F483073

General Info

Members Datasets Scaffolds Average Seq Length
841 488 633 194

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1010227|JGI25159J45721_10102272
Length 195
Sequence MNKPSNTSEDILACARTLIASGGYNGFSYADIAQVVSIRKASIHHHFPAKVDLVKALIARYRQDTEAGVAYIEGSAPGALDQLRAYVQYWKTCIGDGSSAFCVCAMLASELPILPHEVALEVRSYFRFLSGWLASLLERGAQQGLIVLGSGDARSEAEAFMATVHGAMLSARAYGDPAVFGVIMDQQLFRLAAKP

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
17 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
18 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
26 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
27 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
30 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
31 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
32 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
33 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
34 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
35 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
36 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
37 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
38 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
39 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
40 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
41 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
42 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
43 2643221645 Massilia sp. Root351 Isolate Unclassified
44 2643221664 Massilia sp. Root418 Isolate Unclassified
45 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
46 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
47 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
48 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
49 2738541293 Rhizobium sp. GV031 Isolate Unclassified
50 2738541300 Massilia sp. GV016 Isolate Unclassified
51 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
52 2738543018 Massilia sp. GV045 Isolate Unclassified
53 2738543030 Massilia sp. GV097 Isolate Unclassified
54 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
55 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
56 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
57 2791355263 Rhizobium chutanense C5 Isolate Nodule
58 2791355267 Rhizobium sp. L18 Isolate Nodule
59 2802429633 Rhizobium anhuiense J3 Isolate Nodule
60 2802429634 Rhizobium anhuiense S10 Isolate Nodule
61 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
62 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
63 2802429637 Rhizobium anhuiense C15 Isolate Nodule
64 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
65 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
66 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
67 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
68 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
69 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
70 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
71 2841760612 Bosea sp. Tri-49 Isolate Nodule
72 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
73 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
74 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
75 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
76 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
77 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
78 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
79 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
80 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
81 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
82 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
83 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
84 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
85 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
86 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
87 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
88 2844104063 Bosea sp. Tri-39 Isolate Nodule
89 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
90 2851182111 Bosea sp. Tri-44 Isolate Nodule
91 2851246043 Bosea sp. Tri-54 Isolate Nodule
92 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
93 2854911287 Brucella lupini LUP21 Isolate Unclassified
94 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
95 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
96 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
97 2857564685 Duganella sp. R-74599 Isolate Unclassified
98 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
99 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
100 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
101 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
102 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
103 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
104 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
105 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
106 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
107 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
108 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
109 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
110 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
111 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
112 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
113 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
114 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
115 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
116 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
117 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
118 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
119 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
120 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
121 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
122 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
123 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
124 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
125 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
126 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
127 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
128 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
129 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
130 2909042592 Labrys sp. LIt4 Isolate Nodule
131 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
132 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
133 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
134 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
135 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
136 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
137 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
138 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
139 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
140 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
141 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
142 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
143 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
144 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
145 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
146 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
147 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
148 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
149 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
150 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
151 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
152 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
153 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
154 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
155 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
156 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
157 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
158 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
159 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
160 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
161 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
162 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
163 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
164 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
165 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
166 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
167 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
168 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
169 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
170 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
171 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
172 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
173 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
174 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
175 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
176 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
177 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
178 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
179 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
180 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
181 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
182 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
183 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
184 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
185 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
186 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
187 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
188 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
189 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
190 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
191 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
192 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
193 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
194 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
195 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
196 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
