F483115

General Info

Members Datasets Scaffolds Average Seq Length
841 317 1682 220

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2654587600|2655032952
Length 221
Sequence VIMGCGRVGVSLAHTLDSAGHSVAIIDQDPHAFRRLGKDFAGLTVTGRGFDRDTLEAAKIDGAYAFAAVSSGDNSNILATRVARETYNVPHVVARIYDPGRAEIYQRLGIPTVAAVRWSTDQVLRRILPDYSMRGDFREPSGRLVLTEVALNRDWYGRLVKDLEAAAGVRVAYLTRFGEGTIPQNRTRLQGGDLVHVMMRIDQLKDVEKILASPPAPLPND

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
283 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
284 2643221561 Nocardioides sp. Root151 Isolate Unclassified
285 2643221576 Nocardioides sp. Root614 Isolate Unclassified
286 2643221590 Nocardioides sp. Root682 Isolate Unclassified
287 2643221604 Nocardioides sp. Root190 Isolate Unclassified
288 2643221615 Nocardioides sp. Root224 Isolate Unclassified
289 2643221617 Nocardioides sp. Root79 Isolate Unclassified
290 2643221620 Nocardioides sp. Root240 Isolate Unclassified
291 2643221641 Nocardioides sp. Root122 Isolate Unclassified
292 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
293 2643221696 Nocardioides sp. Root140 Isolate Unclassified
294 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
295 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
296 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
297 2738541305 Nocardioides sp. CF167 Isolate Unclassified
298 2739367898 Nocardioides sp. CF479 Isolate Unclassified
299 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
300 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
301 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
302 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
303 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
304 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
305 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
306 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
307 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
308 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
309 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
310 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
311 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
312 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
313 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
314 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
315 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
316 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
317 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 0.24
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 9.51
Nodule 0.12
Rhizoplane 10.34
Rhizosphere 75.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1013543 3300000549 Bacteria 961
2 JGI24737J22298_10031888 3300001990 Bacteria 1644
3 JGI24735J21928_10021270 3300002067 Bacteria 1981
4 JGI24738J21930_10010987 3300002075 Bacteria 2002
5 JGI24744J21845_10014346 3300002077 Bacteria 1592
6 JGI25406J46586_10008760 3300003203 Bacteria 4558
7 Ga0070658_10017644 3300005327 Bacteria 5709
8 Ga0070658_10106845 3300005327 Bacteria 2316
9 Ga0070658_10130750 3300005327 Bacteria 2092
10 Ga0070658_10458431 3300005327 Bacteria 1099
11 Ga0070683_100006425 3300005329 Bacteria 9858
12 Ga0070683_100012951 3300005329 Bacteria 7259
13 Ga0070683_100034907 3300005329 Bacteria 4597
14 Ga0070683_100456769 3300005329 Bacteria 1219
15 Ga0070683_100556617 3300005329 Bacteria 1097
16 Ga0070670_100284331 3300005331 Bacteria 1445
17 Ga0068869_100484054 3300005334 Bacteria 1031
18 Ga0070680_100230594 3300005336 Bacteria 1564
19 Ga0070682_100049931 3300005337 Bacteria 2610
20 Ga0068868_100318026 3300005338 Bacteria 1325
21 Ga0068868_100702414 3300005338 Bacteria 905
22 Ga0070660_100005631 3300005339 Bacteria 8681
23 Ga0070660_100058091 3300005339 Bacteria 2999
24 Ga0070689_100157581 3300005340 Bacteria 1834
25 Ga0070687_100125141 3300005343 Bacteria 1476
26 Ga0070687_100259865 3300005343 Bacteria 1083
27 Ga0070661_100284676 3300005344 Bacteria 1283
28 Ga0070692_10034534 3300005345 Bacteria 2555
29 Ga0070692_10105430 3300005345 Bacteria 1551
30 Ga0070674_100031447 3300005356 Bacteria 3517
31 Ga0070674_100195791 3300005356 Bacteria 1557
32 Ga0070659_100094418 3300005366 Bacteria 2402
33 Ga0070659_100100986 3300005366 Bacteria 2322
34 Ga0070659_100240162 3300005366 Bacteria 1499
35 Ga0070659_100357616 3300005366 Bacteria 1226
36 Ga0070667_100179654 3300005367 Bacteria 1871
37 Ga0070667_100306838 3300005367 Bacteria 1430
38 Ga0070667_100393788 3300005367 Bacteria 1260
39 Ga0070714_100005919 3300005435 Bacteria 9385
40 Ga0070701_10022152 3300005438 Bacteria 3043
41 Ga0070700_100011370 3300005441 Bacteria 4929
42 Ga0070663_100210051 3300005455 Bacteria 1524
43 Ga0070663_100468746 3300005455 Bacteria 1041
44 Ga0070678_100476500 3300005456 Bacteria 1097
45 Ga0070662_100096422 3300005457 Bacteria 2231
46 Ga0070681_10140809 3300005458 Bacteria 2342
47 Ga0068867_100005704 3300005459 Bacteria 8826
48 Ga0070685_10019113 3300005466 Bacteria 3694
49 Ga0070685_10314765 3300005466 Bacteria 1059
50 Ga0070698_100010433 3300005471 Bacteria 9920
51 Ga0070679_100013115 3300005530 Bacteria 7937
52 Ga0070684_100001548 3300005535 Bacteria 16592
53 Ga0070684_100043329 3300005535 Bacteria 3885
54 Ga0070684_100125804 3300005535 Bacteria 2309
55 Ga0070684_100177633 3300005535 Bacteria 1935
56 Ga0068853_100176994 3300005539 Bacteria 1933
57 Ga0070686_100057301 3300005544 Bacteria 2502
58 Ga0070693_100309568 3300005547 Bacteria 1067
59 Ga0070665_100000273 3300005548 Bacteria 84592
60 Ga0068857_100007521 3300005577 Bacteria 9373
61 Ga0068854_100037408 3300005578 Bacteria 3407
62 Ga0068856_100345413 3300005614 Bacteria 1507
63 Ga0070702_100013929 3300005615 Bacteria 4071
64 Ga0070702_100029299 3300005615 Bacteria 2992
65 Ga0068852_100174023 3300005616 Bacteria 2020
66 Ga0068852_100269585 3300005616 Bacteria 1638
67 Ga0068864_100249464 3300005618 Bacteria 1647
68 Ga0068861_100023002 3300005719 Bacteria 4493
69 Ga0068861_100034022 3300005719 Bacteria 3765
70 Ga0068861_100049711 3300005719 Bacteria 3176
71 Ga0068870_10018021 3300005840 Bacteria 3403
72 Ga0068870_10123970 3300005840 Bacteria 1492
73 Ga0068870_10150368 3300005840 Bacteria 1371
74 Ga0068863_100536232 3300005841 Bacteria 1155
75 Ga0068858_100278736 3300005842 Bacteria 1592
76 Ga0068860_100065106 3300005843 Bacteria 3462
77 Ga0068860_100265151 3300005843 Bacteria 1675
78 Ga0081455_10196210 3300005937 Bacteria 1516
79 Ga0081538_10000345 3300005981 Bacteria 53019
80 Ga0081539_10000100 3300005985 Bacteria 199516
81 Ga0081539_10063799 3300005985 Bacteria 2008
82 Ga0075365_10005467 3300006038 Bacteria 6854
83 Ga0075365_10005743 3300006038 Bacteria 6734
84 Ga0075365_10009542 3300006038 Bacteria 5589
85 Ga0075365_10010982 3300006038 Bacteria 5305
86 Ga0075365_10022491 3300006038 Bacteria 3951
87 Ga0075365_10093791 3300006038 Bacteria 2048
88 Ga0075365_10182924 3300006038 Bacteria 1466
89 Ga0075365_10189453 3300006038 Bacteria 1439
90 Ga0075368_10001063 3300006042 Bacteria 8600
91 Ga0075368_10100096 3300006042 Bacteria 1190
92 Ga0075363_100005645 3300006048 Bacteria 5595
93 Ga0075363_100007534 3300006048 Bacteria 5011
94 Ga0075363_100058916 3300006048 Bacteria 2063
95 Ga0075363_100118410 3300006048 Bacteria 1477
96 Ga0075363_100142626 3300006048 Bacteria 1350
97 Ga0075364_10011060 3300006051 Bacteria 5476
98 Ga0075364_10018999 3300006051 Bacteria 4311
99 Ga0075364_10036981 3300006051 Bacteria 3158
100 Ga0075364_10166847 3300006051 Bacteria 1488
101 Ga0075364_10185948 3300006051 Bacteria 1407
102 Ga0075364_10218322 3300006051 Bacteria 1293
103 Ga0075432_10001088 3300006058 Bacteria 8652
104 Ga0075362_10014596 3300006177 Bacteria 3173
105 Ga0075367_10019483 3300006178 Bacteria 3763
106 Ga0075367_10092565 3300006178 Bacteria 1840
107 Ga0075367_10176795 3300006178 Bacteria 1330
108 Ga0075367_10193546 3300006178 Bacteria 1269
109 Ga0075370_10009077 3300006353 Bacteria 5142
110 Ga0075370_10025679 3300006353 Bacteria 3260
111 Ga0075370_10045056 3300006353 Bacteria 2494
112 Ga0075370_10159238 3300006353 Bacteria 1325
113 Ga0068871_100063940 3300006358 Bacteria 3011
114 Ga0075428_100000711 3300006844 Bacteria 34391
115 Ga0075430_100306642 3300006846 Bacteria 1313
116 Ga0075431_100015231 3300006847 Bacteria 7792
117 Ga0075433_10000003 3300006852 Bacteria 85999
118 Ga0075433_10040606 3300006852 Bacteria 4028
119 Ga0075433_10508422 3300006852 Bacteria 1060
120 Ga0075434_100000691 3300006871 Bacteria 26321
121 Ga0075434_100004021 3300006871 Bacteria 13177
122 Ga0075434_100624775 3300006871 Bacteria 1096
123 Ga0068865_100001572 3300006881 Bacteria 13343
124 Ga0068865_100182514 3300006881 Bacteria 1617
125 Ga0068865_100379122 3300006881 Bacteria 1153
126 Ga0075436_100005603 3300006914 Bacteria 8616
127 Ga0075435_100000613 3300007076 Bacteria 21900
128 Ga0111539_10002214 3300009094 Bacteria 25972
129 Ga0111539_10433985 3300009094 Bacteria 1530
130 Ga0111539_10713639 3300009094 Bacteria 1167
