F483115
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 317 | 1682 | 220 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2654587600|2655032952 |
| Length | 221 |
| Sequence | VIMGCGRVGVSLAHTLDSAGHSVAIIDQDPHAFRRLGKDFAGLTVTGRGFDRDTLEAAKIDGAYAFAAVSSGDNSNILATRVARETYNVPHVVARIYDPGRAEIYQRLGIPTVAAVRWSTDQVLRRILPDYSMRGDFREPSGRLVLTEVALNRDWYGRLVKDLEAAAGVRVAYLTRFGEGTIPQNRTRLQGGDLVHVMMRIDQLKDVEKILASPPAPLPND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 151 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 160 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 165 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 166 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 167 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 170 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 173 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 174 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 175 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 260 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 282 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 283 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 284 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 285 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 286 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 287 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 288 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 289 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 290 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 291 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 292 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 293 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 294 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 295 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 296 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 297 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 298 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 299 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 300 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 301 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 302 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 303 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 304 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 305 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 306 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 307 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 308 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 309 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 310 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 311 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 312 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 313 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 314 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 315 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 316 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 317 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.48 |
| Metatranscriptomes | 0.24 |
| Isolates | 4.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 9.51 |
| Nodule | 0.12 |
| Rhizoplane | 10.34 |
| Rhizosphere | 75.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1013543 | 3300000549 | Bacteria | 961 |
| 2 | JGI24737J22298_10031888 | 3300001990 | Bacteria | 1644 |
| 3 | JGI24735J21928_10021270 | 3300002067 | Bacteria | 1981 |
| 4 | JGI24738J21930_10010987 | 3300002075 | Bacteria | 2002 |
| 5 | JGI24744J21845_10014346 | 3300002077 | Bacteria | 1592 |
| 6 | JGI25406J46586_10008760 | 3300003203 | Bacteria | 4558 |
| 7 | Ga0070658_10017644 | 3300005327 | Bacteria | 5709 |
| 8 | Ga0070658_10106845 | 3300005327 | Bacteria | 2316 |
| 9 | Ga0070658_10130750 | 3300005327 | Bacteria | 2092 |
| 10 | Ga0070658_10458431 | 3300005327 | Bacteria | 1099 |
| 11 | Ga0070683_100006425 | 3300005329 | Bacteria | 9858 |
| 12 | Ga0070683_100012951 | 3300005329 | Bacteria | 7259 |
| 13 | Ga0070683_100034907 | 3300005329 | Bacteria | 4597 |
| 14 | Ga0070683_100456769 | 3300005329 | Bacteria | 1219 |
| 15 | Ga0070683_100556617 | 3300005329 | Bacteria | 1097 |
| 16 | Ga0070670_100284331 | 3300005331 | Bacteria | 1445 |
| 17 | Ga0068869_100484054 | 3300005334 | Bacteria | 1031 |
| 18 | Ga0070680_100230594 | 3300005336 | Bacteria | 1564 |
| 19 | Ga0070682_100049931 | 3300005337 | Bacteria | 2610 |
| 20 | Ga0068868_100318026 | 3300005338 | Bacteria | 1325 |
| 21 | Ga0068868_100702414 | 3300005338 | Bacteria | 905 |
| 22 | Ga0070660_100005631 | 3300005339 | Bacteria | 8681 |
| 23 | Ga0070660_100058091 | 3300005339 | Bacteria | 2999 |
| 24 | Ga0070689_100157581 | 3300005340 | Bacteria | 1834 |
| 25 | Ga0070687_100125141 | 3300005343 | Bacteria | 1476 |
| 26 | Ga0070687_100259865 | 3300005343 | Bacteria | 1083 |
| 27 | Ga0070661_100284676 | 3300005344 | Bacteria | 1283 |
| 28 | Ga0070692_10034534 | 3300005345 | Bacteria | 2555 |
| 29 | Ga0070692_10105430 | 3300005345 | Bacteria | 1551 |
| 30 | Ga0070674_100031447 | 3300005356 | Bacteria | 3517 |
| 31 | Ga0070674_100195791 | 3300005356 | Bacteria | 1557 |
| 32 | Ga0070659_100094418 | 3300005366 | Bacteria | 2402 |
| 33 | Ga0070659_100100986 | 3300005366 | Bacteria | 2322 |
| 34 | Ga0070659_100240162 | 3300005366 | Bacteria | 1499 |
| 35 | Ga0070659_100357616 | 3300005366 | Bacteria | 1226 |
| 36 | Ga0070667_100179654 | 3300005367 | Bacteria | 1871 |
| 37 | Ga0070667_100306838 | 3300005367 | Bacteria | 1430 |
| 38 | Ga0070667_100393788 | 3300005367 | Bacteria | 1260 |
| 39 | Ga0070714_100005919 | 3300005435 | Bacteria | 9385 |
| 40 | Ga0070701_10022152 | 3300005438 | Bacteria | 3043 |
| 41 | Ga0070700_100011370 | 3300005441 | Bacteria | 4929 |
| 42 | Ga0070663_100210051 | 3300005455 | Bacteria | 1524 |
| 43 | Ga0070663_100468746 | 3300005455 | Bacteria | 1041 |
| 44 | Ga0070678_100476500 | 3300005456 | Bacteria | 1097 |
| 45 | Ga0070662_100096422 | 3300005457 | Bacteria | 2231 |
| 46 | Ga0070681_10140809 | 3300005458 | Bacteria | 2342 |
| 47 | Ga0068867_100005704 | 3300005459 | Bacteria | 8826 |
| 48 | Ga0070685_10019113 | 3300005466 | Bacteria | 3694 |
| 49 | Ga0070685_10314765 | 3300005466 | Bacteria | 1059 |
| 50 | Ga0070698_100010433 | 3300005471 | Bacteria | 9920 |
| 51 | Ga0070679_100013115 | 3300005530 | Bacteria | 7937 |
| 52 | Ga0070684_100001548 | 3300005535 | Bacteria | 16592 |
| 53 | Ga0070684_100043329 | 3300005535 | Bacteria | 3885 |
| 54 | Ga0070684_100125804 | 3300005535 | Bacteria | 2309 |
| 55 | Ga0070684_100177633 | 3300005535 | Bacteria | 1935 |
| 56 | Ga0068853_100176994 | 3300005539 | Bacteria | 1933 |
| 57 | Ga0070686_100057301 | 3300005544 | Bacteria | 2502 |
| 58 | Ga0070693_100309568 | 3300005547 | Bacteria | 1067 |
| 59 | Ga0070665_100000273 | 3300005548 | Bacteria | 84592 |
| 60 | Ga0068857_100007521 | 3300005577 | Bacteria | 9373 |
| 61 | Ga0068854_100037408 | 3300005578 | Bacteria | 3407 |
| 62 | Ga0068856_100345413 | 3300005614 | Bacteria | 1507 |
| 63 | Ga0070702_100013929 | 3300005615 | Bacteria | 4071 |
| 64 | Ga0070702_100029299 | 3300005615 | Bacteria | 2992 |
| 65 | Ga0068852_100174023 | 3300005616 | Bacteria | 2020 |
| 66 | Ga0068852_100269585 | 3300005616 | Bacteria | 1638 |
| 67 | Ga0068864_100249464 | 3300005618 | Bacteria | 1647 |
| 68 | Ga0068861_100023002 | 3300005719 | Bacteria | 4493 |
| 69 | Ga0068861_100034022 | 3300005719 | Bacteria | 3765 |
| 70 | Ga0068861_100049711 | 3300005719 | Bacteria | 3176 |
| 71 | Ga0068870_10018021 | 3300005840 | Bacteria | 3403 |
| 72 | Ga0068870_10123970 | 3300005840 | Bacteria | 1492 |
| 73 | Ga0068870_10150368 | 3300005840 | Bacteria | 1371 |
| 74 | Ga0068863_100536232 | 3300005841 | Bacteria | 1155 |
| 75 | Ga0068858_100278736 | 3300005842 | Bacteria | 1592 |
| 76 | Ga0068860_100065106 | 3300005843 | Bacteria | 3462 |
| 77 | Ga0068860_100265151 | 3300005843 | Bacteria | 1675 |
| 78 | Ga0081455_10196210 | 3300005937 | Bacteria | 1516 |
| 79 | Ga0081538_10000345 | 3300005981 | Bacteria | 53019 |
| 80 | Ga0081539_10000100 | 3300005985 | Bacteria | 199516 |
| 81 | Ga0081539_10063799 | 3300005985 | Bacteria | 2008 |
| 82 | Ga0075365_10005467 | 3300006038 | Bacteria | 6854 |
| 83 | Ga0075365_10005743 | 3300006038 | Bacteria | 6734 |
| 84 | Ga0075365_10009542 | 3300006038 | Bacteria | 5589 |
| 85 | Ga0075365_10010982 | 3300006038 | Bacteria | 5305 |
| 86 | Ga0075365_10022491 | 3300006038 | Bacteria | 3951 |
| 87 | Ga0075365_10093791 | 3300006038 | Bacteria | 2048 |
| 88 | Ga0075365_10182924 | 3300006038 | Bacteria | 1466 |
| 89 | Ga0075365_10189453 | 3300006038 | Bacteria | 1439 |
| 90 | Ga0075368_10001063 | 3300006042 | Bacteria | 8600 |
| 91 | Ga0075368_10100096 | 3300006042 | Bacteria | 1190 |
| 92 | Ga0075363_100005645 | 3300006048 | Bacteria | 5595 |
| 93 | Ga0075363_100007534 | 3300006048 | Bacteria | 5011 |
| 94 | Ga0075363_100058916 | 3300006048 | Bacteria | 2063 |
| 95 | Ga0075363_100118410 | 3300006048 | Bacteria | 1477 |
| 96 | Ga0075363_100142626 | 3300006048 | Bacteria | 1350 |
| 97 | Ga0075364_10011060 | 3300006051 | Bacteria | 5476 |
| 98 | Ga0075364_10018999 | 3300006051 | Bacteria | 4311 |
| 99 | Ga0075364_10036981 | 3300006051 | Bacteria | 3158 |
| 100 | Ga0075364_10166847 | 3300006051 | Bacteria | 1488 |
| 101 | Ga0075364_10185948 | 3300006051 | Bacteria | 1407 |
| 102 | Ga0075364_10218322 | 3300006051 | Bacteria | 1293 |
| 103 | Ga0075432_10001088 | 3300006058 | Bacteria | 8652 |
| 104 | Ga0075362_10014596 | 3300006177 | Bacteria | 3173 |
| 105 | Ga0075367_10019483 | 3300006178 | Bacteria | 3763 |
| 106 | Ga0075367_10092565 | 3300006178 | Bacteria | 1840 |
| 107 | Ga0075367_10176795 | 3300006178 | Bacteria | 1330 |
| 108 | Ga0075367_10193546 | 3300006178 | Bacteria | 1269 |
| 109 | Ga0075370_10009077 | 3300006353 | Bacteria | 5142 |
| 110 | Ga0075370_10025679 | 3300006353 | Bacteria | 3260 |
| 111 | Ga0075370_10045056 | 3300006353 | Bacteria | 2494 |
| 112 | Ga0075370_10159238 | 3300006353 | Bacteria | 1325 |
| 113 | Ga0068871_100063940 | 3300006358 | Bacteria | 3011 |
| 114 | Ga0075428_100000711 | 3300006844 | Bacteria | 34391 |
| 115 | Ga0075430_100306642 | 3300006846 | Bacteria | 1313 |
| 116 | Ga0075431_100015231 | 3300006847 | Bacteria | 7792 |
| 117 | Ga0075433_10000003 | 3300006852 | Bacteria | 85999 |
| 118 | Ga0075433_10040606 | 3300006852 | Bacteria | 4028 |
