JGI25151J46595_10047265 3300003187 Bacteria 1499
11 JGI25165J46597_1000111 3300003214 Bacteria 147779
12 JGI25165J46597_1000484 3300003214 Bacteria 38657
13 JGI25165J46597_1000508 3300003214 Bacteria 37207
14 rootH2_10013296 3300003320 Bacteria 7416
15 rootL2_10057665 3300003322 Bacteria 6863
16 rootH1_10054242 3300003323 Bacteria 4723
17 JGI25160J50197_1000058 3300003354 Bacteria 117529
18 JGI25161J50226_1000044 3300003374 Bacteria 117529
19 Ga0055533_1000188 3300003756 Bacteria 51375
20 Ga0055532_1000069 3300003758 Bacteria 138614
21 Ga0055527_1000034 3300003760 Bacteria 138614
22 Ga0055535_1000049 3300003761 Bacteria 138835
23 Ga0055542_1000077 3300003762 Bacteria 138614
24 Ga0055529_1000090 3300003763 Bacteria 138416
25 Ga0055528_1027767 3300003790 Bacteria 1581
26 Ga0055530_10000002 3300003791 Bacteria 300466
27 Ga0055540_1000009 3300003792 Bacteria 300466
28 Ga0058692_1025258 3300003856 Bacteria 1183
29 Ga0055543_1000133 3300004625 Bacteria 61636
30 Ga0065165_1000158 3300005262 Bacteria 117567
31 Ga0065714_10002500 3300005288 Bacteria 18562
32 Ga0065714_10066186 3300005288 Bacteria 7391
33 Ga0065704_10001000 3300005289 Bacteria 20119
34 Ga0065712_10071063 3300005290 Bacteria 5505
35 Ga0070683_100335780 3300005329 Bacteria 1439
36 Ga0070670_100001447 3300005331 Bacteria 19062
37 Ga0070670_100004177 3300005331 Bacteria 12081
38 Ga0070661_100000066 3300005344 Bacteria 84469
39 Ga0070669_100000310 3300005353 Bacteria 38441
40 Ga0070669_100499601 3300005353 Bacteria 1009
41 Ga0070673_100261136 3300005364 Bacteria 1513
42 Ga0070708_100034754 3300005445 Bacteria 4387
43 Ga0070681_10141044 3300005458 Bacteria 2340
44 Ga0070707_100001936 3300005468 Bacteria 19873
45 Ga0070707_100535870 3300005468 Bacteria 1133
46 Ga0070684_100539328 3300005535 Bacteria 1082
47 Ga0068853_100001132 3300005539 Bacteria 18885
48 Ga0068853_100103699 3300005539 Bacteria 2517
49 Ga0070665_100073235 3300005548 Bacteria 3432
50 Ga0070665_100117921 3300005548 Bacteria 2657
51 Ga0070665_100248158 3300005548 Bacteria 1780
52 Ga0070665_100586210 3300005548 Bacteria 1128
53 Ga0068855_100823248 3300005563 Bacteria 985
54 Ga0070664_100000034 3300005564 Bacteria 82848
55 Ga0070664_100249602 3300005564 Bacteria 1595
56 Ga0068854_100027038 3300005578 Bacteria 3950
57 Ga0068856_100027877 3300005614 Bacteria 5511
58 Ga0068856_100186967 3300005614 Bacteria 2085
59 Ga0068856_100376777 3300005614 Bacteria 1438
60 Ga0068852_100064992 3300005616 Bacteria 3182
61 Ga0068852_100149153 3300005616 Bacteria 2173
62 Ga0068864_100261871 3300005618 Bacteria 1609
63 Ga0068851_10000006 3300005834 Bacteria 258116
64 Ga0081538_10011693 3300005981 Bacteria 7092
65 Ga0075365_10063192 3300006038 Bacteria 2478
66 Ga0075364_10062745 3300006051 Bacteria 2439
67 Ga0075367_10035513 3300006178 Bacteria 2886
68 Ga0075428_100671086 3300006844 Bacteria 1105
69 Ga0099823_1000047 3300006944 Bacteria 58430
70 Ga0079104_1000003 3300006946 Bacteria 468966
71 Ga0099795_10000877 3300007788 Bacteria 6036
72 Ga0105251_10000106 3300009011 Bacteria 82337
73 Ga0105251_10001276 3300009011 Bacteria 21766
74 Ga0105251_10001527 3300009011 Bacteria 19871
75 Ga0105251_10002275 3300009011 Bacteria 15231
76 Ga0105251_10002281 3300009011 Bacteria 15201
77 Ga0105251_10042893 3300009011 Bacteria 2193
78 Ga0105251_10046157 3300009011 Bacteria 2097
79 Ga0105244_10000500 3300009036 Bacteria 35235
80 Ga0105244_10004088 3300009036 Bacteria 10179
81 Ga0105244_10007940 3300009036 Bacteria 6685
82 Ga0105244_10023086 3300009036 Bacteria 3417
83 Ga0105250_10000153 3300009092 Bacteria 59733
84 Ga0105250_10001930 3300009092 Bacteria 10767
85 Ga0105240_10000012 3300009093 Bacteria 496639
86 Ga0105240_10127080 3300009093 Bacteria 3062
87 Ga0105243_10000450 3300009148 Bacteria 42853
88 Ga0105243_10005836 3300009148 Bacteria 9547
89 Ga0105243_10034101 3300009148 Bacteria 3939
90 Ga0105242_10003251 3300009176 Bacteria 12674
91 Ga0105248_10009584 3300009177 Bacteria 10659
92 Ga0105248_10120456 3300009177 Bacteria 2960
93 Ga0105237_10000160 3300009545 Bacteria 95183
94 Ga0105237_10000941 3300009545 Bacteria 39120
95 Ga0105237_10058313 3300009545 Bacteria 3864
96 Ga0105237_10349349 3300009545 Bacteria 1483
97 Ga0105238_10120019 3300009551 Bacteria 2609
98 Ga0105147_102869 3300009982 Bacteria 1432
99 Ga0105239_10058541 3300010375 Bacteria 4228
100 Ga0105239_10447078 3300010375 Bacteria 1466
101 Ga0105246_10000029 3300011119 Bacteria 52483
102 Ga0157373_10006473 3300013100 Bacteria 8739
103 Ga0157373_10008560 3300013100 Bacteria 7597
104 Ga0157373_10061972 3300013100 Bacteria 2649
105 Ga0157373_10146923 3300013100 Bacteria 1658
106 Ga0157371_10001102 3300013102 Bacteria 29273
107 Ga0157371_10001530 3300013102 Bacteria 23802
108 Ga0157371_10050396 3300013102 Bacteria 2959
109 Ga0157370_10001187 3300013104 Bacteria 32487
110 Ga0157370_10023913 3300013104 Bacteria 6059
111 Ga0157370_10032033 3300013104 Bacteria 5137
112 Ga0157370_10035110 3300013104 Bacteria 4877
113 Ga0157370_10203930 3300013104 Bacteria 1834
114 Ga0157370_10416220 3300013104 Bacteria 1237
115 Ga0157369_10006084 3300013105 Bacteria 14002
116 Ga0157369_10013249 3300013105 Bacteria 9330
117 Ga0163162_10235970 3300013306 Bacteria 1959
118 Ga0157372_10152368 3300013307 Bacteria 2669
119 Ga0157375_10006538 3300013308 Bacteria 10145
120 Ga0157375_10431134 3300013308 Bacteria 1484
121 Ga0163163_10378186 3300014325 Bacteria 1474
122 Ga0182008_10000785 3300014497 Bacteria 22221
123 Ga0182008_10001969 3300014497 Bacteria 13191
124 Ga0182008_10011105 3300014497 Bacteria 4805
125 Ga0182008_10024990 3300014497 Bacteria 3037
126 Ga0182006_1001525 3300015261 Bacteria 13851
127 Ga0182006_1039903 3300015261 Bacteria 1850
128 Ga0182007_10001227 3300015262 Bacteria 13934
129 Ga0182007_10002079 3300015262 Bacteria 10278
130 Ga0182007_10002165 3300015262 Bacteria 9983
131 Ga0182007_10093400 3300015262 Bacteria 992
132 Ga0182005_1001833 3300015265 Bacteria 8091
133 Ga0163161_10050130 3300017792 Bacteria 3020
134 Ga0163161_10122717 3300017792 Bacteria 1953
135 Ga0163161_10143302 3300017792 Bacteria 1811
136 Ga0163161_10165504 3300017792 Bacteria 1688
137 Ga0163161_10505145 3300017792 Bacteria 985
138 Ga0213876_10000330 3300021384 Bacteria 41354
139 Ga0213875_10082533 3300021388 Bacteria 1500
140 Ga0209760_100015 3300025207 Bacteria 176281
141 Ga0209436_107521 3300025208 Bacteria 2263
142 Ga0209674_100139 3300025226 Bacteria 110389
143 Ga0209672_100002 3300025228 Bacteria 1733325
144 Ga0209147_100003 3300025229 Bacteria 1733325
145 Ga0209563_100918 3300025230 Bacteria 8678
146 Ga0207427_100001 3300025231 Bacteria 1410763
147 Ga0207427_100494 3300025231 Bacteria 21083
148 Ga0209437_100003 3300025233 Bacteria 1517827
149 Ga0209437_100022 3300025233 Bacteria 625694
150 Ga0209258_100077 3300025242 Bacteria 264510
151 Ga0207425_1028401 3300025245 Bacteria 1134
152 Ga0209677_101603 3300025253 Bacteria 9546
153 Ga0209148_1000006 3300025254 Bacteria 1733325
154 Ga0209759_1000170 3300025256 Bacteria 110023
155 Ga0209129_1008640 3300025258 Bacteria 2803
156 Ga0209129_1011037 3300025258 Bacteria 2192
157 Ga0209233_1000007 3300025261 Bacteria 1411234
158 Ga0209233_1000031 3300025261 Bacteria 624646
159 Ga0209233_1000146 3300025261 Bacteria 187269
160 Ga0209233_1000177 3300025261 Bacteria 141716
161 Ga0209455_1000140 3300025272 Bacteria 138610