131 Ga0105245_10009217 3300009098 Bacteria 8605
132 Ga0105245_10013771 3300009098 Bacteria 7043
133 Ga0105245_10092996 3300009098 Bacteria 2778
134 Ga0114129_10008508 3300009147 Bacteria 14627
135 Ga0105243_10002326 3300009148 Bacteria 15906
136 Ga0105243_10011520 3300009148 Bacteria 6692
137 Ga0105243_10087827 3300009148 Bacteria 2553
138 Ga0105241_10881577 3300009174 Bacteria 830
139 Ga0105242_10219209 3300009176 Bacteria 1699
140 Ga0105242_10225564 3300009176 Bacteria 1677
141 Ga0105242_11006109 3300009176 Bacteria 842
142 Ga0105238_10193140 3300009551 Bacteria 2011
143 Ga0105238_10313807 3300009551 Bacteria 1553
144 Ga0105238_10428651 3300009551 Bacteria 1318
145 Ga0105249_10021521 3300009553 Bacteria 5773
146 Ga0105249_10045414 3300009553 Bacteria 3995
147 Ga0105249_10137154 3300009553 Bacteria 2343
148 Ga0105249_10298672 3300009553 Bacteria 1614
149 Ga0105239_10028212 3300010375 Bacteria 6174
150 Ga0105239_10031714 3300010375 Bacteria 5807
151 Ga0105239_10215189 3300010375 Bacteria 2154
152 Ga0105239_10360076 3300010375 Bacteria 1643
153 Ga0105239_10913817 3300010375 Bacteria 1008
154 Ga0105246_10015844 3300011119 Bacteria 4767
155 Ga0105246_10083483 3300011119 Bacteria 2283
156 Ga0157371_10211653 3300013102 Bacteria 1391
157 Ga0157374_10227059 3300013296 Bacteria 1833
158 Ga0157374_10295640 3300013296 Bacteria 1601
159 Ga0163162_10011475 3300013306 Bacteria 8641
160 Ga0163162_10059520 3300013306 Bacteria 3852
161 Ga0157372_10020744 3300013307 Bacteria 7095
162 Ga0157372_10071811 3300013307 Bacteria 3900
163 Ga0157372_10121575 3300013307 Bacteria 3000
164 Ga0157372_10123225 3300013307 Bacteria 2979
165 Ga0157372_10430929 3300013307 Bacteria 1537
166 Ga0157372_10670766 3300013307 Bacteria 1207
167 Ga0157372_10853949 3300013307 Bacteria 1057
168 Ga0157375_10226911 3300013308 Bacteria 2026
169 Ga0163163_10033657 3300014325 Bacteria 4959
170 Ga0163163_10388968 3300014325 Bacteria 1452
171 Ga0163163_10718711 3300014325 Bacteria 1062
172 Ga0157380_10258297 3300014326 Bacteria 1581
173 Ga0157380_11165307 3300014326 Bacteria 813
174 Ga0182008_10070187 3300014497 Bacteria 1723
175 Ga0182008_10207747 3300014497 Bacteria 998
176 Ga0157377_10018533 3300014745 Bacteria 3619
177 Ga0157377_10033024 3300014745 Bacteria 2822
178 Ga0157377_10236322 3300014745 Bacteria 1177
179 Ga0157376_10253822 3300014969 Bacteria 1644
180 Ga0163161_10056093 3300017792 Bacteria 2861
181 Ga0163161_10087778 3300017792 Bacteria 2298
182 Ga0163161_10156904 3300017792 Bacteria 1733
183 Ga0206354_11393013 3300020081 Bacteria 1123
184 Ga0206353_10338087 3300020082 Bacteria 7936
185 Ga0207688_10002361 3300025901 Bacteria 10154
186 Ga0207647_10037133 3300025904 Bacteria 3091
187 Ga0207647_10057879 3300025904 Bacteria 2375
188 Ga0207643_10029653 3300025908 Bacteria 3044
189 Ga0207643_10146431 3300025908 Bacteria 1413
190 Ga0207705_10056354 3300025909 Bacteria 2833
191 Ga0207705_10582033 3300025909 Bacteria 870
192 Ga0207707_10213884 3300025912 Bacteria 1679
193 Ga0207662_10076664 3300025918 Bacteria 2032
194 Ga0207662_10107752 3300025918 Bacteria 1734
195 Ga0207662_10262614 3300025918 Bacteria 1137
196 Ga0207657_10007877 3300025919 Bacteria 10871
197 Ga0207657_10042395 3300025919 Bacteria 4016
198 Ga0207657_10066891 3300025919 Bacteria 3058
199 Ga0207657_10274400 3300025919 Bacteria 1340
200 Ga0207657_10314293 3300025919 Bacteria 1239
201 Ga0207649_10083483 3300025920 Bacteria 2074
202 Ga0207649_10279714 3300025920 Bacteria 1213
203 Ga0207652_10011906 3300025921 Bacteria 7017
204 Ga0207652_10361583 3300025921 Bacteria 1310
205 Ga0207694_10120838 3300025924 Bacteria 2092
206 Ga0207694_10155686 3300025924 Bacteria 1843
207 Ga0207694_10307257 3300025924 Bacteria 1307
208 Ga0207694_10336496 3300025924 Bacteria 1248
209 Ga0207650_10259765 3300025925 Bacteria 1408
210 Ga0207687_10019789 3300025927 Bacteria 4463
211 Ga0207687_10033704 3300025927 Bacteria 3474
212 Ga0207687_10057227 3300025927 Bacteria 2738
213 Ga0207664_10034416 3300025929 Bacteria 3902
214 Ga0207690_10020456 3300025932 Bacteria 4090
215 Ga0207690_10042983 3300025932 Bacteria 2972
216 Ga0207690_10100762 3300025932 Bacteria 2062
217 Ga0207690_10203868 3300025932 Bacteria 1504
218 Ga0207690_10356517 3300025932 Bacteria 1158
219 Ga0207706_10066885 3300025933 Bacteria 3163
220 Ga0207706_10423907 3300025933 Bacteria 1153
221 Ga0207706_10503066 3300025933 Bacteria 1046
222 Ga0207686_10116442 3300025934 Bacteria 1812
223 Ga0207709_10016385 3300025935 Bacteria 4119
224 Ga0207709_10077877 3300025935 Bacteria 2127
225 Ga0207709_10081972 3300025935 Bacteria 2082
226 Ga0207709_10154869 3300025935 Bacteria 1591
227 Ga0207670_10071774 3300025936 Bacteria 2395
228 Ga0207669_10350113 3300025937 Bacteria 1141
229 Ga0207704_10148796 3300025938 Bacteria 1649
230 Ga0207691_10008577 3300025940 Bacteria 9810
231 Ga0207711_10057232 3300025941 Bacteria 3352
232 Ga0207661_10002795 3300025944 Bacteria 12041
233 Ga0207661_10054840 3300025944 Bacteria 3194
234 Ga0207661_10063997 3300025944 Bacteria 2980
235 Ga0207661_10093802 3300025944 Bacteria 2506
236 Ga0207679_10108780 3300025945 Bacteria 2183
237 Ga0207679_10439546 3300025945 Bacteria 1155
238 Ga0207667_10428034 3300025949 Bacteria 1346
239 Ga0207651_10132299 3300025960 Bacteria 1912
240 Ga0207712_10008397 3300025961 Bacteria 6525
241 Ga0207712_10039994 3300025961 Bacteria 3215
242 Ga0207712_10431623 3300025961 Bacteria 1114
243 Ga0207640_10567822 3300025981 Bacteria 956
244 Ga0207658_10067683 3300025986 Bacteria 2691
245 Ga0207658_10293508 3300025986 Bacteria 1398
246 Ga0207658_10317574 3300025986 Bacteria 1347
247 Ga0207677_10156792 3300026023 Bacteria 1764
248 Ga0207677_10632629 3300026023 Bacteria 942
249 Ga0207703_10135901 3300026035 Bacteria 2128
250 Ga0207639_10425920 3300026041 Bacteria 1201
251 Ga0207678_10447634 3300026067 Bacteria 1122
252 Ga0207678_10637965 3300026067 Bacteria 935
253 Ga0207708_10000227 3300026075 Bacteria 44512
254 Ga0207708_10095127 3300026075 Bacteria 2300
255 Ga0207702_10179874 3300026078 Bacteria 1947
256 Ga0207702_10192019 3300026078 Bacteria 1887
257 Ga0207648_10009320 3300026089 Bacteria 9408
258 Ga0207676_10289017 3300026095 Bacteria 1492
259 Ga0207674_10014132 3300026116 Bacteria 8821
260 Ga0207674_10225674 3300026116 Bacteria 1821
261 Ga0207675_100003582 3300026118 Bacteria 15138
262 Ga0207675_100044326 3300026118 Bacteria 4156
263 Ga0207675_100049974 3300026118 Bacteria 3902
264 Ga0207698_10041089 3300026142 Bacteria 3442
265 Ga0207698_10684836 3300026142 Bacteria 1019
266 Ga0209813_10013346 3300027866 Bacteria 2192
267 Ga0207428_10005512 3300027907 Bacteria 11790
268 Ga0207428_10009590 3300027907 Bacteria 8672
269 Ga0207428_10165376 3300027907 Bacteria 1678
270 Ga0268266_10000955 3300028379 Bacteria 36877
271 Ga0268264_10040659 3300028381 Bacteria 3842
272 Ga0307515_10389081 3300028794 Bacteria 1024
273 Ga0307408_100007018 3300031548 Bacteria 7449
274 Ga0307408_100017340 3300031548 Bacteria 4819
275 Ga0307408_100705775 3300031548 Bacteria 907
276 Ga0307405_10001273 3300031731 Bacteria 10504
277 Ga0307405_10238370 3300031731 Bacteria 1346
278 Ga0307405_10254752 3300031731 Bacteria 1308
279 Ga0307405_10268350 3300031731 Bacteria 1278
280 Ga0307405_10278956 3300031731 Bacteria 1257
281 Ga0307405_10314921 3300031731 Bacteria 1193
282 Ga0307413_10005028 3300031824 Bacteria 5838
283 Ga0307413_10005736 3300031824 Bacteria 5581
284 Ga0307413_10177644 3300031824 Bacteria 1514
285 Ga0307413_10248434 3300031824 Bacteria 1318
286 Ga0307410_10020799 3300031852 Bacteria 4023
287 Ga0307410_10028034 3300031852 Bacteria 3566
288 Ga0307410_10147347 3300031852 Bacteria 1748
289 Ga0307410_10407580 3300031852 Bacteria 1100
290 Ga0307406_10000718 3300031901 Bacteria 18684
291 Ga0307406_10264998 3300031901 Bacteria 1302
292 Ga0307406_10495283 3300031901 Bacteria 990
293 Ga0307407_10000498 3300031903 Bacteria 12111
294 Ga0307407_10000918 3300031903 Bacteria 9968
295 Ga0307407_10003870 3300031903 Bacteria 6239
296 Ga0307407_10012563 3300031903 Bacteria 4076
297 Ga0307407_10097181 3300031903 Bacteria 1820
298 Ga0307412_10004095 3300031911 Bacteria 8124
299 Ga0307412_10158025 3300031911 Bacteria 1681
300 Ga0307412_10299403 3300031911 Bacteria 1270
301 Ga0307409_100000040 3300031995 Bacteria 44978
302 Ga0307409_100013869 3300031995 Bacteria 5211
303 Ga0307409_100021185 3300031995 Bacteria 4451
304 Ga0307409_100027937 3300031995 Bacteria 4009
305 Ga0307409_100111134 3300031995 Bacteria 2298
306 Ga0307409_100212957 3300031995 Bacteria 1738
307 Ga0307409_100310356 3300031995 Bacteria 1472
308 Ga0307409_100382606 3300031995 Bacteria 1338
309 Ga0307409_100416703 3300031995 Bacteria 1287
310 Ga0307409_100530006 3300031995 Bacteria 1152
311 Ga0307416_100000078 3300032002 Bacteria 71548
312 Ga0307416_100010435 3300032002 Bacteria 6134
313 Ga0307416_100013428 3300032002 Bacteria 5566
314 Ga0307416_100021323 3300032002 Bacteria 4649
315 Ga0307416_100038900 3300032002 Bacteria 3675