| 119 | Ga0075433_10508422 | 3300006852 | Bacteria | 1060 |
| 120 | Ga0075434_100000691 | 3300006871 | Bacteria | 26321 |
| 121 | Ga0075434_100004021 | 3300006871 | Bacteria | 13177 |
| 122 | Ga0075434_100624775 | 3300006871 | Bacteria | 1096 |
| 123 | Ga0068865_100001572 | 3300006881 | Bacteria | 13343 |
| 124 | Ga0068865_100182514 | 3300006881 | Bacteria | 1617 |
| 125 | Ga0068865_100379122 | 3300006881 | Bacteria | 1153 |
| 126 | Ga0075436_100005603 | 3300006914 | Bacteria | 8616 |
| 127 | Ga0075435_100000613 | 3300007076 | Bacteria | 21900 |
| 128 | Ga0111539_10002214 | 3300009094 | Bacteria | 25972 |
| 129 | Ga0111539_10433985 | 3300009094 | Bacteria | 1530 |
| 130 | Ga0111539_10713639 | 3300009094 | Bacteria | 1167 |
| 131 | Ga0105245_10009217 | 3300009098 | Bacteria | 8605 |
| 132 | Ga0105245_10013771 | 3300009098 | Bacteria | 7043 |
| 133 | Ga0105245_10092996 | 3300009098 | Bacteria | 2778 |
| 134 | Ga0114129_10008508 | 3300009147 | Bacteria | 14627 |
| 135 | Ga0105243_10002326 | 3300009148 | Bacteria | 15906 |
| 136 | Ga0105243_10011520 | 3300009148 | Bacteria | 6692 |
| 137 | Ga0105243_10087827 | 3300009148 | Bacteria | 2553 |
| 138 | Ga0105241_10881577 | 3300009174 | Bacteria | 830 |
| 139 | Ga0105242_10219209 | 3300009176 | Bacteria | 1699 |
| 140 | Ga0105242_10225564 | 3300009176 | Bacteria | 1677 |
| 141 | Ga0105242_11006109 | 3300009176 | Bacteria | 842 |
| 142 | Ga0105238_10193140 | 3300009551 | Bacteria | 2011 |
| 143 | Ga0105238_10313807 | 3300009551 | Bacteria | 1553 |
| 144 | Ga0105238_10428651 | 3300009551 | Bacteria | 1318 |
| 145 | Ga0105249_10021521 | 3300009553 | Bacteria | 5773 |
| 146 | Ga0105249_10045414 | 3300009553 | Bacteria | 3995 |
| 147 | Ga0105249_10137154 | 3300009553 | Bacteria | 2343 |
| 148 | Ga0105249_10298672 | 3300009553 | Bacteria | 1614 |
| 149 | Ga0105239_10028212 | 3300010375 | Bacteria | 6174 |
| 150 | Ga0105239_10031714 | 3300010375 | Bacteria | 5807 |
| 151 | Ga0105239_10215189 | 3300010375 | Bacteria | 2154 |
| 152 | Ga0105239_10360076 | 3300010375 | Bacteria | 1643 |
| 153 | Ga0105239_10913817 | 3300010375 | Bacteria | 1008 |
| 154 | Ga0105246_10015844 | 3300011119 | Bacteria | 4767 |
| 155 | Ga0105246_10083483 | 3300011119 | Bacteria | 2283 |
| 156 | Ga0157371_10211653 | 3300013102 | Bacteria | 1391 |
| 157 | Ga0157374_10227059 | 3300013296 | Bacteria | 1833 |
| 158 | Ga0157374_10295640 | 3300013296 | Bacteria | 1601 |
| 159 | Ga0163162_10011475 | 3300013306 | Bacteria | 8641 |
| 160 | Ga0163162_10059520 | 3300013306 | Bacteria | 3852 |
| 161 | Ga0157372_10020744 | 3300013307 | Bacteria | 7095 |
| 162 | Ga0157372_10071811 | 3300013307 | Bacteria | 3900 |
| 163 | Ga0157372_10121575 | 3300013307 | Bacteria | 3000 |
| 164 | Ga0157372_10123225 | 3300013307 | Bacteria | 2979 |
| 165 | Ga0157372_10430929 | 3300013307 | Bacteria | 1537 |
| 166 | Ga0157372_10670766 | 3300013307 | Bacteria | 1207 |
| 167 | Ga0157372_10853949 | 3300013307 | Bacteria | 1057 |
| 168 | Ga0157375_10226911 | 3300013308 | Bacteria | 2026 |
| 169 | Ga0163163_10033657 | 3300014325 | Bacteria | 4959 |
| 170 | Ga0163163_10388968 | 3300014325 | Bacteria | 1452 |
| 171 | Ga0163163_10718711 | 3300014325 | Bacteria | 1062 |
| 172 | Ga0157380_10258297 | 3300014326 | Bacteria | 1581 |
| 173 | Ga0157380_11165307 | 3300014326 | Bacteria | 813 |
| 174 | Ga0182008_10070187 | 3300014497 | Bacteria | 1723 |
| 175 | Ga0182008_10207747 | 3300014497 | Bacteria | 998 |
| 176 | Ga0157377_10018533 | 3300014745 | Bacteria | 3619 |
| 177 | Ga0157377_10033024 | 3300014745 | Bacteria | 2822 |
| 178 | Ga0157377_10236322 | 3300014745 | Bacteria | 1177 |
| 179 | Ga0157376_10253822 | 3300014969 | Bacteria | 1644 |
| 180 | Ga0163161_10056093 | 3300017792 | Bacteria | 2861 |
| 181 | Ga0163161_10087778 | 3300017792 | Bacteria | 2298 |
| 182 | Ga0163161_10156904 | 3300017792 | Bacteria | 1733 |
| 183 | Ga0206354_11393013 | 3300020081 | Bacteria | 1123 |
| 184 | Ga0206353_10338087 | 3300020082 | Bacteria | 7936 |
| 185 | Ga0207688_10002361 | 3300025901 | Bacteria | 10154 |
| 186 | Ga0207647_10037133 | 3300025904 | Bacteria | 3091 |
| 187 | Ga0207647_10057879 | 3300025904 | Bacteria | 2375 |
| 188 | Ga0207643_10029653 | 3300025908 | Bacteria | 3044 |
| 189 | Ga0207643_10146431 | 3300025908 | Bacteria | 1413 |
| 190 | Ga0207705_10056354 | 3300025909 | Bacteria | 2833 |
| 191 | Ga0207705_10582033 | 3300025909 | Bacteria | 870 |
| 192 | Ga0207707_10213884 | 3300025912 | Bacteria | 1679 |
| 193 | Ga0207662_10076664 | 3300025918 | Bacteria | 2032 |
| 194 | Ga0207662_10107752 | 3300025918 | Bacteria | 1734 |
| 195 | Ga0207662_10262614 | 3300025918 | Bacteria | 1137 |
| 196 | Ga0207657_10007877 | 3300025919 | Bacteria | 10871 |
| 197 | Ga0207657_10042395 | 3300025919 | Bacteria | 4016 |
| 198 | Ga0207657_10066891 | 3300025919 | Bacteria | 3058 |
| 199 | Ga0207657_10274400 | 3300025919 | Bacteria | 1340 |
| 200 | Ga0207657_10314293 | 3300025919 | Bacteria | 1239 |
| 201 | Ga0207649_10083483 | 3300025920 | Bacteria | 2074 |
| 202 | Ga0207649_10279714 | 3300025920 | Bacteria | 1213 |
| 203 | Ga0207652_10011906 | 3300025921 | Bacteria | 7017 |
| 204 | Ga0207652_10361583 | 3300025921 | Bacteria | 1310 |
| 205 | Ga0207694_10120838 | 3300025924 | Bacteria | 2092 |
| 206 | Ga0207694_10155686 | 3300025924 | Bacteria | 1843 |
| 207 | Ga0207694_10307257 | 3300025924 | Bacteria | 1307 |
| 208 | Ga0207694_10336496 | 3300025924 | Bacteria | 1248 |
| 209 | Ga0207650_10259765 | 3300025925 | Bacteria | 1408 |
| 210 | Ga0207687_10019789 | 3300025927 | Bacteria | 4463 |
| 211 | Ga0207687_10033704 | 3300025927 | Bacteria | 3474 |
| 212 | Ga0207687_10057227 | 3300025927 | Bacteria | 2738 |
| 213 | Ga0207664_10034416 | 3300025929 | Bacteria | 3902 |
| 214 | Ga0207690_10020456 | 3300025932 | Bacteria | 4090 |
| 215 | Ga0207690_10042983 | 3300025932 | Bacteria | 2972 |
| 216 | Ga0207690_10100762 | 3300025932 | Bacteria | 2062 |
| 217 | Ga0207690_10203868 | 3300025932 | Bacteria | 1504 |
| 218 | Ga0207690_10356517 | 3300025932 | Bacteria | 1158 |
| 219 | Ga0207706_10066885 | 3300025933 | Bacteria | 3163 |
| 220 | Ga0207706_10423907 | 3300025933 | Bacteria | 1153 |
| 221 | Ga0207706_10503066 | 3300025933 | Bacteria | 1046 |
| 222 | Ga0207686_10116442 | 3300025934 | Bacteria | 1812 |
| 223 | Ga0207709_10016385 | 3300025935 | Bacteria | 4119 |
| 224 | Ga0207709_10077877 | 3300025935 | Bacteria | 2127 |
| 225 | Ga0207709_10081972 | 3300025935 | Bacteria | 2082 |
| 226 | Ga0207709_10154869 | 3300025935 | Bacteria | 1591 |
| 227 | Ga0207670_10071774 | 3300025936 | Bacteria | 2395 |
| 228 | Ga0207669_10350113 | 3300025937 | Bacteria | 1141 |
| 229 | Ga0207704_10148796 | 3300025938 | Bacteria | 1649 |
| 230 | Ga0207691_10008577 | 3300025940 | Bacteria | 9810 |
| 231 | Ga0207711_10057232 | 3300025941 | Bacteria | 3352 |
| 232 | Ga0207661_10002795 | 3300025944 | Bacteria | 12041 |
| 233 | Ga0207661_10054840 | 3300025944 | Bacteria | 3194 |
| 234 | Ga0207661_10063997 | 3300025944 | Bacteria | 2980 |
| 235 | Ga0207661_10093802 | 3300025944 | Bacteria | 2506 |
| 236 | Ga0207679_10108780 | 3300025945 | Bacteria | 2183 |
| 237 | Ga0207679_10439546 | 3300025945 | Bacteria | 1155 |
| 238 | Ga0207667_10428034 | 3300025949 | Bacteria | 1346 |
| 239 | Ga0207651_10132299 | 3300025960 | Bacteria | 1912 |
| 240 | Ga0207712_10008397 | 3300025961 | Bacteria | 6525 |
| 241 | Ga0207712_10039994 | 3300025961 | Bacteria | 3215 |
| 242 | Ga0207712_10431623 | 3300025961 | Bacteria | 1114 |
| 243 | Ga0207640_10567822 | 3300025981 | Bacteria | 956 |
| 244 | Ga0207658_10067683 | 3300025986 | Bacteria | 2691 |
| 245 | Ga0207658_10293508 | 3300025986 | Bacteria | 1398 |
| 246 | Ga0207658_10317574 | 3300025986 | Bacteria | 1347 |
| 247 | Ga0207677_10156792 | 3300026023 | Bacteria | 1764 |
| 248 | Ga0207677_10632629 | 3300026023 | Bacteria | 942 |
| 249 | Ga0207703_10135901 | 3300026035 | Bacteria | 2128 |
| 250 | Ga0207639_10425920 | 3300026041 | Bacteria | 1201 |
| 251 | Ga0207678_10447634 | 3300026067 | Bacteria | 1122 |
| 252 | Ga0207678_10637965 | 3300026067 | Bacteria | 935 |
| 253 | Ga0207708_10000227 | 3300026075 | Bacteria | 44512 |
| 254 | Ga0207708_10095127 | 3300026075 | Bacteria | 2300 |
| 255 | Ga0207702_10179874 | 3300026078 | Bacteria | 1947 |
| 256 | Ga0207702_10192019 | 3300026078 | Bacteria | 1887 |
| 257 | Ga0207648_10009320 | 3300026089 | Bacteria | 9408 |
| 258 | Ga0207676_10289017 | 3300026095 | Bacteria | 1492 |
| 259 | Ga0207674_10014132 | 3300026116 | Bacteria | 8821 |
| 260 | Ga0207674_10225674 | 3300026116 | Bacteria | 1821 |
| 261 | Ga0207675_100003582 | 3300026118 | Bacteria | 15138 |
| 262 | Ga0207675_100044326 | 3300026118 | Bacteria | 4156 |
| 263 | Ga0207675_100049974 | 3300026118 | Bacteria | 3902 |
| 264 | Ga0207698_10041089 | 3300026142 | Bacteria | 3442 |
| 265 | Ga0207698_10684836 | 3300026142 | Bacteria | 1019 |
| 266 | Ga0209813_10013346 | 3300027866 | Bacteria | 2192 |
| 267 | Ga0207428_10005512 | 3300027907 | Bacteria | 11790 |
| 268 | Ga0207428_10009590 | 3300027907 | Bacteria | 8672 |
| 269 | Ga0207428_10165376 | 3300027907 | Bacteria | 1678 |
| 270 | Ga0268266_10000955 | 3300028379 | Bacteria | 36877 |
| 271 | Ga0268264_10040659 | 3300028381 | Bacteria | 3842 |
| 272 | Ga0307515_10389081 | 3300028794 | Bacteria | 1024 |
| 273 | Ga0307408_100007018 | 3300031548 | Bacteria | 7449 |
| 274 | Ga0307408_100017340 | 3300031548 | Bacteria | 4819 |
| 275 | Ga0307408_100705775 | 3300031548 | Bacteria | 907 |
| 276 | Ga0307405_10001273 | 3300031731 | Bacteria | 10504 |
| 277 | Ga0307405_10238370 | 3300031731 | Bacteria | 1346 |
| 278 | Ga0307405_10254752 | 3300031731 | Bacteria | 1308 |
| 279 | Ga0307405_10268350 | 3300031731 | Bacteria | 1278 |
| 280 | Ga0307405_10278956 | 3300031731 | Bacteria | 1257 |
| 281 | Ga0307405_10314921 | 3300031731 | Bacteria | 1193 |
| 282 | Ga0307413_10005028 | 3300031824 | Bacteria | 5838 |
| 283 | Ga0307413_10005736 | 3300031824 | Bacteria | 5581 |
| 284 | Ga0307413_10177644 | 3300031824 | Bacteria | 1514 |
| 285 | Ga0307413_10248434 | 3300031824 | Bacteria | 1318 |
| 286 | Ga0307410_10020799 | 3300031852 | Bacteria | 4023 |
| 287 | Ga0307410_10028034 | 3300031852 | Bacteria | 3566 |
| 288 | Ga0307410_10147347 | 3300031852 | Bacteria | 1748 |
| 289 | Ga0307410_10407580 | 3300031852 | Bacteria | 1100 |
| 290 | Ga0307406_10000718 | 3300031901 | Bacteria | 18684 |