201 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
202 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
203 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
204 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
205 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
206 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
207 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
208 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
209 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
210 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
211 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
212 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
213 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
214 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
215 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
216 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
217 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
218 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
219 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
220 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
223 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
227 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
228 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
229 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
230 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
231 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
232 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
233 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
234 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
235 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
236 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
237 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
238 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
239 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
241 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
242 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
243 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
246 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
247 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
248 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
249 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
252 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
253 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
254 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
255 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
256 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
259 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
260 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
263 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
264 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
265 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
267 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
268 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
270 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
274 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
288 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
309 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
310 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
313 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
314 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
320 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
323 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
324 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
325 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
326 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
329 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
330 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
331 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
332 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
333 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
334 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
335 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
336 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
337 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
338 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
339 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
340 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
341 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
342 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
343 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
344 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
345 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
346 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
347 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
348 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
349 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
350 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
353 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
354 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
357 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
358 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
359 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
360 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
363 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
364 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
369 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
370 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
371 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
372 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
375 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
381 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
382 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
383 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
392 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
393 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
413 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
414 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
415 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
416 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
424 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
440 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
441 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
442 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
443 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
444 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
445 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
446 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
447 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
451 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
454 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
455 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
458 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
459 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
462 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
463 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
464 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
465 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
466 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
467 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
468 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
469 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
470 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
471 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
472 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
473 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
474 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
475 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
476 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
477 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
478 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
479 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
480 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
481 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
482 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
483 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
484 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
485 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
486 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
487 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
488 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.27
Metatranscriptomes 0
Isolates 24.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 25.45
Nodule 17.48
Rhizoplane 2.38
Rhizosphere 36.86
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10143181 3300001989 Bacteria 708
2 JGI25156J39149_1007065 3300002705 Bacteria 2998
3 JGI25158J39367_1000147 3300002739 Bacteria 16476
4 JGI25157J39369_1001441 3300002741 Bacteria 8954
5 JGI25152J39213_1000001 3300002773 Bacteria 224104
6 JGI25152J39213_1009455 3300002773 Bacteria 2315
7 JGI25150J39212_1000007 3300002774 Bacteria 253635
8 JGI25159J45721_1000695 3300002987 Bacteria 14706
9 JGI25159J45721_1010227 3300002987 Bacteria 2409
10 JGI25151J46595_10000013 3300003187 Bacteria 253635
11 JGI25151J46595_10002485 3300003187 Bacteria 11035
12 JGI25151J46595_10004416 3300003187 Bacteria 7446
13 JGI25165J46597_1000079 3300003214 Bacteria 179163
14 JGI25153J46596_10000640 3300003215 Bacteria 21401
15 JGI25153J46596_10005600 3300003215 Bacteria 6563
16 JGI25153J46596_10011017 3300003215 Bacteria 4033
17 JGI25153J46596_10037408 3300003215 Bacteria 1543
18 JGI25153J46596_10039892 3300003215 Bacteria 1462
19 rootH1_10017387 3300003316 Bacteria 40873
20 rootH2_10299493 3300003320 Bacteria 1155
21 rootL2_10107941 3300003322 Bacteria 2748
22 rootH1_10035776 3300003323 Bacteria 1900
23 rootH1_10142015 3300003323 Bacteria 3077
24 rootH1_10217570 3300003323 Bacteria 2319
25 JGI25160J50197_1000022 3300003354 Bacteria 201071