316 Ga0307416_100217524 3300032002 Bacteria 1829
317 Ga0307416_100467442 3300032002 Bacteria 1318
318 Ga0307414_10001176 3300032004 Bacteria 13443
319 Ga0307411_10001351 3300032005 Bacteria 9918
320 Ga0307411_10026771 3300032005 Bacteria 3477
321 Ga0307411_10112261 3300032005 Bacteria 1953
322 Ga0307415_100003733 3300032126 Bacteria 7799
323 Ga0307415_100004209 3300032126 Bacteria 7432
324 Ga0307415_100008957 3300032126 Bacteria 5581
325 Ga0307415_100161253 3300032126 Bacteria 1738
326 Ga0373943_0313005 3300035170 Bacteria 894
327 Ga0316574_0025873 3300035398 Bacteria 3526
328 Ga0316584_0197222 3300036712 Bacteria 1487
329 Ga0395899_0034657 3300037312 Bacteria 3791
330 Ga0395900_0025057 3300037418 Bacteria 6106
331 Ga0395900_0039734 3300037418 Bacteria 4847
332 Ga0395900_0089433 3300037418 Bacteria 3165
333 Ga0395900_0546490 3300037418 Bacteria 1103
334 Ga0395900_0809054 3300037418 Bacteria 865
335 Ga0395898_0857162 3300037466 Bacteria 848
336 Ga0395905_0021436 3300037471 Bacteria 6110
337 Ga0395905_0150583 3300037471 Bacteria 2189
338 Ga0395901_0048488 3300038443 Bacteria 4411
339 Ga0395901_0054129 3300038443 Bacteria 4170
340 Ga0395901_0092027 3300038443 Bacteria 3174
341 Ga0395901_0408649 3300038443 Bacteria 1394
342 Ga0436365_0285662 3300039437 Bacteria 824
343 Ga0436365_1327458 3300039437 Bacteria 1089
344 Ga0439436_0091583 3300041404 Bacteria 847
345 Ga0439466_0058193 3300041411 Bacteria 1251
346 Ga0451791_0009612 3300041451 Bacteria 4929
347 Ga0451791_0369297 3300041451 Bacteria 829
348 Ga0451791_1756400 3300041451 Bacteria 3520
349 Ga0451791_1818518 3300041451 Bacteria 1102
350 Ga0451793_0911478 3300041452 Bacteria 1672
351 Ga0451800_1314210 3300041459 Bacteria 951
352 Ga0451802_2065268 3300041460 Bacteria 1386
353 Ga0451833_0367630 3300041491 Bacteria 1003
354 Ga0451837_0226644 3300041494 Bacteria 1900
355 Ga0451837_1470429 3300041494 Bacteria 902
356 Ga0451843_0133041 3300041509 Bacteria 1391
357 Ga0451855_0955642 3300041511 Bacteria 725
358 Ga0451853_1034644 3300041512 Bacteria 3852
359 Ga0451853_1305535 3300041512 Bacteria 1090
360 Ga0439431_0005966 3300041997 Bacteria 2688
361 Ga0439445_0015896 3300042004 Bacteria 1848
362 Ga0439432_054451 3300042006 Bacteria 1243
363 Ga0439463_004986 3300042016 Bacteria 3309
364 Ga0439434_0000739 3300042435 Bacteria 9380
365 Ga0439444_0007830 3300042437 Bacteria 1652
366 Ga0439464_0013977 3300042439 Bacteria 2156
367 Ga0439464_0014395 3300042439 Bacteria 2126
368 Ga0439464_0035743 3300042439 Bacteria 1404
369 Ga0466972_0007342 3300044658 Bacteria 5536
370 Ga0466972_0026224 3300044658 Bacteria 2888
371 Ga0466972_0055285 3300044658 Bacteria 1909
372 Ga0466972_0098728 3300044658 Bacteria 1382
373 Ga0466972_0098833 3300044658 Bacteria 1381
374 Ga0466965_0010769 3300044683 Bacteria 4278
375 Ga0466965_0023418 3300044683 Bacteria 2982
376 Ga0466965_0043192 3300044683 Bacteria 2225
377 Ga0466965_0046182 3300044683 Bacteria 2155
378 Ga0466965_0048327 3300044683 Bacteria 2108
379 Ga0466965_0262627 3300044683 Bacteria 928
380 Ga0466966_0011350 3300044684 Bacteria 5908
381 Ga0466966_0122067 3300044684 Bacteria 1600
382 Ga0466966_0164275 3300044684 Bacteria 1351
383 Ga0466966_0200434 3300044684 Bacteria 1208
384 Ga0466966_0380089 3300044684 Bacteria 849
385 Ga0466961_0018176 3300044693 Bacteria 4520
386 Ga0466961_0028917 3300044693 Bacteria 3564
387 Ga0466961_0032177 3300044693 Bacteria 3370
388 Ga0466961_0060957 3300044693 Bacteria 2398
389 Ga0466961_0168354 3300044693 Bacteria 1363
390 Ga0466961_0177779 3300044693 Bacteria 1322
391 Ga0466963_0014628 3300044694 Bacteria 4842
392 Ga0466963_0016921 3300044694 Bacteria 4542
393 Ga0466963_0037052 3300044694 Bacteria 3183
394 Ga0466963_0043988 3300044694 Bacteria 2938
395 Ga0466963_0192141 3300044694 Bacteria 1426
396 Ga0466963_0244265 3300044694 Bacteria 1259
397 Ga0466964_0086907 3300044706 Bacteria 1353
398 Ga0466964_0416134 3300044706 Bacteria 706
399 Ga0466971_0016821 3300044719 Bacteria 3231
400 Ga0466971_0020670 3300044719 Bacteria 2927
401 Ga0466971_0058425 3300044719 Bacteria 1741
402 Ga0466968_0129080 3300044735 Bacteria 1149
403 Ga0466970_0002084 3300044765 Bacteria 9670
404 Ga0466970_0011794 3300044765 Bacteria 4457
405 Ga0466970_0034042 3300044765 Bacteria 2695
406 Ga0466970_0034873 3300044765 Bacteria 2665
407 Ga0466970_0078572 3300044765 Bacteria 1780
408 Ga0466970_0132251 3300044765 Bacteria 1371
409 Ga0466970_0208805 3300044765 Bacteria 1087
410 Ga0466970_0248269 3300044765 Bacteria 997
411 Ga0466970_0272311 3300044765 Bacteria 951
412 Ga0466957_0022534 3300044842 Bacteria 3717
413 Ga0466957_0090234 3300044842 Bacteria 1919
414 Ga0466957_0092835 3300044842 Bacteria 1893
415 Ga0466960_0002006 3300044901 Bacteria 7549
416 Ga0466960_0002484 3300044901 Bacteria 6940
417 Ga0466960_0005554 3300044901 Bacteria 5002
418 Ga0466960_0009952 3300044901 Bacteria 3936
419 Ga0466960_0021784 3300044901 Bacteria 2857
420 Ga0466960_0052190 3300044901 Bacteria 1977
421 Ga0466960_0066247 3300044901 Bacteria 1785
422 Ga0466960_0104548 3300044901 Bacteria 1463
423 Ga0466960_0117719 3300044901 Bacteria 1388
424 Ga0466960_0127870 3300044901 Bacteria 1338
425 Ga0466959_0018348 3300045049 Bacteria 5135
426 Ga0451576_0133190 3300045051 Bacteria 2591
427 Ga0466958_0156983 3300045836 Bacteria 1436
428 Ga0466958_0203548 3300045836 Bacteria 1260
429 Ga0466967_0011038 3300045976 Bacteria 6816
430 Ga0466967_0029025 3300045976 Bacteria 4625
431 Ga0466967_0029842 3300045976 Bacteria 4569
432 Ga0466967_0041937 3300045976 Bacteria 3950
433 Ga0466967_0058675 3300045976 Bacteria 3403
434 Ga0466967_0063324 3300045976 Bacteria 3286
435 Ga0466967_0111974 3300045976 Bacteria 2509
436 Ga0466967_0144076 3300045976 Bacteria 2221
437 Ga0466967_0145722 3300045976 Bacteria 2209
438 Ga0466967_0302566 3300045976 Bacteria 1539
439 Ga0466967_0334770 3300045976 Bacteria 1462
440 Ga0466967_0350248 3300045976 Bacteria 1429
441 Ga0495603_0162080 3300046455 Bacteria 1297
442 Ga0495629_0299632 3300046459 Bacteria 1101
443 Ga0495641_0051748 3300046461 Bacteria 1874
444 Ga0495641_0190898 3300046461 Bacteria 918
445 Ga0495582_0087457 3300046473 Bacteria 1735
446 Ga0495664_0091417 3300046477 Bacteria 1830
447 Ga0495608_0197757 3300046511 Bacteria 1268
448 Ga0495652_0482208 3300046529 Bacteria 863
449 Ga0495667_0315792 3300046559 Bacteria 989
450 Ga0495657_0157805 3300046675 Bacteria 1405
451 Ga0495657_0315194 3300046675 Bacteria 930
452 Ga0495658_0071700 3300046683 Bacteria 2013
453 Ga0495658_0136261 3300046683 Bacteria 1498
454 Ga0495674_0199790 3300047319 Bacteria 1659
455 Ga0495674_0527723 3300047319 Bacteria 942
456 Ga0495676_0322695 3300047321 Bacteria 1037
457 Ga0496100_0035587 3300048903 Bacteria 3133
458 Ga0496100_0234588 3300048903 Bacteria 1351
459 Ga0496100_0875077 3300048903 Bacteria 705
460 Ga0496101_0032649 3300048904 Bacteria 3667
461 Ga0496101_0086864 3300048904 Bacteria 2320
462 Ga0496101_0239962 3300048904 Bacteria 1410
463 Ga0496101_0374546 3300048904 Bacteria 1120
464 Ga0496101_0566205 3300048904 Bacteria 898
465 Ga0496102_0002619 3300048905 Bacteria 15298
466 Ga0496102_0007593 3300048905 Bacteria 9264
467 Ga0496102_0034286 3300048905 Bacteria 4564
468 Ga0496102_0305785 3300048905 Bacteria 1498
469 Ga0496103_0002260 3300048906 Bacteria 12185
470 Ga0496103_0232391 3300048906 Bacteria 1186
471 Ga0496104_0004379 3300048907 Bacteria 12297
472 Ga0496104_0164407 3300048907 Bacteria 2128
473 Ga0496104_0532272 3300048907 Bacteria 1086
474 Ga0496104_0559404 3300048907 Bacteria 1054
475 Ga0496105_0104786 3300048908 Bacteria 2335
476 Ga0496106_0029064 3300048909 Bacteria 4119
477 Ga0496106_0030279 3300048909 Bacteria 4036
478 Ga0496106_0075344 3300048909 Bacteria 2584
479 Ga0496106_0623091 3300048909 Bacteria 863
480 Ga0496107_0008332 3300048910 Bacteria 7172
481 Ga0496107_0057104 3300048910 Bacteria 2821
482 Ga0496107_0068602 3300048910 Bacteria 2573
483 Ga0496107_0094759 3300048910 Bacteria 2184
484 Ga0496107_0234002 3300048910 Bacteria 1367
485 Ga0496107_0267210 3300048910 Bacteria 1273
486 Ga0496108_0020552 3300048911 Bacteria 5426
487 Ga0496108_0055902 3300048911 Bacteria 3315
488 Ga0496108_0113095 3300048911 Bacteria 2323
489 Ga0496108_0116444 3300048911 Bacteria 2289
490 Ga0496108_0155942 3300048911 Bacteria 1972
491 Ga0496108_0240918 3300048911 Bacteria 1573
492 Ga0496109_0036870 3300048912 Bacteria 4415
493 Ga0496109_0037023 3300048912 Bacteria 4407
494 Ga0496109_0054681 3300048912 Bacteria 3641
495 Ga0496109_0089994 3300048912 Bacteria 2838
496 Ga0496109_0179837 3300048912 Bacteria 1986
497 Ga0496109_0439856 3300048912 Bacteria 1232
498 Ga0496109_0457219 3300048912 Bacteria 1206
499 Ga0496109_0459442 3300048912 Bacteria 1202
500 Ga0496109_0491495 3300048912 Bacteria 1158
501 Ga0496109_0810543 3300048912 Bacteria 874
502 Ga0496109_1194191 3300048912 Bacteria 697
503 Ga0496110_0003350 3300048913 Bacteria 12248
504 Ga0496110_0007800 3300048913 Bacteria 8577
505 Ga0496110_0013242 3300048913 Bacteria 6812