| 291 | Ga0307406_10264998 | 3300031901 | Bacteria | 1302 |
| 292 | Ga0307406_10495283 | 3300031901 | Bacteria | 990 |
| 293 | Ga0307407_10000498 | 3300031903 | Bacteria | 12111 |
| 294 | Ga0307407_10000918 | 3300031903 | Bacteria | 9968 |
| 295 | Ga0307407_10003870 | 3300031903 | Bacteria | 6239 |
| 296 | Ga0307407_10012563 | 3300031903 | Bacteria | 4076 |
| 297 | Ga0307407_10097181 | 3300031903 | Bacteria | 1820 |
| 298 | Ga0307412_10004095 | 3300031911 | Bacteria | 8124 |
| 299 | Ga0307412_10158025 | 3300031911 | Bacteria | 1681 |
| 300 | Ga0307412_10299403 | 3300031911 | Bacteria | 1270 |
| 301 | Ga0307409_100000040 | 3300031995 | Bacteria | 44978 |
| 302 | Ga0307409_100013869 | 3300031995 | Bacteria | 5211 |
| 303 | Ga0307409_100021185 | 3300031995 | Bacteria | 4451 |
| 304 | Ga0307409_100027937 | 3300031995 | Bacteria | 4009 |
| 305 | Ga0307409_100111134 | 3300031995 | Bacteria | 2298 |
| 306 | Ga0307409_100212957 | 3300031995 | Bacteria | 1738 |
| 307 | Ga0307409_100310356 | 3300031995 | Bacteria | 1472 |
| 308 | Ga0307409_100382606 | 3300031995 | Bacteria | 1338 |
| 309 | Ga0307409_100416703 | 3300031995 | Bacteria | 1287 |
| 310 | Ga0307409_100530006 | 3300031995 | Bacteria | 1152 |
| 311 | Ga0307416_100000078 | 3300032002 | Bacteria | 71548 |
| 312 | Ga0307416_100010435 | 3300032002 | Bacteria | 6134 |
| 313 | Ga0307416_100013428 | 3300032002 | Bacteria | 5566 |
| 314 | Ga0307416_100021323 | 3300032002 | Bacteria | 4649 |
| 315 | Ga0307416_100038900 | 3300032002 | Bacteria | 3675 |
| 316 | Ga0307416_100217524 | 3300032002 | Bacteria | 1829 |
| 317 | Ga0307416_100467442 | 3300032002 | Bacteria | 1318 |
| 318 | Ga0307414_10001176 | 3300032004 | Bacteria | 13443 |
| 319 | Ga0307411_10001351 | 3300032005 | Bacteria | 9918 |
| 320 | Ga0307411_10026771 | 3300032005 | Bacteria | 3477 |
| 321 | Ga0307411_10112261 | 3300032005 | Bacteria | 1953 |
| 322 | Ga0307415_100003733 | 3300032126 | Bacteria | 7799 |
| 323 | Ga0307415_100004209 | 3300032126 | Bacteria | 7432 |
| 324 | Ga0307415_100008957 | 3300032126 | Bacteria | 5581 |
| 325 | Ga0307415_100161253 | 3300032126 | Bacteria | 1738 |
| 326 | Ga0373943_0313005 | 3300035170 | Bacteria | 894 |
| 327 | Ga0316574_0025873 | 3300035398 | Bacteria | 3526 |
| 328 | Ga0316584_0197222 | 3300036712 | Bacteria | 1487 |
| 329 | Ga0395899_0034657 | 3300037312 | Bacteria | 3791 |
| 330 | Ga0395900_0025057 | 3300037418 | Bacteria | 6106 |
| 331 | Ga0395900_0039734 | 3300037418 | Bacteria | 4847 |
| 332 | Ga0395900_0089433 | 3300037418 | Bacteria | 3165 |
| 333 | Ga0395900_0546490 | 3300037418 | Bacteria | 1103 |
| 334 | Ga0395900_0809054 | 3300037418 | Bacteria | 865 |
| 335 | Ga0395898_0857162 | 3300037466 | Bacteria | 848 |
| 336 | Ga0395905_0021436 | 3300037471 | Bacteria | 6110 |
| 337 | Ga0395905_0150583 | 3300037471 | Bacteria | 2189 |
| 338 | Ga0395901_0048488 | 3300038443 | Bacteria | 4411 |
| 339 | Ga0395901_0054129 | 3300038443 | Bacteria | 4170 |
| 340 | Ga0395901_0092027 | 3300038443 | Bacteria | 3174 |
| 341 | Ga0395901_0408649 | 3300038443 | Bacteria | 1394 |
| 342 | Ga0436365_0285662 | 3300039437 | Bacteria | 824 |
| 343 | Ga0436365_1327458 | 3300039437 | Bacteria | 1089 |
| 344 | Ga0439436_0091583 | 3300041404 | Bacteria | 847 |
| 345 | Ga0439466_0058193 | 3300041411 | Bacteria | 1251 |
| 346 | Ga0451791_0009612 | 3300041451 | Bacteria | 4929 |
| 347 | Ga0451791_0369297 | 3300041451 | Bacteria | 829 |
| 348 | Ga0451791_1756400 | 3300041451 | Bacteria | 3520 |
| 349 | Ga0451791_1818518 | 3300041451 | Bacteria | 1102 |
| 350 | Ga0451793_0911478 | 3300041452 | Bacteria | 1672 |
| 351 | Ga0451800_1314210 | 3300041459 | Bacteria | 951 |
| 352 | Ga0451802_2065268 | 3300041460 | Bacteria | 1386 |
| 353 | Ga0451833_0367630 | 3300041491 | Bacteria | 1003 |
| 354 | Ga0451837_0226644 | 3300041494 | Bacteria | 1900 |
| 355 | Ga0451837_1470429 | 3300041494 | Bacteria | 902 |
| 356 | Ga0451843_0133041 | 3300041509 | Bacteria | 1391 |
| 357 | Ga0451855_0955642 | 3300041511 | Bacteria | 725 |
| 358 | Ga0451853_1034644 | 3300041512 | Bacteria | 3852 |
| 359 | Ga0451853_1305535 | 3300041512 | Bacteria | 1090 |
| 360 | Ga0439431_0005966 | 3300041997 | Bacteria | 2688 |
| 361 | Ga0439445_0015896 | 3300042004 | Bacteria | 1848 |
| 362 | Ga0439432_054451 | 3300042006 | Bacteria | 1243 |
| 363 | Ga0439463_004986 | 3300042016 | Bacteria | 3309 |
| 364 | Ga0439434_0000739 | 3300042435 | Bacteria | 9380 |
| 365 | Ga0439444_0007830 | 3300042437 | Bacteria | 1652 |
| 366 | Ga0439464_0013977 | 3300042439 | Bacteria | 2156 |
| 367 | Ga0439464_0014395 | 3300042439 | Bacteria | 2126 |
| 368 | Ga0439464_0035743 | 3300042439 | Bacteria | 1404 |
| 369 | Ga0466972_0007342 | 3300044658 | Bacteria | 5536 |
| 370 | Ga0466972_0026224 | 3300044658 | Bacteria | 2888 |
| 371 | Ga0466972_0055285 | 3300044658 | Bacteria | 1909 |
| 372 | Ga0466972_0098728 | 3300044658 | Bacteria | 1382 |
| 373 | Ga0466972_0098833 | 3300044658 | Bacteria | 1381 |
| 374 | Ga0466965_0010769 | 3300044683 | Bacteria | 4278 |
| 375 | Ga0466965_0023418 | 3300044683 | Bacteria | 2982 |
| 376 | Ga0466965_0043192 | 3300044683 | Bacteria | 2225 |
| 377 | Ga0466965_0046182 | 3300044683 | Bacteria | 2155 |
| 378 | Ga0466965_0048327 | 3300044683 | Bacteria | 2108 |
| 379 | Ga0466965_0262627 | 3300044683 | Bacteria | 928 |
| 380 | Ga0466966_0011350 | 3300044684 | Bacteria | 5908 |
| 381 | Ga0466966_0122067 | 3300044684 | Bacteria | 1600 |
| 382 | Ga0466966_0164275 | 3300044684 | Bacteria | 1351 |
| 383 | Ga0466966_0200434 | 3300044684 | Bacteria | 1208 |
| 384 | Ga0466966_0380089 | 3300044684 | Bacteria | 849 |
| 385 | Ga0466961_0018176 | 3300044693 | Bacteria | 4520 |
| 386 | Ga0466961_0028917 | 3300044693 | Bacteria | 3564 |
| 387 | Ga0466961_0032177 | 3300044693 | Bacteria | 3370 |
| 388 | Ga0466961_0060957 | 3300044693 | Bacteria | 2398 |
| 389 | Ga0466961_0168354 | 3300044693 | Bacteria | 1363 |
| 390 | Ga0466961_0177779 | 3300044693 | Bacteria | 1322 |
| 391 | Ga0466963_0014628 | 3300044694 | Bacteria | 4842 |
| 392 | Ga0466963_0016921 | 3300044694 | Bacteria | 4542 |
| 393 | Ga0466963_0037052 | 3300044694 | Bacteria | 3183 |
| 394 | Ga0466963_0043988 | 3300044694 | Bacteria | 2938 |
| 395 | Ga0466963_0192141 | 3300044694 | Bacteria | 1426 |
| 396 | Ga0466963_0244265 | 3300044694 | Bacteria | 1259 |
| 397 | Ga0466964_0086907 | 3300044706 | Bacteria | 1353 |
| 398 | Ga0466964_0416134 | 3300044706 | Bacteria | 706 |
| 399 | Ga0466971_0016821 | 3300044719 | Bacteria | 3231 |
| 400 | Ga0466971_0020670 | 3300044719 | Bacteria | 2927 |
| 401 | Ga0466971_0058425 | 3300044719 | Bacteria | 1741 |
| 402 | Ga0466968_0129080 | 3300044735 | Bacteria | 1149 |
| 403 | Ga0466970_0002084 | 3300044765 | Bacteria | 9670 |
| 404 | Ga0466970_0011794 | 3300044765 | Bacteria | 4457 |
| 405 | Ga0466970_0034042 | 3300044765 | Bacteria | 2695 |
| 406 | Ga0466970_0034873 | 3300044765 | Bacteria | 2665 |
| 407 | Ga0466970_0078572 | 3300044765 | Bacteria | 1780 |
| 408 | Ga0466970_0132251 | 3300044765 | Bacteria | 1371 |
| 409 | Ga0466970_0208805 | 3300044765 | Bacteria | 1087 |
| 410 | Ga0466970_0248269 | 3300044765 | Bacteria | 997 |
| 411 | Ga0466970_0272311 | 3300044765 | Bacteria | 951 |
| 412 | Ga0466957_0022534 | 3300044842 | Bacteria | 3717 |
| 413 | Ga0466957_0090234 | 3300044842 | Bacteria | 1919 |
| 414 | Ga0466957_0092835 | 3300044842 | Bacteria | 1893 |
| 415 | Ga0466960_0002006 | 3300044901 | Bacteria | 7549 |
| 416 | Ga0466960_0002484 | 3300044901 | Bacteria | 6940 |
| 417 | Ga0466960_0005554 | 3300044901 | Bacteria | 5002 |
| 418 | Ga0466960_0009952 | 3300044901 | Bacteria | 3936 |
| 419 | Ga0466960_0021784 | 3300044901 | Bacteria | 2857 |
| 420 | Ga0466960_0052190 | 3300044901 | Bacteria | 1977 |
| 421 | Ga0466960_0066247 | 3300044901 | Bacteria | 1785 |
| 422 | Ga0466960_0104548 | 3300044901 | Bacteria | 1463 |
| 423 | Ga0466960_0117719 | 3300044901 | Bacteria | 1388 |
| 424 | Ga0466960_0127870 | 3300044901 | Bacteria | 1338 |
| 425 | Ga0466959_0018348 | 3300045049 | Bacteria | 5135 |
| 426 | Ga0451576_0133190 | 3300045051 | Bacteria | 2591 |
| 427 | Ga0466958_0156983 | 3300045836 | Bacteria | 1436 |
| 428 | Ga0466958_0203548 | 3300045836 | Bacteria | 1260 |
| 429 | Ga0466967_0011038 | 3300045976 | Bacteria | 6816 |
| 430 | Ga0466967_0029025 | 3300045976 | Bacteria | 4625 |
| 431 | Ga0466967_0029842 | 3300045976 | Bacteria | 4569 |
| 432 | Ga0466967_0041937 | 3300045976 | Bacteria | 3950 |
| 433 | Ga0466967_0058675 | 3300045976 | Bacteria | 3403 |
| 434 | Ga0466967_0063324 | 3300045976 | Bacteria | 3286 |
| 435 | Ga0466967_0111974 | 3300045976 | Bacteria | 2509 |
| 436 | Ga0466967_0144076 | 3300045976 | Bacteria | 2221 |
| 437 | Ga0466967_0145722 | 3300045976 | Bacteria | 2209 |
| 438 | Ga0466967_0302566 | 3300045976 | Bacteria | 1539 |
| 439 | Ga0466967_0334770 | 3300045976 | Bacteria | 1462 |
| 440 | Ga0466967_0350248 | 3300045976 | Bacteria | 1429 |
| 441 | Ga0495603_0162080 | 3300046455 | Bacteria | 1297 |
| 442 | Ga0495629_0299632 | 3300046459 | Bacteria | 1101 |
| 443 | Ga0495641_0051748 | 3300046461 | Bacteria | 1874 |
| 444 | Ga0495641_0190898 | 3300046461 | Bacteria | 918 |
| 445 | Ga0495582_0087457 | 3300046473 | Bacteria | 1735 |
| 446 | Ga0495664_0091417 | 3300046477 | Bacteria | 1830 |
| 447 | Ga0495608_0197757 | 3300046511 | Bacteria | 1268 |
| 448 | Ga0495652_0482208 | 3300046529 | Bacteria | 863 |
| 449 | Ga0495667_0315792 | 3300046559 | Bacteria | 989 |
| 450 | Ga0495657_0157805 | 3300046675 | Bacteria | 1405 |
| 451 | Ga0495657_0315194 | 3300046675 | Bacteria | 930 |
| 452 | Ga0495658_0071700 | 3300046683 | Bacteria | 2013 |
| 453 | Ga0495658_0136261 | 3300046683 | Bacteria | 1498 |
| 454 | Ga0495674_0199790 | 3300047319 | Bacteria | 1659 |
| 455 | Ga0495674_0527723 | 3300047319 | Bacteria | 942 |
| 456 | Ga0495676_0322695 | 3300047321 | Bacteria | 1037 |
| 457 | Ga0496100_0035587 | 3300048903 | Bacteria | 3133 |
| 458 | Ga0496100_0234588 | 3300048903 | Bacteria | 1351 |
| 459 | Ga0496100_0875077 | 3300048903 | Bacteria | 705 |
| 460 | Ga0496101_0032649 | 3300048904 | Bacteria | 3667 |
| 461 | Ga0496101_0086864 | 3300048904 | Bacteria | 2320 |
| 462 | Ga0496101_0239962 | 3300048904 | Bacteria | 1410 |
| 463 | Ga0496101_0374546 | 3300048904 | Bacteria | 1120 |
| 464 | Ga0496101_0566205 | 3300048904 | Bacteria | 898 |
| 465 | Ga0496102_0002619 | 3300048905 | Bacteria | 15298 |
| 466 | Ga0496102_0007593 | 3300048905 | Bacteria | 9264 |