26 JGI25160J50197_1001505 3300003354 Bacteria 11577
27 JGI25160J50197_1007219 3300003354 Bacteria 4373
28 JGI25161J50226_1000024 3300003374 Bacteria 152176
29 JGI25161J50226_1000154 3300003374 Bacteria 47801
30 JGI25161J50226_1003426 3300003374 Bacteria 3628
31 Ga0055539_1003522 3300003752 Bacteria 2179
32 Ga0055535_1007104 3300003761 Bacteria 2177
33 Ga0055542_1001962 3300003762 Bacteria 7992
34 Ga0055529_1004114 3300003763 Bacteria 2257
35 Ga0055526_1002360 3300003771 Bacteria 12814
36 Ga0055526_1009151 3300003771 Bacteria 4813
37 Ga0055526_1018520 3300003771 Bacteria 2594
38 Ga0055537_1000103 3300003773 Bacteria 63399
39 Ga0055524_1001735 3300003775 Bacteria 12094
40 Ga0055524_1006641 3300003775 Bacteria 5002
41 Ga0055524_1018190 3300003775 Bacteria 2448
42 Ga0055536_1005082 3300003781 Bacteria 6530
43 Ga0055534_1000317 3300003784 Bacteria 32025
44 Ga0055528_1000031 3300003790 Bacteria 120960
45 Ga0055528_1006346 3300003790 Bacteria 5373
46 Ga0055528_1007257 3300003790 Bacteria 4920
47 Ga0055528_1013691 3300003790 Bacteria 3056
48 Ga0055528_1016425 3300003790 Bacteria 2618
49 Ga0055540_1010940 3300003792 Bacteria 2976
50 Ga0055540_1028948 3300003792 Bacteria 1303
51 Ga0055540_1034201 3300003792 Bacteria 1146
52 Ga0055543_1000125 3300004625 Bacteria 63343
53 Ga0055543_1000513 3300004625 Bacteria 22087
54 Ga0055543_1001652 3300004625 Bacteria 8502
55 Ga0055543_1004558 3300004625 Bacteria 3740
56 Ga0065165_1000051 3300005262 Bacteria 194844
57 Ga0065165_1000439 3300005262 Bacteria 65347
58 Ga0065165_1005437 3300005262 Bacteria 7160
59 Ga0065165_1081622 3300005262 Bacteria 838
60 Ga0070658_10015348 3300005327 Bacteria 6130
61 Ga0070658_10440893 3300005327 Bacteria 1121
62 Ga0070676_10224910 3300005328 Bacteria 1241
63 Ga0070670_100000133 3300005331 Bacteria 69691
64 Ga0070669_100162007 3300005353 Bacteria 1739
65 Ga0070671_100013556 3300005355 Bacteria 6572
66 Ga0070667_100032879 3300005367 Bacteria 4329
67 Ga0070667_100433010 3300005367 Bacteria 1200
68 Ga0070663_100317289 3300005455 Bacteria 1252
69 Ga0070685_10481149 3300005466 Bacteria 875
70 Ga0068853_100087342 3300005539 Bacteria 2736
71 Ga0068853_100370186 3300005539 Bacteria 1336
72 Ga0070665_100004155 3300005548 Bacteria 15236
73 Ga0068855_100005827 3300005563 Bacteria 15039
74 Ga0068857_101013580 3300005577 Bacteria 799
75 Ga0068852_100295556 3300005616 Bacteria 1566
76 Ga0068859_100498381 3300005617 Bacteria 1313
77 Ga0068863_100013407 3300005841 Bacteria 7903
78 Ga0068860_100244881 3300005843 Bacteria 1744
79 Ga0068862_100188986 3300005844 Bacteria 1852
80 Ga0081540_1045274 3300005983 Bacteria 2237
81 Ga0075365_10015925 3300006038 Bacteria 4559
82 Ga0075365_10034333 3300006038 Bacteria 3275
83 Ga0075365_10036220 3300006038 Bacteria 3196
84 Ga0075365_10523189 3300006038 Bacteria 839
85 Ga0075368_10069582 3300006042 Bacteria 1420
86 Ga0075368_10074203 3300006042 Bacteria 1377
87 Ga0075363_100089068 3300006048 Bacteria 1697
88 Ga0075363_100246756 3300006048 Bacteria 1027
89 Ga0075363_100285269 3300006048 Bacteria 956
90 Ga0075364_10158518 3300006051 Bacteria 1527
91 Ga0075362_10013087 3300006177 Bacteria 3312
92 Ga0075362_10086383 3300006177 Bacteria 1451
93 Ga0075362_10160809 3300006177 Bacteria 1081
94 Ga0075367_10050070 3300006178 Bacteria 2465
95 Ga0075367_10053778 3300006178 Bacteria 2387
96 Ga0075367_10155947 3300006178 Bacteria 1418
97 Ga0075369_10009159 3300006186 Bacteria 3836
98 Ga0075369_10009605 3300006186 Bacteria 3763
99 Ga0075369_10019280 3300006186 Bacteria 2784
100 Ga0075369_10115653 3300006186 Bacteria 1211
101 Ga0075366_10074784 3300006195 Bacteria 2020
102 Ga0075366_10202987 3300006195 Bacteria 1206
103 Ga0075370_10024096 3300006353 Bacteria 3358
104 Ga0075370_10063254 3300006353 Bacteria 2109
105 Ga0075370_10178295 3300006353 Bacteria 1250
106 Ga0075370_10381898 3300006353 Bacteria 844
107 Ga0097620_100498403 3300006931 Bacteria 1313
108 Ga0105244_10004485 3300009036 Bacteria 9590
109 Ga0105240_10031594 3300009093 Bacteria 6863
110 Ga0105240_10118452 3300009093 Bacteria 3191
111 Ga0105240_10131078 3300009093 Bacteria 3007
112 Ga0105240_10527314 3300009093 Bacteria 1310
113 Ga0105241_10545483 3300009174 Bacteria 1040
114 Ga0105242_10591399 3300009176 Bacteria 1070
115 Ga0105242_10688563 3300009176 Bacteria 999
116 Ga0105248_10219814 3300009177 Bacteria 2139
117 Ga0105248_10596640 3300009177 Bacteria 1246
118 Ga0105237_10032528 3300009545 Bacteria 5280
119 Ga0105237_10174637 3300009545 Bacteria 2149
120 Ga0105237_10220033 3300009545 Bacteria 1899
121 Ga0105237_10349530 3300009545 Bacteria 1483
122 Ga0105238_10155985 3300009551 Bacteria 2258
123 Ga0105238_11230290 3300009551 Bacteria 774
124 Ga0123342_1009171 3300009766 Bacteria 11998
125 Ga0105033_102193 3300009986 Bacteria 1618
126 Ga0105239_10128575 3300010375 Bacteria 2816
127 Ga0105239_10214198 3300010375 Bacteria 2159
128 Ga0105239_10291625 3300010375 Bacteria 1837
129 Ga0105239_10317884 3300010375 Bacteria 1755
130 Ga0105239_10395079 3300010375 Bacteria 1564
131 Ga0105239_10476348 3300010375 Bacteria 1418
132 Ga0105239_10581782 3300010375 Bacteria 1276
133 Ga0105239_10857598 3300010375 Bacteria 1042
134 Ga0157373_10072471 3300013100 Bacteria 2431
135 Ga0157371_10024423 3300013102 Bacteria 4413
136 Ga0157369_10307003 3300013105 Bacteria 1650
137 Ga0157378_10415752 3300013297 Bacteria 1328
138 Ga0157378_10707947 3300013297 Bacteria 1027
139 Ga0163162_10630477 3300013306 Bacteria 1197
140 Ga0157372_10316079 3300013307 Bacteria 1818
141 Ga0157372_10481303 3300013307 Bacteria 1447
142 Ga0163163_10087771 3300014325 Bacteria 3121
143 Ga0163163_11040635 3300014325 Bacteria 882
144 Ga0182008_10139732 3300014497 Bacteria 1211
145 Ga0182008_10358043 3300014497 Bacteria 775
146 Ga0157376_10236718 3300014969 Bacteria 1699
147 Ga0157376_10326539 3300014969 Bacteria 1460
148 Ga0182007_10005652 3300015262 Bacteria 5458
149 Ga0182007_10006344 3300015262 Bacteria 5085
150 Ga0182005_1004353 3300015265 Bacteria 4600
151 Ga0182005_1005418 3300015265 Bacteria 3989
152 Ga0163161_10555417 3300017792 Bacteria 942
153 Ga0213872_10060697 3300021361 Bacteria 1710
154 Ga0228711_1004434 3300022739 Bacteria 21595
155 Ga0228710_1004658 3300022740 Bacteria 21595
156 Ga0209436_100021 3300025208 Bacteria 102115
157 Ga0207427_102046 3300025231 Bacteria 6047
158 Ga0209437_100590 3300025233 Bacteria 23064
159 Ga0209258_100341 3300025242 Bacteria 68437
160 Ga0207425_1000032 3300025245 Bacteria 253689
161 Ga0207425_1000699 3300025245 Bacteria 18154
162 Ga0207425_1002075 3300025245 Bacteria 7443
163 Ga0207425_1007448 3300025245 Bacteria 2885
164 Ga0207425_1011452 3300025245 Bacteria 2113
165 Ga0209026_1000118 3300025250 Bacteria 130611
166 Ga0209677_100364 3300025253 Bacteria 27796
167 Ga0209148_1000212 3300025254 Bacteria 101454
168 Ga0209759_1000076 3300025256 Bacteria 175911
169 Ga0209129_1000056 3300025258 Bacteria 253689
170 Ga0209129_1000149 3300025258 Bacteria 114222
171 Ga0209129_1003333 3300025258 Bacteria 7078
172 Ga0209129_1004094 3300025258 Bacteria 5937
173 Ga0209129_1014147 3300025258 Bacteria 1714
174 Ga0209233_1000247 3300025261 Bacteria 87890
175 Ga0209233_1000250 3300025261 Bacteria 85129
176 Ga0209565_1000035 3300025263 Bacteria 298125
177 Ga0209455_1000170 3300025272 Bacteria 110681
178 Ga0209673_1000006 3300025273 Bacteria 650600
179 Ga0209673_1001640 3300025273 Bacteria 19356
180 Ga0209673_1002960 3300025273 Bacteria 10625
181 Ga0209673_1010222 3300025273 Bacteria 3975
182 Ga0209673_1011182 3300025273 Bacteria 3717
183 Ga0209673_1013245 3300025273 Bacteria 3266
184 Ga0209673_1052102 3300025273 Bacteria 1076
185 Ga0209130_1000019 3300025284 Bacteria 381993
186 Ga0209130_1000063 3300025284 Bacteria 198142
187 Ga0209130_1000251 3300025284 Bacteria 67741
188 Ga0209675_1000005 3300025291 Bacteria 849192
189 Ga0209675_1033682 3300025291 Bacteria 1185
190 Ga0209676_1000138 3300025292 Bacteria 178932
191 Ga0209025_1000090 3300025294 Bacteria 253689
192 Ga0209025_1000205 3300025294 Bacteria 141452
193 Ga0209025_1000253 3300025294 Bacteria 125975
194 Ga0209025_1000866 3300025294 Bacteria 47843
195 Ga0209025_1006828 3300025294 Bacteria 8712
196 Ga0209025_1017611 3300025294 Bacteria 4109
197 Ga0209025_1039984 3300025294 Bacteria 2036
198 Ga0209564_1000007 3300025295 Bacteria 1028582
199 Ga0209564_1000083 3300025295 Bacteria 259272
200 Ga0209564_1001757 3300025295 Bacteria 20239
201 Ga0209564_1002391 3300025295 Bacteria 15000
202 Ga0209564_1018387 3300025295 Bacteria 2666
203 Ga0209758_1000084 3300025297 Bacteria 256346
204 Ga0209758_1000296 3300025297 Bacteria 97937
205 Ga0209758_1000567 3300025297 Bacteria 58201
206 Ga0209758_1001105 3300025297 Bacteria 34833
207 Ga0209758_1003899 3300025297 Bacteria 13034
208 Ga0209758_1007385 3300025297 Bacteria 7508
209 Ga0209758_1009542 3300025297 Bacteria 6005
210 Ga0209758_1010105 3300025297 Bacteria 5716
211 Ga0209758_1024193 3300025297 Bacteria 2715
212 Ga0209050_1028567 3300025298 Bacteria 1807
213 Ga0209256_1000141 3300025299 Bacteria 152280
214 Ga0209256_1000200 3300025299 Bacteria 112931
215 Ga0209256_1003442 3300025299 Bacteria 11105
216 Ga0209256_1005526 3300025299 Bacteria 7225
217 Ga0209256_1015501 3300025299 Bacteria 2662
218 Ga0207426_1000005 3300025302 Bacteria 1037188
219 Ga0207426_1000082 3300025302 Bacteria 298939
220 Ga0207426_1000538 3300025302 Bacteria 54233
221 Ga0207426_1020869 3300025302 Bacteria 2271
222 Ga0209051_1017527 3300025303 Bacteria 3197
223 Ga0209051_1050104 3300025303 Bacteria 1401
224 Ga0209257_1074395 3300025304 Bacteria 887
225 Ga0207655_1032856 3300025728 Bacteria 2363
226 Ga0207647_10031287 3300025904 Bacteria 3425
227 Ga0207647_10187446 3300025904 Bacteria 1199
228 Ga0207654_10145889 3300025911 Bacteria 1514
229 Ga0207695_10008916 3300025913 Bacteria 12489
230 Ga0207695_10072374 3300025913 Bacteria 3517
231 Ga0207671_10229575 3300025914 Bacteria 1456
232 Ga0207657_10550164 3300025919 Bacteria 902
233 Ga0207681_10285995 3300025923 Bacteria 1300
234 Ga0207694_10098844 3300025924 Bacteria 2311
235 Ga0207694_10134079 3300025924 Bacteria 1987
236 Ga0207650_10000592 3300025925 Bacteria 29057
237 Ga0207650_10326419 3300025925 Bacteria 1258
238 Ga0207644_10001838 3300025931 Bacteria 13801
239 Ga0207690_10236725 3300025932 Bacteria 1404