506 Ga0496110_0060049 3300048913 Bacteria 3353
507 Ga0496110_0344684 3300048913 Bacteria 1357
508 Ga0496110_0433466 3300048913 Bacteria 1198
509 Ga0496111_0000864 3300048914 Bacteria 16432
510 Ga0496111_0046043 3300048914 Bacteria 3140
511 Ga0496111_0152557 3300048914 Bacteria 1714
512 Ga0496111_0178310 3300048914 Bacteria 1579
513 Ga0496112_0075788 3300048915 Bacteria 3326
514 Ga0496112_0187291 3300048915 Bacteria 2033
515 Ga0496112_0611960 3300048915 Bacteria 1021
516 Ga0496113_0021530 3300048916 Bacteria 4549
517 Ga0496113_0058344 3300048916 Bacteria 2904
518 Ga0496113_0134353 3300048916 Bacteria 1943
519 Ga0496113_0137010 3300048916 Bacteria 1924
520 Ga0496114_0006364 3300048917 Bacteria 9291
521 Ga0496114_0030149 3300048917 Bacteria 4462
522 Ga0496114_0042109 3300048917 Bacteria 3784
523 Ga0496114_0060357 3300048917 Bacteria 3169
524 Ga0496114_0112198 3300048917 Bacteria 2337
525 Ga0496114_0126419 3300048917 Bacteria 2204
526 Ga0496114_0130219 3300048917 Bacteria 2172
527 Ga0496114_0143814 3300048917 Bacteria 2066
528 Ga0496114_0145333 3300048917 Bacteria 2055
529 Ga0496114_0178589 3300048917 Bacteria 1853
530 Ga0496114_0199434 3300048917 Bacteria 1752
531 Ga0496114_0222314 3300048917 Bacteria 1658
532 Ga0496114_0338534 3300048917 Bacteria 1330
533 Ga0496114_0723722 3300048917 Bacteria 871
534 Ga0496115_0027879 3300048918 Bacteria 4421
535 Ga0496115_0190320 3300048918 Bacteria 1695
536 Ga0496115_0245663 3300048918 Bacteria 1475
537 Ga0496125_0000025 3300048928 Bacteria 440074
538 Ga0496125_0007435 3300048928 Bacteria 11652
539 Ga0501031_0021538 3300049568 Bacteria 4202
540 Ga0501031_0031482 3300049568 Bacteria 3460
541 Ga0501031_0034438 3300049568 Bacteria 3305
542 Ga0501031_0078740 3300049568 Bacteria 2148
543 Ga0501031_0079871 3300049568 Bacteria 2132
544 Ga0501031_0159715 3300049568 Bacteria 1473
545 Ga0501031_0248540 3300049568 Bacteria 1156
546 Ga0501032_0003962 3300049569 Bacteria 11230
547 Ga0501032_0100372 3300049569 Bacteria 1918
548 Ga0501032_0278190 3300049569 Bacteria 1084
549 Ga0501033_0002176 3300049570 Bacteria 16916
550 Ga0501033_0174351 3300049570 Bacteria 1544
551 Ga0501033_0177533 3300049570 Bacteria 1527
552 Ga0501033_0234726 3300049570 Bacteria 1302
553 Ga0501033_0255252 3300049570 Bacteria 1242
554 Ga0501033_0283966 3300049570 Bacteria 1168
555 Ga0501034_0002826 3300049571 Bacteria 20262
556 Ga0501034_0010995 3300049571 Bacteria 9395
557 Ga0501034_0017477 3300049571 Bacteria 7356
558 Ga0501034_0018380 3300049571 Bacteria 7168
559 Ga0501034_0162210 3300049571 Bacteria 2206
560 Ga0501034_0347175 3300049571 Bacteria 1413
561 Ga0501036_0004236 3300049572 Bacteria 11565
562 Ga0501036_0006275 3300049572 Bacteria 9645
563 Ga0501036_0047032 3300049572 Bacteria 3654
564 Ga0501036_0074551 3300049572 Bacteria 2870
565 Ga0501036_0091452 3300049572 Bacteria 2570
566 Ga0501036_0189742 3300049572 Bacteria 1729
567 Ga0501036_0307482 3300049572 Bacteria 1326
568 Ga0501036_0512934 3300049572 Bacteria 997
569 Ga0501037_0015119 3300049573 Bacteria 5677
570 Ga0501037_0071090 3300049573 Bacteria 2532
571 Ga0501037_0162118 3300049573 Bacteria 1594
572 Ga0501037_0178772 3300049573 Bacteria 1506
573 Ga0501037_0346142 3300049573 Bacteria 1026
574 Ga0501038_0001739 3300049574 Bacteria 20245
575 Ga0501038_0011247 3300049574 Bacteria 8171
576 Ga0501038_0175850 3300049574 Bacteria 1730
577 Ga0501038_0575633 3300049574 Bacteria 854
578 Ga0501038_0717773 3300049574 Bacteria 748
579 Ga0501039_0011086 3300049575 Bacteria 6869
580 Ga0501039_0023504 3300049575 Bacteria 4730
581 Ga0501039_0027252 3300049575 Bacteria 4393
582 Ga0501039_0068600 3300049575 Bacteria 2753
583 Ga0501039_0117397 3300049575 Bacteria 2084
584 Ga0501039_0177882 3300049575 Bacteria 1673
585 Ga0501039_0231428 3300049575 Bacteria 1453
586 Ga0501039_0357345 3300049575 Bacteria 1148
587 Ga0501040_0007132 3300049576 Bacteria 7234
588 Ga0501040_0032226 3300049576 Bacteria 3546
589 Ga0501040_0091609 3300049576 Bacteria 2113
590 Ga0501040_0222759 3300049576 Bacteria 1342
591 Ga0501040_0237959 3300049576 Bacteria 1297
592 Ga0501040_0325843 3300049576 Bacteria 1099
593 Ga0501041_0002311 3300049577 Bacteria 10781
594 Ga0501041_0007641 3300049577 Bacteria 6349
595 Ga0501041_0022712 3300049577 Bacteria 3758
596 Ga0501041_0213846 3300049577 Bacteria 1209
597 Ga0501042_0001922 3300049578 Bacteria 12499
598 Ga0501042_0012839 3300049578 Bacteria 5689
599 Ga0501042_0061797 3300049578 Bacteria 2675
600 Ga0501042_0117721 3300049578 Bacteria 1913
601 Ga0501042_0192133 3300049578 Bacteria 1472
602 Ga0501042_0241322 3300049578 Bacteria 1304
603 Ga0501043_0012512 3300049579 Bacteria 6638
604 Ga0501043_0020940 3300049579 Bacteria 5128
605 Ga0501043_0311143 3300049579 Bacteria 1202
606 Ga0501046_0000096 3300049580 Bacteria 94786
607 Ga0501046_0006158 3300049580 Bacteria 10655
608 Ga0501046_0020341 3300049580 Bacteria 5492
609 Ga0501046_0027745 3300049580 Bacteria 4616
610 Ga0501046_0193891 3300049580 Bacteria 1514
611 Ga0501047_0012721 3300049581 Bacteria 7972
612 Ga0501047_0119600 3300049581 Bacteria 2516
613 Ga0501047_0260656 3300049581 Bacteria 1581
614 Ga0501047_0396550 3300049581 Bacteria 1213
615 Ga0501048_0000591 3300049582 Bacteria 25746
616 Ga0501048_0009408 3300049582 Bacteria 7338
617 Ga0501048_0025144 3300049582 Bacteria 4340
618 Ga0501048_0044595 3300049582 Bacteria 3170
619 Ga0501048_0051557 3300049582 Bacteria 2929
620 Ga0501048_0054450 3300049582 Bacteria 2842
621 Ga0501048_0256089 3300049582 Bacteria 1243
622 Ga0501048_0322698 3300049582 Bacteria 1100
623 Ga0501048_0342906 3300049582 Bacteria 1065
624 Ga0501067_0000467 3300049583 Bacteria 22014
625 Ga0501067_0000635 3300049583 Bacteria 18888
626 Ga0501067_0001844 3300049583 Bacteria 11652
627 Ga0501067_0020959 3300049583 Bacteria 3616
628 Ga0501067_0048669 3300049583 Bacteria 2351
629 Ga0501067_0166326 3300049583 Bacteria 1228
630 Ga0501068_0008475 3300049584 Bacteria 5722
631 Ga0501068_0013807 3300049584 Bacteria 4602
632 Ga0501068_0034016 3300049584 Bacteria 3038
633 Ga0501068_0093160 3300049584 Bacteria 1861
634 Ga0501068_0157535 3300049584 Bacteria 1430
635 Ga0501068_0165321 3300049584 Bacteria 1395
636 Ga0501068_0334043 3300049584 Bacteria 973
637 Ga0501069_0008443 3300049585 Bacteria 5414
638 Ga0501069_0070389 3300049585 Bacteria 1959
639 Ga0501069_0071956 3300049585 Bacteria 1938
640 Ga0501069_0073211 3300049585 Bacteria 1921
641 Ga0501069_0092537 3300049585 Bacteria 1710
642 Ga0501069_0153062 3300049585 Bacteria 1326
643 Ga0501070_0007120 3300049586 Bacteria 9498
644 Ga0501070_0007425 3300049586 Bacteria 9308
645 Ga0501070_0031638 3300049586 Bacteria 4433
646 Ga0501070_0191795 3300049586 Bacteria 1679
647 Ga0501070_0210785 3300049586 Bacteria 1595
648 Ga0501070_0270305 3300049586 Bacteria 1388
649 Ga0501070_0309544 3300049586 Bacteria 1286
650 Ga0501070_0325438 3300049586 Bacteria 1250
651 Ga0501070_0440212 3300049586 Bacteria 1051
652 Ga0501070_0702164 3300049586 Bacteria 800
653 Ga0501070_0739842 3300049586 Bacteria 775
654 Ga0501071_0001348 3300049587 Bacteria 14040
655 Ga0501071_0019030 3300049587 Bacteria 4764
656 Ga0501071_0023374 3300049587 Bacteria 4316
657 Ga0501071_0065517 3300049587 Bacteria 2638
658 Ga0501072_0008548 3300049588 Bacteria 7765
659 Ga0501072_0016021 3300049588 Bacteria 5748
660 Ga0501072_0042271 3300049588 Bacteria 3580
661 Ga0501072_0104117 3300049588 Bacteria 2256
662 Ga0501072_0199145 3300049588 Bacteria 1597
663 Ga0501072_0259156 3300049588 Bacteria 1384
664 Ga0501073_0003593 3300049589 Bacteria 11658
665 Ga0501073_0005531 3300049589 Bacteria 9460
666 Ga0501073_0036606 3300049589 Bacteria 3487
667 Ga0501073_0042192 3300049589 Bacteria 3221
668 Ga0501073_0065475 3300049589 Bacteria 2534
669 Ga0501073_0233624 3300049589 Bacteria 1270
670 Ga0501073_0306733 3300049589 Bacteria 1095
671 Ga0501074_0008029 3300049590 Bacteria 7643
672 Ga0501074_0008366 3300049590 Bacteria 7499
673 Ga0501074_0035609 3300049590 Bacteria 3607
674 Ga0501074_0061952 3300049590 Bacteria 2695
675 Ga0501074_0173826 3300049590 Bacteria 1537
676 Ga0501075_0017803 3300049591 Bacteria 5132
677 Ga0501075_0028653 3300049591 Bacteria 4111
678 Ga0501075_0028693 3300049591 Bacteria 4109
679 Ga0501075_0031091 3300049591 Bacteria 3961
680 Ga0501075_0063576 3300049591 Bacteria 2782
681 Ga0501075_0435594 3300049591 Bacteria 1000
682 Ga0501076_0008225 3300049592 Bacteria 7643
683 Ga0501076_0029935 3300049592 Bacteria 4238
684 Ga0501076_0070561 3300049592 Bacteria 2794
685 Ga0501076_0142611 3300049592 Bacteria 1947
686 Ga0501076_0177967 3300049592 Bacteria 1734
687 Ga0501076_0909600 3300049592 Bacteria 725
688 Ga0501077_0022882 3300049593 Bacteria 3961
689 Ga0501077_0054923 3300049593 Bacteria 2529
690 Ga0501077_0374909 3300049593 Bacteria 909
691 Ga0501217_029157 3300049661 Bacteria 1348
692 Ga0501079_0014031 3300049741 Bacteria 6110
693 Ga0501079_0018882 3300049741 Bacteria 5269
694 Ga0501079_0024470 3300049741 Bacteria 4634