| 467 | Ga0496102_0034286 | 3300048905 | Bacteria | 4564 |
| 468 | Ga0496102_0305785 | 3300048905 | Bacteria | 1498 |
| 469 | Ga0496103_0002260 | 3300048906 | Bacteria | 12185 |
| 470 | Ga0496103_0232391 | 3300048906 | Bacteria | 1186 |
| 471 | Ga0496104_0004379 | 3300048907 | Bacteria | 12297 |
| 472 | Ga0496104_0164407 | 3300048907 | Bacteria | 2128 |
| 473 | Ga0496104_0532272 | 3300048907 | Bacteria | 1086 |
| 474 | Ga0496104_0559404 | 3300048907 | Bacteria | 1054 |
| 475 | Ga0496105_0104786 | 3300048908 | Bacteria | 2335 |
| 476 | Ga0496106_0029064 | 3300048909 | Bacteria | 4119 |
| 477 | Ga0496106_0030279 | 3300048909 | Bacteria | 4036 |
| 478 | Ga0496106_0075344 | 3300048909 | Bacteria | 2584 |
| 479 | Ga0496106_0623091 | 3300048909 | Bacteria | 863 |
| 480 | Ga0496107_0008332 | 3300048910 | Bacteria | 7172 |
| 481 | Ga0496107_0057104 | 3300048910 | Bacteria | 2821 |
| 482 | Ga0496107_0068602 | 3300048910 | Bacteria | 2573 |
| 483 | Ga0496107_0094759 | 3300048910 | Bacteria | 2184 |
| 484 | Ga0496107_0234002 | 3300048910 | Bacteria | 1367 |
| 485 | Ga0496107_0267210 | 3300048910 | Bacteria | 1273 |
| 486 | Ga0496108_0020552 | 3300048911 | Bacteria | 5426 |
| 487 | Ga0496108_0055902 | 3300048911 | Bacteria | 3315 |
| 488 | Ga0496108_0113095 | 3300048911 | Bacteria | 2323 |
| 489 | Ga0496108_0116444 | 3300048911 | Bacteria | 2289 |
| 490 | Ga0496108_0155942 | 3300048911 | Bacteria | 1972 |
| 491 | Ga0496108_0240918 | 3300048911 | Bacteria | 1573 |
| 492 | Ga0496109_0036870 | 3300048912 | Bacteria | 4415 |
| 493 | Ga0496109_0037023 | 3300048912 | Bacteria | 4407 |
| 494 | Ga0496109_0054681 | 3300048912 | Bacteria | 3641 |
| 495 | Ga0496109_0089994 | 3300048912 | Bacteria | 2838 |
| 496 | Ga0496109_0179837 | 3300048912 | Bacteria | 1986 |
| 497 | Ga0496109_0439856 | 3300048912 | Bacteria | 1232 |
| 498 | Ga0496109_0457219 | 3300048912 | Bacteria | 1206 |
| 499 | Ga0496109_0459442 | 3300048912 | Bacteria | 1202 |
| 500 | Ga0496109_0491495 | 3300048912 | Bacteria | 1158 |
| 501 | Ga0496109_0810543 | 3300048912 | Bacteria | 874 |
| 502 | Ga0496109_1194191 | 3300048912 | Bacteria | 697 |
| 503 | Ga0496110_0003350 | 3300048913 | Bacteria | 12248 |
| 504 | Ga0496110_0007800 | 3300048913 | Bacteria | 8577 |
| 505 | Ga0496110_0013242 | 3300048913 | Bacteria | 6812 |
| 506 | Ga0496110_0060049 | 3300048913 | Bacteria | 3353 |
| 507 | Ga0496110_0344684 | 3300048913 | Bacteria | 1357 |
| 508 | Ga0496110_0433466 | 3300048913 | Bacteria | 1198 |
| 509 | Ga0496111_0000864 | 3300048914 | Bacteria | 16432 |
| 510 | Ga0496111_0046043 | 3300048914 | Bacteria | 3140 |
| 511 | Ga0496111_0152557 | 3300048914 | Bacteria | 1714 |
| 512 | Ga0496111_0178310 | 3300048914 | Bacteria | 1579 |
| 513 | Ga0496112_0075788 | 3300048915 | Bacteria | 3326 |
| 514 | Ga0496112_0187291 | 3300048915 | Bacteria | 2033 |
| 515 | Ga0496112_0611960 | 3300048915 | Bacteria | 1021 |
| 516 | Ga0496113_0021530 | 3300048916 | Bacteria | 4549 |
| 517 | Ga0496113_0058344 | 3300048916 | Bacteria | 2904 |
| 518 | Ga0496113_0134353 | 3300048916 | Bacteria | 1943 |
| 519 | Ga0496113_0137010 | 3300048916 | Bacteria | 1924 |
| 520 | Ga0496114_0006364 | 3300048917 | Bacteria | 9291 |
| 521 | Ga0496114_0030149 | 3300048917 | Bacteria | 4462 |
| 522 | Ga0496114_0042109 | 3300048917 | Bacteria | 3784 |
| 523 | Ga0496114_0060357 | 3300048917 | Bacteria | 3169 |
| 524 | Ga0496114_0112198 | 3300048917 | Bacteria | 2337 |
| 525 | Ga0496114_0126419 | 3300048917 | Bacteria | 2204 |
| 526 | Ga0496114_0130219 | 3300048917 | Bacteria | 2172 |
| 527 | Ga0496114_0143814 | 3300048917 | Bacteria | 2066 |
| 528 | Ga0496114_0145333 | 3300048917 | Bacteria | 2055 |
| 529 | Ga0496114_0178589 | 3300048917 | Bacteria | 1853 |
| 530 | Ga0496114_0199434 | 3300048917 | Bacteria | 1752 |
| 531 | Ga0496114_0222314 | 3300048917 | Bacteria | 1658 |
| 532 | Ga0496114_0338534 | 3300048917 | Bacteria | 1330 |
| 533 | Ga0496114_0723722 | 3300048917 | Bacteria | 871 |
| 534 | Ga0496115_0027879 | 3300048918 | Bacteria | 4421 |
| 535 | Ga0496115_0190320 | 3300048918 | Bacteria | 1695 |
| 536 | Ga0496115_0245663 | 3300048918 | Bacteria | 1475 |
| 537 | Ga0496125_0000025 | 3300048928 | Bacteria | 440074 |
| 538 | Ga0496125_0007435 | 3300048928 | Bacteria | 11652 |
| 539 | Ga0501031_0021538 | 3300049568 | Bacteria | 4202 |
| 540 | Ga0501031_0031482 | 3300049568 | Bacteria | 3460 |
| 541 | Ga0501031_0034438 | 3300049568 | Bacteria | 3305 |
| 542 | Ga0501031_0078740 | 3300049568 | Bacteria | 2148 |
| 543 | Ga0501031_0079871 | 3300049568 | Bacteria | 2132 |
| 544 | Ga0501031_0159715 | 3300049568 | Bacteria | 1473 |
| 545 | Ga0501031_0248540 | 3300049568 | Bacteria | 1156 |
| 546 | Ga0501032_0003962 | 3300049569 | Bacteria | 11230 |
| 547 | Ga0501032_0100372 | 3300049569 | Bacteria | 1918 |
| 548 | Ga0501032_0278190 | 3300049569 | Bacteria | 1084 |
| 549 | Ga0501033_0002176 | 3300049570 | Bacteria | 16916 |
| 550 | Ga0501033_0174351 | 3300049570 | Bacteria | 1544 |
| 551 | Ga0501033_0177533 | 3300049570 | Bacteria | 1527 |
| 552 | Ga0501033_0234726 | 3300049570 | Bacteria | 1302 |
| 553 | Ga0501033_0255252 | 3300049570 | Bacteria | 1242 |
| 554 | Ga0501033_0283966 | 3300049570 | Bacteria | 1168 |
| 555 | Ga0501034_0002826 | 3300049571 | Bacteria | 20262 |
| 556 | Ga0501034_0010995 | 3300049571 | Bacteria | 9395 |
| 557 | Ga0501034_0017477 | 3300049571 | Bacteria | 7356 |
| 558 | Ga0501034_0018380 | 3300049571 | Bacteria | 7168 |
| 559 | Ga0501034_0162210 | 3300049571 | Bacteria | 2206 |
| 560 | Ga0501034_0347175 | 3300049571 | Bacteria | 1413 |
| 561 | Ga0501036_0004236 | 3300049572 | Bacteria | 11565 |
| 562 | Ga0501036_0006275 | 3300049572 | Bacteria | 9645 |
| 563 | Ga0501036_0047032 | 3300049572 | Bacteria | 3654 |
| 564 | Ga0501036_0074551 | 3300049572 | Bacteria | 2870 |
| 565 | Ga0501036_0091452 | 3300049572 | Bacteria | 2570 |
| 566 | Ga0501036_0189742 | 3300049572 | Bacteria | 1729 |
| 567 | Ga0501036_0307482 | 3300049572 | Bacteria | 1326 |
| 568 | Ga0501036_0512934 | 3300049572 | Bacteria | 997 |
| 569 | Ga0501037_0015119 | 3300049573 | Bacteria | 5677 |
| 570 | Ga0501037_0071090 | 3300049573 | Bacteria | 2532 |
| 571 | Ga0501037_0162118 | 3300049573 | Bacteria | 1594 |
| 572 | Ga0501037_0178772 | 3300049573 | Bacteria | 1506 |
| 573 | Ga0501037_0346142 | 3300049573 | Bacteria | 1026 |
| 574 | Ga0501038_0001739 | 3300049574 | Bacteria | 20245 |
| 575 | Ga0501038_0011247 | 3300049574 | Bacteria | 8171 |
| 576 | Ga0501038_0175850 | 3300049574 | Bacteria | 1730 |
| 577 | Ga0501038_0575633 | 3300049574 | Bacteria | 854 |
| 578 | Ga0501038_0717773 | 3300049574 | Bacteria | 748 |
| 579 | Ga0501039_0011086 | 3300049575 | Bacteria | 6869 |
| 580 | Ga0501039_0023504 | 3300049575 | Bacteria | 4730 |
| 581 | Ga0501039_0027252 | 3300049575 | Bacteria | 4393 |
| 582 | Ga0501039_0068600 | 3300049575 | Bacteria | 2753 |
| 583 | Ga0501039_0117397 | 3300049575 | Bacteria | 2084 |
| 584 | Ga0501039_0177882 | 3300049575 | Bacteria | 1673 |
| 585 | Ga0501039_0231428 | 3300049575 | Bacteria | 1453 |
| 586 | Ga0501039_0357345 | 3300049575 | Bacteria | 1148 |
| 587 | Ga0501040_0007132 | 3300049576 | Bacteria | 7234 |
| 588 | Ga0501040_0032226 | 3300049576 | Bacteria | 3546 |
| 589 | Ga0501040_0091609 | 3300049576 | Bacteria | 2113 |
| 590 | Ga0501040_0222759 | 3300049576 | Bacteria | 1342 |
| 591 | Ga0501040_0237959 | 3300049576 | Bacteria | 1297 |
| 592 | Ga0501040_0325843 | 3300049576 | Bacteria | 1099 |
| 593 | Ga0501041_0002311 | 3300049577 | Bacteria | 10781 |
| 594 | Ga0501041_0007641 | 3300049577 | Bacteria | 6349 |
| 595 | Ga0501041_0022712 | 3300049577 | Bacteria | 3758 |
| 596 | Ga0501041_0213846 | 3300049577 | Bacteria | 1209 |
| 597 | Ga0501042_0001922 | 3300049578 | Bacteria | 12499 |
| 598 | Ga0501042_0012839 | 3300049578 | Bacteria | 5689 |
| 599 | Ga0501042_0061797 | 3300049578 | Bacteria | 2675 |
| 600 | Ga0501042_0117721 | 3300049578 | Bacteria | 1913 |
| 601 | Ga0501042_0192133 | 3300049578 | Bacteria | 1472 |
| 602 | Ga0501042_0241322 | 3300049578 | Bacteria | 1304 |
| 603 | Ga0501043_0012512 | 3300049579 | Bacteria | 6638 |
| 604 | Ga0501043_0020940 | 3300049579 | Bacteria | 5128 |
| 605 | Ga0501043_0311143 | 3300049579 | Bacteria | 1202 |
| 606 | Ga0501046_0000096 | 3300049580 | Bacteria | 94786 |
| 607 | Ga0501046_0006158 | 3300049580 | Bacteria | 10655 |
| 608 | Ga0501046_0020341 | 3300049580 | Bacteria | 5492 |
| 609 | Ga0501046_0027745 | 3300049580 | Bacteria | 4616 |
| 610 | Ga0501046_0193891 | 3300049580 | Bacteria | 1514 |
| 611 | Ga0501047_0012721 | 3300049581 | Bacteria | 7972 |
| 612 | Ga0501047_0119600 | 3300049581 | Bacteria | 2516 |
| 613 | Ga0501047_0260656 | 3300049581 | Bacteria | 1581 |
| 614 | Ga0501047_0396550 | 3300049581 | Bacteria | 1213 |
| 615 | Ga0501048_0000591 | 3300049582 | Bacteria | 25746 |
| 616 | Ga0501048_0009408 | 3300049582 | Bacteria | 7338 |
| 617 | Ga0501048_0025144 | 3300049582 | Bacteria | 4340 |
| 618 | Ga0501048_0044595 | 3300049582 | Bacteria | 3170 |
| 619 | Ga0501048_0051557 | 3300049582 | Bacteria | 2929 |
| 620 | Ga0501048_0054450 | 3300049582 | Bacteria | 2842 |
| 621 | Ga0501048_0256089 | 3300049582 | Bacteria | 1243 |
| 622 | Ga0501048_0322698 | 3300049582 | Bacteria | 1100 |
| 623 | Ga0501048_0342906 | 3300049582 | Bacteria | 1065 |
| 624 | Ga0501067_0000467 | 3300049583 | Bacteria | 22014 |
| 625 | Ga0501067_0000635 | 3300049583 | Bacteria | 18888 |
| 626 | Ga0501067_0001844 | 3300049583 | Bacteria | 11652 |
| 627 | Ga0501067_0020959 | 3300049583 | Bacteria | 3616 |
| 628 | Ga0501067_0048669 | 3300049583 | Bacteria | 2351 |
| 629 | Ga0501067_0166326 | 3300049583 | Bacteria | 1228 |
| 630 | Ga0501068_0008475 | 3300049584 | Bacteria | 5722 |
| 631 | Ga0501068_0013807 | 3300049584 | Bacteria | 4602 |
| 632 | Ga0501068_0034016 | 3300049584 | Bacteria | 3038 |
| 633 | Ga0501068_0093160 | 3300049584 | Bacteria | 1861 |
| 634 | Ga0501068_0157535 | 3300049584 | Bacteria | 1430 |
| 635 | Ga0501068_0165321 | 3300049584 | Bacteria | 1395 |
| 636 | Ga0501068_0334043 | 3300049584 | Bacteria | 973 |
| 637 | Ga0501069_0008443 | 3300049585 | Bacteria | 5414 |
| 638 | Ga0501069_0070389 | 3300049585 | Bacteria | 1959 |
| 639 | Ga0501069_0071956 | 3300049585 | Bacteria | 1938 |
| 640 | Ga0501069_0073211 | 3300049585 | Bacteria | 1921 |
| 641 | Ga0501069_0092537 | 3300049585 | Bacteria | 1710 |
| 642 | Ga0501069_0153062 | 3300049585 | Bacteria | 1326 |