240 Ga0207658_10132232 3300025986 Bacteria 2006
241 Ga0207658_10192846 3300025986 Bacteria 1695
242 Ga0207677_11148917 3300026023 Bacteria 709
243 Ga0207639_10148940 3300026041 Bacteria 1958
244 Ga0207678_10456818 3300026067 Bacteria 1111
245 Ga0207702_10719312 3300026078 Bacteria 984
246 Ga0207641_10006236 3300026088 Bacteria 10086
247 Ga0207674_10312323 3300026116 Bacteria 1521
248 Ga0209281_1000194 3300027111 Bacteria 139318
249 Ga0209813_10078746 3300027866 Bacteria 1085
250 Ga0268266_10093857 3300028379 Bacteria 2633
251 Ga0268264_10218603 3300028381 Bacteria 1753
252 Ga0307515_10126031 3300028794 Bacteria 2860
253 Ga0307408_100119605 3300031548 Bacteria 2039
254 Ga0307406_10031266 3300031901 Bacteria 3240
255 Ga0307416_101389291 3300032002 Bacteria 808
256 Ga0307414_10162646 3300032004 Bacteria 1775
257 Ga0307414_10469113 3300032004 Bacteria 1108
258 Ga0373959_0021527 3300034820 Bacteria 1239
259 Ga0395900_0059101 3300037418 Bacteria 3947
260 Ga0395900_0084308 3300037418 Bacteria 3265
261 Ga0395900_0143224 3300037418 Bacteria 2446
262 Ga0395900_0464805 3300037418 Bacteria 1219
263 Ga0395900_0661767 3300037418 Bacteria 980
264 Ga0395898_0024814 3300037466 Bacteria 6044
265 Ga0395898_0239545 3300037466 Bacteria 1730
266 Ga0395905_0000708 3300037471 Bacteria 44246
267 Ga0395905_0120491 3300037471 Bacteria 2466
268 Ga0395905_0133883 3300037471 Bacteria 2331
269 Ga0395901_0066789 3300038443 Bacteria 3745
270 Ga0395901_0411471 3300038443 Bacteria 1388
271 Ga0436361_0218161 3300039447 Bacteria 11074
272 Ga0439438_011759 3300041405 Bacteria 2713
273 Ga0439466_0000152 3300041411 Bacteria 27540
274 Ga0439466_0000502 3300041411 Bacteria 14823
275 Ga0439466_0038688 3300041411 Bacteria 1602
276 Ga0439465_0000115 3300041413 Bacteria 18835
277 Ga0439465_0010116 3300041413 Bacteria 2966
278 Ga0439465_0088021 3300041413 Bacteria 1060
279 Ga0439465_0170467 3300041413 Bacteria 784
280 Ga0451789_0536031 3300041443 Bacteria 1231
281 Ga0451797_1166613 3300041453 Bacteria 1535
282 Ga0451833_0974868 3300041491 Bacteria 1965
283 Ga0451837_0287631 3300041494 Bacteria 1620
284 Ga0451839_0896053 3300041496 Bacteria 1235
285 Ga0451839_0907431 3300041496 Bacteria 2518
286 Ga0451841_0483661 3300041498 Bacteria 3713
287 Ga0451845_0285311 3300041501 Bacteria 1503
288 Ga0451847_0030482 3300041503 Bacteria 1373
289 Ga0451847_0032234 3300041503 Bacteria 1593
290 Ga0451849_1090712 3300041505 Bacteria 1681
291 Ga0451849_1413358 3300041505 Bacteria 1608
292 Ga0451851_0713013 3300041507 Bacteria 1576
293 Ga0451851_0979460 3300041507 Bacteria 1114
294 Ga0451843_0175228 3300041509 Bacteria 816
295 Ga0451843_0179076 3300041509 Bacteria 1262
296 Ga0451843_0637164 3300041509 Bacteria 4098
297 Ga0451843_0781011 3300041509 Bacteria 1257
298 Ga0451853_2319690 3300041512 Bacteria 4648
299 Ga0439431_0003810 3300041997 Bacteria 3333
300 Ga0439431_0010346 3300041997 Bacteria 2117
301 Ga0439442_013133 3300042002 Bacteria 1699
302 Ga0439445_0004610 3300042004 Bacteria 3123
303 Ga0439445_0007696 3300042004 Bacteria 2506
304 Ga0439448_0161039 3300042005 Bacteria 781
305 Ga0439452_010972 3300042010 Bacteria 2617
306 Ga0439456_000415 3300042013 Bacteria 9542
307 Ga0439434_0179732 3300042435 Bacteria 708
308 Ga0466972_0022345 3300044658 Bacteria 3151
309 Ga0466972_0043238 3300044658 Bacteria 2188
310 Ga0466972_0313551 3300044658 Bacteria 733
311 Ga0466965_0046487 3300044683 Bacteria 2149
312 Ga0466965_0091758 3300044683 Bacteria 1546
313 Ga0466966_0016349 3300044684 Bacteria 4904
314 Ga0466966_0051844 3300044684 Bacteria 2607
315 Ga0466961_0058081 3300044693 Bacteria 2462
316 Ga0466971_0061536 3300044719 Bacteria 1698
317 Ga0466970_0191168 3300044765 Bacteria 1137
318 Ga0466957_0097676 3300044842 Bacteria 1847
319 Ga0466959_0030637 3300045049 Bacteria 3983
320 Ga0466959_0042806 3300045049 Bacteria 3340
321 Ga0466958_0334425 3300045836 Bacteria 974
322 Ga0495617_075637 3300046452 Bacteria 1105
323 Ga0495627_013893 3300046453 Bacteria 2825
324 Ga0495590_0011991 3300046457 Bacteria 3227
325 Ga0495590_0046549 3300046457 Bacteria 1513
326 Ga0495590_0199904 3300046457 Bacteria 734
327 Ga0495591_027476 3300046458 Bacteria 1754
328 Ga0495638_0000169 3300046460 Bacteria 101640
329 Ga0495638_0181671 3300046460 Unclassified 1200
330 Ga0495653_0000042 3300046463 Bacteria 117284
331 Ga0495650_0000042 3300046471 Bacteria 357244
332 Ga0495650_0000101 3300046471 Bacteria 212903
333 Ga0495650_0007944 3300046471 Bacteria 6285
334 Ga0495650_0051593 3300046471 Bacteria 1694
335 Ga0495650_0129695 3300046471 Bacteria 921
336 Ga0495584_0005907 3300046491 Bacteria 6450
337 Ga0495584_0020035 3300046491 Bacteria 3397
338 Ga0495596_0000094 3300046500 Bacteria 62938
339 Ga0495607_0004276 3300046501 Bacteria 10564
340 Ga0495607_0018713 3300046501 Bacteria 4407
341 Ga0495607_0019127 3300046501 Bacteria 4355
342 Ga0495607_0050762 3300046501 Bacteria 2413
343 Ga0495607_0053369 3300046501 Bacteria 2336
344 Ga0495607_0072404 3300046501 Unclassified 1918
345 Ga0495607_0080839 3300046501 Bacteria 1786
346 Ga0495583_0018119 3300046506 Bacteria 3716
347 Ga0495583_0025877 3300046506 Bacteria 2922
348 Ga0495583_0026708 3300046506 Bacteria 2857
349 Ga0495583_0046605 3300046506 Bacteria 1998
350 Ga0495583_0222822 3300046506 Bacteria 762
351 Ga0495606_0000039 3300046507 Bacteria 224632
352 Ga0495606_0000087 3300046507 Bacteria 156407
353 Ga0495606_0000576 3300046507 Bacteria 58266
354 Ga0495606_0004066 3300046507 Bacteria 14886
355 Ga0495606_0004183 3300046507 Bacteria 14621
356 Ga0495606_0010822 3300046507 Bacteria 7517
357 Ga0495606_0069006 3300046507 Bacteria 2234
358 Ga0495606_0112336 3300046507 Bacteria 1642
359 Ga0495606_0113385 3300046507 Bacteria 1632
360 Ga0495606_0138844 3300046507 Bacteria 1437
361 Ga0495606_0208584 3300046507 Bacteria 1108
362 Ga0495606_0257742 3300046507 Bacteria 964
363 Ga0495606_0321685 3300046507 Bacteria 831
364 Ga0495610_0002460 3300046512 Bacteria 15569
365 Ga0495610_0004765 3300046512 Bacteria 9895
366 Ga0495610_0018020 3300046512 Bacteria 4003
367 Ga0495610_0062161 3300046512 Bacteria 1772
368 Ga0495610_0082109 3300046512 Bacteria 1478
369 Ga0495610_0090555 3300046512 Bacteria 1387
370 Ga0495610_0107157 3300046512 Bacteria 1243
371 Ga0495616_0038296 3300046513 Bacteria 2462
372 Ga0495616_0092503 3300046513 Bacteria 1430
373 Ga0495620_0010126 3300046515 Bacteria 4984
374 Ga0495620_0054470 3300046515 Bacteria 1689
375 Ga0495620_0060299 3300046515 Bacteria 1582
376 Ga0495620_0125466 3300046515 Bacteria 1010
377 Ga0495631_0012429 3300046518 Bacteria 4157
378 Ga0495632_0214626 3300046519 Bacteria 872
379 Ga0495632_0225862 3300046519 Bacteria 846
380 Ga0495637_0000528 3300046520 Bacteria 27567
381 Ga0495637_0007307 3300046520 Bacteria 5490
382 Ga0495637_0027583 3300046520 Bacteria 2539
383 Ga0495637_0030898 3300046520 Bacteria 2373
384 Ga0495643_0017925 3300046522 Bacteria 4128
385 Ga0495643_0066315 3300046522 Bacteria 1904
386 Ga0495643_0139202 3300046522 Bacteria 1212
387 Ga0495643_0348653 3300046522 Bacteria 663
388 Ga0495648_0002125 3300046524 Bacteria 18671
389 Ga0495648_0002883 3300046524 Bacteria 15481
390 Ga0495663_0090743 3300046525 Bacteria 996
391 Ga0495642_0001000 3300046528 Bacteria 13122
392 Ga0495642_0032721 3300046528 Bacteria 2087
393 Ga0495654_0000038 3300046530 Bacteria 185693
394 Ga0495654_0012778 3300046530 Bacteria 4507
395 Ga0495654_0180559 3300046530 Bacteria 914
396 Ga0495609_0011230 3300046538 Bacteria 4271
397 Ga0495609_0011488 3300046538 Bacteria 4216
398 Ga0495597_0006248 3300046542 Bacteria 6176
399 Ga0495622_0010327 3300046557 Bacteria 4316
400 Ga0495622_0061210 3300046557 Bacteria 1743
401 Ga0495633_0000446 3300046558 Bacteria 42633
402 Ga0495633_0001911 3300046558 Bacteria 15164
403 Ga0495633_0001922 3300046558 Bacteria 15124
404 Ga0495633_0007219 3300046558 Bacteria 6432
405 Ga0495656_0084106 3300046615 Bacteria 1442
406 Ga0495668_0000492 3300046616 Bacteria 49497
407 Ga0495668_0003911 3300046616 Bacteria 10880
408 Ga0495668_0003969 3300046616 Bacteria 10781
409 Ga0495668_0038840 3300046616 Bacteria 2659
410 Ga0495668_0532785 3300046616 Bacteria 648
411 Ga0495625_0004405 3300046660 Bacteria 13347
412 Ga0495625_0025457 3300046660 Bacteria 4489
413 Ga0495625_0041146 3300046660 Bacteria 3365
414 Ga0495625_0130465 3300046660 Bacteria 1703
415 Ga0495625_0188241 3300046660 Bacteria 1369
416 Ga0495625_0217047 3300046660 Bacteria 1255
417 Ga0495625_0223534 3300046660 Bacteria 1232
418 Ga0495661_0033658 3300046665 Bacteria 3231
419 Ga0495661_0128037 3300046665 Bacteria 1394
420 Ga0495588_0014578 3300046674 Bacteria 3763
421 Ga0495669_0032435 3300046684 Bacteria 2296
422 Ga0495670_0022329 3300046691 Bacteria 3124
423 Ga0495671_0082758 3300046692 Bacteria 1573
424 Ga0495649_0011304 3300046694 Bacteria 5241
425 Ga0495649_0045411 3300046694 Bacteria 2395
426 Ga0495649_0061696 3300046694 Bacteria 2016
427 Ga0495649_0095780 3300046694 Bacteria 1580
428 Ga0495589_0005121 3300046794 Bacteria 6936
429 Ga0495589_0024415 3300046794 Bacteria 3072
430 Ga0495660_0011379 3300046810 Bacteria 5166
431 Ga0495660_0015387 3300046810 Bacteria 4420
432 Ga0495660_0044555 3300046810 Bacteria 2440
433 Ga0495660_0116655 3300046810 Bacteria 1356
434 Ga0495660_0207633 3300046810 Bacteria 931
435 Ga0495672_0061166 3300047320 Bacteria 2171
436 Ga0495687_027801 3300047443 Bacteria 2641
437 Ga0495677_0006203 3300047445 Bacteria 4517
438 Ga0495679_116906 3300047446 Bacteria 731
439 Ga0495685_068146 3300047447 Bacteria 1194
440 Ga0495673_0000243 3300047469 Bacteria 77026
441 Ga0495673_0001921 3300047469 Bacteria 15487
442 Ga0495673_0032589 3300047469 Bacteria 2427
443 Ga0495681_0002453 3300047470 Bacteria 13248
444 Ga0495681_0007214 3300047470 Bacteria 7145
445 Ga0495681_0114463 3300047470 Bacteria 1164
446 Ga0495686_0001183 3300047472 Bacteria 30424
447 Ga0495686_0011273 3300047472 Bacteria 6301
448 Ga0495686_0013882 3300047472 Bacteria 5574
449 Ga0495686_0032379 3300047472 Bacteria 3383
450 Ga0495686_0034421 3300047472 Bacteria 3263
451 Ga0495686_0053471 3300047472 Bacteria 2531
452 Ga0495626_0000005 3300048091 Bacteria 337534
453 Ga0495626_0022855 3300048091 Bacteria 3085
454 Ga0495626_0026649 3300048091 Bacteria 2814