695 Ga0501079_0398012 3300049741 Bacteria 1080
696 Ga0501079_0460646 3300049741 Bacteria 999
697 Ga0501080_0006193 3300049742 Bacteria 10736
698 Ga0501080_0012953 3300049742 Bacteria 7656
699 Ga0501080_0048383 3300049742 Bacteria 3958
700 Ga0501080_0368636 3300049742 Bacteria 1295
701 Ga0501081_0028781 3300049743 Bacteria 3751
702 Ga0501083_0005804 3300049744 Bacteria 8744
703 Ga0501083_0011647 3300049744 Bacteria 6170
704 Ga0501035_0007454 3300049822 Bacteria 10219
705 Ga0501035_0026628 3300049822 Bacteria 5289
706 Ga0501035_0030525 3300049822 Bacteria 4911
707 Ga0501035_0033762 3300049822 Bacteria 4651
708 Ga0501035_0065706 3300049822 Bacteria 3220
709 Ga0501035_0236883 3300049822 Bacteria 1554
710 Ga0501035_0335536 3300049822 Bacteria 1268
711 Ga0501044_0003408 3300049823 Bacteria 17911
712 Ga0501044_0009916 3300049823 Bacteria 10347
713 Ga0501044_0020374 3300049823 Bacteria 7081
714 Ga0501044_0095184 3300049823 Bacteria 3001
715 Ga0501045_0039614 3300049824 Bacteria 3429
716 Ga0501045_0067271 3300049824 Bacteria 2631
717 Ga0501045_0071329 3300049824 Bacteria 2557
718 Ga0501045_0539498 3300049824 Bacteria 865
719 nmdc:mga03683_18229_c1 3300050489 Bacteria 2665
720 nmdc:mga03n38_12047_c1 3300050490 Bacteria 3243
721 nmdc:mga03n38_151110_c1 3300050490 Bacteria 1169
722 nmdc:mga03n38_162485_c1 3300050490 Bacteria 1132
723 nmdc:mga03n38_22661_c1 3300050490 Bacteria 2545
724 nmdc:mga03n38_38789_c1 3300050490 Bacteria 1181
725 nmdc:mga00v17_106606_c1 3300050491 Bacteria 1774
726 nmdc:mga00v17_143102_c1 3300050491 Bacteria 1534
727 nmdc:mga00v17_15226_c1 3300050491 Bacteria 2401
728 nmdc:mga00v17_20082_c1 3300050491 Bacteria 3823
729 nmdc:mga00v17_26516_c1 3300050491 Bacteria 3378
730 nmdc:mga00v17_27714_c1 3300050491 Bacteria 3310
731 nmdc:mga00v17_33657_c1 3300050491 Bacteria 3038
732 nmdc:mga00v17_35845_c1 3300050491 Bacteria 2955
733 nmdc:mga00v17_70321_c1 3300050491 Bacteria 2167
734 nmdc:mga00v17_70654_c1 3300050491 Bacteria 2163
735 nmdc:mga0yw44_124588_c1 3300050492 Bacteria 1663
736 nmdc:mga0yw44_18056_c1 3300050492 Bacteria 3856
737 nmdc:mga0yw44_232109_c1 3300050492 Bacteria 1225
738 nmdc:mga0yw44_28961_c1 3300050492 Bacteria 3192
739 nmdc:mga0yw44_3248_c1 3300050492 Bacteria 7164
740 nmdc:mga0yw44_33152_c1 3300050492 Bacteria 3015
741 nmdc:mga0yw44_49722_c1 3300050492 Bacteria 2532
742 nmdc:mga0yw44_50192_c1 3300050492 Bacteria 2522
743 nmdc:mga0yw44_560688_c1 3300050492 Bacteria 776
744 nmdc:mga0yw44_654529_c1 3300050492 Bacteria 714
745 nmdc:mga0yw44_75127_c1 3300050492 Bacteria 2107
746 nmdc:mga0yw44_76702_c1 3300050492 Bacteria 2087
747 nmdc:mga0yw44_77816_c1 3300050492 Bacteria 2073
748 nmdc:mga0yw44_81310_c1 3300050492 Bacteria 2031
749 nmdc:mga0yw44_96255_c1 3300050492 Bacteria 1879
750 nmdc:mga06z11_21369_c1 3300050494 Bacteria 3006
751 nmdc:mga06z11_3468_c1 3300050494 Bacteria 6107
752 nmdc:mga06z11_60211_c1 3300050494 Bacteria 1976
753 nmdc:mga04h51_14894_c1 3300050495 Bacteria 2231
754 nmdc:mga07m45_11677_c1 3300050496 Bacteria 4620
755 nmdc:mga07m45_166100_c1 3300050496 Bacteria 1282
756 nmdc:mga07m45_220124_c1 3300050496 Bacteria 1104
757 nmdc:mga07m45_225650_c1 3300050496 Bacteria 1090
758 nmdc:mga07m45_38437_c1 3300050496 Bacteria 2671
759 nmdc:mga07m45_40799_c1 3300050496 Bacteria 2598
760 nmdc:mga07m45_80298_c1 3300050496 Bacteria 1862
761 nmdc:mga05p37_18823_c1 3300050507 Bacteria 8346
762 nmdc:mga09592_10592_c1 3300050508 Bacteria 7506
763 nmdc:mga06r32_77109_c1 3300050510 Bacteria 3237
764 nmdc:mga08y16_124677_c1 3300050511 Bacteria 2680
765 nmdc:mga08y16_321950_c1 3300050511 Bacteria 1592
766 nmdc:mga08y16_562434_c1 3300050511 Bacteria 1153
767 nmdc:mga08y16_67489_c1 3300050511 Bacteria 3731
768 nmdc:mga0n895_429297_c1 3300050512 Bacteria 1335
769 nmdc:mga0n895_7655_c1 3300050512 Bacteria 9287
770 nmdc:mga0rr50_10723_c1 3300050513 Bacteria 5836
771 nmdc:mga08x19_5831_c1 3300050514 Bacteria 7287
772 nmdc:mga0a205_1500_c1 3300050515 Bacteria 19905
773 nmdc:mga0a205_5044_c1 3300050515 Bacteria 11885
774 nmdc:mga0sz30_88205_c1 3300050516 Bacteria 1347
775 Ga0495612_0120751 3300053078 Bacteria 1127
776 Ga0495595_0030187 3300053084 Bacteria 2430
777 Ga0495619_0014336 3300053085 Bacteria 5007
778 Ga0495619_0138301 3300053085 Bacteria 1676
779 Ga0495619_0315744 3300053085 Bacteria 1082
780 Ga0495619_0726221 3300053085 Bacteria 675
781 Ga0500644_0000014 3300053088 Bacteria 109650
782 Ga0500644_0058548 3300053088 Bacteria 1348
783 Ga0500554_096859 3300053102 Bacteria 984
784 Ga0500556_0000823 3300053104 Bacteria 17936
785 Ga0500593_000350 3300053117 Bacteria 18674
786 Ga0500573_0003978 3300053140 Bacteria 7717
787 Ga0501084_0017359 3300054114 Bacteria 5981
788 Ga0501084_0020608 3300054114 Bacteria 5498
789 Ga0501084_0024338 3300054114 Bacteria 5050
790 Ga0501084_0052333 3300054114 Bacteria 3417
791 Ga0501084_0196552 3300054114 Bacteria 1702
792 Ga0501082_0013575 3300060353 Bacteria 6998
793 Ga0501082_0023824 3300060353 Bacteria 5278
794 Ga0501082_0062974 3300060353 Bacteria 3193
795 Ga0501082_0081381 3300060353 Bacteria 2794
796 Ga0501082_0104205 3300060353 Bacteria 2454
797 Ga0501082_0247997 3300060353 Bacteria 1550
798 Ga0501082_0477794 3300060353 Bacteria 1089
799 Ga0466962_0018047 3300061719 Bacteria 3394
800 Ga0466962_0041149 3300061719 Bacteria 2211
801 Ga0466962_0177453 3300061719 Bacteria 1038
802 Ga0530510_0005855 3300061734 Bacteria 8516
803 Ga0530510_0087929 3300061734 Bacteria 2264
804 Ga0530510_0204008 3300061734 Bacteria 1469
805 Ga0530510_0315596 3300061734 Bacteria 1171
806 2655032952 2654587600 Bacteria 3911798
807 2555231288 2554235227 Bacteria 3637389
808 2643825710 2643221561 Bacteria 4984412
809 2643888869 2643221576 Bacteria 5214352
810 2643957924 2643221590 Bacteria 5214697
811 2644034432 2643221604 Bacteria 5014917
812 2644089434 2643221615 Bacteria 5487866
813 2644098518 2643221617 Bacteria 5139111
814 2644114624 2643221620 Bacteria 5134593
815 2644230304 2643221641 Bacteria 4490190
816 2644319279 2643221657 Bacteria 5490246
817 2644531702 2643221696 Bacteria 5431823
818 2676490724 2675903060 Bacteria 10051191
819 2729905384 2728369276 Bacteria 5610032
820 2731906827 2731639228 Bacteria 4187555
821 2738869789 2738541305 Bacteria 4910150
822 2740169025 2739367898 Bacteria 4367674
823 2774392413 2773857762 Bacteria 5971770
824 2799186167 2799112218 Bacteria 4315149
825 2809196207 2808606439 Bacteria 5952208
826 2812332492 2811994874 Bacteria 5367947
827 2812351639 2811994878 Bacteria 5992952
828 2835190694 2835188231 Bacteria 3476928
829 2855387929 2855386786 Bacteria 4752232
830 2857484305 2857481737 Bacteria 4761446
831 2868088677 2868088558 Bacteria 7609351
832 2873318681 2873314349 Bacteria 8512634
833 2883824400 2883821847 Bacteria 5121194
834 2884701409 2884693830 Bacteria 11273186
835 2887446427 2887443736 Bacteria 4426037
836 2891970749 2891968417 Bacteria 5821697
837 2895437154 2895427314 Bacteria 13147766
838 2895442701 2895442618 Bacteria 11027144
839 2990259151 2990256926 Bacteria 4252839
840 8054611145 8054609563 Bacteria 5170090
841 8055067858 8055066027 Bacteria 9479577
842 LJQas_1013543
843 JGI24737J22298_10031888
844 JGI24735J21928_10021270
845 JGI24738J21930_10010987
846 JGI24744J21845_10014346
847 JGI25406J46586_10008760
848 Ga0070658_10017644
849 Ga0070658_10106845
850 Ga0070658_10130750
851 Ga0070658_10458431
852 Ga0070683_100006425
853 Ga0070683_100012951
854 Ga0070683_100034907
855 Ga0070683_100456769
856 Ga0070683_100556617
857 Ga0070670_100284331
858 Ga0068869_100484054
859 Ga0070680_100230594
860 Ga0070682_100049931
861 Ga0068868_100318026
862 Ga0068868_100702414
863 Ga0070660_100005631
864 Ga0070660_100058091
865 Ga0070689_100157581
866 Ga0070687_100125141
867 Ga0070687_100259865
868 Ga0070661_100284676
869 Ga0070692_10034534
870 Ga0070692_10105430
871 Ga0070674_100031447
872 Ga0070674_100195791
873 Ga0070659_100094418
874 Ga0070659_100100986
875 Ga0070659_100240162
876 Ga0070659_100357616
877 Ga0070667_100179654
878 Ga0070667_100306838
879 Ga0070667_100393788
880 Ga0070714_100005919
881 Ga0070701_10022152
882 Ga0070700_100011370
883 Ga0070663_100210051
884 Ga0070663_100468746
885 Ga0070678_100476500
886 Ga0070662_100096422
887 Ga0070681_10140809
888 Ga0068867_100005704
889 Ga0070685_10019113
890 Ga0070685_10314765
891 Ga0070698_100010433
892 Ga0070679_100013115
893 Ga0070684_100001548
894 Ga0070684_100043329
895 Ga0070684_100125804
896 Ga0070684_100177633
897 Ga0068853_100176994
898 Ga0070686_100057301
899 Ga0070693_100309568
900 Ga0070665_100000273
901 Ga0068857_100007521
902 Ga0068854_100037408
903 Ga0068856_100345413
904 Ga0070702_100013929
905 Ga0070702_100029299
906 Ga0068852_100174023
907 Ga0068852_100269585
908 Ga0068864_100249464
909 Ga0068861_100023002
910 Ga0068861_100034022
911 Ga0068861_100049711
912 Ga0068870_10018021
913 Ga0068870_10123970
914 Ga0068870_10150368
915 Ga0068863_100536232
916 Ga0068858_100278736
917 Ga0068860_100065106
918 Ga0068860_100265151