162 Ga0209673_1003380 3300025273 Bacteria 9492
163 Ga0209130_1000085 3300025284 Bacteria 158670
164 Ga0209676_1001896 3300025292 Bacteria 17054
165 Ga0209025_1009994 3300025294 Bacteria 6503
166 Ga0209025_1014796 3300025294 Bacteria 4764
167 Ga0209758_1009390 3300025297 Bacteria 6089
168 Ga0209758_1028644 3300025297 Bacteria 2349
169 Ga0209050_1000009 3300025298 Bacteria 1047265
170 Ga0209256_1010329 3300025299 Bacteria 3930
171 Ga0207426_1000076 3300025302 Bacteria 320851
172 Ga0209051_1000008 3300025303 Bacteria 706935
173 Ga0209051_1034544 3300025303 Bacteria 1894
174 Ga0209257_1001914 3300025304 Bacteria 22494
175 Ga0207656_10000017 3300025321 Bacteria 117646
176 Ga0207696_1000121 3300025711 Bacteria 143687
177 Ga0207696_1000283 3300025711 Bacteria 59741
178 Ga0207655_1000086 3300025728 Bacteria 206068
179 Ga0207655_1001672 3300025728 Bacteria 19562
180 Ga0207655_1025878 3300025728 Bacteria 2834
181 Ga0207655_1040802 3300025728 Bacteria 1997
182 Ga0207655_1052317 3300025728 Bacteria 1643
183 Ga0207713_1000159 3300025735 Bacteria 101793
184 Ga0207713_1000356 3300025735 Bacteria 50001
185 Ga0207713_1000454 3300025735 Bacteria 42911
186 Ga0207713_1007117 3300025735 Bacteria 6689
187 Ga0207713_1008996 3300025735 Bacteria 5679
188 Ga0207688_10164349 3300025901 Bacteria 1317
189 Ga0207647_10059588 3300025904 Bacteria 2336
190 Ga0207695_10000120 3300025913 Bacteria 234247
191 Ga0207671_10000019 3300025914 Bacteria 317781
192 Ga0207671_10000023 3300025914 Bacteria 274756
193 Ga0207657_10097942 3300025919 Bacteria 2438
194 Ga0207649_10000004 3300025920 Bacteria 360726
195 Ga0207649_10300174 3300025920 Bacteria 1174
196 Ga0207646_10002940 3300025922 Bacteria 19746
197 Ga0207681_10000679 3300025923 Bacteria 22341
198 Ga0207694_10286791 3300025924 Bacteria 1353
199 Ga0207650_10000167 3300025925 Bacteria 78836
200 Ga0207650_10000789 3300025925 Bacteria 24404
201 Ga0207706_10001441 3300025933 Bacteria 23804
202 Ga0207686_10471551 3300025934 Bacteria 969
203 Ga0207709_10000749 3300025935 Bacteria 25748
204 Ga0207709_10001659 3300025935 Bacteria 15025
205 Ga0207709_10017879 3300025935 Bacteria 3963
206 Ga0207709_10034006 3300025935 Bacteria 3000
207 Ga0207669_10197495 3300025937 Bacteria 1457
208 Ga0207711_10052506 3300025941 Bacteria 3494
209 Ga0207711_10123282 3300025941 Bacteria 2316
210 Ga0207711_10133256 3300025941 Bacteria 2230
211 Ga0207711_10238165 3300025941 Bacteria 1668
212 Ga0207679_10000019 3300025945 Bacteria 230270
213 Ga0207667_10037067 3300025949 Bacteria 5216
214 Ga0207651_10254786 3300025960 Bacteria 1438
215 Ga0207640_10051333 3300025981 Bacteria 2680
216 Ga0207639_10023439 3300026041 Bacteria 4458
217 Ga0207639_10147745 3300026041 Bacteria 1965
218 Ga0207708_10168534 3300026075 Bacteria 1733
219 Ga0207702_10061153 3300026078 Bacteria 3212
220 Ga0207702_10143869 3300026078 Bacteria 2161
221 Ga0207676_10314465 3300026095 Bacteria 1435
222 Ga0207674_10198878 3300026116 Bacteria 1954
223 Ga0207674_10303507 3300026116 Bacteria 1546
224 Ga0207698_10092441 3300026142 Bacteria 2480
225 Ga0209281_1000002 3300027111 Bacteria 1924012
226 Ga0209389_1000116 3300027296 Bacteria 71576
227 Ga0209371_1003262 3300027312 Bacteria 8070
228 Ga0209371_1003397 3300027312 Bacteria 7797
229 Ga0209371_1005470 3300027312 Bacteria 5036
230 Ga0209371_1025345 3300027312 Bacteria 1364
231 Ga0209179_1003229 3300027512 Bacteria 2321
232 Ga0268266_10090681 3300028379 Bacteria 2679
233 Ga0268266_10399293 3300028379 Bacteria 1300
234 Ga0268266_10761873 3300028379 Bacteria 934
235 Ga0307517_10066800 3300028786 Bacteria 3303
236 Ga0307515_10009226 3300028794 Bacteria 19106
237 Ga0307515_10418641 3300028794 Bacteria 961
238 Ga0268256_1002957 3300030500 Bacteria 8070
239 Ga0268256_1003009 3300030500 Bacteria 7958
240 Ga0268256_1003319 3300030500 Bacteria 7382
241 Ga0268256_1028869 3300030500 Bacteria 1364
242 Ga0307513_10182644 3300031456 Bacteria 1959
243 Ga0307509_10342693 3300031507 Bacteria 1221
244 Ga0307408_100011788 3300031548 Bacteria 5782
245 Ga0307408_100248217 3300031548 Bacteria 1467
246 Ga0307408_100253130 3300031548 Bacteria 1454
247 Ga0307405_10000584 3300031731 Bacteria 13975
248 Ga0307405_10332513 3300031731 Bacteria 1165
249 Ga0307410_10006271 3300031852 Bacteria 6403
250 Ga0307410_10017381 3300031852 Bacteria 4318
251 Ga0307406_10026160 3300031901 Bacteria 3501
252 Ga0307406_10044903 3300031901 Bacteria 2771
253 Ga0307407_10268696 3300031903 Bacteria 1176
254 Ga0307412_10054010 3300031911 Bacteria 2665
255 Ga0307412_10146951 3300031911 Bacteria 1734
256 Ga0307412_10449946 3300031911 Bacteria 1061
257 Ga0307409_100007655 3300031995 Bacteria 6482
258 Ga0307409_100482010 3300031995 Bacteria 1204
259 Ga0307416_100001329 3300032002 Bacteria 13325
260 Ga0307416_100005662 3300032002 Bacteria 7716
261 Ga0307416_100361136 3300032002 Bacteria 1475
262 Ga0307416_100657611 3300032002 Bacteria 1133
263 Ga0307415_100311541 3300032126 Bacteria 1308
264 Ga0307415_100411492 3300032126 Bacteria 1158
265 Ga0316593_10020061 3300032168 Bacteria 2073
266 Ga0395900_0033242 3300037418 Bacteria 5309
267 Ga0395900_0609209 3300037418 Bacteria 1032
268 Ga0395898_0007784 3300037466 Bacteria 11372
269 Ga0395898_0053360 3300037466 Bacteria 3948
270 Ga0395898_0061481 3300037466 Bacteria 3648
271 Ga0395905_0003063 3300037471 Bacteria 18103
272 Ga0395905_0019442 3300037471 Bacteria 6439
273 Ga0395905_0325853 3300037471 Bacteria 1426
274 Ga0436364_0798987 3300037853 Bacteria 7152
275 Ga0395901_0019211 3300038443 Bacteria 6986
276 Ga0395901_0310137 3300038443 Unclassified 1634
277 Ga0395901_0601189 3300038443 Bacteria 1109
278 Ga0436365_0496418 3300039437 Bacteria 36061
279 Ga0436365_1362721 3300039437 Bacteria 2247
280 Ga0436365_1656529 3300039437 Bacteria 1723
281 Ga0436363_0518276 3300039450 Bacteria 4693
282 Ga0439461_0011815 3300041410 Bacteria 1626
283 Ga0439465_0046026 3300041413 Bacteria 1419
284 Ga0451833_0874771 3300041491 Bacteria 1787
285 Ga0451843_0508359 3300041509 Bacteria 1036
286 Ga0439431_0005467 3300041997 Bacteria 2805
287 Ga0439445_0019371 3300042004 Bacteria 1695
288 Ga0439432_000010 3300042006 Bacteria 72226
289 Ga0439432_000274 3300042006 Bacteria 18600
290 Ga0439432_022247 3300042006 Bacteria 2094
291 Ga0439452_000001 3300042010 Bacteria 1725439
292 Ga0439452_033145 3300042010 Bacteria 1256
293 Ga0439456_007922 3300042013 Bacteria 2189
294 Ga0439463_005675 3300042016 Bacteria 3101
295 Ga0439446_0019442 3300042156 Bacteria 1909
296 Ga0466963_0006126 3300044694 Bacteria 7094
297 Ga0466963_0044742 3300044694 Bacteria 2914
298 Ga0466964_0054469 3300044706 Bacteria 1649
299 Ga0466971_0237576 3300044719 Bacteria 866
300 Ga0466960_0034347 3300044901 Bacteria 2363
301 Ga0466960_0226445 3300044901 Bacteria 1031
302 Ga0466958_0238250 3300045836 Bacteria 1162
303 Ga0466967_0104666 3300045976 Bacteria 2591
304 Ga0466967_0180491 3300045976 Bacteria 1991
305 Ga0466967_0182756 3300045976 Bacteria 1979
306 Ga0495617_053770 3300046452 Bacteria 1337
307 Ga0495627_000021 3300046453 Bacteria 282454
308 Ga0495627_001141 3300046453 Bacteria 17175
309 Ga0495627_002165 3300046453 Bacteria 9827
310 Ga0495592_0042692 3300046454 Bacteria 3395
311 Ga0495592_0235759 3300046454 Bacteria 1216
312 Ga0495590_0003325 3300046457 Bacteria 6576
313 Ga0495590_0010337 3300046457 Bacteria 3512