455 Ga0495626_0101622 3300048091 Bacteria 1253
456 Ga0496100_0404129 3300048903 Bacteria 1041
457 Ga0496101_0424195 3300048904 Bacteria 1048
458 Ga0496102_0378775 3300048905 Bacteria 1332
459 Ga0496102_1179393 3300048905 Bacteria 685
460 Ga0496103_0054846 3300048906 Bacteria 2471
461 Ga0496106_0000128 3300048909 Bacteria 58226
462 Ga0496108_0267916 3300048911 Bacteria 1487
463 Ga0496110_0091361 3300048913 Bacteria 2723
464 Ga0496111_0058413 3300048914 Bacteria 2793
465 Ga0496111_0237746 3300048914 Bacteria 1353
466 Ga0496112_0120045 3300048915 Bacteria 2599
467 Ga0496112_0316885 3300048915 Bacteria 1504
468 Ga0496113_0103871 3300048916 Bacteria 2204
469 Ga0496114_0218110 3300048917 Bacteria 1674
470 Ga0496116_0003539 3300048919 Bacteria 15371
471 Ga0496116_0012411 3300048919 Bacteria 6963
472 Ga0496116_0013590 3300048919 Bacteria 6549
473 Ga0496116_0037378 3300048919 Bacteria 3386
474 Ga0496116_0256223 3300048919 Bacteria 867
475 Ga0496117_0065358 3300048920 Bacteria 2474
476 Ga0496117_0104860 3300048920 Bacteria 1778
477 Ga0496118_0067336 3300048921 Bacteria 2608
478 Ga0496118_0069457 3300048921 Bacteria 2551
479 Ga0496118_0185131 3300048921 Bacteria 1253
480 Ga0496118_0224259 3300048921 Bacteria 1091
481 Ga0496119_0088072 3300048922 Bacteria 1771
482 Ga0496119_0233240 3300048922 Bacteria 935
483 Ga0496120_0082741 3300048923 Bacteria 1734
484 Ga0496121_0000115 3300048924 Bacteria 178411
485 Ga0496121_0000732 3300048924 Bacteria 60492
486 Ga0496121_0003073 3300048924 Bacteria 24180
487 Ga0496121_0003099 3300048924 Bacteria 24038
488 Ga0496121_0009567 3300048924 Bacteria 11105
489 Ga0496121_0019771 3300048924 Bacteria 6712
490 Ga0496121_0023911 3300048924 Bacteria 5860
491 Ga0496121_0087448 3300048924 Bacteria 2447
492 Ga0496121_0108896 3300048924 Bacteria 2118
493 Ga0496121_0164941 3300048924 Bacteria 1616
494 Ga0496121_0200413 3300048924 Bacteria 1423
495 Ga0496121_0293755 3300048924 Bacteria 1106
496 Ga0496121_0445888 3300048924 Bacteria 835
497 Ga0496122_0002345 3300048925 Bacteria 27302
498 Ga0496122_0003047 3300048925 Bacteria 22665
499 Ga0496122_0004149 3300048925 Bacteria 18287
500 Ga0496122_0006437 3300048925 Bacteria 13481
501 Ga0496122_0022551 3300048925 Bacteria 5590
502 Ga0496122_0024625 3300048925 Bacteria 5261
503 Ga0496122_0033637 3300048925 Bacteria 4212
504 Ga0496122_0056585 3300048925 Bacteria 2922
505 Ga0496122_0106500 3300048925 Bacteria 1856
506 Ga0496123_0001894 3300048926 Bacteria 27302
507 Ga0496123_0002119 3300048926 Bacteria 25445
508 Ga0496123_0002549 3300048926 Bacteria 22213
509 Ga0496123_0004684 3300048926 Bacteria 14173
510 Ga0496123_0017127 3300048926 Bacteria 5847
511 Ga0496123_0023010 3300048926 Bacteria 4784
512 Ga0496123_0155944 3300048926 Unclassified 1224
513 Ga0496123_0191780 3300048926 Bacteria 1056
514 Ga0496123_0285417 3300048926 Bacteria 795
515 Ga0496123_0323993 3300048926 Bacteria 726
516 Ga0496124_0000006 3300048927 Bacteria 904259
517 Ga0496124_0002110 3300048927 Bacteria 26805
518 Ga0496124_0006984 3300048927 Bacteria 12110
519 Ga0496124_0013347 3300048927 Bacteria 8027
520 Ga0496124_0015566 3300048927 Bacteria 7282
521 Ga0496124_0036011 3300048927 Bacteria 4323
522 Ga0496124_0064129 3300048927 Bacteria 3068
523 Ga0496124_0069909 3300048927 Bacteria 2913
524 Ga0496124_0175490 3300048927 Bacteria 1655
525 Ga0496124_0317854 3300048927 Unclassified 1116
526 Ga0496124_0329822 3300048927 Bacteria 1089
527 Ga0496124_0434379 3300048927 Bacteria 900
528 Ga0496124_0451068 3300048927 Bacteria 877
529 Ga0496125_0000989 3300048928 Bacteria 44313
530 Ga0496125_0003290 3300048928 Bacteria 19824
531 Ga0496125_0005889 3300048928 Bacteria 13437
532 Ga0496125_0054813 3300048928 Bacteria 3255
533 Ga0496125_0071584 3300048928 Bacteria 2707
534 Ga0496125_0109079 3300048928 Bacteria 2011
535 Ga0496125_0184735 3300048928 Bacteria 1384
536 Ga0496125_0241744 3300048928 Bacteria 1146
537 Ga0496125_0343223 3300048928 Bacteria 895
538 Ga0496126_0002733 3300048929 Bacteria 23320
539 Ga0496126_0002943 3300048929 Bacteria 22129
540 Ga0496126_0008699 3300048929 Bacteria 10901
541 Ga0496126_0113740 3300048929 Bacteria 2355
542 Ga0496126_0129931 3300048929 Bacteria 2177
543 Ga0496126_0148142 3300048929 Bacteria 2014
544 Ga0496126_0166514 3300048929 Bacteria 1881
545 Ga0496126_0348803 3300048929 Bacteria 1211
546 Ga0496126_0418313 3300048929 Bacteria 1084
547 Ga0495678_085823 3300049459 Bacteria 1120
548 Ga0495678_140902 3300049459 Bacteria 789
549 Ga0495682_0002858 3300049460 Bacteria 7948
550 Ga0495682_0005105 3300049460 Bacteria 5502
551 Ga0495682_0154738 3300049460 Bacteria 817
552 Ga0501034_0072221 3300049571 Bacteria 3459
553 Ga0501034_0117686 3300049571 Bacteria 2645
554 Ga0501034_0342867 3300049571 Bacteria 1424
555 Ga0501036_0106295 3300049572 Bacteria 2374
556 Ga0501036_0179945 3300049572 Bacteria 1780
557 Ga0501037_0086717 3300049573 Bacteria 2266
558 Ga0501039_0225718 3300049575 Bacteria 1472
559 Ga0501040_0888174 3300049576 Bacteria 645
560 Ga0501043_0011739 3300049579 Bacteria 6860
561 Ga0501043_0425390 3300049579 Bacteria 1001
562 Ga0501238_005046 3300049671 Bacteria 1664
563 Ga0501035_0522056 3300049822 Bacteria 975
564 nmdc:mga03683_38234_c1 3300050489 Bacteria 1512
565 nmdc:mga03n38_24298_c1 3300050490 Bacteria 2476
566 nmdc:mga00v17_278059_c1 3300050491 Bacteria 1087
567 nmdc:mga00v17_79470_c1 3300050491 Bacteria 2045
568 nmdc:mga0yw44_232903_c1 3300050492 Bacteria 1223
569 nmdc:mga0yw44_42549_c1 3300050492 Bacteria 2709
570 nmdc:mga0yw44_45675_c1 3300050492 Bacteria 2627
571 nmdc:mga0k408_22463_c1 3300050493 Bacteria 3552
572 nmdc:mga06z11_123663_c1 3300050494 Bacteria 1446
573 nmdc:mga06z11_14867_c1 3300050494 Bacteria 3459
574 nmdc:mga06z11_149601_c1 3300050494 Bacteria 1326
575 nmdc:mga06z11_265596_c1 3300050494 Bacteria 1014
576 nmdc:mga06z11_540624_c1 3300050494 Bacteria 707
577 nmdc:mga04h51_55368_c1 3300050495 Bacteria 1343
578 nmdc:mga04h51_73920_c1 3300050495 Bacteria 1196
579 nmdc:mga07m45_123254_c1 3300050496 Bacteria 1498
580 nmdc:mga07m45_140417_c1 3300050496 Bacteria 1399
581 nmdc:mga07m45_198735_c1 3300050496 Bacteria 1166
582 nmdc:mga07m45_23192_c1 3300050496 Bacteria 3391
583 nmdc:mga07m45_30862_c1 3300050496 Bacteria 2969
584 nmdc:mga07m45_65164_c1 3300050496 Bacteria 2068
585 nmdc:mga0sz30_105200_c1 3300050516 Bacteria 1234
586 nmdc:mga0sz30_109349_c1 3300050516 Bacteria 1211
587 nmdc:mga0sz30_267815_c1 3300050516 Bacteria 761
588 nmdc:mga0sz30_50858_c1 3300050516 Bacteria 1757
589 Ga0500578_0052014 3300053086 Bacteria 2623
590 Ga0500578_0226559 3300053086 Bacteria 1134
591 Ga0500644_0003082 3300053088 Bacteria 4130
592 Ga0500583_0032819 3300053092 Bacteria 2293
593 Ga0500566_0004935 3300053094 Bacteria 7949
594 Ga0500555_023376 3300053103 Bacteria 1773
595 Ga0500562_007425 3300053108 Bacteria 2765
596 Ga0500562_095712 3300053108 Bacteria 807
597 Ga0500594_0011681 3300053118 Bacteria 2053
598 Ga0500595_001365 3300053119 Bacteria 13120
599 Ga0500614_020700 3300053123 Unclassified 1521
600 Ga0500618_000157 3300053125 Bacteria 56116
601 Ga0500618_000364 3300053125 Bacteria 31481
602 Ga0500618_006259 3300053125 Bacteria 3514
603 Ga0500618_009728 3300053125 Bacteria 2613
604 Ga0500642_0067534 3300053130 Bacteria 1620
605 Ga0500655_006895 3300053133 Bacteria 2044
606 Ga0500655_032332 3300053133 Unclassified 1010
607 Ga0500658_0002753 3300053134 Bacteria 6759
608 Ga0500658_0053275 3300053134 Bacteria 1659
609 Ga0500564_059167 3300053138 Bacteria 1741
610 Ga0500564_174455 3300053138 Bacteria 901
611 Ga0500568_0001525 3300053139 Bacteria 14748
612 Ga0500568_0007325 3300053139 Bacteria 5424
613 Ga0500586_000032 3300053145 Bacteria 24537
614 Ga0500586_000214 3300053145 Bacteria 11404
615 Ga0500603_001447 3300053150 Bacteria 5420
616 Ga0500604_0001630 3300053151 Bacteria 6305
617 Ga0500616_0000066 3300053153 Bacteria 237304
618 Ga0500616_0000104 3300053153 Bacteria 159954
619 Ga0500616_0004850 3300053153 Bacteria 9389
620 Ga0500616_0015076 3300053153 Bacteria 4428
621 Ga0500616_0027363 3300053153 Bacteria 3148
622 Ga0500616_0035345 3300053153 Bacteria 2718
623 Ga0500616_0106963 3300053153 Bacteria 1357
624 Ga0500620_075416 3300053155 Bacteria 1164
625 Ga0500622_0001635 3300053156 Bacteria 17534
626 Ga0500622_0001984 3300053156 Bacteria 15344
627 Ga0500622_0026539 3300053156 Bacteria 3056
628 Ga0500627_0001791 3300053158 Bacteria 6107
629 Ga0500627_0131148 3300053158 Bacteria 1132
630 Ga0500627_0138542 3300053158 Bacteria 1099
631 Ga0500627_0245753 3300053158 Bacteria 793
632 Ga0500633_0000139 3300053160 Bacteria 9642
633 Ga0500661_010391 3300055283 Bacteria 1696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0424195 Ga0496101_0424195_22_552 176
2 3300041411 Ga0439466_0000152 Ga0439466_0000152_21112_21717 184
3 3300041413 Ga0439465_0000115 Ga0439465_0000115_13023_13628 184
4 3300041997 Ga0439431_0003810 Ga0439431_0003810_1457_2062 184
5 3300042004 Ga0439445_0004610 Ga0439445_0004610_1273_1878 184
6 iso_pu_bacteria 2503198000 2503203128 187
7 3300003781 Ga0055536_1005082 Ga0055536_10050824 189
8 3300025292 Ga0209676_1000138 Ga0209676_10001384 189
9 3300025298 Ga0209050_1028567 Ga0209050_10285671 189
10 3300048929 Ga0496126_0166514 Ga0496126_0166514_748_1317 189
11 3300053153 Ga0500616_0027363 Ga0500616_0027363_1791_2363 189
12 iso_pu_bacteria 2510917030 2511195007 189
13 iso_pu_bacteria 2582581298 2585221888 189
14 iso_pu_bacteria 2585427529 2585543942 189
15 iso_pu_bacteria 2791355267 2793367180 189
16 iso_pu_bacteria 2852387548 2852391826 189
17 iso_pu_bacteria 2909399089 2909400818 189
18 iso_pu_bacteria 2919100787 2919103142 189
19 iso_pu_bacteria 8046767195 8046767338 189
20 iso_pu_bacteria 8056375014 8056378839 189
21 iso_pu_bacteria 8057575449 8057580112 189
22 3300015262 Ga0182007_10005652 Ga0182007_100056527 190
23 3300015265 Ga0182005_1004353 Ga0182005_10043535 190
24 3300027111 Ga0209281_1000194 Ga0209281_1000194112 190
25 3300032002 Ga0307416_101389291 Ga0307416_1013892911 190
26 3300048927 Ga0496124_0175490 Ga0496124_0175490_14_586 190
27 iso_pu_bacteria 2510461069 2510840626 190
28 iso_pu_bacteria 2524023209 2524458577 190
29 iso_pu_bacteria 2524023250 2524612861 190
30 iso_pu_bacteria 2643221645 2644251640 190