919 Ga0081455_10196210
920 Ga0081538_10000345
921 Ga0081539_10000100
922 Ga0081539_10063799
923 Ga0075365_10005467
924 Ga0075365_10005743
925 Ga0075365_10009542
926 Ga0075365_10010982
927 Ga0075365_10022491
928 Ga0075365_10093791
929 Ga0075365_10182924
930 Ga0075365_10189453
931 Ga0075368_10001063
932 Ga0075368_10100096
933 Ga0075363_100005645
934 Ga0075363_100007534
935 Ga0075363_100058916
936 Ga0075363_100118410
937 Ga0075363_100142626
938 Ga0075364_10011060
939 Ga0075364_10018999
940 Ga0075364_10036981
941 Ga0075364_10166847
942 Ga0075364_10185948
943 Ga0075364_10218322
944 Ga0075432_10001088
945 Ga0075362_10014596
946 Ga0075367_10019483
947 Ga0075367_10092565
948 Ga0075367_10176795
949 Ga0075367_10193546
950 Ga0075370_10009077
951 Ga0075370_10025679
952 Ga0075370_10045056
953 Ga0075370_10159238
954 Ga0068871_100063940
955 Ga0075428_100000711
956 Ga0075430_100306642
957 Ga0075431_100015231
958 Ga0075433_10000003
959 Ga0075433_10040606
960 Ga0075433_10508422
961 Ga0075434_100000691
962 Ga0075434_100004021
963 Ga0075434_100624775
964 Ga0068865_100001572
965 Ga0068865_100182514
966 Ga0068865_100379122
967 Ga0075436_100005603
968 Ga0075435_100000613
969 Ga0111539_10002214
970 Ga0111539_10433985
971 Ga0111539_10713639
972 Ga0105245_10009217
973 Ga0105245_10013771
974 Ga0105245_10092996
975 Ga0114129_10008508
976 Ga0105243_10002326
977 Ga0105243_10011520
978 Ga0105243_10087827
979 Ga0105241_10881577
980 Ga0105242_10219209
981 Ga0105242_10225564
982 Ga0105242_11006109
983 Ga0105238_10193140
984 Ga0105238_10313807
985 Ga0105238_10428651
986 Ga0105249_10021521
987 Ga0105249_10045414
988 Ga0105249_10137154
989 Ga0105249_10298672
990 Ga0105239_10028212
991 Ga0105239_10031714
992 Ga0105239_10215189
993 Ga0105239_10360076
994 Ga0105239_10913817
995 Ga0105246_10015844
996 Ga0105246_10083483
997 Ga0157371_10211653
998 Ga0157374_10227059
999 Ga0157374_10295640
1000 Ga0163162_10011475
1001 Ga0163162_10059520
1002 Ga0157372_10020744
1003 Ga0157372_10071811
1004 Ga0157372_10121575
1005 Ga0157372_10123225
1006 Ga0157372_10430929
1007 Ga0157372_10670766
1008 Ga0157372_10853949
1009 Ga0157375_10226911
1010 Ga0163163_10033657
1011 Ga0163163_10388968
1012 Ga0163163_10718711
1013 Ga0157380_10258297
1014 Ga0157380_11165307
1015 Ga0182008_10070187
1016 Ga0182008_10207747
1017 Ga0157377_10018533
1018 Ga0157377_10033024
1019 Ga0157377_10236322
1020 Ga0157376_10253822
1021 Ga0163161_10056093
1022 Ga0163161_10087778
1023 Ga0163161_10156904
1024 Ga0206354_11393013
1025 Ga0206353_10338087
1026 Ga0207688_10002361
1027 Ga0207647_10037133
1028 Ga0207647_10057879
1029 Ga0207643_10029653
1030 Ga0207643_10146431
1031 Ga0207705_10056354
1032 Ga0207705_10582033
1033 Ga0207707_10213884
1034 Ga0207662_10076664
1035 Ga0207662_10107752
1036 Ga0207662_10262614
1037 Ga0207657_10007877
1038 Ga0207657_10042395
1039 Ga0207657_10066891
1040 Ga0207657_10274400
1041 Ga0207657_10314293
1042 Ga0207649_10083483
1043 Ga0207649_10279714
1044 Ga0207652_10011906
1045 Ga0207652_10361583
1046 Ga0207694_10120838
1047 Ga0207694_10155686
1048 Ga0207694_10307257
1049 Ga0207694_10336496
1050 Ga0207650_10259765
1051 Ga0207687_10019789
1052 Ga0207687_10033704
1053 Ga0207687_10057227
1054 Ga0207664_10034416
1055 Ga0207690_10020456
1056 Ga0207690_10042983
1057 Ga0207690_10100762
1058 Ga0207690_10203868
1059 Ga0207690_10356517
1060 Ga0207706_10066885
1061 Ga0207706_10423907
1062 Ga0207706_10503066
1063 Ga0207686_10116442
1064 Ga0207709_10016385
1065 Ga0207709_10077877
1066 Ga0207709_10081972
1067 Ga0207709_10154869
1068 Ga0207670_10071774
1069 Ga0207669_10350113
1070 Ga0207704_10148796
1071 Ga0207691_10008577
1072 Ga0207711_10057232
1073 Ga0207661_10002795
1074 Ga0207661_10054840
1075 Ga0207661_10063997
1076 Ga0207661_10093802
1077 Ga0207679_10108780
1078 Ga0207679_10439546
1079 Ga0207667_10428034
1080 Ga0207651_10132299
1081 Ga0207712_10008397
1082 Ga0207712_10039994
1083 Ga0207712_10431623
1084 Ga0207640_10567822
1085 Ga0207658_10067683
1086 Ga0207658_10293508
1087 Ga0207658_10317574
1088 Ga0207677_10156792
1089 Ga0207677_10632629
1090 Ga0207703_10135901
1091 Ga0207639_10425920
1092 Ga0207678_10447634
1093 Ga0207678_10637965
1094 Ga0207708_10000227
1095 Ga0207708_10095127
1096 Ga0207702_10179874
1097 Ga0207702_10192019
1098 Ga0207648_10009320
1099 Ga0207676_10289017
1100 Ga0207674_10014132
1101 Ga0207674_10225674
1102 Ga0207675_100003582
1103 Ga0207675_100044326
1104 Ga0207675_100049974
1105 Ga0207698_10041089
1106 Ga0207698_10684836
1107 Ga0209813_10013346
1108 Ga0207428_10005512
1109 Ga0207428_10009590
1110 Ga0207428_10165376
1111 Ga0268266_10000955
1112 Ga0268264_10040659
1113 Ga0307515_10389081
1114 Ga0307408_100007018
1115 Ga0307408_100017340
1116 Ga0307408_100705775
1117 Ga0307405_10001273
1118 Ga0307405_10238370
1119 Ga0307405_10254752
1120 Ga0307405_10268350
1121 Ga0307405_10278956
1122 Ga0307405_10314921
1123 Ga0307413_10005028
1124 Ga0307413_10005736
1125 Ga0307413_10177644
1126 Ga0307413_10248434
1127 Ga0307410_10020799
1128 Ga0307410_10028034
1129 Ga0307410_10147347
1130 Ga0307410_10407580
1131 Ga0307406_10000718
1132 Ga0307406_10264998
1133 Ga0307406_10495283
1134 Ga0307407_10000498
1135 Ga0307407_10000918
1136 Ga0307407_10003870
1137 Ga0307407_10012563
1138 Ga0307407_10097181
1139 Ga0307412_10004095
1140 Ga0307412_10158025
1141 Ga0307412_10299403
1142 Ga0307409_100000040
1143 Ga0307409_100013869
1144 Ga0307409_100021185
1145 Ga0307409_100027937
1146 Ga0307409_100111134
1147 Ga0307409_100212957
1148 Ga0307409_100310356
1149 Ga0307409_100382606
1150 Ga0307409_100416703
1151 Ga0307409_100530006
1152 Ga0307416_100000078
1153 Ga0307416_100010435
1154 Ga0307416_100013428
1155 Ga0307416_100021323
1156 Ga0307416_100038900
1157 Ga0307416_100217524
1158 Ga0307416_100467442
1159 Ga0307414_10001176
1160 Ga0307411_10001351
1161 Ga0307411_10026771
1162 Ga0307411_10112261
1163 Ga0307415_100003733
1164 Ga0307415_100004209
1165 Ga0307415_100008957
1166 Ga0307415_100161253
1167 Ga0373943_0313005
1168 Ga0316574_0025873
1169 Ga0316584_0197222
1170 Ga0395899_0034657
1171 Ga0395900_0025057
1172 Ga0395900_0039734
1173 Ga0395900_0089433
1174 Ga0395900_0546490
1175 Ga0395900_0809054
1176 Ga0395898_0857162
1177 Ga0395905_0021436
1178 Ga0395905_0150583
1179 Ga0395901_0048488
1180 Ga0395901_0054129
1181 Ga0395901_0092027
1182 Ga0395901_0408649
1183 Ga0436365_0285662
1184 Ga0436365_1327458
1185 Ga0439436_0091583
1186 Ga0439466_0058193
1187 Ga0451791_0009612
1188 Ga0451791_0369297
1189 Ga0451791_1756400
1190 Ga0451791_1818518
1191 Ga0451793_0911478
1192 Ga0451800_1314210
1193 Ga0451802_2065268
1194 Ga0451833_0367630
1195 Ga0451837_0226644
1196 Ga0451837_1470429
1197 Ga0451843_0133041
1198 Ga0451855_0955642
1199 Ga0451853_1034644
1200 Ga0451853_1305535
1201 Ga0439431_0005966
1202 Ga0439445_0015896
1203 Ga0439432_054451
1204 Ga0439463_004986
1205 Ga0439434_0000739
1206 Ga0439444_0007830
1207 Ga0439464_0013977
1208 Ga0439464_0014395
1209 Ga0439464_0035743
1210 Ga0466972_0007342
1211 Ga0466972_0026224
1212 Ga0466972_0055285
1213 Ga0466972_0098728
1214 Ga0466972_0098833
1215 Ga0466965_0010769
1216 Ga0466965_0023418
1217 Ga0466965_0043192
1218 Ga0466965_0046182
1219 Ga0466965_0048327
1220 Ga0466965_0262627
1221 Ga0466966_0011350
1222 Ga0466966_0122067
1223 Ga0466966_0164275
1224 Ga0466966_0200434
1225 Ga0466966_0380089
1226 Ga0466961_0018176
1227 Ga0466961_0028917
1228 Ga0466961_0032177
1229 Ga0466961_0060957
1230 Ga0466961_0168354
1231 Ga0466961_0177779
1232 Ga0466963_0014628
1233 Ga0466963_0016921
1234 Ga0466963_0037052
1235 Ga0466963_0043988
1236 Ga0466963_0192141
1237 Ga0466963_0244265
1238 Ga0466964_0086907
1239 Ga0466964_0416134
1240 Ga0466971_0016821
1241 Ga0466971_0020670
1242 Ga0466971_0058425
1243 Ga0466968_0129080
1244 Ga0466970_0002084
1245 Ga0466970_0011794
1246 Ga0466970_0034042
1247 Ga0466970_0034873
1248 Ga0466970_0078572
1249 Ga0466970_0132251
1250 Ga0466970_0208805
1251 Ga0466970_0248269
1252 Ga0466970_0272311
1253 Ga0466957_0022534
1254 Ga0466957_0090234
1255 Ga0466957_0092835
1256 Ga0466960_0002006
1257 Ga0466960_0002484
1258 Ga0466960_0005554
1259 Ga0466960_0009952
1260 Ga0466960_0021784
1261 Ga0466960_0052190
1262 Ga0466960_0066247
1263 Ga0466960_0104548
1264 Ga0466960_0117719
1265 Ga0466960_0127870
1266 Ga0466959_0018348
1267 Ga0451576_0133190
1268 Ga0466958_0156983
1269 Ga0466958_0203548
1270 Ga0466967_0011038
1271 Ga0466967_0029025
1272 Ga0466967_0029842
1273 Ga0466967_0041937
1274 Ga0466967_0058675
1275 Ga0466967_0063324
1276 Ga0466967_0111974
1277 Ga0466967_0144076
1278 Ga0466967_0145722
1279 Ga0466967_0302566
1280 Ga0466967_0334770
1281 Ga0466967_0350248
1282 Ga0495603_0162080
1283 Ga0495629_0299632
1284 Ga0495641_0051748
1285 Ga0495641_0190898
1286 Ga0495582_0087457
1287 Ga0495664_0091417
1288 Ga0495608_0197757
1289 Ga0495652_0482208
1290 Ga0495667_0315792
1291 Ga0495657_0157805
1292 Ga0495657_0315194
1293 Ga0495658_0071700
1294 Ga0495658_0136261
1295 Ga0495674_0199790
1296 Ga0495674_0527723