314 Ga0495591_004135 3300046458 Bacteria 7210
315 Ga0495629_0002115 3300046459 Bacteria 15383
316 Ga0495629_0003380 3300046459 Bacteria 12063
317 Ga0495629_0257615 3300046459 Bacteria 1199
318 Ga0495638_0000210 3300046460 Bacteria 82776
319 Ga0495641_0038544 3300046461 Bacteria 2232
320 Ga0495651_0258112 3300046462 Bacteria 1187
321 Ga0495653_0000147 3300046463 Bacteria 58379
322 Ga0495653_0037872 3300046463 Bacteria 3786
323 Ga0495653_0039102 3300046463 Bacteria 3719
324 Ga0495653_0068115 3300046463 Bacteria 2670
325 Ga0495650_0014928 3300046471 Bacteria 4009
326 Ga0495580_0000008 3300046472 Bacteria 102421
327 Ga0495580_0039326 3300046472 Bacteria 3383
328 Ga0495580_0226574 3300046472 Bacteria 1284
329 Ga0495582_0005698 3300046473 Bacteria 6938
330 Ga0495582_0007828 3300046473 Bacteria 5907
331 Ga0495605_0011225 3300046474 Bacteria 5002
332 Ga0495605_0024523 3300046474 Bacteria 3154
333 Ga0495605_0069637 3300046474 Bacteria 1665
334 Ga0495605_0174827 3300046474 Bacteria 947
335 Ga0495662_0007289 3300046476 Bacteria 5472
336 Ga0495664_0003916 3300046477 Bacteria 8120
337 Ga0495664_0025042 3300046477 Bacteria 3472
338 Ga0495584_0017057 3300046491 Bacteria 3702
339 Ga0495584_0037821 3300046491 Bacteria 2440
340 Ga0495584_0110448 3300046491 Bacteria 1391
341 Ga0495607_0000305 3300046501 Bacteria 51421
342 Ga0495607_0013330 3300046501 Bacteria 5390
343 Ga0495607_0017720 3300046501 Bacteria 4560
344 Ga0495607_0021135 3300046501 Bacteria 4098
345 Ga0495607_0030362 3300046501 Bacteria 3319
346 Ga0495607_0067355 3300046501 Bacteria 2012
347 Ga0495607_0106822 3300046501 Bacteria 1489
348 Ga0495607_0180251 3300046501 Bacteria 1059
349 Ga0495583_0001609 3300046506 Bacteria 22138
350 Ga0495583_0003054 3300046506 Bacteria 13308
351 Ga0495583_0004050 3300046506 Bacteria 10774
352 Ga0495583_0005222 3300046506 Bacteria 8917
353 Ga0495583_0005957 3300046506 Bacteria 8091
354 Ga0495606_0000627 3300046507 Bacteria 55643
355 Ga0495606_0000640 3300046507 Bacteria 54916
356 Ga0495606_0006739 3300046507 Bacteria 10513
357 Ga0495606_0013051 3300046507 Bacteria 6600
358 Ga0495606_0016134 3300046507 Bacteria 5714
359 Ga0495606_0031402 3300046507 Bacteria 3693
360 Ga0495606_0055024 3300046507 Bacteria 2575
361 Ga0495606_0070862 3300046507 Bacteria 2197
362 Ga0495610_0010070 3300046512 Bacteria 5903
363 Ga0495610_0012954 3300046512 Bacteria 4984
364 Ga0495610_0022585 3300046512 Bacteria 3436
365 Ga0495610_0108131 3300046512 Bacteria 1235
366 Ga0495616_0038180 3300046513 Bacteria 2467
367 Ga0495616_0052241 3300046513 Bacteria 2035
368 Ga0495618_0018010 3300046514 Bacteria 4335
369 Ga0495618_0025970 3300046514 Bacteria 3638
370 Ga0495620_0013392 3300046515 Bacteria 4200
371 Ga0495620_0018545 3300046515 Bacteria 3444
372 Ga0495628_0000175 3300046516 Bacteria 56421
373 Ga0495630_0017098 3300046517 Bacteria 5308
374 Ga0495630_0030421 3300046517 Bacteria 4016
375 Ga0495631_0000151 3300046518 Bacteria 47384
376 Ga0495631_0011676 3300046518 Bacteria 4310
377 Ga0495632_0004825 3300046519 Bacteria 9058
378 Ga0495632_0019790 3300046519 Bacteria 3659
379 Ga0495632_0020623 3300046519 Bacteria 3564
380 Ga0495632_0025366 3300046519 Bacteria 3136
381 Ga0495632_0079677 3300046519 Bacteria 1563
382 Ga0495637_0000521 3300046520 Bacteria 27960
383 Ga0495637_0006096 3300046520 Bacteria 6070
384 Ga0495637_0039298 3300046520 Bacteria 2043
385 Ga0495643_0000029 3300046522 Bacteria 261028
386 Ga0495643_0096096 3300046522 Bacteria 1523
387 Ga0495648_0004049 3300046524 Bacteria 12654
388 Ga0495648_0038560 3300046524 Bacteria 3053
389 Ga0495648_0090885 3300046524 Bacteria 1709
390 Ga0495666_0000084 3300046526 Bacteria 37781
391 Ga0495666_0007202 3300046526 Bacteria 5584
392 Ga0495642_0047592 3300046528 Bacteria 1757
393 Ga0495652_0021003 3300046529 Bacteria 5803
394 Ga0495652_0133813 3300046529 Bacteria 1958
395 Ga0495654_0000020 3300046530 Bacteria 284814
396 Ga0495654_0001502 3300046530 Bacteria 15945
397 Ga0495654_0003933 3300046530 Bacteria 8972
398 Ga0495654_0019663 3300046530 Bacteria 3531
399 Ga0495665_0022719 3300046531 Bacteria 3369
400 Ga0495640_0000670 3300046533 Bacteria 25499
401 Ga0495640_0021445 3300046533 Bacteria 4740
402 Ga0495587_0000444 3300046536 Bacteria 28997
403 Ga0495609_0000070 3300046538 Bacteria 128181
404 Ga0495597_0002495 3300046542 Bacteria 11599
405 Ga0495597_0057818 3300046542 Bacteria 1696
406 Ga0495597_0067919 3300046542 Bacteria 1541
407 Ga0495645_0259781 3300046543 Bacteria 1150
408 Ga0495668_0025017 3300046616 Bacteria 3394
409 Ga0495634_0004322 3300046642 Bacteria 11194
410 Ga0495634_0031332 3300046642 Bacteria 3663
411 Ga0495611_0028594 3300046648 Bacteria 2442
412 Ga0495625_0001778 3300046660 Bacteria 24818
413 Ga0495625_0086284 3300046660 Bacteria 2178
414 Ga0495635_0006872 3300046663 Bacteria 7951
415 Ga0495635_0033058 3300046663 Bacteria 3588
416 Ga0495661_0000661 3300046665 Bacteria 34573
417 Ga0495661_0000897 3300046665 Bacteria 27460
418 Ga0495661_0007625 3300046665 Bacteria 7540
419 Ga0495661_0187757 3300046665 Bacteria 1091
420 Ga0495588_0012905 3300046674 Bacteria 3964
421 Ga0495599_0000157 3300046678 Bacteria 44891
422 Ga0495623_0004255 3300046679 Bacteria 9432
423 Ga0495623_0015720 3300046679 Bacteria 4890
424 Ga0495646_0021652 3300046680 Bacteria 4060
425 Ga0495646_0021801 3300046680 Bacteria 4046
426 Ga0495669_0000623 3300046684 Bacteria 15406
427 Ga0495669_0055625 3300046684 Bacteria 1782
428 Ga0495613_0026845 3300046689 Bacteria 4287
429 Ga0495613_0315046 3300046689 Bacteria 1081
430 Ga0495624_0032173 3300046690 Bacteria 3402
431 Ga0495624_0040405 3300046690 Bacteria 2987
432 Ga0495624_0062004 3300046690 Bacteria 2340
433 Ga0495624_0156454 3300046690 Bacteria 1393
434 Ga0495671_0002838 3300046692 Bacteria 10845
435 Ga0495671_0054905 3300046692 Bacteria 1974
436 Ga0495671_0059892 3300046692 Bacteria 1880
437 Ga0495671_0098710 3300046692 Bacteria 1428
438 Ga0495649_0001816 3300046694 Bacteria 15674
439 Ga0495649_0002718 3300046694 Bacteria 12316
440 Ga0495649_0006587 3300046694 Bacteria 7220
441 Ga0495649_0036573 3300046694 Bacteria 2697
442 Ga0495649_0067068 3300046694 Bacteria 1925
443 Ga0495649_0117073 3300046694 Bacteria 1410
444 Ga0495589_0006986 3300046794 Bacteria 5923
445 Ga0495589_0039526 3300046794 Bacteria 2357
446 Ga0495589_0054903 3300046794 Bacteria 1964
447 Ga0495600_0029617 3300046809 Bacteria 3545
448 Ga0495600_0032259 3300046809 Bacteria 3398
449 Ga0495660_0000011 3300046810 Bacteria 361397
450 Ga0495660_0009481 3300046810 Bacteria 5677
451 Ga0495660_0049556 3300046810 Bacteria 2292
452 Ga0495660_0054385 3300046810 Bacteria 2169
453 Ga0495660_0200794 3300046810 Bacteria 952
454 Ga0495581_0000035 3300047315 Bacteria 50218
455 Ga0495581_0048174 3300047315 Bacteria 2461
456 Ga0495604_0003016 3300047317 Bacteria 13463
457 Ga0495604_0154925 3300047317 Bacteria 1624
458 Ga0495636_0000557 3300047318 Bacteria 13669
459 Ga0495674_0056878 3300047319 Bacteria 3424
460 Ga0495672_0000004 3300047320 Bacteria 631810
461 Ga0495672_0000893 3300047320 Bacteria 31321
462 Ga0495672_0007369 3300047320 Bacteria 8288
463 Ga0495672_0022837 3300047320 Bacteria 4059
464 Ga0495672_0024260 3300047320 Bacteria 3911
465 Ga0495672_0068950 3300047320 Bacteria 2009
466 Ga0495672_0069486 3300047320 Bacteria 1999
467 Ga0495676_0003157 3300047321 Bacteria 14901
468 Ga0495676_0013897 3300047321 Bacteria 7218