| 643 | Ga0501070_0007120 | 3300049586 | Bacteria | 9498 |
| 644 | Ga0501070_0007425 | 3300049586 | Bacteria | 9308 |
| 645 | Ga0501070_0031638 | 3300049586 | Bacteria | 4433 |
| 646 | Ga0501070_0191795 | 3300049586 | Bacteria | 1679 |
| 647 | Ga0501070_0210785 | 3300049586 | Bacteria | 1595 |
| 648 | Ga0501070_0270305 | 3300049586 | Bacteria | 1388 |
| 649 | Ga0501070_0309544 | 3300049586 | Bacteria | 1286 |
| 650 | Ga0501070_0325438 | 3300049586 | Bacteria | 1250 |
| 651 | Ga0501070_0440212 | 3300049586 | Bacteria | 1051 |
| 652 | Ga0501070_0702164 | 3300049586 | Bacteria | 800 |
| 653 | Ga0501070_0739842 | 3300049586 | Bacteria | 775 |
| 654 | Ga0501071_0001348 | 3300049587 | Bacteria | 14040 |
| 655 | Ga0501071_0019030 | 3300049587 | Bacteria | 4764 |
| 656 | Ga0501071_0023374 | 3300049587 | Bacteria | 4316 |
| 657 | Ga0501071_0065517 | 3300049587 | Bacteria | 2638 |
| 658 | Ga0501072_0008548 | 3300049588 | Bacteria | 7765 |
| 659 | Ga0501072_0016021 | 3300049588 | Bacteria | 5748 |
| 660 | Ga0501072_0042271 | 3300049588 | Bacteria | 3580 |
| 661 | Ga0501072_0104117 | 3300049588 | Bacteria | 2256 |
| 662 | Ga0501072_0199145 | 3300049588 | Bacteria | 1597 |
| 663 | Ga0501072_0259156 | 3300049588 | Bacteria | 1384 |
| 664 | Ga0501073_0003593 | 3300049589 | Bacteria | 11658 |
| 665 | Ga0501073_0005531 | 3300049589 | Bacteria | 9460 |
| 666 | Ga0501073_0036606 | 3300049589 | Bacteria | 3487 |
| 667 | Ga0501073_0042192 | 3300049589 | Bacteria | 3221 |
| 668 | Ga0501073_0065475 | 3300049589 | Bacteria | 2534 |
| 669 | Ga0501073_0233624 | 3300049589 | Bacteria | 1270 |
| 670 | Ga0501073_0306733 | 3300049589 | Bacteria | 1095 |
| 671 | Ga0501074_0008029 | 3300049590 | Bacteria | 7643 |
| 672 | Ga0501074_0008366 | 3300049590 | Bacteria | 7499 |
| 673 | Ga0501074_0035609 | 3300049590 | Bacteria | 3607 |
| 674 | Ga0501074_0061952 | 3300049590 | Bacteria | 2695 |
| 675 | Ga0501074_0173826 | 3300049590 | Bacteria | 1537 |
| 676 | Ga0501075_0017803 | 3300049591 | Bacteria | 5132 |
| 677 | Ga0501075_0028653 | 3300049591 | Bacteria | 4111 |
| 678 | Ga0501075_0028693 | 3300049591 | Bacteria | 4109 |
| 679 | Ga0501075_0031091 | 3300049591 | Bacteria | 3961 |
| 680 | Ga0501075_0063576 | 3300049591 | Bacteria | 2782 |
| 681 | Ga0501075_0435594 | 3300049591 | Bacteria | 1000 |
| 682 | Ga0501076_0008225 | 3300049592 | Bacteria | 7643 |
| 683 | Ga0501076_0029935 | 3300049592 | Bacteria | 4238 |
| 684 | Ga0501076_0070561 | 3300049592 | Bacteria | 2794 |
| 685 | Ga0501076_0142611 | 3300049592 | Bacteria | 1947 |
| 686 | Ga0501076_0177967 | 3300049592 | Bacteria | 1734 |
| 687 | Ga0501076_0909600 | 3300049592 | Bacteria | 725 |
| 688 | Ga0501077_0022882 | 3300049593 | Bacteria | 3961 |
| 689 | Ga0501077_0054923 | 3300049593 | Bacteria | 2529 |
| 690 | Ga0501077_0374909 | 3300049593 | Bacteria | 909 |
| 691 | Ga0501217_029157 | 3300049661 | Bacteria | 1348 |
| 692 | Ga0501079_0014031 | 3300049741 | Bacteria | 6110 |
| 693 | Ga0501079_0018882 | 3300049741 | Bacteria | 5269 |
| 694 | Ga0501079_0024470 | 3300049741 | Bacteria | 4634 |
| 695 | Ga0501079_0398012 | 3300049741 | Bacteria | 1080 |
| 696 | Ga0501079_0460646 | 3300049741 | Bacteria | 999 |
| 697 | Ga0501080_0006193 | 3300049742 | Bacteria | 10736 |
| 698 | Ga0501080_0012953 | 3300049742 | Bacteria | 7656 |
| 699 | Ga0501080_0048383 | 3300049742 | Bacteria | 3958 |
| 700 | Ga0501080_0368636 | 3300049742 | Bacteria | 1295 |
| 701 | Ga0501081_0028781 | 3300049743 | Bacteria | 3751 |
| 702 | Ga0501083_0005804 | 3300049744 | Bacteria | 8744 |
| 703 | Ga0501083_0011647 | 3300049744 | Bacteria | 6170 |
| 704 | Ga0501035_0007454 | 3300049822 | Bacteria | 10219 |
| 705 | Ga0501035_0026628 | 3300049822 | Bacteria | 5289 |
| 706 | Ga0501035_0030525 | 3300049822 | Bacteria | 4911 |
| 707 | Ga0501035_0033762 | 3300049822 | Bacteria | 4651 |
| 708 | Ga0501035_0065706 | 3300049822 | Bacteria | 3220 |
| 709 | Ga0501035_0236883 | 3300049822 | Bacteria | 1554 |
| 710 | Ga0501035_0335536 | 3300049822 | Bacteria | 1268 |
| 711 | Ga0501044_0003408 | 3300049823 | Bacteria | 17911 |
| 712 | Ga0501044_0009916 | 3300049823 | Bacteria | 10347 |
| 713 | Ga0501044_0020374 | 3300049823 | Bacteria | 7081 |
| 714 | Ga0501044_0095184 | 3300049823 | Bacteria | 3001 |
| 715 | Ga0501045_0039614 | 3300049824 | Bacteria | 3429 |
| 716 | Ga0501045_0067271 | 3300049824 | Bacteria | 2631 |
| 717 | Ga0501045_0071329 | 3300049824 | Bacteria | 2557 |
| 718 | Ga0501045_0539498 | 3300049824 | Bacteria | 865 |
| 719 | nmdc:mga03683_18229_c1 | 3300050489 | Bacteria | 2665 |
| 720 | nmdc:mga03n38_12047_c1 | 3300050490 | Bacteria | 3243 |
| 721 | nmdc:mga03n38_151110_c1 | 3300050490 | Bacteria | 1169 |
| 722 | nmdc:mga03n38_162485_c1 | 3300050490 | Bacteria | 1132 |
| 723 | nmdc:mga03n38_22661_c1 | 3300050490 | Bacteria | 2545 |
| 724 | nmdc:mga03n38_38789_c1 | 3300050490 | Bacteria | 1181 |
| 725 | nmdc:mga00v17_106606_c1 | 3300050491 | Bacteria | 1774 |
| 726 | nmdc:mga00v17_143102_c1 | 3300050491 | Bacteria | 1534 |
| 727 | nmdc:mga00v17_15226_c1 | 3300050491 | Bacteria | 2401 |
| 728 | nmdc:mga00v17_20082_c1 | 3300050491 | Bacteria | 3823 |
| 729 | nmdc:mga00v17_26516_c1 | 3300050491 | Bacteria | 3378 |
| 730 | nmdc:mga00v17_27714_c1 | 3300050491 | Bacteria | 3310 |
| 731 | nmdc:mga00v17_33657_c1 | 3300050491 | Bacteria | 3038 |
| 732 | nmdc:mga00v17_35845_c1 | 3300050491 | Bacteria | 2955 |
| 733 | nmdc:mga00v17_70321_c1 | 3300050491 | Bacteria | 2167 |
| 734 | nmdc:mga00v17_70654_c1 | 3300050491 | Bacteria | 2163 |
| 735 | nmdc:mga0yw44_124588_c1 | 3300050492 | Bacteria | 1663 |
| 736 | nmdc:mga0yw44_18056_c1 | 3300050492 | Bacteria | 3856 |
| 737 | nmdc:mga0yw44_232109_c1 | 3300050492 | Bacteria | 1225 |
| 738 | nmdc:mga0yw44_28961_c1 | 3300050492 | Bacteria | 3192 |
| 739 | nmdc:mga0yw44_3248_c1 | 3300050492 | Bacteria | 7164 |
| 740 | nmdc:mga0yw44_33152_c1 | 3300050492 | Bacteria | 3015 |
| 741 | nmdc:mga0yw44_49722_c1 | 3300050492 | Bacteria | 2532 |
| 742 | nmdc:mga0yw44_50192_c1 | 3300050492 | Bacteria | 2522 |
| 743 | nmdc:mga0yw44_560688_c1 | 3300050492 | Bacteria | 776 |
| 744 | nmdc:mga0yw44_654529_c1 | 3300050492 | Bacteria | 714 |
| 745 | nmdc:mga0yw44_75127_c1 | 3300050492 | Bacteria | 2107 |
| 746 | nmdc:mga0yw44_76702_c1 | 3300050492 | Bacteria | 2087 |
| 747 | nmdc:mga0yw44_77816_c1 | 3300050492 | Bacteria | 2073 |
| 748 | nmdc:mga0yw44_81310_c1 | 3300050492 | Bacteria | 2031 |
| 749 | nmdc:mga0yw44_96255_c1 | 3300050492 | Bacteria | 1879 |
| 750 | nmdc:mga06z11_21369_c1 | 3300050494 | Bacteria | 3006 |
| 751 | nmdc:mga06z11_3468_c1 | 3300050494 | Bacteria | 6107 |
| 752 | nmdc:mga06z11_60211_c1 | 3300050494 | Bacteria | 1976 |
| 753 | nmdc:mga04h51_14894_c1 | 3300050495 | Bacteria | 2231 |
| 754 | nmdc:mga07m45_11677_c1 | 3300050496 | Bacteria | 4620 |
| 755 | nmdc:mga07m45_166100_c1 | 3300050496 | Bacteria | 1282 |
| 756 | nmdc:mga07m45_220124_c1 | 3300050496 | Bacteria | 1104 |
| 757 | nmdc:mga07m45_225650_c1 | 3300050496 | Bacteria | 1090 |
| 758 | nmdc:mga07m45_38437_c1 | 3300050496 | Bacteria | 2671 |
| 759 | nmdc:mga07m45_40799_c1 | 3300050496 | Bacteria | 2598 |
| 760 | nmdc:mga07m45_80298_c1 | 3300050496 | Bacteria | 1862 |
| 761 | nmdc:mga05p37_18823_c1 | 3300050507 | Bacteria | 8346 |
| 762 | nmdc:mga09592_10592_c1 | 3300050508 | Bacteria | 7506 |
| 763 | nmdc:mga06r32_77109_c1 | 3300050510 | Bacteria | 3237 |
| 764 | nmdc:mga08y16_124677_c1 | 3300050511 | Bacteria | 2680 |
| 765 | nmdc:mga08y16_321950_c1 | 3300050511 | Bacteria | 1592 |
| 766 | nmdc:mga08y16_562434_c1 | 3300050511 | Bacteria | 1153 |
| 767 | nmdc:mga08y16_67489_c1 | 3300050511 | Bacteria | 3731 |
| 768 | nmdc:mga0n895_429297_c1 | 3300050512 | Bacteria | 1335 |
| 769 | nmdc:mga0n895_7655_c1 | 3300050512 | Bacteria | 9287 |
| 770 | nmdc:mga0rr50_10723_c1 | 3300050513 | Bacteria | 5836 |
| 771 | nmdc:mga08x19_5831_c1 | 3300050514 | Bacteria | 7287 |
| 772 | nmdc:mga0a205_1500_c1 | 3300050515 | Bacteria | 19905 |
| 773 | nmdc:mga0a205_5044_c1 | 3300050515 | Bacteria | 11885 |
| 774 | nmdc:mga0sz30_88205_c1 | 3300050516 | Bacteria | 1347 |
| 775 | Ga0495612_0120751 | 3300053078 | Bacteria | 1127 |
| 776 | Ga0495595_0030187 | 3300053084 | Bacteria | 2430 |
| 777 | Ga0495619_0014336 | 3300053085 | Bacteria | 5007 |
| 778 | Ga0495619_0138301 | 3300053085 | Bacteria | 1676 |
| 779 | Ga0495619_0315744 | 3300053085 | Bacteria | 1082 |
| 780 | Ga0495619_0726221 | 3300053085 | Bacteria | 675 |
| 781 | Ga0500644_0000014 | 3300053088 | Bacteria | 109650 |
| 782 | Ga0500644_0058548 | 3300053088 | Bacteria | 1348 |
| 783 | Ga0500554_096859 | 3300053102 | Bacteria | 984 |
| 784 | Ga0500556_0000823 | 3300053104 | Bacteria | 17936 |
| 785 | Ga0500593_000350 | 3300053117 | Bacteria | 18674 |
| 786 | Ga0500573_0003978 | 3300053140 | Bacteria | 7717 |
| 787 | Ga0501084_0017359 | 3300054114 | Bacteria | 5981 |
| 788 | Ga0501084_0020608 | 3300054114 | Bacteria | 5498 |
| 789 | Ga0501084_0024338 | 3300054114 | Bacteria | 5050 |
| 790 | Ga0501084_0052333 | 3300054114 | Bacteria | 3417 |
| 791 | Ga0501084_0196552 | 3300054114 | Bacteria | 1702 |
| 792 | Ga0501082_0013575 | 3300060353 | Bacteria | 6998 |
| 793 | Ga0501082_0023824 | 3300060353 | Bacteria | 5278 |
| 794 | Ga0501082_0062974 | 3300060353 | Bacteria | 3193 |
| 795 | Ga0501082_0081381 | 3300060353 | Bacteria | 2794 |
| 796 | Ga0501082_0104205 | 3300060353 | Bacteria | 2454 |
| 797 | Ga0501082_0247997 | 3300060353 | Bacteria | 1550 |
| 798 | Ga0501082_0477794 | 3300060353 | Bacteria | 1089 |
| 799 | Ga0466962_0018047 | 3300061719 | Bacteria | 3394 |
| 800 | Ga0466962_0041149 | 3300061719 | Bacteria | 2211 |
| 801 | Ga0466962_0177453 | 3300061719 | Bacteria | 1038 |
| 802 | Ga0530510_0005855 | 3300061734 | Bacteria | 8516 |
| 803 | Ga0530510_0087929 | 3300061734 | Bacteria | 2264 |
| 804 | Ga0530510_0204008 | 3300061734 | Bacteria | 1469 |
| 805 | Ga0530510_0315596 | 3300061734 | Bacteria | 1171 |
| 806 | 2655032952 | 2654587600 | Bacteria | 3911798 |
| 807 | 2555231288 | 2554235227 | Bacteria | 3637389 |
| 808 | 2643825710 | 2643221561 | Bacteria | 4984412 |
| 809 | 2643888869 | 2643221576 | Bacteria | 5214352 |
| 810 | 2643957924 | 2643221590 | Bacteria | 5214697 |
| 811 | 2644034432 | 2643221604 | Bacteria | 5014917 |
| 812 | 2644089434 | 2643221615 | Bacteria | 5487866 |
| 813 | 2644098518 | 2643221617 | Bacteria | 5139111 |
| 814 | 2644114624 | 2643221620 | Bacteria | 5134593 |