1297 Ga0495676_0322695
1298 Ga0496100_0035587
1299 Ga0496100_0234588
1300 Ga0496100_0875077
1301 Ga0496101_0032649
1302 Ga0496101_0086864
1303 Ga0496101_0239962
1304 Ga0496101_0374546
1305 Ga0496101_0566205
1306 Ga0496102_0002619
1307 Ga0496102_0007593
1308 Ga0496102_0034286
1309 Ga0496102_0305785
1310 Ga0496103_0002260
1311 Ga0496103_0232391
1312 Ga0496104_0004379
1313 Ga0496104_0164407
1314 Ga0496104_0532272
1315 Ga0496104_0559404
1316 Ga0496105_0104786
1317 Ga0496106_0029064
1318 Ga0496106_0030279
1319 Ga0496106_0075344
1320 Ga0496106_0623091
1321 Ga0496107_0008332
1322 Ga0496107_0057104
1323 Ga0496107_0068602
1324 Ga0496107_0094759
1325 Ga0496107_0234002
1326 Ga0496107_0267210
1327 Ga0496108_0020552
1328 Ga0496108_0055902
1329 Ga0496108_0113095
1330 Ga0496108_0116444
1331 Ga0496108_0155942
1332 Ga0496108_0240918
1333 Ga0496109_0036870
1334 Ga0496109_0037023
1335 Ga0496109_0054681
1336 Ga0496109_0089994
1337 Ga0496109_0179837
1338 Ga0496109_0439856
1339 Ga0496109_0457219
1340 Ga0496109_0459442
1341 Ga0496109_0491495
1342 Ga0496109_0810543
1343 Ga0496109_1194191
1344 Ga0496110_0003350
1345 Ga0496110_0007800
1346 Ga0496110_0013242
1347 Ga0496110_0060049
1348 Ga0496110_0344684
1349 Ga0496110_0433466
1350 Ga0496111_0000864
1351 Ga0496111_0046043
1352 Ga0496111_0152557
1353 Ga0496111_0178310
1354 Ga0496112_0075788
1355 Ga0496112_0187291
1356 Ga0496112_0611960
1357 Ga0496113_0021530
1358 Ga0496113_0058344
1359 Ga0496113_0134353
1360 Ga0496113_0137010
1361 Ga0496114_0006364
1362 Ga0496114_0030149
1363 Ga0496114_0042109
1364 Ga0496114_0060357
1365 Ga0496114_0112198
1366 Ga0496114_0126419
1367 Ga0496114_0130219
1368 Ga0496114_0143814
1369 Ga0496114_0145333
1370 Ga0496114_0178589
1371 Ga0496114_0199434
1372 Ga0496114_0222314
1373 Ga0496114_0338534
1374 Ga0496114_0723722
1375 Ga0496115_0027879
1376 Ga0496115_0190320
1377 Ga0496115_0245663
1378 Ga0496125_0000025
1379 Ga0496125_0007435
1380 Ga0501031_0021538
1381 Ga0501031_0031482
1382 Ga0501031_0034438
1383 Ga0501031_0078740
1384 Ga0501031_0079871
1385 Ga0501031_0159715
1386 Ga0501031_0248540
1387 Ga0501032_0003962
1388 Ga0501032_0100372
1389 Ga0501032_0278190
1390 Ga0501033_0002176
1391 Ga0501033_0174351
1392 Ga0501033_0177533
1393 Ga0501033_0234726
1394 Ga0501033_0255252
1395 Ga0501033_0283966
1396 Ga0501034_0002826
1397 Ga0501034_0010995
1398 Ga0501034_0017477
1399 Ga0501034_0018380
1400 Ga0501034_0162210
1401 Ga0501034_0347175
1402 Ga0501036_0004236
1403 Ga0501036_0006275
1404 Ga0501036_0047032
1405 Ga0501036_0074551
1406 Ga0501036_0091452
1407 Ga0501036_0189742
1408 Ga0501036_0307482
1409 Ga0501036_0512934
1410 Ga0501037_0015119
1411 Ga0501037_0071090
1412 Ga0501037_0162118
1413 Ga0501037_0178772
1414 Ga0501037_0346142
1415 Ga0501038_0001739
1416 Ga0501038_0011247
1417 Ga0501038_0175850
1418 Ga0501038_0575633
1419 Ga0501038_0717773
1420 Ga0501039_0011086
1421 Ga0501039_0023504
1422 Ga0501039_0027252
1423 Ga0501039_0068600
1424 Ga0501039_0117397
1425 Ga0501039_0177882
1426 Ga0501039_0231428
1427 Ga0501039_0357345
1428 Ga0501040_0007132
1429 Ga0501040_0032226
1430 Ga0501040_0091609
1431 Ga0501040_0222759
1432 Ga0501040_0237959
1433 Ga0501040_0325843
1434 Ga0501041_0002311
1435 Ga0501041_0007641
1436 Ga0501041_0022712
1437 Ga0501041_0213846
1438 Ga0501042_0001922
1439 Ga0501042_0012839
1440 Ga0501042_0061797
1441 Ga0501042_0117721
1442 Ga0501042_0192133
1443 Ga0501042_0241322
1444 Ga0501043_0012512
1445 Ga0501043_0020940
1446 Ga0501043_0311143
1447 Ga0501046_0000096
1448 Ga0501046_0006158
1449 Ga0501046_0020341
1450 Ga0501046_0027745
1451 Ga0501046_0193891
1452 Ga0501047_0012721
1453 Ga0501047_0119600
1454 Ga0501047_0260656
1455 Ga0501047_0396550
1456 Ga0501048_0000591
1457 Ga0501048_0009408
1458 Ga0501048_0025144
1459 Ga0501048_0044595
1460 Ga0501048_0051557
1461 Ga0501048_0054450
1462 Ga0501048_0256089
1463 Ga0501048_0322698
1464 Ga0501048_0342906
1465 Ga0501067_0000467
1466 Ga0501067_0000635
1467 Ga0501067_0001844
1468 Ga0501067_0020959
1469 Ga0501067_0048669
1470 Ga0501067_0166326
1471 Ga0501068_0008475
1472 Ga0501068_0013807
1473 Ga0501068_0034016
1474 Ga0501068_0093160
1475 Ga0501068_0157535
1476 Ga0501068_0165321
1477 Ga0501068_0334043
1478 Ga0501069_0008443
1479 Ga0501069_0070389
1480 Ga0501069_0071956
1481 Ga0501069_0073211
1482 Ga0501069_0092537
1483 Ga0501069_0153062
1484 Ga0501070_0007120
1485 Ga0501070_0007425
1486 Ga0501070_0031638
1487 Ga0501070_0191795
1488 Ga0501070_0210785
1489 Ga0501070_0270305
1490 Ga0501070_0309544
1491 Ga0501070_0325438
1492 Ga0501070_0440212
1493 Ga0501070_0702164
1494 Ga0501070_0739842
1495 Ga0501071_0001348
1496 Ga0501071_0019030
1497 Ga0501071_0023374
1498 Ga0501071_0065517
1499 Ga0501072_0008548
1500 Ga0501072_0016021
1501 Ga0501072_0042271
1502 Ga0501072_0104117
1503 Ga0501072_0199145
1504 Ga0501072_0259156
1505 Ga0501073_0003593
1506 Ga0501073_0005531
1507 Ga0501073_0036606
1508 Ga0501073_0042192
1509 Ga0501073_0065475
1510 Ga0501073_0233624
1511 Ga0501073_0306733
1512 Ga0501074_0008029
1513 Ga0501074_0008366
1514 Ga0501074_0035609
1515 Ga0501074_0061952
1516 Ga0501074_0173826
1517 Ga0501075_0017803
1518 Ga0501075_0028653
1519 Ga0501075_0028693
1520 Ga0501075_0031091
1521 Ga0501075_0063576
1522 Ga0501075_0435594
1523 Ga0501076_0008225
1524 Ga0501076_0029935
1525 Ga0501076_0070561
1526 Ga0501076_0142611
1527 Ga0501076_0177967
1528 Ga0501076_0909600
1529 Ga0501077_0022882
1530 Ga0501077_0054923
1531 Ga0501077_0374909
1532 Ga0501217_029157
1533 Ga0501079_0014031
1534 Ga0501079_0018882
1535 Ga0501079_0024470
1536 Ga0501079_0398012
1537 Ga0501079_0460646
1538 Ga0501080_0006193
1539 Ga0501080_0012953
1540 Ga0501080_0048383
1541 Ga0501080_0368636
1542 Ga0501081_0028781
1543 Ga0501083_0005804
1544 Ga0501083_0011647
1545 Ga0501035_0007454
1546 Ga0501035_0026628
1547 Ga0501035_0030525
1548 Ga0501035_0033762
1549 Ga0501035_0065706
1550 Ga0501035_0236883
1551 Ga0501035_0335536
1552 Ga0501044_0003408
1553 Ga0501044_0009916
1554 Ga0501044_0020374
1555 Ga0501044_0095184
1556 Ga0501045_0039614
1557 Ga0501045_0067271
1558 Ga0501045_0071329
1559 Ga0501045_0539498
1560 nmdc:mga03683_18229_c1
1561 nmdc:mga03n38_12047_c1
1562 nmdc:mga03n38_151110_c1
1563 nmdc:mga03n38_162485_c1
1564 nmdc:mga03n38_22661_c1
1565 nmdc:mga03n38_38789_c1
1566 nmdc:mga00v17_106606_c1
1567 nmdc:mga00v17_143102_c1
1568 nmdc:mga00v17_15226_c1
1569 nmdc:mga00v17_20082_c1
1570 nmdc:mga00v17_26516_c1
1571 nmdc:mga00v17_27714_c1
1572 nmdc:mga00v17_33657_c1
1573 nmdc:mga00v17_35845_c1
1574 nmdc:mga00v17_70321_c1
1575 nmdc:mga00v17_70654_c1
1576 nmdc:mga0yw44_124588_c1
1577 nmdc:mga0yw44_18056_c1
1578 nmdc:mga0yw44_232109_c1
1579 nmdc:mga0yw44_28961_c1
1580 nmdc:mga0yw44_3248_c1
1581 nmdc:mga0yw44_33152_c1
1582 nmdc:mga0yw44_49722_c1
1583 nmdc:mga0yw44_50192_c1
1584 nmdc:mga0yw44_560688_c1
1585 nmdc:mga0yw44_654529_c1
1586 nmdc:mga0yw44_75127_c1
1587 nmdc:mga0yw44_76702_c1
1588 nmdc:mga0yw44_77816_c1
1589 nmdc:mga0yw44_81310_c1
1590 nmdc:mga0yw44_96255_c1
1591 nmdc:mga06z11_21369_c1
1592 nmdc:mga06z11_3468_c1
1593 nmdc:mga06z11_60211_c1
1594 nmdc:mga04h51_14894_c1
1595 nmdc:mga07m45_11677_c1
1596 nmdc:mga07m45_166100_c1
1597 nmdc:mga07m45_220124_c1
1598 nmdc:mga07m45_225650_c1
1599 nmdc:mga07m45_38437_c1
1600 nmdc:mga07m45_40799_c1
1601 nmdc:mga07m45_80298_c1
1602 nmdc:mga05p37_18823_c1
1603 nmdc:mga09592_10592_c1
1604 nmdc:mga06r32_77109_c1
1605 nmdc:mga08y16_124677_c1
1606 nmdc:mga08y16_321950_c1
1607 nmdc:mga08y16_562434_c1
1608 nmdc:mga08y16_67489_c1
1609 nmdc:mga0n895_429297_c1
1610 nmdc:mga0n895_7655_c1
1611 nmdc:mga0rr50_10723_c1
1612 nmdc:mga08x19_5831_c1
1613 nmdc:mga0a205_1500_c1
1614 nmdc:mga0a205_5044_c1
1615 nmdc:mga0sz30_88205_c1
1616 Ga0495612_0120751
1617 Ga0495595_0030187
1618 Ga0495619_0014336
1619 Ga0495619_0138301
1620 Ga0495619_0315744
1621 Ga0495619_0726221
1622 Ga0500644_0000014
1623 Ga0500644_0058548
1624 Ga0500554_096859
1625 Ga0500556_0000823
1626 Ga0500593_000350
1627 Ga0500573_0003978
1628 Ga0501084_0017359
1629 Ga0501084_0020608
1630 Ga0501084_0024338
1631 Ga0501084_0052333
1632 Ga0501084_0196552
1633 Ga0501082_0013575
1634 Ga0501082_0023824
1635 Ga0501082_0062974
1636 Ga0501082_0081381
1637 Ga0501082_0104205
1638 Ga0501082_0247997
1639 Ga0501082_0477794
1640 Ga0466962_0018047
1641 Ga0466962_0041149
1642 Ga0466962_0177453
1643 Ga0530510_0005855
1644 Ga0530510_0087929
1645 Ga0530510_0204008
1646 Ga0530510_0315596
1647 2655032952
1648 2555231288
1649 2643825710
1650 2643888869
1651 2643957924
1652 2644034432
1653 2644089434
1654 2644098518
1655 2644114624
1656 2644230304
1657 2644319279
1658 2644531702
1659 2676490724
1660 2729905384
1661 2731906827
1662 2738869789
1663 2740169025
1664 2774392413
1665 2799186167
1666 2809196207
1667 2812332492
1668 2812351639
1669 2835190694
1670 2855387929
1671 2857484305
1672 2868088677
1673 2873318681
1674 2883824400
1675 2884701409
1676 2887446427
1677 2891970749
1678 2895437154
1679 2895442701
1680 2990259151
1681 8054611145
1682 8055067858