469 Ga0495680_0002162 3300047322 Bacteria 20362
470 Ga0495680_0020477 3300047322 Bacteria 5564
471 Ga0495680_0052842 3300047322 Bacteria 3165
472 Ga0495683_0004487 3300047323 Bacteria 7908
473 Ga0495683_0008408 3300047323 Bacteria 5523
474 Ga0495683_0019106 3300047323 Bacteria 3537
475 Ga0495683_0037047 3300047323 Bacteria 2474
476 Ga0495683_0092657 3300047323 Bacteria 1462
477 Ga0495687_008620 3300047443 Bacteria 5814
478 Ga0495687_012182 3300047443 Bacteria 4563
479 Ga0495687_036537 3300047443 Bacteria 2197
480 Ga0495675_0037948 3300047444 Bacteria 3067
481 Ga0495679_000671 3300047446 Bacteria 22414
482 Ga0495679_007960 3300047446 Bacteria 4359
483 Ga0495673_0000023 3300047469 Bacteria 539904
484 Ga0495673_0002011 3300047469 Bacteria 14954
485 Ga0495673_0006995 3300047469 Bacteria 6555
486 Ga0495673_0007432 3300047469 Bacteria 6300
487 Ga0495673_0090287 3300047469 Bacteria 1253
488 Ga0495681_0012068 3300047470 Bacteria 5096
489 Ga0495681_0068878 3300047470 Bacteria 1609
490 Ga0495681_0109728 3300047470 Bacteria 1196
491 Ga0495684_0037999 3300047471 Bacteria 3692
492 Ga0495686_0000181 3300047472 Bacteria 119765
493 Ga0495686_0018366 3300047472 Bacteria 4695
494 Ga0495686_0070373 3300047472 Bacteria 2156
495 Ga0495686_0116194 3300047472 Bacteria 1599
496 Ga0495593_0011000 3300047673 Bacteria 5209
497 Ga0495593_0012141 3300047673 Bacteria 4928
498 Ga0495593_0030896 3300047673 Bacteria 2928
499 Ga0495602_0017161 3300048088 Bacteria 7259
500 Ga0495602_0111017 3300048088 Bacteria 2227
501 Ga0495614_0001254 3300048089 Bacteria 10908
502 Ga0495614_0002405 3300048089 Bacteria 8321
503 Ga0495626_0002474 3300048091 Bacteria 12781
504 Ga0495626_0008895 3300048091 Bacteria 5455
505 Ga0496100_0369322 3300048903 Bacteria 1087
506 Ga0496100_0406620 3300048903 Bacteria 1037
507 Ga0496101_0001439 3300048904 Bacteria 14202
508 Ga0496101_0124513 3300048904 Bacteria 1952
509 Ga0496102_0073509 3300048905 Bacteria 3142
510 Ga0496102_0117553 3300048905 Bacteria 2481
511 Ga0496103_0000561 3300048906 Bacteria 29491
512 Ga0496103_0014207 3300048906 Bacteria 4727
513 Ga0496104_0169255 3300048907 Bacteria 2095
514 Ga0496105_0461126 3300048908 Bacteria 1002
515 Ga0496106_0012653 3300048909 Bacteria 6233
516 Ga0496107_0007775 3300048910 Bacteria 7407
517 Ga0496108_0455614 3300048911 Bacteria 1117
518 Ga0496109_0208393 3300048912 Bacteria 1838
519 Ga0496109_0286232 3300048912 Bacteria 1553
520 Ga0496110_0009655 3300048913 Bacteria 7813
521 Ga0496111_0145121 3300048914 Bacteria 1759
522 Ga0496112_0008617 3300048915 Bacteria 9142
523 Ga0496112_0357937 3300048915 Bacteria 1402
524 Ga0496113_0000352 3300048916 Bacteria 21988
525 Ga0496113_0168652 3300048916 Bacteria 1733
526 Ga0496114_0542208 3300048917 Bacteria 1028
527 Ga0496116_0000087 3300048919 Bacteria 217284
528 Ga0496116_0000126 3300048919 Bacteria 160425
529 Ga0496116_0006140 3300048919 Bacteria 10984
530 Ga0496116_0008040 3300048919 Bacteria 9228
531 Ga0496116_0136182 3300048919 Bacteria 1390
532 Ga0496117_0000312 3300048920 Bacteria 84843
533 Ga0496117_0001193 3300048920 Bacteria 39104
534 Ga0496117_0005265 3300048920 Bacteria 13719
535 Ga0496117_0009337 3300048920 Bacteria 9142
536 Ga0496117_0027166 3300048920 Bacteria 4465
537 Ga0496117_0037689 3300048920 Bacteria 3597
538 Ga0496117_0051370 3300048920 Bacteria 2914
539 Ga0496117_0117522 3300048920 Bacteria 1641
540 Ga0496118_0005893 3300048921 Bacteria 13723
541 Ga0496118_0026806 3300048921 Bacteria 4897
542 Ga0496118_0050760 3300048921 Bacteria 3179
543 Ga0496118_0083080 3300048921 Bacteria 2241
544 Ga0496118_0092991 3300048921 Bacteria 2067
545 Ga0496118_0112471 3300048921 Bacteria 1802
546 Ga0496118_0129469 3300048921 Bacteria 1624
547 Ga0496118_0284731 3300048921 Bacteria 917
548 Ga0496119_0020879 3300048922 Bacteria 4753
549 Ga0496119_0026984 3300048922 Bacteria 3965
550 Ga0496119_0046328 3300048922 Bacteria 2716
551 Ga0496119_0058096 3300048922 Bacteria 2333
552 Ga0496119_0158019 3300048922 Bacteria 1208
553 Ga0496120_0002576 3300048923 Bacteria 18062
554 Ga0496120_0043051 3300048923 Bacteria 2633
555 Ga0496120_0049697 3300048923 Bacteria 2405
556 Ga0496121_0000142 3300048924 Bacteria 160072
557 Ga0496121_0004518 3300048924 Bacteria 18630
558 Ga0496121_0004705 3300048924 Bacteria 18072
559 Ga0496121_0007651 3300048924 Bacteria 12977
560 Ga0496121_0013975 3300048924 Bacteria 8575
561 Ga0496121_0022096 3300048924 Bacteria 6192
562 Ga0496121_0120748 3300048924 Bacteria 1980
563 Ga0496121_0178818 3300048924 Bacteria 1533
564 Ga0496122_0000043 3300048925 Bacteria 280333
565 Ga0496122_0000072 3300048925 Bacteria 222436
566 Ga0496122_0000266 3300048925 Bacteria 117021
567 Ga0496122_0002287 3300048925 Bacteria 27682
568 Ga0496122_0009466 3300048925 Bacteria 10262
569 Ga0496122_0010708 3300048925 Bacteria 9411
570 Ga0496122_0050111 3300048925 Bacteria 3188
571 Ga0496122_0051828 3300048925 Bacteria 3113
572 Ga0496122_0072952 3300048925 Bacteria 2437
573 Ga0496123_0000018 3300048926 Bacteria 404553
574 Ga0496123_0000035 3300048926 Bacteria 267288
575 Ga0496123_0000090 3300048926 Bacteria 179735
576 Ga0496123_0000434 3300048926 Bacteria 75349
577 Ga0496123_0012903 3300048926 Bacteria 7070
578 Ga0496123_0037825 3300048926 Bacteria 3402
579 Ga0496123_0055292 3300048926 Bacteria 2605
580 Ga0496123_0159747 3300048926 Bacteria 1203
581 Ga0496124_0000047 3300048927 Bacteria 285554
582 Ga0496124_0006876 3300048927 Bacteria 12235
583 Ga0496124_0008633 3300048927 Bacteria 10617
584 Ga0496124_0011258 3300048927 Bacteria 8957
585 Ga0496124_0018587 3300048927 Bacteria 6505
586 Ga0496124_0072030 3300048927 Bacteria 2862
587 Ga0496124_0134239 3300048927 Bacteria 1962
588 Ga0496124_0134678 3300048927 Bacteria 1958
589 Ga0496125_0000215 3300048928 Bacteria 118487
590 Ga0496125_0000507 3300048928 Bacteria 67577
591 Ga0496125_0010985 3300048928 Bacteria 9087
592 Ga0496125_0020758 3300048928 Bacteria 6157
593 Ga0496125_0021917 3300048928 Bacteria 5943
594 Ga0496125_0059921 3300048928 Bacteria 3063
595 Ga0496125_0065558 3300048928 Bacteria 2876
596 Ga0496125_0065812 3300048928 Bacteria 2868
597 Ga0496125_0077865 3300048928 Bacteria 2552
598 Ga0496125_0217743 3300048928 Bacteria 1233
599 Ga0496126_0000412 3300048929 Bacteria 86638
600 Ga0496126_0026036 3300048929 Bacteria 5616
601 Ga0496126_0047716 3300048929 Bacteria 3920
602 Ga0496126_0098862 3300048929 Bacteria 2556
603 Ga0496126_0288460 3300048929 Bacteria 1358
604 Ga0495678_000031 3300049459 Bacteria 215528
605 Ga0495678_005590 3300049459 Bacteria 6883
606 Ga0495678_005891 3300049459 Bacteria 6635
607 Ga0495678_019209 3300049459 Bacteria 3054
608 Ga0495682_0000004 3300049460 Bacteria 378337
609 Ga0495682_0003429 3300049460 Bacteria 7043
610 Ga0495682_0034215 3300049460 Bacteria 1874
611 Ga0495682_0065455 3300049460 Bacteria 1310
612 Ga0501033_0385467 3300049570 Bacteria 979
613 Ga0501039_0085261 3300049575 Bacteria 2461
614 Ga0501042_0052271 3300049578 Bacteria 2914
615 Ga0501046_0496636 3300049580 Bacteria 874
616 Ga0501048_0116206 3300049582 Bacteria 1890
617 Ga0501067_0107866 3300049583 Bacteria 1548
618 Ga0501072_0041269 3300049588 Bacteria 3624
619 Ga0501073_0009154 3300049589 Bacteria 7305
620 Ga0501075_0224032 3300049591 Bacteria 1434
621 Ga0501081_0002092 3300049743 Bacteria 12463
622 Ga0501045_0017506 3300049824 Bacteria 5088