31 iso_pu_bacteria 2643221664 2644358181 190
32 iso_pu_bacteria 2738541300 2738845434 190
33 iso_pu_bacteria 2738543018 2739276487 190
34 iso_pu_bacteria 2738543030 2739345531 190
35 iso_pu_bacteria 2841760612 2841766319 190
36 iso_pu_bacteria 2842298080 2842300162 190
37 iso_pu_bacteria 2842357229 2842359073 190
38 iso_pu_bacteria 2844104063 2844106085 190
39 iso_pu_bacteria 2851182111 2851186590 190
40 iso_pu_bacteria 2851246043 2851246441 190
41 iso_pu_bacteria 2854911287 2854914714 190
42 iso_pu_bacteria 2857564685 2857567125 190
43 iso_pu_bacteria 2899803654 2899806758 190
44 iso_pu_bacteria 2989776772 2989779518 190
45 iso_pu_bacteria 8001845381 8001845874 190
46 3300003771 Ga0055526_1002360 Ga0055526_100236016 191
47 3300003773 Ga0055537_1000103 Ga0055537_100010315 191
48 3300003775 Ga0055524_1006641 Ga0055524_10066416 191
49 3300003784 Ga0055534_1000317 Ga0055534_100031723 191
50 3300003790 Ga0055528_1000031 Ga0055528_100003171 191
51 3300009177 Ga0105248_10596640 Ga0105248_105966402 191
52 3300025263 Ga0209565_1000035 Ga0209565_1000035111 191
53 3300025273 Ga0209673_1000006 Ga0209673_1000006201 191
54 3300025291 Ga0209675_1000005 Ga0209675_1000005571 191
55 3300025295 Ga0209564_1000083 Ga0209564_100008365 191
56 3300025299 Ga0209256_1000141 Ga0209256_100014147 191
57 iso_pu_bacteria 2510065019 2510131908 191
58 iso_pu_bacteria 2510461076 2510898223 191
59 iso_pu_bacteria 2510917026 2511169774 191
60 iso_pu_bacteria 2512875016 2512933840 191
61 iso_pu_bacteria 2513237088 2513601079 191
62 iso_pu_bacteria 2513237090 2513614464 191
63 iso_pu_bacteria 2513237093 2513634666 191
64 iso_pu_bacteria 2513237103 2513709587 191
65 iso_pu_bacteria 2513237138 2513865999 191
66 iso_pu_bacteria 2513237162 2514022985 191
67 iso_pu_bacteria 2515075009 2515110872 191
68 iso_pu_bacteria 2515154113 2515638605 191
69 iso_pu_bacteria 2515154114 2515645723 191
70 iso_pu_bacteria 2515154116 2515661999 191
71 iso_pu_bacteria 2516653077 2517039560 191
72 iso_pu_bacteria 2517093000 2517093698 191
73 iso_pu_bacteria 2517287029 2517405482 191
74 iso_pu_bacteria 2529292951 2530644276 191
75 iso_pu_bacteria 2534681796 2535517650 191
76 iso_pu_bacteria 2558860242 2559298582 191
77 iso_pu_bacteria 2582581867 2585404256 191
78 iso_pu_bacteria 2585427528 2585540025 191
79 iso_pu_bacteria 2585427590 2585823188 191
80 iso_pu_bacteria 2585427593 2585838006 191
81 iso_pu_bacteria 2585427608 2585900105 191
82 iso_pu_bacteria 2585427633 2585997597 191
83 iso_pu_bacteria 2588253730 2588519934 191
84 iso_pu_bacteria 2599185156 2599336344 191
85 iso_pu_bacteria 2599185210 2599606289 191
86 iso_pu_bacteria 2599185236 2599722712 191
87 iso_pu_bacteria 2643221689 2644500976 191
88 iso_pu_bacteria 2724679232 2725951022 191
89 iso_pu_bacteria 2738541293 2738805702 191
90 iso_pu_bacteria 2738541333 2739034892 191
91 iso_pu_bacteria 2765235802 2765468886 191
92 iso_pu_bacteria 2791355123 2792745510 191
93 iso_pu_bacteria 2791355263 2793344296 191
94 iso_pu_bacteria 2802429633 2806044179 191
95 iso_pu_bacteria 2802429634 2806052009 191
96 iso_pu_bacteria 2802429635 2806058311 191
97 iso_pu_bacteria 2802429636 2806069215 191
98 iso_pu_bacteria 2802429637 2806074542 191
99 iso_pu_bacteria 2818991439 2819561655 191
100 iso_pu_bacteria 2838029111 2838033561 191
101 iso_pu_bacteria 2838042994 2838043813 191
102 iso_pu_bacteria 2838742623 2838743791 191
103 iso_pu_bacteria 2839993093 2839996276 191
104 iso_pu_bacteria 2839993093 2839997321 191
105 iso_pu_bacteria 2842110456 2842117163 191
106 iso_pu_bacteria 2842217011 2842220957 191
107 iso_pu_bacteria 2842257432 2842260095 191
108 iso_pu_bacteria 2842304105 2842307178 191
109 iso_pu_bacteria 2842475841 2842480167 191
110 iso_pu_bacteria 2842502639 2842508047 191
111 iso_pu_bacteria 2842922631 2842927908 191
112 iso_pu_bacteria 2856364286 2856369799 191
113 iso_pu_bacteria 2857349434 2857353005 191
114 iso_pu_bacteria 2869285874 2869290605 191
115 iso_pu_bacteria 2871429161 2871432887 191
116 iso_pu_bacteria 2874123672 2874130262 191
117 iso_pu_bacteria 2874146452 2874153952 191
118 iso_pu_bacteria 2874155637 2874158639 191
119 iso_pu_bacteria 2876363079 2876363904 191
120 iso_pu_bacteria 2876369609 2876371512 191
121 iso_pu_bacteria 2876413966 2876419256 191
122 iso_pu_bacteria 2878745973 2878750501 191
123 iso_pu_bacteria 2881147464 2881148273 191
124 iso_pu_bacteria 2888350351 2888353276 191
125 iso_pu_bacteria 2889016732 2889019931 191
126 iso_pu_bacteria 2903448605 2903454015 191
127 iso_pu_bacteria 2903492973 2903499654 191
128 iso_pu_bacteria 2903521522 2903525937 191
129 iso_pu_bacteria 2903528002 2903532517 191
130 iso_pu_bacteria 2906308376 2906313426 191
131 iso_pu_bacteria 2906321335 2906326134 191
132 iso_pu_bacteria 2909042592 2909046047 191
133 iso_pu_bacteria 2919171160 2919177422 191
134 iso_pu_bacteria 2922130491 2922133188 191
135 iso_pu_bacteria 2922185730 2922189283 191
136 iso_pu_bacteria 2924762789 2924767051 191
137 iso_pu_bacteria 2936367885 2936368534 191
138 iso_pu_bacteria 2936367885 2936371347 191
139 iso_pu_bacteria 2936375103 2936375451 191
140 iso_pu_bacteria 2936375103 2936376373 191
141 iso_pu_bacteria 2937813078 2937820270 191
142 iso_pu_bacteria 2937822353 2937827625 191
143 iso_pu_bacteria 2937848649 2937850107 191
144 iso_pu_bacteria 2958041894 2958055798 191
145 iso_pu_bacteria 2958100919 2958102102 191
146 iso_pu_bacteria 2958130278 2958135006 191
147 iso_pu_bacteria 2958179912 2958184035 191
148 iso_pu_bacteria 2961077736 2961082090 191
149 iso_pu_bacteria 2963644680 2963645362 191
150 iso_pu_bacteria 2965119406 2965127179 191
151 iso_pu_bacteria 2968083720 2968089741 191
152 iso_pu_bacteria 2968117919 2968122586 191
153 iso_pu_bacteria 2977843712 2977847037 191
154 iso_pu_bacteria 2977942078 2977943280 191
155 iso_pu_bacteria 2977986579 2977992121 191
156 iso_pu_bacteria 2979710463 2979714688 191
157 iso_pu_bacteria 2979742915 2979748206 191
158 iso_pu_bacteria 2984509177 2984514253 191
159 iso_pu_bacteria 2984518228 2984523284 191
160 iso_pu_bacteria 2984537506 2984542694 191
161 iso_pu_bacteria 2987636660 2987641598 191
162 iso_pu_bacteria 2987652177 2987656308 191
163 iso_pu_bacteria 2987666974 2987671583 191
164 iso_pu_bacteria 3000135777 3000136609 191
165 iso_pu_bacteria 3004203850 3004209591 191
166 iso_pu_bacteria 3004211236 3004216941 191
167 iso_pu_bacteria 3004218560 3004225465 191
168 iso_pu_bacteria 3004334049 3004337227 191
169 iso_pu_bacteria 637000159 637076951 191
170 iso_pu_bacteria 639633055 639647105 191
171 iso_pu_bacteria 8004387939 8004392895 191
172 iso_pu_bacteria 8004714634 8004719682 191
173 iso_pu_bacteria 8005376324 8005377028 191
174 iso_pu_bacteria 8005460587 8005461511 191
175 iso_pu_bacteria 8005484373 8005487657 191
176 iso_pu_bacteria 8005542996 8005549680 191
177 iso_pu_bacteria 8005556819 8005562759 191
178 iso_pu_bacteria 8005563573 8005570032 191
179 iso_pu_bacteria 8005570704 8005577277 191
180 iso_pu_bacteria 8018163183 8018168559 191
181 iso_pu_bacteria 8024479707 8024480685 191
182 iso_pu_bacteria 8054795415 8054804163 191
183 iso_pu_bacteria 8055909800 8055914992 191
184 iso_pu_bacteria 8057874678 8057881607 191
185 3300003323 rootH1_10217570 rootH1_102175702 192
186 3300005328 Ga0070676_10224910 Ga0070676_102249101 192
187 3300006038 Ga0075365_10523189 Ga0075365_105231891 192
188 3300009551 Ga0105238_11230290 Ga0105238_112302901 192
189 3300010375 Ga0105239_10476348 Ga0105239_104763482 192
190 3300013297 Ga0157378_10415752 Ga0157378_104157522 192
191 3300013307 Ga0157372_10316079 Ga0157372_103160792 192
192 3300014969 Ga0157376_10326539 Ga0157376_103265391 192
193 3300025245 Ga0207425_1000699 Ga0207425_100069911 192
194 3300025294 Ga0209025_1000866 Ga0209025_100086629 192
195 3300025294 Ga0209025_1006828 Ga0209025_10068285 192
196 3300025294 Ga0209025_1039984 Ga0209025_10399842 192
197 3300025297 Ga0209758_1001105 Ga0209758_100110527 192
198 3300025297 Ga0209758_1024193 Ga0209758_10241934 192
199 3300025932 Ga0207690_10236725 Ga0207690_102367252 192
200 3300031901 Ga0307406_10031266 Ga0307406_100312664 192
201 3300032004 Ga0307414_10162646 Ga0307414_101626462 192
202 3300037418 Ga0395900_0084308 Ga0395900_0084308_2343_2921 192
203 3300037418 Ga0395900_0661767 Ga0395900_0661767_123_701 192
204 3300037466 Ga0395898_0239545 Ga0395898_0239545_156_734 192
205 3300044684 Ga0466966_0051844 Ga0466966_0051844_2007_2585 192
206 3300045049 Ga0466959_0030637 Ga0466959_0030637_3140_3718 192
207 3300045836 Ga0466958_0334425 Ga0466958_0334425_315_893 192
208 3300046452 Ga0495617_075637 Ga0495617_075637_261_863 192
209 3300046457 Ga0495590_0046549 Ga0495590_0046549_598_1200 192
210 3300046463 Ga0495653_0000042 Ga0495653_0000042_41539_42117 192
211 3300046471 Ga0495650_0007944 Ga0495650_0007944_2079_2657 192
212 3300046507 Ga0495606_0000087 Ga0495606_0000087_11634_12221 192
213 3300046507 Ga0495606_0000576 Ga0495606_0000576_29092_29670 192
214 3300046507 Ga0495606_0113385 Ga0495606_0113385_601_1179 192
215 3300046522 Ga0495643_0348653 Ga0495643_0348653_44_646 192
216 3300046615 Ga0495656_0084106 Ga0495656_0084106_31_633 192
217 3300046810 Ga0495660_0116655 Ga0495660_0116655_655_1257 192
218 3300047472 Ga0495686_0032379 Ga0495686_0032379_1748_2326 192
219 3300048917 Ga0496114_0218110 Ga0496114_0218110_363_941 192
220 3300048922 Ga0496119_0088072 Ga0496119_0088072_704_1282 192
221 3300048925 Ga0496122_0004149 Ga0496122_0004149_14226_14804 192
222 3300048926 Ga0496123_0002119 Ga0496123_0002119_23752_24330 192
223 3300048926 Ga0496123_0323993 Ga0496123_0323993_31_609 192
224 3300048927 Ga0496124_0002110 Ga0496124_0002110_25276_25854 192
225 3300048927 Ga0496124_0064129 Ga0496124_0064129_1314_1892 192
226 3300048927 Ga0496124_0329822 Ga0496124_0329822_263_841 192
227 3300048928 Ga0496125_0000989 Ga0496125_0000989_38408_38986 192
228 3300048928 Ga0496125_0003290 Ga0496125_0003290_18399_18977 192
229 3300048928 Ga0496125_0184735 Ga0496125_0184735_70_648 192
230 3300048929 Ga0496126_0002943 Ga0496126_0002943_19592_20170 192
231 3300048929 Ga0496126_0148142 Ga0496126_0148142_679_1257 192
232 3300049571 Ga0501034_0342867 Ga0501034_0342867_363_941 192
233 3300053125 Ga0500618_000364 Ga0500618_000364_1796_2374 192