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

1

116

0.96

PF02080

TrkA_C

TrkA-C domain

144

212

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l4b-assembly1.cif.gz_E crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima 0.9122 2 113
3l4b-assembly1.cif.gz_A crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima 0.9099 2 113
1lss-assembly1.cif.gz_A ktn mja218 crystal structure in complex with nad+ 0.9043 2 115
4xtt-assembly1.cif.gz_B structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp) 0.8702 143 206
5nc8-assembly1.cif.gz_A shewanella denitrificans kef ctd in amp bound form 0.8691 2 113
ID Description Score Start End Superfamily
af_I6XF25_142_211_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9399 137 204 3.30.70.1450
3l4bE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9122 2 113 3.40.50.720
af_I6XF25_142_211_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9024 137 204 3.30.70.1450
1lssD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8938 2 115 3.40.50.720
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8869 1 123 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6J4VNH4-F1-model_v4 TrkA-like protein 0.9987 2 87 GO:0005886
GO:0015079
AF-A0A352I7V1-F1-model_v4 deleted 0.984 2 95
AF-A0A3C1D8J3-F1-model_v4 TrkA family potassium uptake protein 0.9839 2 98 GO:0005886
GO:0015079
AF-A0A0L8QTB0-F1-model_v4 deleted 0.9668 134 214
AF-A0A535EMT7-F1-model_v4 TrkA family potassium uptake protein 0.9663 2 113 GO:0005886
GO:0015079

Map