623 nmdc:mga0yw44_16137_c1 3300050492 Bacteria 4028
624 Ga0500578_0043559 3300053086 Bacteria 2881
625 Ga0500644_0004269 3300053088 Bacteria 3571
626 Ga0500557_000232 3300053105 Bacteria 8428
627 Ga0500562_013750 3300053108 Bacteria 2070
628 Ga0500594_0003205 3300053118 Bacteria 3584
629 Ga0500618_011541 3300053125 Bacteria 2340
630 Ga0500621_000001 3300053126 Bacteria 1049698
631 Ga0500652_041522 3300053131 Bacteria 1853
632 Ga0500658_0000111 3300053134 Bacteria 38411
633 Ga0500659_0003377 3300053135 Bacteria 9356
634 Ga0500568_0000824 3300053139 Bacteria 21808
635 Ga0500577_0125163 3300053142 Bacteria 1073
636 Ga0500616_0000369 3300053153 Bacteria 63221
637 Ga0500616_0010244 3300053153 Bacteria 5621
638 Ga0500622_0000609 3300053156 Bacteria 32500
639 Ga0500622_0060248 3300053156 Bacteria 1937
640 Ga0500633_0110539 3300053160 Bacteria 1018
641 Ga0501084_0057995 3300054114 Bacteria 3240
642 Ga0501084_0398161 3300054114 Bacteria 1164
643 Ga0530510_0011333 3300061734 Bacteria 6257
644 2509127859 2508501125 Bacteria 7208311
645 2510285025 2510065053 Bacteria 5005518
646 2510294139 2510065055 Bacteria 5037935
647 2510313170 2510065058 Bacteria 5005894
648 2511131689 2510917022 Bacteria 6504556
649 2511193696 2510917030 Bacteria 7460662
650 2513574315 2513237085 Bacteria 7695351
651 2513636511 2513237093 Bacteria 7545552
652 2513640004 2513237094 Bacteria 8789602
653 2513711165 2513237103 Bacteria 7647401
654 2517079776 2516653085 Bacteria 7346596
655 2524451834 2524023207 Bacteria 6813453
656 2555668343 2554235341 Bacteria 6867980
657 2558907094 2558860112 Bacteria 9931328
658 2585226178 2582581298 Bacteria 7315509
659 2585275163 2582581307 Bacteria 6597605
660 2585278326 2582581308 Bacteria 7413247
661 2585324831 2582581315 Bacteria 7318924
662 2585333229 2582581316 Bacteria 7774528
663 2585399594 2582581867 Bacteria 7184437
664 2585532017 2585427527 Bacteria 7273426
665 2585548902 2585427529 Bacteria 7395659
666 2585552377 2585427530 Bacteria 7383882
667 2585561123 2585427531 Bacteria 6992870
668 2585899773 2585427608 Bacteria 6544331
669 2585908285 2585427609 Bacteria 6667127
670 2587983680 2585428125 Bacteria 6662905
671 2588514427 2588253730 Bacteria 6881675
672 2599330113 2599185155 Bacteria 5827168
673 2599355344 2599185160 Bacteria 6844013
674 2599360837 2599185161 Bacteria 6960462
675 2599367159 2599185162 Bacteria 6957254
676 2599373949 2599185163 Bacteria 6995158
677 2599380450 2599185164 Bacteria 6841688
678 2599386897 2599185165 Bacteria 6843250
679 2599392807 2599185166 Bacteria 6959206
680 2599397051 2599185167 Bacteria 6353609
681 2599404574 2599185168 Bacteria 6997636
682 2599449044 2599185179 Bacteria 6611171
683 2599462178 2599185181 Bacteria 6844519
684 2599466780 2599185182 Bacteria 6883168
685 2599490730 2599185186 Bacteria 6831633
686 2599511212 2599185190 Bacteria 6285678
687 2599519297 2599185191 Bacteria 6297582
688 2599614605 2599185212 Bacteria 6765997
689 2599879659 2599185288 Bacteria 6666191
690 2599890586 2599185290 Bacteria 6289611
691 2599925695 2599185299 Bacteria 4854625
692 2599948158 2599185303 Bacteria 6512725
693 2599994837 2599185311 Bacteria 6354990
694 2600023982 2599185316 Bacteria 6320029
695 2600030981 2599185317 Bacteria 6435722
696 2600034657 2599185318 Bacteria 6961590
697 2600061341 2599185322 Bacteria 6763055
698 2600077675 2599185325 Bacteria 6324919
699 2600195167 2599185352 Bacteria 7228948
700 2600214800 2599185356 Bacteria 6843884
701 2600360872 2600254930 Bacteria 6431253
702 2600813479 2600255067 Bacteria 6795583
703 2601774495 2600255313 Bacteria 6842543
704 2616307844 2615840626 Bacteria 7921970
705 2616552743 2615840698 Bacteria 7319877
706 2621301532 2619619299 Bacteria 6649820
707 2643868886 2643221571 Bacteria 6228673
708 2644108245 2643221618 Bacteria 7717186
709 2644130626 2643221623 Bacteria 5239945
710 2644145827 2643221626 Bacteria 8069654
711 2644307306 2643221655 Bacteria 7722067
712 2644331322 2643221659 Bacteria 7890716
713 2644541338 2643221698 Bacteria 7756764
714 2644613395 2643221712 Bacteria 7729434
715 2644624020 2643221713 Bacteria 6554480
716 2650899028 2648501693 Bacteria 5069560
717 2671097945 2667528171 Bacteria 6900659
718 2671116888 2667528174 Bacteria 6435400
719 2671127351 2667528176 Bacteria 6724917
720 2677898160 2675903420 Bacteria 6247433
721 2686353413 2684622997 Bacteria 4624240
722 2725948366 2724679232 Bacteria 7646494
723 2729909900 2728369276 Bacteria 5610032
724 2738673752 2738541265 Bacteria 6594665
725 2738687725 2738541271 Bacteria 5657310
726 2738752145 2738541282 Bacteria 6593925
727 2738809117 2738541294 Bacteria 6925949
728 2738861186 2738541303 Bacteria 6591772
729 2738896477 2738541309 Bacteria 6926455
730 2739263840 2738543016 Bacteria 5657564
731 2743735971 2740892503 Bacteria 6855563
732 2766064661 2765235942 Bacteria 7445910
733 2774128124 2773857672 Bacteria 4993178
734 2776910663 2775507049 Bacteria 6284736
735 2778174870 2775507266 Bacteria 7392367
736 2808975257 2808606385 Bacteria 6711065
737 2808991104 2808606388 Bacteria 6706662
738 2809123531 2808606414 Bacteria 4917181
739 2817489114 2816332298 Bacteria 6852809
740 2819613162 2818991448 Bacteria 6772224
741 2819640262 2818991453 Bacteria 7181617
742 2819703029 2818991464 Bacteria 6907494
743 2825652490 2825651385 Bacteria 6715909
744 2826585752 2826581358 Bacteria 5963467
745 2834029017 2834028612 Bacteria 6354979
746 2838031774 2838029111 Bacteria 6603031
747 2838687958 2838686498 Bacteria 7807632
748 2838699570 2838694306 Bacteria 6853137
749 2838712990 2838707686 Bacteria 6619912
750 2838733681 2838729681 Bacteria 7400765
751 2838746351 2838742623 Bacteria 7396178
752 2841857659 2841851746 Bacteria 7532261
753 2842082357 2842077413 Bacteria 6508645
754 2842113744 2842110456 Bacteria 7656360
755 2842123239 2842118031 Bacteria 7033875
756 2842159226 2842156927 Bacteria 6894975
757 2842183205 2842180545 Bacteria 6888678
758 2842221672 2842217011 Bacteria 7497767
759 2842234469 2842229732 Bacteria 7475766
760 2842242314 2842237096 Bacteria 6620661
761 2842247991 2842243621 Bacteria 7421798
762 2842259586 2842257432 Bacteria 7401195
763 2842272011 2842271015 Bacteria 7807131
764 2842296381 2842291075 Bacteria 7076806
765 2842375330 2842370503 Bacteria 7038661
766 2842382933 2842377471 Bacteria 7140707
767 2842389682 2842384541 Bacteria 7057858
768 2842478506 2842475841 Bacteria 6603183
769 2842505549 2842502639 Bacteria 6604161
770 2842818622 2842815866 Bacteria 5947510
771 2842853232 2842849001 Bacteria 5924277
772 2844167019 2844163670 Bacteria 7266046
773 2844459915 2844454524 Bacteria 7952546
774 2847799798 2847797336 Bacteria 5176640
775 2852393161 2852387548 Bacteria 8025568
776 2852615498 2852612431 Bacteria 6885235
777 2852670466 2852667396 Bacteria 6885555
778 2856290066 2856287931 Bacteria 7223934
779 2857362893 2857357740 Bacteria 9937880
780 2857522763 2857516855 Bacteria 7787325
781 2860869045 2860867994 Bacteria 5645326
782 2870785209 2870782633 Bacteria 9624083
783 2889792502 2889790730 Bacteria 5689708
784 2891376789 2891373044 Bacteria 5202277
785 2899371579 2899370129 Bacteria 6781179
786 2904436047 2904434214 Bacteria 6230908
787 2904490264 2904483920 Bacteria 7545285
788 2908447840 2908446538 Bacteria 6829095
789 2909047898 2909042592 Bacteria 6499737