234 3300053138 Ga0500564_059167 Ga0500564_059167_1132_1710 192
235 3300055283 Ga0500661_010391 Ga0500661_010391_443_1021 192
236 3300002739 JGI25158J39367_1000147 JGI25158J39367_10001479 193
237 3300003215 JGI25153J46596_10039892 JGI25153J46596_100398922 193
238 3300003320 rootH2_10299493 rootH2_102994932 193
239 3300003322 rootL2_10107941 rootL2_101079414 193
240 3300003323 rootH1_10035776 rootH1_100357763 193
241 3300003323 rootH1_10142015 rootH1_101420151 193
242 3300003354 JGI25160J50197_1007219 JGI25160J50197_10072195 193
243 3300003374 JGI25161J50226_1000154 JGI25161J50226_100015422 193
244 3300003761 Ga0055535_1007104 Ga0055535_10071042 193
245 3300003771 Ga0055526_1009151 Ga0055526_10091513 193
246 3300003790 Ga0055528_1007257 Ga0055528_10072574 193
247 3300003790 Ga0055528_1013691 Ga0055528_10136912 193
248 3300003792 Ga0055540_1028948 Ga0055540_10289482 193
249 3300003792 Ga0055540_1034201 Ga0055540_10342011 193
250 3300004625 Ga0055543_1000513 Ga0055543_100051321 193
251 3300005327 Ga0070658_10015348 Ga0070658_100153483 193
252 3300005353 Ga0070669_100162007 Ga0070669_1001620072 193
253 3300005455 Ga0070663_100317289 Ga0070663_1003172892 193
254 3300005563 Ga0068855_100005827 Ga0068855_10000582717 193
255 3300006177 Ga0075362_10160809 Ga0075362_101608092 193
256 3300006195 Ga0075366_10074784 Ga0075366_100747842 193
257 3300006353 Ga0075370_10178295 Ga0075370_101782952 193
258 3300009093 Ga0105240_10131078 Ga0105240_101310784 193
259 3300009176 Ga0105242_10688563 Ga0105242_106885632 193
260 3300025208 Ga0209436_100021 Ga0209436_10002121 193
261 3300025231 Ga0207427_102046 Ga0207427_1020466 193
262 3300025233 Ga0209437_100590 Ga0209437_1005909 193
263 3300025242 Ga0209258_100341 Ga0209258_10034156 193
264 3300025245 Ga0207425_1011452 Ga0207425_10114522 193
265 3300025258 Ga0209129_1003333 Ga0209129_10033338 193
266 3300025273 Ga0209673_1001640 Ga0209673_100164010 193
267 3300025273 Ga0209673_1011182 Ga0209673_10111823 193
268 3300025284 Ga0209130_1000019 Ga0209130_100001959 193
269 3300025295 Ga0209564_1001757 Ga0209564_100175722 193
270 3300025297 Ga0209758_1007385 Ga0209758_10073855 193
271 3300025299 Ga0209256_1005526 Ga0209256_10055264 193
272 3300025302 Ga0207426_1000005 Ga0207426_1000005548 193
273 3300025303 Ga0209051_1017527 Ga0209051_10175274 193
274 3300025304 Ga0209257_1074395 Ga0209257_10743951 193
275 3300025913 Ga0207695_10008916 Ga0207695_100089167 193
276 3300025923 Ga0207681_10285995 Ga0207681_102859951 193
277 3300026067 Ga0207678_10456818 Ga0207678_104568183 193
278 3300034820 Ga0373959_0021527 Ga0373959_0021527_135_719 193
279 3300041413 Ga0439465_0170467 Ga0439465_0170467_137_718 193
280 3300046507 Ga0495606_0257742 Ga0495606_0257742_255_836 193
281 3300046694 Ga0495649_0045411 Ga0495649_0045411_1720_2301 193
282 3300048909 Ga0496106_0000128 Ga0496106_0000128_25475_26056 193
283 3300048919 Ga0496116_0013590 Ga0496116_0013590_5124_5705 193
284 3300048921 Ga0496118_0067336 Ga0496118_0067336_1820_2401 193
285 3300048924 Ga0496121_0009567 Ga0496121_0009567_2895_3476 193
286 3300048924 Ga0496121_0445888 Ga0496121_0445888_128_709 193
287 3300048925 Ga0496122_0106500 Ga0496122_0106500_305_886 193
288 3300048926 Ga0496123_0191780 Ga0496123_0191780_226_807 193
289 3300048927 Ga0496124_0013347 Ga0496124_0013347_5353_6060 193
290 3300048928 Ga0496125_0071584 Ga0496125_0071584_894_1475 193
291 3300049459 Ga0495678_140902 Ga0495678_140902_177_758 193
292 3300050494 nmdc:mga06z11_540624_c1 nmdc:mga06z11_540624_c1_13_594 193
293 3300050496 nmdc:mga07m45_198735_c1 nmdc:mga07m45_198735_c1_322_903 193
294 3300050516 nmdc:mga0sz30_105200_c1 nmdc:mga0sz30_105200_c1_262_843 193
295 3300050516 nmdc:mga0sz30_50858_c1 nmdc:mga0sz30_50858_c1_217_798 193
296 3300053134 Ga0500658_0053275 Ga0500658_0053275_967_1548 193
297 3300053139 Ga0500568_0001525 Ga0500568_0001525_2625_3206 193
298 3300053155 Ga0500620_075416 Ga0500620_075416_120_830 193
299 3300053156 Ga0500622_0001984 Ga0500622_0001984_6842_7423 193
300 3300053160 Ga0500633_0000139 Ga0500633_0000139_4525_5235 193
301 iso_pu_bacteria 2871495908 2871499805 193
302 iso_pu_bacteria 2876392853 2876396969 193
303 iso_pu_bacteria 2878760144 2878763969 193
304 iso_pu_bacteria 2878767105 2878770999 193
305 iso_pu_bacteria 2881161766 2881165055 193
306 iso_pu_bacteria 2885305155 2885306929 193
307 iso_pu_bacteria 2885326080 2885331688 193
308 iso_pu_bacteria 2885334103 2885335599 193
309 iso_pu_bacteria 2889010040 2889014993 193
310 iso_pu_bacteria 2903540706 2903544616 193
311 iso_pu_bacteria 2904659560 2904663723 193
312 iso_pu_bacteria 2906354277 2906358336 193
313 iso_pu_bacteria 2937994558 2937998464 193
314 iso_pu_bacteria 2958165035 2958168940 193
315 iso_pu_bacteria 2958172287 2958178159 193
316 iso_pu_bacteria 2961114664 2961119137 193
317 iso_pu_bacteria 2961163497 2961167402 193
318 iso_pu_bacteria 2965018300 2965022224 193
319 iso_pu_bacteria 2968110612 2968114862 193
320 iso_pu_bacteria 2968171901 2968175809 193
321 iso_pu_bacteria 2970554993 2970558813 193
322 iso_pu_bacteria 2987659509 2987663408 193
323 iso_pu_bacteria 3004188549 3004192467 193
324 iso_pu_bacteria 8004640170 8004643836 193
325 3300002987 JGI25159J45721_1000695 JGI25159J45721_10006957 194
326 3300002987 JGI25159J45721_1010227 JGI25159J45721_10102272 194
327 3300003316 rootH1_10017387 rootH1_1001738712 194
328 3300003354 JGI25160J50197_1000022 JGI25160J50197_1000022126 194
329 3300003374 JGI25161J50226_1000024 JGI25161J50226_10000247 194
330 3300003792 Ga0055540_1010940 Ga0055540_10109401 194
331 3300004625 Ga0055543_1000125 Ga0055543_100012550 194
332 3300004625 Ga0055543_1004558 Ga0055543_10045583 194
333 3300005262 Ga0065165_1000051 Ga0065165_100005146 194
334 3300005262 Ga0065165_1000439 Ga0065165_100043922 194
335 3300005617 Ga0068859_100498381 Ga0068859_1004983812 194
336 3300005844 Ga0068862_100188986 Ga0068862_1001889861 194
337 3300005983 Ga0081540_1045274 Ga0081540_10452741 194
338 3300006038 Ga0075365_10036220 Ga0075365_100362205 194
339 3300006186 Ga0075369_10009159 Ga0075369_100091594 194
340 3300006931 Ga0097620_100498403 Ga0097620_1004984031 194
341 3300009036 Ga0105244_10004485 Ga0105244_100044852 194
342 3300010375 Ga0105239_10317884 Ga0105239_103178842 194
343 3300010375 Ga0105239_10857598 Ga0105239_108575981 194
344 3300013306 Ga0163162_10630477 Ga0163162_106304772 194
345 3300014497 Ga0182008_10358043 Ga0182008_103580432 194
346 3300021361 Ga0213872_10060697 Ga0213872_100606971 194
347 3300025284 Ga0209130_1000063 Ga0209130_1000063152 194
348 3300025284 Ga0209130_1000251 Ga0209130_10002517 194
349 3300025294 Ga0209025_1017611 Ga0209025_10176113 194
350 3300025295 Ga0209564_1000007 Ga0209564_1000007922 194
351 3300025299 Ga0209256_1000200 Ga0209256_100020023 194
352 3300025302 Ga0207426_1000082 Ga0207426_1000082139 194
353 3300025302 Ga0207426_1020869 Ga0207426_10208692 194
354 3300025728 Ga0207655_1032856 Ga0207655_10328563 194
355 3300028794 Ga0307515_10126031 Ga0307515_101260312 194
356 3300031548 Ga0307408_100119605 Ga0307408_1001196052 194
357 3300037418 Ga0395900_0143224 Ga0395900_0143224_366_950 194
358 3300037418 Ga0395900_0464805 Ga0395900_0464805_158_742 194
359 3300037466 Ga0395898_0024814 Ga0395898_0024814_3210_3794 194
360 3300037471 Ga0395905_0000708 Ga0395905_0000708_39848_40432 194
361 3300037471 Ga0395905_0120491 Ga0395905_0120491_37_621 194
362 3300037471 Ga0395905_0133883 Ga0395905_0133883_1571_2155 194
363 3300038443 Ga0395901_0066789 Ga0395901_0066789_371_955 194
364 3300039447 Ga0436361_0218161 Ga0436361_0218161_6692_7276 194
365 3300041405 Ga0439438_011759 Ga0439438_011759_71_655 194
366 3300041411 Ga0439466_0000502 Ga0439466_0000502_1777_2361 194
367 3300041411 Ga0439466_0038688 Ga0439466_0038688_937_1521 194
368 3300041413 Ga0439465_0010116 Ga0439465_0010116_2160_2744 194
369 3300042004 Ga0439445_0007696 Ga0439445_0007696_504_1088 194
370 3300042005 Ga0439448_0161039 Ga0439448_0161039_167_751 194
371 3300042010 Ga0439452_010972 Ga0439452_010972_1619_2203 194
372 3300042013 Ga0439456_000415 Ga0439456_000415_3263_3847 194
373 3300042435 Ga0439434_0179732 Ga0439434_0179732_48_632 194
374 3300044658 Ga0466972_0043238 Ga0466972_0043238_711_1295 194
375 3300044658 Ga0466972_0313551 Ga0466972_0313551_120_704 194
376 3300044683 Ga0466965_0091758 Ga0466965_0091758_82_666 194
377 3300044684 Ga0466966_0016349 Ga0466966_0016349_1661_2245 194
378 3300044693 Ga0466961_0058081 Ga0466961_0058081_1168_1752 194
379 3300044719 Ga0466971_0061536 Ga0466971_0061536_634_1218 194
380 3300044765 Ga0466970_0191168 Ga0466970_0191168_133_717 194
381 3300044842 Ga0466957_0097676 Ga0466957_0097676_1230_1814 194
382 3300045049 Ga0466959_0042806 Ga0466959_0042806_707_1291 194
383 3300046457 Ga0495590_0011991 Ga0495590_0011991_1078_1662 194
384 3300046457 Ga0495590_0199904 Ga0495590_0199904_132_716 194
385 3300046458 Ga0495591_027476 Ga0495591_027476_548_1132 194
386 3300046460 Ga0495638_0181671 Ga0495638_0181671_309_896 194
387 3300046471 Ga0495650_0000042 Ga0495650_0000042_119295_119879 194
388 3300046471 Ga0495650_0000101 Ga0495650_0000101_132892_133476 194
389 3300046471 Ga0495650_0051593 Ga0495650_0051593_702_1289 194
390 3300046491 Ga0495584_0005907 Ga0495584_0005907_4707_5291 194
391 3300046491 Ga0495584_0020035 Ga0495584_0020035_2349_2933 194
392 3300046500 Ga0495596_0000094 Ga0495596_0000094_38550_39134 194
393 3300046501 Ga0495607_0018713 Ga0495607_0018713_1730_2314 194
394 3300046501 Ga0495607_0050762 Ga0495607_0050762_1231_1815 194
395 3300046501 Ga0495607_0072404 Ga0495607_0072404_406_990 194
396 3300046501 Ga0495607_0080839 Ga0495607_0080839_284_868 194
397 3300046506 Ga0495583_0018119 Ga0495583_0018119_177_761 194
398 3300046506 Ga0495583_0026708 Ga0495583_0026708_1854_2438 194
399 3300046507 Ga0495606_0000039 Ga0495606_0000039_108856_109440 194
400 3300046507 Ga0495606_0004066 Ga0495606_0004066_7692_8276 194
401 3300046507 Ga0495606_0004183 Ga0495606_0004183_4622_5206 194
402 3300046507 Ga0495606_0010822 Ga0495606_0010822_5125_5709 194
403 3300046507 Ga0495606_0069006 Ga0495606_0069006_956_1540 194
404 3300046507 Ga0495606_0208584 Ga0495606_0208584_206_793 194
405 3300046512 Ga0495610_0002460 Ga0495610_0002460_14606_15190 194