| 815 | 2644230304 | 2643221641 | Bacteria | 4490190 |
| 816 | 2644319279 | 2643221657 | Bacteria | 5490246 |
| 817 | 2644531702 | 2643221696 | Bacteria | 5431823 |
| 818 | 2676490724 | 2675903060 | Bacteria | 10051191 |
| 819 | 2729905384 | 2728369276 | Bacteria | 5610032 |
| 820 | 2731906827 | 2731639228 | Bacteria | 4187555 |
| 821 | 2738869789 | 2738541305 | Bacteria | 4910150 |
| 822 | 2740169025 | 2739367898 | Bacteria | 4367674 |
| 823 | 2774392413 | 2773857762 | Bacteria | 5971770 |
| 824 | 2799186167 | 2799112218 | Bacteria | 4315149 |
| 825 | 2809196207 | 2808606439 | Bacteria | 5952208 |
| 826 | 2812332492 | 2811994874 | Bacteria | 5367947 |
| 827 | 2812351639 | 2811994878 | Bacteria | 5992952 |
| 828 | 2835190694 | 2835188231 | Bacteria | 3476928 |
| 829 | 2855387929 | 2855386786 | Bacteria | 4752232 |
| 830 | 2857484305 | 2857481737 | Bacteria | 4761446 |
| 831 | 2868088677 | 2868088558 | Bacteria | 7609351 |
| 832 | 2873318681 | 2873314349 | Bacteria | 8512634 |
| 833 | 2883824400 | 2883821847 | Bacteria | 5121194 |
| 834 | 2884701409 | 2884693830 | Bacteria | 11273186 |
| 835 | 2887446427 | 2887443736 | Bacteria | 4426037 |
| 836 | 2891970749 | 2891968417 | Bacteria | 5821697 |
| 837 | 2895437154 | 2895427314 | Bacteria | 13147766 |
| 838 | 2895442701 | 2895442618 | Bacteria | 11027144 |
| 839 | 2990259151 | 2990256926 | Bacteria | 4252839 |
| 840 | 8054611145 | 8054609563 | Bacteria | 5170090 |
| 841 | 8055067858 | 8055066027 | Bacteria | 9479577 |
| 842 | LJQas_1013543 | |||
| 843 | JGI24737J22298_10031888 | |||
| 844 | JGI24735J21928_10021270 | |||
| 845 | JGI24738J21930_10010987 | |||
| 846 | JGI24744J21845_10014346 | |||
| 847 | JGI25406J46586_10008760 | |||
| 848 | Ga0070658_10017644 | |||
| 849 | Ga0070658_10106845 | |||
| 850 | Ga0070658_10130750 | |||
| 851 | Ga0070658_10458431 | |||
| 852 | Ga0070683_100006425 | |||
| 853 | Ga0070683_100012951 | |||
| 854 | Ga0070683_100034907 | |||
| 855 | Ga0070683_100456769 | |||
| 856 | Ga0070683_100556617 | |||
| 857 | Ga0070670_100284331 | |||
| 858 | Ga0068869_100484054 | |||
| 859 | Ga0070680_100230594 | |||
| 860 | Ga0070682_100049931 | |||
| 861 | Ga0068868_100318026 | |||
| 862 | Ga0068868_100702414 | |||
| 863 | Ga0070660_100005631 | |||
| 864 | Ga0070660_100058091 | |||
| 865 | Ga0070689_100157581 | |||
| 866 | Ga0070687_100125141 | |||
| 867 | Ga0070687_100259865 | |||
| 868 | Ga0070661_100284676 | |||
| 869 | Ga0070692_10034534 | |||
| 870 | Ga0070692_10105430 | |||
| 871 | Ga0070674_100031447 | |||
| 872 | Ga0070674_100195791 | |||
| 873 | Ga0070659_100094418 | |||
| 874 | Ga0070659_100100986 | |||
| 875 | Ga0070659_100240162 | |||
| 876 | Ga0070659_100357616 | |||
| 877 | Ga0070667_100179654 | |||
| 878 | Ga0070667_100306838 | |||
| 879 | Ga0070667_100393788 | |||
| 880 | Ga0070714_100005919 | |||
| 881 | Ga0070701_10022152 | |||
| 882 | Ga0070700_100011370 | |||
| 883 | Ga0070663_100210051 | |||
| 884 | Ga0070663_100468746 | |||
| 885 | Ga0070678_100476500 | |||
| 886 | Ga0070662_100096422 | |||
| 887 | Ga0070681_10140809 | |||
| 888 | Ga0068867_100005704 | |||
| 889 | Ga0070685_10019113 | |||
| 890 | Ga0070685_10314765 | |||
| 891 | Ga0070698_100010433 | |||
| 892 | Ga0070679_100013115 | |||
| 893 | Ga0070684_100001548 | |||
| 894 | Ga0070684_100043329 | |||
| 895 | Ga0070684_100125804 | |||
| 896 | Ga0070684_100177633 | |||
| 897 | Ga0068853_100176994 | |||
| 898 | Ga0070686_100057301 | |||
| 899 | Ga0070693_100309568 | |||
| 900 | Ga0070665_100000273 | |||
| 901 | Ga0068857_100007521 | |||
| 902 | Ga0068854_100037408 | |||
| 903 | Ga0068856_100345413 | |||
| 904 | Ga0070702_100013929 | |||
| 905 | Ga0070702_100029299 | |||
| 906 | Ga0068852_100174023 | |||
| 907 | Ga0068852_100269585 | |||
| 908 | Ga0068864_100249464 | |||
| 909 | Ga0068861_100023002 | |||
| 910 | Ga0068861_100034022 | |||
| 911 | Ga0068861_100049711 | |||
| 912 | Ga0068870_10018021 | |||
| 913 | Ga0068870_10123970 | |||
| 914 | Ga0068870_10150368 | |||
| 915 | Ga0068863_100536232 | |||
| 916 | Ga0068858_100278736 | |||
| 917 | Ga0068860_100065106 | |||
| 918 | Ga0068860_100265151 | |||
| 919 | Ga0081455_10196210 | |||
| 920 | Ga0081538_10000345 | |||
| 921 | Ga0081539_10000100 | |||
| 922 | Ga0081539_10063799 | |||
| 923 | Ga0075365_10005467 | |||
| 924 | Ga0075365_10005743 | |||
| 925 | Ga0075365_10009542 | |||
| 926 | Ga0075365_10010982 | |||
| 927 | Ga0075365_10022491 | |||
| 928 | Ga0075365_10093791 | |||
| 929 | Ga0075365_10182924 | |||
| 930 | Ga0075365_10189453 | |||
| 931 | Ga0075368_10001063 | |||
| 932 | Ga0075368_10100096 | |||
| 933 | Ga0075363_100005645 | |||
| 934 | Ga0075363_100007534 | |||
| 935 | Ga0075363_100058916 | |||
| 936 | Ga0075363_100118410 | |||
| 937 | Ga0075363_100142626 | |||
| 938 | Ga0075364_10011060 | |||
| 939 | Ga0075364_10018999 | |||
| 940 | Ga0075364_10036981 | |||
| 941 | Ga0075364_10166847 | |||
| 942 | Ga0075364_10185948 | |||
| 943 | Ga0075364_10218322 | |||
| 944 | Ga0075432_10001088 | |||
| 945 | Ga0075362_10014596 | |||
| 946 | Ga0075367_10019483 | |||
| 947 | Ga0075367_10092565 | |||
| 948 | Ga0075367_10176795 | |||
| 949 | Ga0075367_10193546 | |||
| 950 | Ga0075370_10009077 | |||
| 951 | Ga0075370_10025679 | |||
| 952 | Ga0075370_10045056 | |||
| 953 | Ga0075370_10159238 | |||
| 954 | Ga0068871_100063940 | |||
| 955 | Ga0075428_100000711 | |||
| 956 | Ga0075430_100306642 | |||
| 957 | Ga0075431_100015231 | |||
| 958 | Ga0075433_10000003 | |||
| 959 | Ga0075433_10040606 | |||
| 960 | Ga0075433_10508422 | |||
| 961 | Ga0075434_100000691 | |||
| 962 | Ga0075434_100004021 | |||
| 963 | Ga0075434_100624775 | |||
| 964 | Ga0068865_100001572 | |||
| 965 | Ga0068865_100182514 | |||
| 966 | Ga0068865_100379122 | |||
| 967 | Ga0075436_100005603 | |||
| 968 | Ga0075435_100000613 | |||
| 969 | Ga0111539_10002214 | |||
| 970 | Ga0111539_10433985 | |||
| 971 | Ga0111539_10713639 | |||
| 972 | Ga0105245_10009217 | |||
| 973 | Ga0105245_10013771 | |||
| 974 | Ga0105245_10092996 | |||
| 975 | Ga0114129_10008508 | |||
| 976 | Ga0105243_10002326 | |||
| 977 | Ga0105243_10011520 | |||
| 978 | Ga0105243_10087827 | |||
| 979 | Ga0105241_10881577 | |||
| 980 | Ga0105242_10219209 | |||
| 981 | Ga0105242_10225564 | |||
| 982 | Ga0105242_11006109 | |||
| 983 | Ga0105238_10193140 | |||
| 984 | Ga0105238_10313807 | |||
| 985 | Ga0105238_10428651 | |||
| 986 | Ga0105249_10021521 | |||
| 987 | Ga0105249_10045414 | |||
| 988 | Ga0105249_10137154 | |||
| 989 | Ga0105249_10298672 | |||
| 990 | Ga0105239_10028212 | |||
| 991 | Ga0105239_10031714 | |||
| 992 | Ga0105239_10215189 | |||
| 993 | Ga0105239_10360076 | |||
| 994 | Ga0105239_10913817 | |||
| 995 | Ga0105246_10015844 | |||
| 996 | Ga0105246_10083483 | |||
| 997 | Ga0157371_10211653 | |||
| 998 | Ga0157374_10227059 | |||
| 999 | Ga0157374_10295640 | |||
| 1000 | Ga0163162_10011475 | |||
| 1001 | Ga0163162_10059520 | |||
| 1002 | Ga0157372_10020744 | |||
| 1003 | Ga0157372_10071811 | |||
| 1004 | Ga0157372_10121575 | |||
| 1005 | Ga0157372_10123225 | |||
| 1006 | Ga0157372_10430929 | |||
| 1007 | Ga0157372_10670766 | |||
| 1008 | Ga0157372_10853949 | |||
| 1009 | Ga0157375_10226911 | |||
| 1010 | Ga0163163_10033657 | |||
| 1011 | Ga0163163_10388968 | |||
| 1012 | Ga0163163_10718711 | |||
| 1013 | Ga0157380_10258297 | |||
| 1014 | Ga0157380_11165307 | |||
| 1015 | Ga0182008_10070187 | |||
| 1016 | Ga0182008_10207747 | |||
| 1017 | Ga0157377_10018533 | |||
| 1018 | Ga0157377_10033024 | |||
| 1019 | Ga0157377_10236322 | |||
| 1020 | Ga0157376_10253822 | |||
| 1021 | Ga0163161_10056093 | |||
| 1022 | Ga0163161_10087778 | |||
| 1023 | Ga0163161_10156904 | |||
| 1024 | Ga0206354_11393013 | |||
| 1025 | Ga0206353_10338087 | |||
| 1026 | Ga0207688_10002361 | |||
| 1027 | Ga0207647_10037133 | |||
| 1028 | Ga0207647_10057879 | |||
| 1029 | Ga0207643_10029653 | |||
| 1030 | Ga0207643_10146431 | |||
| 1031 | Ga0207705_10056354 | |||
| 1032 | Ga0207705_10582033 | |||
| 1033 | Ga0207707_10213884 | |||
| 1034 | Ga0207662_10076664 | |||
| 1035 | Ga0207662_10107752 | |||
| 1036 | Ga0207662_10262614 | |||
| 1037 | Ga0207657_10007877 | |||
| 1038 | Ga0207657_10042395 | |||
| 1039 | Ga0207657_10066891 | |||
| 1040 | Ga0207657_10274400 | |||
| 1041 | Ga0207657_10314293 | |||
| 1042 | Ga0207649_10083483 | |||
| 1043 | Ga0207649_10279714 | |||
| 1044 | Ga0207652_10011906 | |||
| 1045 | Ga0207652_10361583 | |||
| 1046 | Ga0207694_10120838 | |||
| 1047 | Ga0207694_10155686 | |||
| 1048 | Ga0207694_10307257 | |||
| 1049 | Ga0207694_10336496 | |||
| 1050 | Ga0207650_10259765 | |||
| 1051 | Ga0207687_10019789 | |||
| 1052 | Ga0207687_10033704 | |||
| 1053 | Ga0207687_10057227 | |||
| 1054 | Ga0207664_10034416 | |||
| 1055 | Ga0207690_10020456 | |||
| 1056 | Ga0207690_10042983 | |||
| 1057 | Ga0207690_10100762 | |||
| 1058 | Ga0207690_10203868 | |||
| 1059 | Ga0207690_10356517 | |||
| 1060 | Ga0207706_10066885 | |||
| 1061 | Ga0207706_10423907 | |||
| 1062 | Ga0207706_10503066 | |||
| 1063 | Ga0207686_10116442 | |||
| 1064 | Ga0207709_10016385 | |||
| 1065 | Ga0207709_10077877 | |||
| 1066 | Ga0207709_10081972 | |||
| 1067 | Ga0207709_10154869 | |||
| 1068 | Ga0207670_10071774 | |||
| 1069 | Ga0207669_10350113 | |||
| 1070 | Ga0207704_10148796 | |||
| 1071 | Ga0207691_10008577 | |||
| 1072 | Ga0207711_10057232 | |||
| 1073 | Ga0207661_10002795 | |||
| 1074 | Ga0207661_10054840 | |||
| 1075 | Ga0207661_10063997 | |||
| 1076 | Ga0207661_10093802 | |||
| 1077 | Ga0207679_10108780 | |||
| 1078 | Ga0207679_10439546 | |||
| 1079 | Ga0207667_10428034 | |||
| 1080 | Ga0207651_10132299 | |||
| 1081 | Ga0207712_10008397 | |||
| 1082 | Ga0207712_10039994 | |||
| 1083 | Ga0207712_10431623 | |||
| 1084 | Ga0207640_10567822 | |||
| 1085 | Ga0207658_10067683 | |||
| 1086 | Ga0207658_10293508 | |||
| 1087 | Ga0207658_10317574 | |||
| 1088 | Ga0207677_10156792 | |||
| 1089 | Ga0207677_10632629 | |||
| 1090 | Ga0207703_10135901 | |||
| 1091 | Ga0207639_10425920 | |||
| 1092 | Ga0207678_10447634 | |||
| 1093 | Ga0207678_10637965 | |||
| 1094 | Ga0207708_10000227 | |||
| 1095 | Ga0207708_10095127 | |||
| 1096 | Ga0207702_10179874 | |||
| 1097 | Ga0207702_10192019 | |||
| 1098 | Ga0207648_10009320 | |||
| 1099 | Ga0207676_10289017 | |||
| 1100 | Ga0207674_10014132 | |||
| 1101 | Ga0207674_10225674 | |||
| 1102 | Ga0207675_100003582 | |||
| 1103 | Ga0207675_100044326 | |||
| 1104 | Ga0207675_100049974 | |||