790 2913039055 2913036834 Bacteria 6704877
791 2917072110 2917070673 Bacteria 6868303
792 2919052045 2919051321 Bacteria 4210889
793 2919104843 2919100787 Bacteria 7710546
794 2919413032 2919408235 Bacteria 6149349
795 2919486906 2919481497 Bacteria 6907839
796 2919533435 2919527303 Bacteria 7718827
797 2920880185 2920879853 Bacteria 4216831
798 2923154981 2923153595 Bacteria 6870622
799 2923586723 2923586266 Bacteria 6565975
800 2928146559 2928142448 Bacteria 5288925
801 2931369947 2931369376 Bacteria 6847892
802 2931392048 2931390751 Bacteria 6273349
803 2933589619 2933586486 Bacteria 7667493
804 2935354282 2935353572 Unclassified 6955622
805 2935899276 2935894831 Bacteria 6620579
806 2936371319 2936367885 Bacteria 7324495
807 2936375478 2936375103 Bacteria 6652732
808 2941502814 2941499720 Bacteria 7599444
809 2945929535 2945928738 Bacteria 6053221
810 2945961275 2945961074 Bacteria 7342064
811 2946011816 2946006987 Bacteria 6705746
812 2946029291 2946027586 Bacteria 6049274
813 2947235840 2947233263 Bacteria 6439278
814 2974299720 2974298342 Bacteria 4840922
815 2984496701 2984494565 Bacteria 5000175
816 2984502080 2984499530 Bacteria 5020881
817 2984563870 2984559226 Bacteria 5683096
818 2984596603 2984595703 Bacteria 5682994
819 2989352763 2989349275 Bacteria 6349068
820 2989775243 2989771324 Bacteria 5605128
821 2990262118 2990261002 Bacteria 4919493
822 2995726898 2995726249 Bacteria 3470435
823 3004171785 3004167301 Bacteria 8330599
824 3005420843 3005416602 Bacteria 7064308
825 3006428815 3006425503 Bacteria 6491253
826 637318705 637000220 Bacteria 7074893
827 639644914 639633055 Bacteria 7751309
828 8005319422 8005314921 Bacteria 7072929
829 8005380267 8005376324 Bacteria 6590079
830 8005487719 8005484373 Bacteria 6297373
831 8005563387 8005556819 Bacteria 6908598
832 8005567740 8005563573 Bacteria 7153261
833 8005651787 8005645114 Bacteria 6950293
834 8005683817 8005682033 Bacteria 6726518
835 8018168801 8018163183 Bacteria 7277977
836 8019770899 8019769354 Bacteria 6924660
837 8024482368 8024479707 Bacteria 6954785
838 8054287361 8054285046 Bacteria 6919322
839 8054504628 8054503363 Bacteria 6101651
840 8055175855 8055172936 Bacteria 9305943
841 8055307128 8055301274 Bacteria 8587385
842 8055819068 8055817908 Bacteria 6609162
843 8056132938 8056131705 Bacteria 6107031
844 8056161188 8056161164 Bacteria 6106669
845 MRS1b_contig_6140270
846 JGI24740J21852_10000003
847 JGI24735J21928_10005504
848 JGI25162J39368_1000054
849 JGI25162J39368_1000102
850 JGI25163J39215_1000106
851 JGI25164J39214_1000029
852 JGI25159J45721_1000219
853 JGI25151J46595_10046455
854 JGI25151J46595_10047265
855 JGI25165J46597_1000111
856 JGI25165J46597_1000484
857 JGI25165J46597_1000508
858 rootH2_10013296
859 rootL2_10057665
860 rootH1_10054242
861 JGI25160J50197_1000058
862 JGI25161J50226_1000044
863 Ga0055533_1000188
864 Ga0055532_1000069
865 Ga0055527_1000034
866 Ga0055535_1000049
867 Ga0055542_1000077
868 Ga0055529_1000090
869 Ga0055528_1027767
870 Ga0055530_10000002
871 Ga0055540_1000009
872 Ga0058692_1025258
873 Ga0055543_1000133
874 Ga0065165_1000158
875 Ga0065714_10002500
876 Ga0065714_10066186
877 Ga0065704_10001000
878 Ga0065712_10071063
879 Ga0070683_100335780
880 Ga0070670_100001447
881 Ga0070670_100004177
882 Ga0070661_100000066
883 Ga0070669_100000310
884 Ga0070669_100499601
885 Ga0070673_100261136
886 Ga0070708_100034754
887 Ga0070681_10141044
888 Ga0070707_100001936
889 Ga0070707_100535870
890 Ga0070684_100539328
891 Ga0068853_100001132
892 Ga0068853_100103699
893 Ga0070665_100073235
894 Ga0070665_100117921
895 Ga0070665_100248158
896 Ga0070665_100586210
897 Ga0068855_100823248
898 Ga0070664_100000034
899 Ga0070664_100249602
900 Ga0068854_100027038
901 Ga0068856_100027877
902 Ga0068856_100186967
903 Ga0068856_100376777
904 Ga0068852_100064992
905 Ga0068852_100149153
906 Ga0068864_100261871
907 Ga0068851_10000006
908 Ga0081538_10011693
909 Ga0075365_10063192
910 Ga0075364_10062745
911 Ga0075367_10035513
912 Ga0075428_100671086
913 Ga0099823_1000047
914 Ga0079104_1000003
915 Ga0099795_10000877
916 Ga0105251_10000106
917 Ga0105251_10001276
918 Ga0105251_10001527
919 Ga0105251_10002275
920 Ga0105251_10002281
921 Ga0105251_10042893
922 Ga0105251_10046157
923 Ga0105244_10000500
924 Ga0105244_10004088
925 Ga0105244_10007940
926 Ga0105244_10023086
927 Ga0105250_10000153
928 Ga0105250_10001930
929 Ga0105240_10000012
930 Ga0105240_10127080
931 Ga0105243_10000450
932 Ga0105243_10005836
933 Ga0105243_10034101
934 Ga0105242_10003251
935 Ga0105248_10009584
936 Ga0105248_10120456
937 Ga0105237_10000160
938 Ga0105237_10000941
939 Ga0105237_10058313
940 Ga0105237_10349349
941 Ga0105238_10120019
942 Ga0105147_102869
943 Ga0105239_10058541
944 Ga0105239_10447078
945 Ga0105246_10000029
946 Ga0157373_10006473
947 Ga0157373_10008560
948 Ga0157373_10061972
949 Ga0157373_10146923
950 Ga0157371_10001102
951 Ga0157371_10001530
952 Ga0157371_10050396
953 Ga0157370_10001187
954 Ga0157370_10023913
955 Ga0157370_10032033
956 Ga0157370_10035110
957 Ga0157370_10203930
958 Ga0157370_10416220
959 Ga0157369_10006084
960 Ga0157369_10013249
961 Ga0163162_10235970
962 Ga0157372_10152368
963 Ga0157375_10006538
964 Ga0157375_10431134
965 Ga0163163_10378186
966 Ga0182008_10000785
967 Ga0182008_10001969
968 Ga0182008_10011105
969 Ga0182008_10024990
970 Ga0182006_1001525
971 Ga0182006_1039903
972 Ga0182007_10001227
973 Ga0182007_10002079
974 Ga0182007_10002165
975 Ga0182007_10093400
976 Ga0182005_1001833
977 Ga0163161_10050130
978 Ga0163161_10122717
979 Ga0163161_10143302
980 Ga0163161_10165504
981 Ga0163161_10505145
982 Ga0213876_10000330
983 Ga0213875_10082533
984 Ga0209760_100015
985 Ga0209436_107521
986 Ga0209674_100139
987 Ga0209672_100002
988 Ga0209147_100003
989 Ga0209563_100918
990 Ga0207427_100001
991 Ga0207427_100494
992 Ga0209437_100003
993 Ga0209437_100022
994 Ga0209258_100077
995 Ga0207425_1028401
996 Ga0209677_101603
997 Ga0209148_1000006
998 Ga0209759_1000170
999 Ga0209129_1008640
1000 Ga0209129_1011037
1001 Ga0209233_1000007
1002 Ga0209233_1000031
1003 Ga0209233_1000146
1004 Ga0209233_1000177
1005 Ga0209455_1000140
1006 Ga0209673_1003380
1007 Ga0209130_1000085
1008 Ga0209676_1001896
1009 Ga0209025_1009994
1010 Ga0209025_1014796
1011 Ga0209758_1009390
1012 Ga0209758_1028644
1013 Ga0209050_1000009
1014 Ga0209256_1010329
1015 Ga0207426_1000076
1016 Ga0209051_1000008
1017 Ga0209051_1034544
1018 Ga0209257_1001914
1019 Ga0207656_10000017
1020 Ga0207696_1000121
1021 Ga0207696_1000283
1022 Ga0207655_1000086
1023 Ga0207655_1001672
1024 Ga0207655_1025878
1025 Ga0207655_1040802
1026 Ga0207655_1052317
1027 Ga0207713_1000159
1028 Ga0207713_1000356
1029 Ga0207713_1000454
1030 Ga0207713_1007117
1031 Ga0207713_1008996
1032 Ga0207688_10164349
1033 Ga0207647_10059588
1034 Ga0207695_10000120
1035 Ga0207671_10000019
1036 Ga0207671_10000023
1037 Ga0207657_10097942
1038 Ga0207649_10000004
1039 Ga0207649_10300174
1040 Ga0207646_10002940
1041 Ga0207681_10000679
1042 Ga0207694_10286791
1043 Ga0207650_10000167
1044 Ga0207650_10000789
1045 Ga0207706_10001441
1046 Ga0207686_10471551
1047 Ga0207709_10000749
1048 Ga0207709_10001659
1049 Ga0207709_10017879
1050 Ga0207709_10034006
1051 Ga0207669_10197495
1052 Ga0207711_10052506
1053 Ga0207711_10123282
1054 Ga0207711_10133256
1055 Ga0207711_10238165
1056 Ga0207679_10000019
1057 Ga0207667_10037067
1058 Ga0207651_10254786
1059 Ga0207640_10051333
1060 Ga0207639_10023439
1061 Ga0207639_10147745
1062 Ga0207708_10168534
1063 Ga0207702_10061153
1064 Ga0207702_10143869
1065 Ga0207676_10314465
1066 Ga0207674_10198878
1067 Ga0207674_10303507
1068 Ga0207698_10092441
1069 Ga0209281_1000002
1070 Ga0209389_1000116
1071 Ga0209371_1003262
1072 Ga0209371_1003397
1073 Ga0209371_1005470
1074 Ga0209371_1025345
1075 Ga0209179_1003229
1076 Ga0268266_10090681
1077 Ga0268266_10399293
1078 Ga0268266_10761873
1079 Ga0307517_10066800
1080 Ga0307515_10009226
1081 Ga0307515_10418641
1082 Ga0268256_1002957
1083 Ga0268256_1003009
1084 Ga0268256_1003319
1085 Ga0268256_1028869
1086 Ga0307513_10182644
1087 Ga0307509_10342693
1088 Ga0307408_100011788
1089 Ga0307408_100248217
1090 Ga0307408_100253130
1091 Ga0307405_10000584
1092 Ga0307405_10332513
1093 Ga0307410_10006271
1094 Ga0307410_10017381
1095 Ga0307406_10026160
1096 Ga0307406_10044903
1097 Ga0307407_10268696
1098 Ga0307412_10054010
1099 Ga0307412_10146951
1100 Ga0307412_10449946
1101 Ga0307409_100007655
1102 Ga0307409_100482010
1103 Ga0307416_100001329
1104 Ga0307416_100005662
1105 Ga0307416_100361136
1106 Ga0307416_100657611
1107 Ga0307415_100311541
1108 Ga0307415_100411492
1109 Ga0316593_10020061
1110 Ga0395900_0033242
1111 Ga0395900_0609209
1112 Ga0395898_0007784
1113 Ga0395898_0053360
1114 Ga0395898_0061481
1115 Ga0395905_0003063
1116 Ga0395905_0019442
1117 Ga0395905_0325853
1118 Ga0436364_0798987
1119 Ga0395901_0019211
1120 Ga0395901_0310137
1121 Ga0395901_0601189
1122 Ga0436365_0496418
1123 Ga0436365_1362721
1124 Ga0436365_1656529
1125 Ga0436363_0518276
1126 Ga0439461_0011815
1127 Ga0439465_0046026
1128 Ga0451833_0874771
1129 Ga0451843_0508359
1130 Ga0439431_0005467
1131 Ga0439445_0019371
1132 Ga0439432_000010
1133 Ga0439432_000274
1134 Ga0439432_022247
1135 Ga0439452_000001
1136 Ga0439452_033145
1137 Ga0439456_007922
1138 Ga0439463_005675
1139 Ga0439446_0019442
1140 Ga0466963_0006126
1141 Ga0466963_0044742
1142 Ga0466964_0054469
1143 Ga0466971_0237576
1144 Ga0466960_0034347
1145 Ga0466960_0226445
1146 Ga0466958_0238250
1147 Ga0466967_0104666
1148 Ga0466967_0180491
1149 Ga0466967_0182756
1150 Ga0495617_053770
1151 Ga0495627_000021
1152 Ga0495627_001141
1153 Ga0495627_002165
1154 Ga0495592_0042692
1155 Ga0495592_0235759
1156 Ga0495590_0003325
1157 Ga0495590_0010337
1158 Ga0495591_004135
1159 Ga0495629_0002115
1160 Ga0495629_0003380
1161 Ga0495629_0257615
1162 Ga0495638_0000210
1163 Ga0495641_0038544
1164 Ga0495651_0258112
1165 Ga0495653_0000147
1166 Ga0495653_0037872
1167 Ga0495653_0039102
1168 Ga0495653_0068115
1169 Ga0495650_0014928
1170 Ga0495580_0000008
1171 Ga0495580_0039326
1172 Ga0495580_0226574
1173 Ga0495582_0005698
1174 Ga0495582_0007828
1175 Ga0495605_0011225
1176 Ga0495605_0024523
1177 Ga0495605_0069637
1178 Ga0495605_0174827
1179 Ga0495662_0007289
1180 Ga0495664_0003916
1181 Ga0495664_0025042
1182 Ga0495584_0017057
1183 Ga0495584_0037821
1184 Ga0495584_0110448
1185 Ga0495607_0000305
1186 Ga0495607_0013330
1187 Ga0495607_0017720
1188 Ga0495607_0021135
1189 Ga0495607_0030362
1190 Ga0495607_0067355
1191 Ga0495607_0106822
1192 Ga0495607_0180251
1193 Ga0495583_0001609
1194 Ga0495583_0003054
1195 Ga0495583_0004050
1196 Ga0495583_0005222
1197 Ga0495583_0005957
1198 Ga0495606_0000627
1199 Ga0495606_0000640
1200 Ga0495606_0006739
1201 Ga0495606_0013051
1202 Ga0495606_0016134
1203 Ga0495606_0031402
1204 Ga0495606_0055024
1205 Ga0495606_0070862
1206 Ga0495610_0010070
1207 Ga0495610_0012954
1208 Ga0495610_0022585
1209 Ga0495610_0108131
1210 Ga0495616_0038180
1211 Ga0495616_0052241
1212 Ga0495618_0018010
1213 Ga0495618_0025970
1214 Ga0495620_0013392
1215 Ga0495620_0018545
1216 Ga0495628_0000175
1217 Ga0495630_0017098
1218 Ga0495630_0030421
1219 Ga0495631_0000151
1220 Ga0495631_0011676
1221 Ga0495632_0004825
1222 Ga0495632_0019790
1223 Ga0495632_0020623
1224 Ga0495632_0025366
1225 Ga0495632_0079677
1226 Ga0495637_0000521
1227 Ga0495637_0006096
1228 Ga0495637_0039298
1229 Ga0495643_0000029
1230 Ga0495643_0096096
1231 Ga0495648_0004049
1232 Ga0495648_0038560
1233 Ga0495648_0090885
1234 Ga0495666_0000084
1235 Ga0495666_0007202
1236 Ga0495642_0047592
1237 Ga0495652_0021003
1238 Ga0495652_0133813
1239 Ga0495654_0000020
1240 Ga0495654_0001502
1241 Ga0495654_0003933
1242 Ga0495654_0019663
1243 Ga0495665_0022719
1244 Ga0495640_0000670
1245 Ga0495640_0021445
1246 Ga0495587_0000444
1247 Ga0495609_0000070
1248 Ga0495597_0002495
1249 Ga0495597_0057818
1250 Ga0495597_0067919
1251 Ga0495645_0259781
1252 Ga0495668_0025017
1253 Ga0495634_0004322
1254 Ga0495634_0031332
1255 Ga0495611_0028594
1256 Ga0495625_0001778
1257 Ga0495625_0086284
1258 Ga0495635_0006872
1259 Ga0495635_0033058
1260 Ga0495661_0000661
1261 Ga0495661_0000897
1262 Ga0495661_0007625
1263 Ga0495661_0187757
1264 Ga0495588_0012905
1265 Ga0495599_0000157
1266 Ga0495623_0004255
1267 Ga0495623_0015720
1268 Ga0495646_0021652
1269 Ga0495646_0021801
1270 Ga0495669_0000623
1271 Ga0495669_0055625
1272 Ga0495613_0026845
1273 Ga0495613_0315046
1274 Ga0495624_0032173
1275 Ga0495624_0040405
1276 Ga0495624_0062004
1277 Ga0495624_0156454
1278 Ga0495671_0002838
1279 Ga0495671_0054905
1280 Ga0495671_0059892
1281 Ga0495671_0098710
1282 Ga0495649_0001816
1283 Ga0495649_0002718
1284 Ga0495649_0006587
1285 Ga0495649_0036573
1286 Ga0495649_0067068
1287 Ga0495649_0117073
1288 Ga0495589_0006986
1289 Ga0495589_0039526
1290 Ga0495589_0054903
1291 Ga0495600_0029617
1292 Ga0495600_0032259
1293 Ga0495660_0000011
1294 Ga0495660_0009481
1295 Ga0495660_0049556
1296 Ga0495660_0054385
1297 Ga0495660_0200794
1298 Ga0495581_0000035
1299 Ga0495581_0048174
1300 Ga0495604_0003016
1301 Ga0495604_0154925
1302 Ga0495636_0000557
1303 Ga0495674_0056878
1304 Ga0495672_0000004
1305 Ga0495672_0000893
1306 Ga0495672_0007369
1307 Ga0495672_0022837
1308 Ga0495672_0024260
1309 Ga0495672_0068950
1310 Ga0495672_0069486
1311 Ga0495676_0003157
1312 Ga0495676_0013897
1313 Ga0495680_0002162
1314 Ga0495680_0020477
1315 Ga0495680_0052842
1316 Ga0495683_0004487
1317 Ga0495683_0008408
1318 Ga0495683_0019106
1319 Ga0495683_0037047
1320 Ga0495683_0092657
1321 Ga0495687_008620
1322 Ga0495687_012182
1323 Ga0495687_036537
1324 Ga0495675_0037948
1325 Ga0495679_000671
1326 Ga0495679_007960
1327 Ga0495673_0000023
1328 Ga0495673_0002011
1329 Ga0495673_0006995
1330 Ga0495673_0007432
1331 Ga0495673_0090287
1332 Ga0495681_0012068
1333 Ga0495681_0068878
1334 Ga0495681_0109728
1335 Ga0495684_0037999
1336 Ga0495686_0000181
1337 Ga0495686_0018366
1338 Ga0495686_0070373
1339 Ga0495686_0116194
1340 Ga0495593_0011000
1341 Ga0495593_0012141
1342 Ga0495593_0030896
1343 Ga0495602_0017161
1344 Ga0495602_0111017
1345 Ga0495614_0001254
1346 Ga0495614_0002405
1347 Ga0495626_0002474
1348 Ga0495626_0008895
1349 Ga0496100_0369322
1350 Ga0496100_0406620
1351 Ga0496101_0001439
1352 Ga0496101_0124513
1353 Ga0496102_0073509
1354 Ga0496102_0117553
1355 Ga0496103_0000561
1356 Ga0496103_0014207
1357 Ga0496104_0169255
1358 Ga0496105_0461126
1359 Ga0496106_0012653
1360 Ga0496107_0007775
1361 Ga0496108_0455614
1362 Ga0496109_0208393
1363 Ga0496109_0286232
1364 Ga0496110_0009655
1365 Ga0496111_0145121
1366 Ga0496112_0008617
1367 Ga0496112_0357937
1368 Ga0496113_0000352
1369 Ga0496113_0168652
1370 Ga0496114_0542208
1371 Ga0496116_0000087
1372 Ga0496116_0000126