| 1105 | Ga0207698_10041089 | |||
| 1106 | Ga0207698_10684836 | |||
| 1107 | Ga0209813_10013346 | |||
| 1108 | Ga0207428_10005512 | |||
| 1109 | Ga0207428_10009590 | |||
| 1110 | Ga0207428_10165376 | |||
| 1111 | Ga0268266_10000955 | |||
| 1112 | Ga0268264_10040659 | |||
| 1113 | Ga0307515_10389081 | |||
| 1114 | Ga0307408_100007018 | |||
| 1115 | Ga0307408_100017340 | |||
| 1116 | Ga0307408_100705775 | |||
| 1117 | Ga0307405_10001273 | |||
| 1118 | Ga0307405_10238370 | |||
| 1119 | Ga0307405_10254752 | |||
| 1120 | Ga0307405_10268350 | |||
| 1121 | Ga0307405_10278956 | |||
| 1122 | Ga0307405_10314921 | |||
| 1123 | Ga0307413_10005028 | |||
| 1124 | Ga0307413_10005736 | |||
| 1125 | Ga0307413_10177644 | |||
| 1126 | Ga0307413_10248434 | |||
| 1127 | Ga0307410_10020799 | |||
| 1128 | Ga0307410_10028034 | |||
| 1129 | Ga0307410_10147347 | |||
| 1130 | Ga0307410_10407580 | |||
| 1131 | Ga0307406_10000718 | |||
| 1132 | Ga0307406_10264998 | |||
| 1133 | Ga0307406_10495283 | |||
| 1134 | Ga0307407_10000498 | |||
| 1135 | Ga0307407_10000918 | |||
| 1136 | Ga0307407_10003870 | |||
| 1137 | Ga0307407_10012563 | |||
| 1138 | Ga0307407_10097181 | |||
| 1139 | Ga0307412_10004095 | |||
| 1140 | Ga0307412_10158025 | |||
| 1141 | Ga0307412_10299403 | |||
| 1142 | Ga0307409_100000040 | |||
| 1143 | Ga0307409_100013869 | |||
| 1144 | Ga0307409_100021185 | |||
| 1145 | Ga0307409_100027937 | |||
| 1146 | Ga0307409_100111134 | |||
| 1147 | Ga0307409_100212957 | |||
| 1148 | Ga0307409_100310356 | |||
| 1149 | Ga0307409_100382606 | |||
| 1150 | Ga0307409_100416703 | |||
| 1151 | Ga0307409_100530006 | |||
| 1152 | Ga0307416_100000078 | |||
| 1153 | Ga0307416_100010435 | |||
| 1154 | Ga0307416_100013428 | |||
| 1155 | Ga0307416_100021323 | |||
| 1156 | Ga0307416_100038900 | |||
| 1157 | Ga0307416_100217524 | |||
| 1158 | Ga0307416_100467442 | |||
| 1159 | Ga0307414_10001176 | |||
| 1160 | Ga0307411_10001351 | |||
| 1161 | Ga0307411_10026771 | |||
| 1162 | Ga0307411_10112261 | |||
| 1163 | Ga0307415_100003733 | |||
| 1164 | Ga0307415_100004209 | |||
| 1165 | Ga0307415_100008957 | |||
| 1166 | Ga0307415_100161253 | |||
| 1167 | Ga0373943_0313005 | |||
| 1168 | Ga0316574_0025873 | |||
| 1169 | Ga0316584_0197222 | |||
| 1170 | Ga0395899_0034657 | |||
| 1171 | Ga0395900_0025057 | |||
| 1172 | Ga0395900_0039734 | |||
| 1173 | Ga0395900_0089433 | |||
| 1174 | Ga0395900_0546490 | |||
| 1175 | Ga0395900_0809054 | |||
| 1176 | Ga0395898_0857162 | |||
| 1177 | Ga0395905_0021436 | |||
| 1178 | Ga0395905_0150583 | |||
| 1179 | Ga0395901_0048488 | |||
| 1180 | Ga0395901_0054129 | |||
| 1181 | Ga0395901_0092027 | |||
| 1182 | Ga0395901_0408649 | |||
| 1183 | Ga0436365_0285662 | |||
| 1184 | Ga0436365_1327458 | |||
| 1185 | Ga0439436_0091583 | |||
| 1186 | Ga0439466_0058193 | |||
| 1187 | Ga0451791_0009612 | |||
| 1188 | Ga0451791_0369297 | |||
| 1189 | Ga0451791_1756400 | |||
| 1190 | Ga0451791_1818518 | |||
| 1191 | Ga0451793_0911478 | |||
| 1192 | Ga0451800_1314210 | |||
| 1193 | Ga0451802_2065268 | |||
| 1194 | Ga0451833_0367630 | |||
| 1195 | Ga0451837_0226644 | |||
| 1196 | Ga0451837_1470429 | |||
| 1197 | Ga0451843_0133041 | |||
| 1198 | Ga0451855_0955642 | |||
| 1199 | Ga0451853_1034644 | |||
| 1200 | Ga0451853_1305535 | |||
| 1201 | Ga0439431_0005966 | |||
| 1202 | Ga0439445_0015896 | |||
| 1203 | Ga0439432_054451 | |||
| 1204 | Ga0439463_004986 | |||
| 1205 | Ga0439434_0000739 | |||
| 1206 | Ga0439444_0007830 | |||
| 1207 | Ga0439464_0013977 | |||
| 1208 | Ga0439464_0014395 | |||
| 1209 | Ga0439464_0035743 | |||
| 1210 | Ga0466972_0007342 | |||
| 1211 | Ga0466972_0026224 | |||
| 1212 | Ga0466972_0055285 | |||
| 1213 | Ga0466972_0098728 | |||
| 1214 | Ga0466972_0098833 | |||
| 1215 | Ga0466965_0010769 | |||
| 1216 | Ga0466965_0023418 | |||
| 1217 | Ga0466965_0043192 | |||
| 1218 | Ga0466965_0046182 | |||
| 1219 | Ga0466965_0048327 | |||
| 1220 | Ga0466965_0262627 | |||
| 1221 | Ga0466966_0011350 | |||
| 1222 | Ga0466966_0122067 | |||
| 1223 | Ga0466966_0164275 | |||
| 1224 | Ga0466966_0200434 | |||
| 1225 | Ga0466966_0380089 | |||
| 1226 | Ga0466961_0018176 | |||
| 1227 | Ga0466961_0028917 | |||
| 1228 | Ga0466961_0032177 | |||
| 1229 | Ga0466961_0060957 | |||
| 1230 | Ga0466961_0168354 | |||
| 1231 | Ga0466961_0177779 | |||
| 1232 | Ga0466963_0014628 | |||
| 1233 | Ga0466963_0016921 | |||
| 1234 | Ga0466963_0037052 | |||
| 1235 | Ga0466963_0043988 | |||
| 1236 | Ga0466963_0192141 | |||
| 1237 | Ga0466963_0244265 | |||
| 1238 | Ga0466964_0086907 | |||
| 1239 | Ga0466964_0416134 | |||
| 1240 | Ga0466971_0016821 | |||
| 1241 | Ga0466971_0020670 | |||
| 1242 | Ga0466971_0058425 | |||
| 1243 | Ga0466968_0129080 | |||
| 1244 | Ga0466970_0002084 | |||
| 1245 | Ga0466970_0011794 | |||
| 1246 | Ga0466970_0034042 | |||
| 1247 | Ga0466970_0034873 | |||
| 1248 | Ga0466970_0078572 | |||
| 1249 | Ga0466970_0132251 | |||
| 1250 | Ga0466970_0208805 | |||
| 1251 | Ga0466970_0248269 | |||
| 1252 | Ga0466970_0272311 | |||
| 1253 | Ga0466957_0022534 | |||
| 1254 | Ga0466957_0090234 | |||
| 1255 | Ga0466957_0092835 | |||
| 1256 | Ga0466960_0002006 | |||
| 1257 | Ga0466960_0002484 | |||
| 1258 | Ga0466960_0005554 | |||
| 1259 | Ga0466960_0009952 | |||
| 1260 | Ga0466960_0021784 | |||
| 1261 | Ga0466960_0052190 | |||
| 1262 | Ga0466960_0066247 | |||
| 1263 | Ga0466960_0104548 | |||
| 1264 | Ga0466960_0117719 | |||
| 1265 | Ga0466960_0127870 | |||
| 1266 | Ga0466959_0018348 | |||
| 1267 | Ga0451576_0133190 | |||
| 1268 | Ga0466958_0156983 | |||
| 1269 | Ga0466958_0203548 | |||
| 1270 | Ga0466967_0011038 | |||
| 1271 | Ga0466967_0029025 | |||
| 1272 | Ga0466967_0029842 | |||
| 1273 | Ga0466967_0041937 | |||
| 1274 | Ga0466967_0058675 | |||
| 1275 | Ga0466967_0063324 | |||
| 1276 | Ga0466967_0111974 | |||
| 1277 | Ga0466967_0144076 | |||
| 1278 | Ga0466967_0145722 | |||
| 1279 | Ga0466967_0302566 | |||
| 1280 | Ga0466967_0334770 | |||
| 1281 | Ga0466967_0350248 | |||
| 1282 | Ga0495603_0162080 | |||
| 1283 | Ga0495629_0299632 | |||
| 1284 | Ga0495641_0051748 | |||
| 1285 | Ga0495641_0190898 | |||
| 1286 | Ga0495582_0087457 | |||
| 1287 | Ga0495664_0091417 | |||
| 1288 | Ga0495608_0197757 | |||
| 1289 | Ga0495652_0482208 | |||
| 1290 | Ga0495667_0315792 | |||
| 1291 | Ga0495657_0157805 | |||
| 1292 | Ga0495657_0315194 | |||
| 1293 | Ga0495658_0071700 | |||
| 1294 | Ga0495658_0136261 | |||
| 1295 | Ga0495674_0199790 | |||
| 1296 | Ga0495674_0527723 | |||
| 1297 | Ga0495676_0322695 | |||
| 1298 | Ga0496100_0035587 | |||
| 1299 | Ga0496100_0234588 | |||
| 1300 | Ga0496100_0875077 | |||
| 1301 | Ga0496101_0032649 | |||
| 1302 | Ga0496101_0086864 | |||
| 1303 | Ga0496101_0239962 | |||
| 1304 | Ga0496101_0374546 | |||
| 1305 | Ga0496101_0566205 | |||
| 1306 | Ga0496102_0002619 | |||
| 1307 | Ga0496102_0007593 | |||
| 1308 | Ga0496102_0034286 | |||
| 1309 | Ga0496102_0305785 | |||
| 1310 | Ga0496103_0002260 | |||
| 1311 | Ga0496103_0232391 | |||
| 1312 | Ga0496104_0004379 | |||
| 1313 | Ga0496104_0164407 | |||
| 1314 | Ga0496104_0532272 | |||
| 1315 | Ga0496104_0559404 | |||
| 1316 | Ga0496105_0104786 | |||
| 1317 | Ga0496106_0029064 | |||
| 1318 | Ga0496106_0030279 | |||
| 1319 | Ga0496106_0075344 | |||
| 1320 | Ga0496106_0623091 | |||
| 1321 | Ga0496107_0008332 | |||
| 1322 | Ga0496107_0057104 | |||
| 1323 | Ga0496107_0068602 | |||
| 1324 | Ga0496107_0094759 | |||
| 1325 | Ga0496107_0234002 | |||
| 1326 | Ga0496107_0267210 | |||
| 1327 | Ga0496108_0020552 | |||
| 1328 | Ga0496108_0055902 | |||
| 1329 | Ga0496108_0113095 | |||
| 1330 | Ga0496108_0116444 | |||
| 1331 | Ga0496108_0155942 | |||
| 1332 | Ga0496108_0240918 | |||
| 1333 | Ga0496109_0036870 | |||
| 1334 | Ga0496109_0037023 | |||
| 1335 | Ga0496109_0054681 | |||
| 1336 | Ga0496109_0089994 | |||
| 1337 | Ga0496109_0179837 | |||
| 1338 | Ga0496109_0439856 | |||
| 1339 | Ga0496109_0457219 | |||
| 1340 | Ga0496109_0459442 | |||
| 1341 | Ga0496109_0491495 | |||
| 1342 | Ga0496109_0810543 | |||
| 1343 | Ga0496109_1194191 | |||
| 1344 | Ga0496110_0003350 | |||
| 1345 | Ga0496110_0007800 | |||
| 1346 | Ga0496110_0013242 | |||
| 1347 | Ga0496110_0060049 | |||
| 1348 | Ga0496110_0344684 | |||
| 1349 | Ga0496110_0433466 | |||
| 1350 | Ga0496111_0000864 | |||
| 1351 | Ga0496111_0046043 | |||
| 1352 | Ga0496111_0152557 | |||
| 1353 | Ga0496111_0178310 | |||
| 1354 | Ga0496112_0075788 | |||
| 1355 | Ga0496112_0187291 | |||
| 1356 | Ga0496112_0611960 | |||
| 1357 | Ga0496113_0021530 | |||
| 1358 | Ga0496113_0058344 | |||
| 1359 | Ga0496113_0134353 | |||
| 1360 | Ga0496113_0137010 | |||
| 1361 | Ga0496114_0006364 | |||
| 1362 | Ga0496114_0030149 | |||
| 1363 | Ga0496114_0042109 | |||
| 1364 | Ga0496114_0060357 | |||
| 1365 | Ga0496114_0112198 | |||
| 1366 | Ga0496114_0126419 | |||
| 1367 | Ga0496114_0130219 | |||
| 1368 | Ga0496114_0143814 | |||
| 1369 | Ga0496114_0145333 | |||
| 1370 | Ga0496114_0178589 | |||
| 1371 | Ga0496114_0199434 | |||
| 1372 | Ga0496114_0222314 | |||
| 1373 | Ga0496114_0338534 | |||
| 1374 | Ga0496114_0723722 | |||
| 1375 | Ga0496115_0027879 | |||
| 1376 | Ga0496115_0190320 | |||
| 1377 | Ga0496115_0245663 | |||
| 1378 | Ga0496125_0000025 | |||
| 1379 | Ga0496125_0007435 | |||
| 1380 | Ga0501031_0021538 | |||
| 1381 | Ga0501031_0031482 | |||
| 1382 | Ga0501031_0034438 | |||
| 1383 | Ga0501031_0078740 | |||
| 1384 | Ga0501031_0079871 | |||
| 1385 | Ga0501031_0159715 | |||
| 1386 | Ga0501031_0248540 | |||
| 1387 | Ga0501032_0003962 | |||
| 1388 | Ga0501032_0100372 | |||
| 1389 | Ga0501032_0278190 | |||
| 1390 | Ga0501033_0002176 | |||
| 1391 | Ga0501033_0174351 | |||
| 1392 | Ga0501033_0177533 | |||
| 1393 | Ga0501033_0234726 | |||
| 1394 | Ga0501033_0255252 | |||
| 1395 | Ga0501033_0283966 | |||
| 1396 | Ga0501034_0002826 | |||
| 1397 | Ga0501034_0010995 | |||
| 1398 | Ga0501034_0017477 | |||
| 1399 | Ga0501034_0018380 | |||
| 1400 | Ga0501034_0162210 | |||
| 1401 | Ga0501034_0347175 | |||
| 1402 | Ga0501036_0004236 | |||
| 1403 | Ga0501036_0006275 | |||
| 1404 | Ga0501036_0047032 | |||
| 1405 | Ga0501036_0074551 | |||
| 1406 | Ga0501036_0091452 | |||
| 1407 | Ga0501036_0189742 | |||
| 1408 | Ga0501036_0307482 | |||
| 1409 | Ga0501036_0512934 | |||
| 1410 | Ga0501037_0015119 | |||
| 1411 | Ga0501037_0071090 | |||
| 1412 | Ga0501037_0162118 | |||
| 1413 | Ga0501037_0178772 | |||
| 1414 | Ga0501037_0346142 | |||
| 1415 | Ga0501038_0001739 | |||
| 1416 | Ga0501038_0011247 | |||
| 1417 | Ga0501038_0175850 | |||
| 1418 | Ga0501038_0575633 | |||
| 1419 | Ga0501038_0717773 | |||
| 1420 | Ga0501039_0011086 | |||
| 1421 | Ga0501039_0023504 | |||
| 1422 | Ga0501039_0027252 | |||
| 1423 | Ga0501039_0068600 | |||
| 1424 | Ga0501039_0117397 | |||
| 1425 | Ga0501039_0177882 | |||
| 1426 | Ga0501039_0231428 | |||
| 1427 | Ga0501039_0357345 | |||
| 1428 | Ga0501040_0007132 | |||
| 1429 | Ga0501040_0032226 | |||
| 1430 | Ga0501040_0091609 | |||
| 1431 | Ga0501040_0222759 | |||
| 1432 | Ga0501040_0237959 | |||
| 1433 | Ga0501040_0325843 | |||
| 1434 | Ga0501041_0002311 | |||
| 1435 | Ga0501041_0007641 | |||
| 1436 | Ga0501041_0022712 | |||
| 1437 | Ga0501041_0213846 | |||
| 1438 | Ga0501042_0001922 | |||
| 1439 | Ga0501042_0012839 | |||
| 1440 | Ga0501042_0061797 | |||
| 1441 | Ga0501042_0117721 | |||
| 1442 | Ga0501042_0192133 | |||
| 1443 | Ga0501042_0241322 | |||
| 1444 | Ga0501043_0012512 | |||
| 1445 | Ga0501043_0020940 | |||
| 1446 | Ga0501043_0311143 | |||
| 1447 | Ga0501046_0000096 | |||
| 1448 | Ga0501046_0006158 | |||
| 1449 | Ga0501046_0020341 | |||
| 1450 | Ga0501046_0027745 | |||
| 1451 | Ga0501046_0193891 | |||
| 1452 | Ga0501047_0012721 | |||
| 1453 | Ga0501047_0119600 | |||
| 1454 | Ga0501047_0260656 | |||
| 1455 | Ga0501047_0396550 | |||
| 1456 | Ga0501048_0000591 | |||
| 1457 | Ga0501048_0009408 | |||
| 1458 | Ga0501048_0025144 | |||
| 1459 | Ga0501048_0044595 | |||
| 1460 | Ga0501048_0051557 | |||
| 1461 | Ga0501048_0054450 | |||
| 1462 | Ga0501048_0256089 | |||
| 1463 | Ga0501048_0322698 | |||
| 1464 | Ga0501048_0342906 | |||
| 1465 | Ga0501067_0000467 | |||
| 1466 | Ga0501067_0000635 | |||
| 1467 | Ga0501067_0001844 | |||
| 1468 | Ga0501067_0020959 | |||
| 1469 | Ga0501067_0048669 | |||
| 1470 | Ga0501067_0166326 | |||
| 1471 | Ga0501068_0008475 | |||
| 1472 | Ga0501068_0013807 | |||
| 1473 | Ga0501068_0034016 | |||
| 1474 | Ga0501068_0093160 | |||
| 1475 | Ga0501068_0157535 | |||
| 1476 | Ga0501068_0165321 | |||
| 1477 | Ga0501068_0334043 | |||
| 1478 | Ga0501069_0008443 | |||
| 1479 | Ga0501069_0070389 | |||
| 1480 | Ga0501069_0071956 | |||
| 1481 | Ga0501069_0073211 | |||
| 1482 | Ga0501069_0092537 | |||
| 1483 | Ga0501069_0153062 | |||
| 1484 | Ga0501070_0007120 | |||
| 1485 | Ga0501070_0007425 | |||
| 1486 | Ga0501070_0031638 | |||
| 1487 | Ga0501070_0191795 | |||
| 1488 | Ga0501070_0210785 | |||
| 1489 | Ga0501070_0270305 | |||
| 1490 | Ga0501070_0309544 | |||
| 1491 | Ga0501070_0325438 | |||
| 1492 | Ga0501070_0440212 | |||
| 1493 | Ga0501070_0702164 | |||
| 1494 | Ga0501070_0739842 | |||
| 1495 | Ga0501071_0001348 | |||
| 1496 | Ga0501071_0019030 | |||
| 1497 | Ga0501071_0023374 | |||
| 1498 | Ga0501071_0065517 | |||
| 1499 | Ga0501072_0008548 | |||
| 1500 | Ga0501072_0016021 | |||
| 1501 | Ga0501072_0042271 | |||
| 1502 | Ga0501072_0104117 | |||
| 1503 | Ga0501072_0199145 | |||
| 1504 | Ga0501072_0259156 | |||
| 1505 | Ga0501073_0003593 | |||
| 1506 | Ga0501073_0005531 | |||
| 1507 | Ga0501073_0036606 | |||
| 1508 | Ga0501073_0042192 | |||
| 1509 | Ga0501073_0065475 | |||
| 1510 | Ga0501073_0233624 | |||
| 1511 | Ga0501073_0306733 | |||
| 1512 | Ga0501074_0008029 | |||
| 1513 | Ga0501074_0008366 | |||
| 1514 | Ga0501074_0035609 | |||
| 1515 | Ga0501074_0061952 | |||
| 1516 | Ga0501074_0173826 | |||
| 1517 | Ga0501075_0017803 | |||
| 1518 | Ga0501075_0028653 | |||
| 1519 | Ga0501075_0028693 | |||
| 1520 | Ga0501075_0031091 | |||
| 1521 | Ga0501075_0063576 | |||
| 1522 | Ga0501075_0435594 | |||
| 1523 | Ga0501076_0008225 | |||
| 1524 | Ga0501076_0029935 | |||
| 1525 | Ga0501076_0070561 | |||
| 1526 | Ga0501076_0142611 | |||
| 1527 | Ga0501076_0177967 | |||
| 1528 | Ga0501076_0909600 | |||
| 1529 | Ga0501077_0022882 | |||
| 1530 | Ga0501077_0054923 | |||
| 1531 | Ga0501077_0374909 | |||
| 1532 | Ga0501217_029157 | |||
| 1533 | Ga0501079_0014031 | |||
| 1534 | Ga0501079_0018882 | |||
| 1535 | Ga0501079_0024470 | |||
| 1536 | Ga0501079_0398012 | |||
| 1537 | Ga0501079_0460646 | |||
| 1538 | Ga0501080_0006193 | |||
| 1539 | Ga0501080_0012953 | |||
| 1540 | Ga0501080_0048383 | |||
| 1541 | Ga0501080_0368636 | |||
| 1542 | Ga0501081_0028781 | |||
| 1543 | Ga0501083_0005804 | |||
| 1544 | Ga0501083_0011647 | |||
| 1545 | Ga0501035_0007454 | |||
| 1546 | Ga0501035_0026628 | |||
| 1547 | Ga0501035_0030525 | |||
| 1548 | Ga0501035_0033762 | |||
| 1549 | Ga0501035_0065706 | |||
| 1550 | Ga0501035_0236883 | |||
| 1551 | Ga0501035_0335536 | |||
| 1552 | Ga0501044_0003408 | |||
| 1553 | Ga0501044_0009916 | |||
| 1554 | Ga0501044_0020374 | |||
| 1555 | Ga0501044_0095184 | |||
| 1556 | Ga0501045_0039614 | |||
| 1557 | Ga0501045_0067271 | |||
| 1558 | Ga0501045_0071329 | |||
| 1559 | Ga0501045_0539498 | |||
| 1560 | nmdc:mga03683_18229_c1 | |||
| 1561 | nmdc:mga03n38_12047_c1 | |||
| 1562 | nmdc:mga03n38_151110_c1 | |||
| 1563 | nmdc:mga03n38_162485_c1 | |||
| 1564 | nmdc:mga03n38_22661_c1 | |||
| 1565 | nmdc:mga03n38_38789_c1 | |||
| 1566 | nmdc:mga00v17_106606_c1 | |||
| 1567 | nmdc:mga00v17_143102_c1 | |||
| 1568 | nmdc:mga00v17_15226_c1 | |||
| 1569 | nmdc:mga00v17_20082_c1 | |||
| 1570 | nmdc:mga00v17_26516_c1 | |||
| 1571 | nmdc:mga00v17_27714_c1 | |||
| 1572 | nmdc:mga00v17_33657_c1 | |||
| 1573 | nmdc:mga00v17_35845_c1 | |||
| 1574 | nmdc:mga00v17_70321_c1 | |||
| 1575 | nmdc:mga00v17_70654_c1 | |||
| 1576 | nmdc:mga0yw44_124588_c1 | |||
| 1577 | nmdc:mga0yw44_18056_c1 | |||
| 1578 | nmdc:mga0yw44_232109_c1 | |||
| 1579 | nmdc:mga0yw44_28961_c1 | |||
| 1580 | nmdc:mga0yw44_3248_c1 | |||
| 1581 | nmdc:mga0yw44_33152_c1 | |||
| 1582 | nmdc:mga0yw44_49722_c1 | |||
| 1583 | nmdc:mga0yw44_50192_c1 | |||
| 1584 | nmdc:mga0yw44_560688_c1 | |||
| 1585 | nmdc:mga0yw44_654529_c1 | |||
| 1586 | nmdc:mga0yw44_75127_c1 | |||
| 1587 | nmdc:mga0yw44_76702_c1 | |||
| 1588 | nmdc:mga0yw44_77816_c1 | |||
| 1589 | nmdc:mga0yw44_81310_c1 | |||
| 1590 | nmdc:mga0yw44_96255_c1 | |||
| 1591 | nmdc:mga06z11_21369_c1 | |||
| 1592 | nmdc:mga06z11_3468_c1 | |||
| 1593 | nmdc:mga06z11_60211_c1 | |||
| 1594 | nmdc:mga04h51_14894_c1 | |||
| 1595 | nmdc:mga07m45_11677_c1 | |||
| 1596 | nmdc:mga07m45_166100_c1 | |||
| 1597 | nmdc:mga07m45_220124_c1 | |||
| 1598 | nmdc:mga07m45_225650_c1 | |||
| 1599 | nmdc:mga07m45_38437_c1 | |||
| 1600 | nmdc:mga07m45_40799_c1 | |||
| 1601 | nmdc:mga07m45_80298_c1 | |||
| 1602 | nmdc:mga05p37_18823_c1 | |||
| 1603 | nmdc:mga09592_10592_c1 | |||
| 1604 | nmdc:mga06r32_77109_c1 | |||
| 1605 | nmdc:mga08y16_124677_c1 | |||
| 1606 | nmdc:mga08y16_321950_c1 | |||
| 1607 | nmdc:mga08y16_562434_c1 | |||
| 1608 | nmdc:mga08y16_67489_c1 | |||
| 1609 | nmdc:mga0n895_429297_c1 | |||
| 1610 | nmdc:mga0n895_7655_c1 | |||
| 1611 | nmdc:mga0rr50_10723_c1 | |||
| 1612 | nmdc:mga08x19_5831_c1 | |||
| 1613 | nmdc:mga0a205_1500_c1 | |||
| 1614 | nmdc:mga0a205_5044_c1 | |||
| 1615 | nmdc:mga0sz30_88205_c1 | |||
| 1616 | Ga0495612_0120751 | |||
| 1617 | Ga0495595_0030187 | |||
| 1618 | Ga0495619_0014336 | |||
| 1619 | Ga0495619_0138301 | |||
| 1620 | Ga0495619_0315744 | |||
| 1621 | Ga0495619_0726221 | |||
| 1622 | Ga0500644_0000014 | |||
| 1623 | Ga0500644_0058548 | |||
| 1624 | Ga0500554_096859 | |||
| 1625 | Ga0500556_0000823 | |||
| 1626 | Ga0500593_000350 | |||
| 1627 | Ga0500573_0003978 | |||
| 1628 | Ga0501084_0017359 | |||
| 1629 | Ga0501084_0020608 | |||
| 1630 | Ga0501084_0024338 | |||
| 1631 | Ga0501084_0052333 | |||
| 1632 | Ga0501084_0196552 | |||
| 1633 | Ga0501082_0013575 | |||
| 1634 | Ga0501082_0023824 | |||
| 1635 | Ga0501082_0062974 | |||
| 1636 | Ga0501082_0081381 | |||
| 1637 | Ga0501082_0104205 | |||
| 1638 | Ga0501082_0247997 | |||
| 1639 | Ga0501082_0477794 | |||
| 1640 | Ga0466962_0018047 | |||
| 1641 | Ga0466962_0041149 | |||
| 1642 | Ga0466962_0177453 | |||
| 1643 | Ga0530510_0005855 | |||
| 1644 | Ga0530510_0087929 | |||
| 1645 | Ga0530510_0204008 | |||
| 1646 | Ga0530510_0315596 | |||
| 1647 | 2655032952 | |||
| 1648 | 2555231288 | |||
| 1649 | 2643825710 | |||
| 1650 | 2643888869 | |||
| 1651 | 2643957924 | |||
| 1652 | 2644034432 | |||
| 1653 | 2644089434 | |||
| 1654 | 2644098518 | |||
| 1655 | 2644114624 | |||
| 1656 | 2644230304 | |||
| 1657 | 2644319279 | |||
| 1658 | 2644531702 | |||
| 1659 | 2676490724 | |||
| 1660 | 2729905384 | |||
| 1661 | 2731906827 | |||
| 1662 | 2738869789 | |||
| 1663 | 2740169025 | |||
| 1664 | 2774392413 | |||
| 1665 | 2799186167 | |||
| 1666 | 2809196207 | |||
| 1667 | 2812332492 | |||
| 1668 | 2812351639 | |||
| 1669 | 2835190694 | |||
| 1670 | 2855387929 | |||
| 1671 | 2857484305 | |||
| 1672 | 2868088677 | |||
| 1673 | 2873318681 | |||
| 1674 | 2883824400 | |||
| 1675 | 2884701409 | |||
| 1676 | 2887446427 | |||
| 1677 | 2891970749 | |||
| 1678 | 2895437154 | |||
| 1679 | 2895442701 | |||
| 1680 | 2990259151 | |||
| 1681 | 8054611145 | |||
| 1682 | 8055067858 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l4b-assembly1.cif.gz_E | crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima | 0.9122 | 2 | 113 |
| 3l4b-assembly1.cif.gz_A | crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima | 0.9099 | 2 | 113 |
| 1lss-assembly1.cif.gz_A | ktn mja218 crystal structure in complex with nad+ | 0.9043 | 2 | 115 |
| 4xtt-assembly1.cif.gz_B | structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp) | 0.8702 | 143 | 206 |
| 5nc8-assembly1.cif.gz_A | shewanella denitrificans kef ctd in amp bound form | 0.8691 | 2 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XF25_142_211_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9399 | 137 | 204 | 3.30.70.1450 |
| 3l4bE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9122 | 2 | 113 | 3.40.50.720 |
| af_I6XF25_142_211_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9024 | 137 | 204 | 3.30.70.1450 |
| 1lssD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8938 | 2 | 115 | 3.40.50.720 |
| af_I6XF25_1_136_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8869 | 1 | 123 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4VNH4-F1-model_v4 | TrkA-like protein | 0.9987 | 2 | 87 |
GO:0005886
GO:0015079 |
| AF-A0A352I7V1-F1-model_v4 | deleted | 0.984 | 2 | 95 |
|
| AF-A0A3C1D8J3-F1-model_v4 | TrkA family potassium uptake protein | 0.9839 | 2 | 98 |
GO:0005886
GO:0015079 |
| AF-A0A0L8QTB0-F1-model_v4 | deleted | 0.9668 | 134 | 214 |
|
| AF-A0A535EMT7-F1-model_v4 | TrkA family potassium uptake protein | 0.9663 | 2 | 113 |
GO:0005886
GO:0015079 |