1373 Ga0496116_0006140
1374 Ga0496116_0008040
1375 Ga0496116_0136182
1376 Ga0496117_0000312
1377 Ga0496117_0001193
1378 Ga0496117_0005265
1379 Ga0496117_0009337
1380 Ga0496117_0027166
1381 Ga0496117_0037689
1382 Ga0496117_0051370
1383 Ga0496117_0117522
1384 Ga0496118_0005893
1385 Ga0496118_0026806
1386 Ga0496118_0050760
1387 Ga0496118_0083080
1388 Ga0496118_0092991
1389 Ga0496118_0112471
1390 Ga0496118_0129469
1391 Ga0496118_0284731
1392 Ga0496119_0020879
1393 Ga0496119_0026984
1394 Ga0496119_0046328
1395 Ga0496119_0058096
1396 Ga0496119_0158019
1397 Ga0496120_0002576
1398 Ga0496120_0043051
1399 Ga0496120_0049697
1400 Ga0496121_0000142
1401 Ga0496121_0004518
1402 Ga0496121_0004705
1403 Ga0496121_0007651
1404 Ga0496121_0013975
1405 Ga0496121_0022096
1406 Ga0496121_0120748
1407 Ga0496121_0178818
1408 Ga0496122_0000043
1409 Ga0496122_0000072
1410 Ga0496122_0000266
1411 Ga0496122_0002287
1412 Ga0496122_0009466
1413 Ga0496122_0010708
1414 Ga0496122_0050111
1415 Ga0496122_0051828
1416 Ga0496122_0072952
1417 Ga0496123_0000018
1418 Ga0496123_0000035
1419 Ga0496123_0000090
1420 Ga0496123_0000434
1421 Ga0496123_0012903
1422 Ga0496123_0037825
1423 Ga0496123_0055292
1424 Ga0496123_0159747
1425 Ga0496124_0000047
1426 Ga0496124_0006876
1427 Ga0496124_0008633
1428 Ga0496124_0011258
1429 Ga0496124_0018587
1430 Ga0496124_0072030
1431 Ga0496124_0134239
1432 Ga0496124_0134678
1433 Ga0496125_0000215
1434 Ga0496125_0000507
1435 Ga0496125_0010985
1436 Ga0496125_0020758
1437 Ga0496125_0021917
1438 Ga0496125_0059921
1439 Ga0496125_0065558
1440 Ga0496125_0065812
1441 Ga0496125_0077865
1442 Ga0496125_0217743
1443 Ga0496126_0000412
1444 Ga0496126_0026036
1445 Ga0496126_0047716
1446 Ga0496126_0098862
1447 Ga0496126_0288460
1448 Ga0495678_000031
1449 Ga0495678_005590
1450 Ga0495678_005891
1451 Ga0495678_019209
1452 Ga0495682_0000004
1453 Ga0495682_0003429
1454 Ga0495682_0034215
1455 Ga0495682_0065455
1456 Ga0501033_0385467
1457 Ga0501039_0085261
1458 Ga0501042_0052271
1459 Ga0501046_0496636
1460 Ga0501048_0116206
1461 Ga0501067_0107866
1462 Ga0501072_0041269
1463 Ga0501073_0009154
1464 Ga0501075_0224032
1465 Ga0501081_0002092
1466 Ga0501045_0017506
1467 nmdc:mga0yw44_16137_c1
1468 Ga0500578_0043559
1469 Ga0500644_0004269
1470 Ga0500557_000232
1471 Ga0500562_013750
1472 Ga0500594_0003205
1473 Ga0500618_011541
1474 Ga0500621_000001
1475 Ga0500652_041522
1476 Ga0500658_0000111
1477 Ga0500659_0003377
1478 Ga0500568_0000824
1479 Ga0500577_0125163
1480 Ga0500616_0000369
1481 Ga0500616_0010244
1482 Ga0500622_0000609
1483 Ga0500622_0060248
1484 Ga0500633_0110539
1485 Ga0501084_0057995
1486 Ga0501084_0398161
1487 Ga0530510_0011333
1488 2509127859
1489 2510285025
1490 2510294139
1491 2510313170
1492 2511131689
1493 2511193696
1494 2513574315
1495 2513636511
1496 2513640004
1497 2513711165
1498 2517079776
1499 2524451834
1500 2555668343
1501 2558907094
1502 2585226178
1503 2585275163
1504 2585278326
1505 2585324831
1506 2585333229
1507 2585399594
1508 2585532017
1509 2585548902
1510 2585552377
1511 2585561123
1512 2585899773
1513 2585908285
1514 2587983680
1515 2588514427
1516 2599330113
1517 2599355344
1518 2599360837
1519 2599367159
1520 2599373949
1521 2599380450
1522 2599386897
1523 2599392807
1524 2599397051
1525 2599404574
1526 2599449044
1527 2599462178
1528 2599466780
1529 2599490730
1530 2599511212
1531 2599519297
1532 2599614605
1533 2599879659
1534 2599890586
1535 2599925695
1536 2599948158
1537 2599994837
1538 2600023982
1539 2600030981
1540 2600034657
1541 2600061341
1542 2600077675
1543 2600195167
1544 2600214800
1545 2600360872
1546 2600813479
1547 2601774495
1548 2616307844
1549 2616552743
1550 2621301532
1551 2643868886
1552 2644108245
1553 2644130626
1554 2644145827
1555 2644307306
1556 2644331322
1557 2644541338
1558 2644613395
1559 2644624020
1560 2650899028
1561 2671097945
1562 2671116888
1563 2671127351
1564 2677898160
1565 2686353413
1566 2725948366
1567 2729909900
1568 2738673752
1569 2738687725
1570 2738752145
1571 2738809117
1572 2738861186
1573 2738896477
1574 2739263840
1575 2743735971
1576 2766064661
1577 2774128124
1578 2776910663
1579 2778174870
1580 2808975257
1581 2808991104
1582 2809123531
1583 2817489114
1584 2819613162
1585 2819640262
1586 2819703029
1587 2825652490
1588 2826585752
1589 2834029017
1590 2838031774
1591 2838687958
1592 2838699570
1593 2838712990
1594 2838733681
1595 2838746351
1596 2841857659
1597 2842082357
1598 2842113744
1599 2842123239
1600 2842159226
1601 2842183205
1602 2842221672
1603 2842234469
1604 2842242314
1605 2842247991
1606 2842259586
1607 2842272011
1608 2842296381
1609 2842375330
1610 2842382933
1611 2842389682
1612 2842478506
1613 2842505549
1614 2842818622
1615 2842853232
1616 2844167019
1617 2844459915
1618 2847799798
1619 2852393161
1620 2852615498
1621 2852670466
1622 2856290066
1623 2857362893
1624 2857522763
1625 2860869045
1626 2870785209
1627 2889792502
1628 2891376789
1629 2899371579
1630 2904436047
1631 2904490264
1632 2908447840
1633 2909047898
1634 2913039055
1635 2917072110
1636 2919052045
1637 2919104843
1638 2919413032
1639 2919486906
1640 2919533435
1641 2920880185
1642 2923154981
1643 2923586723
1644 2928146559
1645 2931369947
1646 2931392048
1647 2933589619
1648 2935354282
1649 2935899276
1650 2936371319
1651 2936375478
1652 2941502814
1653 2945929535
1654 2945961275
1655 2946011816
1656 2946029291
1657 2947235840
1658 2974299720
1659 2984496701
1660 2984502080
1661 2984563870
1662 2984596603
1663 2989352763
1664 2989775243
1665 2990262118
1666 2995726898
1667 3004171785
1668 3005420843
1669 3006428815
1670 637318705
1671 639644914
1672 8005319422
1673 8005380267
1674 8005487719
1675 8005563387
1676 8005567740
1677 8005651787
1678 8005683817
1679 8018168801
1680 8019770899
1681 8024482368
1682 8054287361
1683 8054504628
1684 8055175855
1685 8055307128
1686 8055819068
1687 8056132938
1688 8056161188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

229

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

273

0.93

PF08659

KR

KR domain

36

217

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_G architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9784 34 276
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.974 31 276
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.971 32 273
2cdh-assembly1.cif.gz_G architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9706 34 276
2ph3-assembly1.cif.gz_A-2 crystal structure of 3-oxoacyl-[acyl carrier protein] reductase ttha0415 from thermus thermophilus 0.9695 35 275
ID Description Score Start End Superfamily
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.975 37 276 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 32 273 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 110 276 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 29 273 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9655 31 277 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A522E0N1-F1-model_v4 SDR family oxidoreductase 0.9797 31 274 GO:0016491
AF-A0A6B3D965-F1-model_v4 deleted 0.9751 39 273
AF-A0A0S7XKD8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9742 31 273 GO:0016616
GO:0030497
AF-X1DT56-F1-model_v4 Uncharacterized protein 0.9742 119 245 GO:0016491
AF-A0A7X9KFR3-F1-model_v4 SDR family oxidoreductase 0.9713 33 277 GO:0016491

Map