406 3300046512 Ga0495610_0004765 Ga0495610_0004765_1030_1614 194
407 3300046512 Ga0495610_0018020 Ga0495610_0018020_1934_2521 194
408 3300046512 Ga0495610_0082109 Ga0495610_0082109_62_646 194
409 3300046512 Ga0495610_0107157 Ga0495610_0107157_326_916 194
410 3300046513 Ga0495616_0038296 Ga0495616_0038296_1578_2162 194
411 3300046515 Ga0495620_0010126 Ga0495620_0010126_4274_4858 194
412 3300046515 Ga0495620_0060299 Ga0495620_0060299_909_1493 194
413 3300046518 Ga0495631_0012429 Ga0495631_0012429_25_609 194
414 3300046519 Ga0495632_0214626 Ga0495632_0214626_160_744 194
415 3300046520 Ga0495637_0000528 Ga0495637_0000528_172_756 194
416 3300046520 Ga0495637_0007307 Ga0495637_0007307_1839_2423 194
417 3300046520 Ga0495637_0027583 Ga0495637_0027583_150_734 194
418 3300046520 Ga0495637_0030898 Ga0495637_0030898_1668_2252 194
419 3300046522 Ga0495643_0017925 Ga0495643_0017925_694_1278 194
420 3300046522 Ga0495643_0139202 Ga0495643_0139202_46_630 194
421 3300046524 Ga0495648_0002125 Ga0495648_0002125_9154_9738 194
422 3300046528 Ga0495642_0001000 Ga0495642_0001000_4486_5070 194
423 3300046528 Ga0495642_0032721 Ga0495642_0032721_422_1006 194
424 3300046530 Ga0495654_0000038 Ga0495654_0000038_45472_46056 194
425 3300046538 Ga0495609_0011488 Ga0495609_0011488_3311_3895 194
426 3300046542 Ga0495597_0006248 Ga0495597_0006248_5056_5640 194
427 3300046557 Ga0495622_0010327 Ga0495622_0010327_524_1108 194
428 3300046558 Ga0495633_0000446 Ga0495633_0000446_5271_5855 194
429 3300046558 Ga0495633_0001922 Ga0495633_0001922_591_1175 194
430 3300046558 Ga0495633_0007219 Ga0495633_0007219_3402_3986 194
431 3300046616 Ga0495668_0000492 Ga0495668_0000492_36575_37159 194
432 3300046616 Ga0495668_0003911 Ga0495668_0003911_3729_4313 194
433 3300046616 Ga0495668_0003969 Ga0495668_0003969_2911_3495 194
434 3300046660 Ga0495625_0004405 Ga0495625_0004405_1082_1666 194
435 3300046660 Ga0495625_0217047 Ga0495625_0217047_300_884 194
436 3300046665 Ga0495661_0128037 Ga0495661_0128037_57_641 194
437 3300046684 Ga0495669_0032435 Ga0495669_0032435_806_1390 194
438 3300046691 Ga0495670_0022329 Ga0495670_0022329_2441_3025 194
439 3300046692 Ga0495671_0082758 Ga0495671_0082758_517_1104 194
440 3300046694 Ga0495649_0061696 Ga0495649_0061696_1373_1957 194
441 3300046794 Ga0495589_0005121 Ga0495589_0005121_6125_6709 194
442 3300046794 Ga0495589_0024415 Ga0495589_0024415_421_1005 194
443 3300046810 Ga0495660_0011379 Ga0495660_0011379_2181_2765 194
444 3300046810 Ga0495660_0015387 Ga0495660_0015387_3515_4099 194
445 3300046810 Ga0495660_0207633 Ga0495660_0207633_318_911 194
446 3300047445 Ga0495677_0006203 Ga0495677_0006203_42_626 194
447 3300047446 Ga0495679_116906 Ga0495679_116906_110_694 194
448 3300047447 Ga0495685_068146 Ga0495685_068146_583_1167 194
449 3300047469 Ga0495673_0001921 Ga0495673_0001921_12344_12928 194
450 3300047469 Ga0495673_0032589 Ga0495673_0032589_1747_2331 194
451 3300047470 Ga0495681_0007214 Ga0495681_0007214_751_1335 194
452 3300047470 Ga0495681_0114463 Ga0495681_0114463_32_616 194
453 3300047472 Ga0495686_0001183 Ga0495686_0001183_12158_12742 194
454 3300047472 Ga0495686_0011273 Ga0495686_0011273_721_1305 194
455 3300047472 Ga0495686_0034421 Ga0495686_0034421_1447_2034 194
456 3300048091 Ga0495626_0000005 Ga0495626_0000005_81535_82119 194
457 3300048091 Ga0495626_0022855 Ga0495626_0022855_281_865 194
458 3300048091 Ga0495626_0026649 Ga0495626_0026649_307_891 194
459 3300048903 Ga0496100_0404129 Ga0496100_0404129_34_618 194
460 3300048905 Ga0496102_1179393 Ga0496102_1179393_82_666 194
461 3300048906 Ga0496103_0054846 Ga0496103_0054846_348_932 194
462 3300048914 Ga0496111_0237746 Ga0496111_0237746_554_1138 194
463 3300048915 Ga0496112_0120045 Ga0496112_0120045_1230_1814 194
464 3300048916 Ga0496113_0103871 Ga0496113_0103871_589_1173 194
465 3300048919 Ga0496116_0012411 Ga0496116_0012411_6290_6874 194
466 3300048919 Ga0496116_0256223 Ga0496116_0256223_92_676 194
467 3300048920 Ga0496117_0104860 Ga0496117_0104860_969_1553 194
468 3300048921 Ga0496118_0224259 Ga0496118_0224259_417_1001 194
469 3300048923 Ga0496120_0082741 Ga0496120_0082741_810_1394 194
470 3300048924 Ga0496121_0019771 Ga0496121_0019771_5310_5894 194
471 3300048924 Ga0496121_0023911 Ga0496121_0023911_911_1495 194
472 3300048924 Ga0496121_0087448 Ga0496121_0087448_1270_1854 194
473 3300048925 Ga0496122_0022551 Ga0496122_0022551_3971_4555 194
474 3300048925 Ga0496122_0024625 Ga0496122_0024625_4512_5096 194
475 3300048926 Ga0496123_0023010 Ga0496123_0023010_3050_3634 194
476 3300048927 Ga0496124_0000006 Ga0496124_0000006_593076_593660 194
477 3300048927 Ga0496124_0015566 Ga0496124_0015566_1918_2502 194
478 3300048927 Ga0496124_0434379 Ga0496124_0434379_25_609 194
479 3300048927 Ga0496124_0451068 Ga0496124_0451068_246_830 194
480 3300048928 Ga0496125_0241744 Ga0496125_0241744_361_945 194
481 3300048928 Ga0496125_0343223 Ga0496125_0343223_156_740 194
482 3300048929 Ga0496126_0002733 Ga0496126_0002733_16727_17311 194
483 3300048929 Ga0496126_0129931 Ga0496126_0129931_838_1422 194
484 3300049459 Ga0495678_085823 Ga0495678_085823_449_1033 194
485 3300049460 Ga0495682_0002858 Ga0495682_0002858_2835_3419 194
486 3300049460 Ga0495682_0005105 Ga0495682_0005105_3916_4500 194
487 3300049460 Ga0495682_0154738 Ga0495682_0154738_87_671 194
488 3300049576 Ga0501040_0888174 Ga0501040_0888174_13_597 194
489 3300050496 nmdc:mga07m45_23192_c1 nmdc:mga07m45_23192_c1_447_1031 194
490 3300050496 nmdc:mga07m45_30862_c1 nmdc:mga07m45_30862_c1_743_1327 194
491 3300050516 nmdc:mga0sz30_267815_c1 nmdc:mga0sz30_267815_c1_72_656 194
492 3300053088 Ga0500644_0003082 Ga0500644_0003082_2948_3535 194
493 3300053092 Ga0500583_0032819 Ga0500583_0032819_1142_1729 194
494 3300053094 Ga0500566_0004935 Ga0500566_0004935_6642_7235 194
495 3300053103 Ga0500555_023376 Ga0500555_023376_1014_1601 194
496 3300053118 Ga0500594_0011681 Ga0500594_0011681_697_1284 194
497 3300053123 Ga0500614_020700 Ga0500614_020700_391_978 194
498 3300053125 Ga0500618_006259 Ga0500618_006259_2570_3160 194
499 3300053125 Ga0500618_009728 Ga0500618_009728_1926_2516 194
500 3300053130 Ga0500642_0067534 Ga0500642_0067534_266_853 194
501 3300053133 Ga0500655_006895 Ga0500655_006895_571_1158 194
502 3300053133 Ga0500655_032332 Ga0500655_032332_188_775 194
503 3300053138 Ga0500564_174455 Ga0500564_174455_22_615 194
504 3300053145 Ga0500586_000214 Ga0500586_000214_4979_5563 194
505 3300053150 Ga0500603_001447 Ga0500603_001447_3976_4569 194
506 3300053151 Ga0500604_0001630 Ga0500604_0001630_4734_5321 194
507 3300053153 Ga0500616_0035345 Ga0500616_0035345_655_1239 194
508 3300053156 Ga0500622_0001635 Ga0500622_0001635_6240_6827 194
509 3300053156 Ga0500622_0026539 Ga0500622_0026539_2125_2709 194
510 iso_pu_bacteria 2513237084 2513568725 194
511 iso_pu_bacteria 2513237085 2513580601 194
512 iso_pu_bacteria 2515154134 2515743186 194
513 iso_pu_bacteria 2516653085 2517075065 194
514 iso_pu_bacteria 2585427526 2585525227 194
515 iso_pu_bacteria 2765235942 2766062629 194
516 iso_pu_bacteria 2838686498 2838689020 194
517 iso_pu_bacteria 2838729681 2838731315 194
518 iso_pu_bacteria 2841851746 2841857149 194
519 iso_pu_bacteria 2842156927 2842159644 194
520 iso_pu_bacteria 2842163707 2842169485 194
521 iso_pu_bacteria 2842180545 2842183740 194
522 iso_pu_bacteria 2842229732 2842233780 194
523 iso_pu_bacteria 2842243621 2842245255 194
524 iso_pu_bacteria 2842271015 2842278562 194
525 iso_pu_bacteria 2844454524 2844455545 194
526 iso_pu_bacteria 2857516855 2857523296 194
527 iso_pu_bacteria 2933570622 2933572708 194
528 iso_pu_bacteria 2933586486 2933593318 194
529 iso_pu_bacteria 2935901341 2935906712 194
530 iso_pu_bacteria 8005307578 8005310932 194
531 iso_pu_bacteria 8023680758 8023687391 194
532 3300001989 JGI24739J22299_10143181 JGI24739J22299_101431812 195
533 3300002705 JGI25156J39149_1007065 JGI25156J39149_10070652 195
534 3300002741 JGI25157J39369_1001441 JGI25157J39369_10014412 195
535 3300002773 JGI25152J39213_1000001 JGI25152J39213_1000001157 195
536 3300002773 JGI25152J39213_1009455 JGI25152J39213_10094552 195
537 3300002774 JGI25150J39212_1000007 JGI25150J39212_100000776 195
538 3300003187 JGI25151J46595_10000013 JGI25151J46595_1000001377 195
539 3300003187 JGI25151J46595_10002485 JGI25151J46595_100024858 195
540 3300003187 JGI25151J46595_10004416 JGI25151J46595_100044167 195
541 3300003214 JGI25165J46597_1000079 JGI25165J46597_100007946 195
542 3300003215 JGI25153J46596_10000640 JGI25153J46596_1000064014 195
543 3300003215 JGI25153J46596_10005600 JGI25153J46596_100056002 195
544 3300003215 JGI25153J46596_10011017 JGI25153J46596_100110176 195
545 3300003215 JGI25153J46596_10037408 JGI25153J46596_100374081 195
546 3300003354 JGI25160J50197_1001505 JGI25160J50197_10015053 195
547 3300003374 JGI25161J50226_1003426 JGI25161J50226_10034262 195
548 3300003752 Ga0055539_1003522 Ga0055539_10035223 195
549 3300003762 Ga0055542_1001962 Ga0055542_10019626 195
550 3300003763 Ga0055529_1004114 Ga0055529_10041142 195
551 3300003771 Ga0055526_1018520 Ga0055526_10185203 195
552 3300003775 Ga0055524_1001735 Ga0055524_10017356 195
553 3300003775 Ga0055524_1018190 Ga0055524_10181902 195
554 3300003790 Ga0055528_1006346 Ga0055528_10063465 195
555 3300003790 Ga0055528_1016425 Ga0055528_10164253 195
556 3300004625 Ga0055543_1001652 Ga0055543_10016529 195
557 3300005262 Ga0065165_1005437 Ga0065165_10054376 195
558 3300005262 Ga0065165_1081622 Ga0065165_10816221 195
559 3300005327 Ga0070658_10440893 Ga0070658_104408932 195
560 3300005331 Ga0070670_100000133 Ga0070670_10000013355 195
561 3300005355 Ga0070671_100013556 Ga0070671_1000135562 195
562 3300005367 Ga0070667_100032879 Ga0070667_1000328792 195
563 3300005367 Ga0070667_100433010 Ga0070667_1004330101 195
564 3300005466 Ga0070685_10481149 Ga0070685_104811491 195
565 3300005539 Ga0068853_100087342 Ga0068853_1000873421 195
566 3300005539 Ga0068853_100370186 Ga0068853_1003701861 195
567 3300005548 Ga0070665_100004155 Ga0070665_10000415510 195
568 3300005577 Ga0068857_101013580 Ga0068857_1010135801 195
569 3300005616 Ga0068852_100295556 Ga0068852_1002955562 195
570 3300005841 Ga0068863_100013407 Ga0068863_1000134072 195
571 3300005843 Ga0068860_100244881 Ga0068860_1002448813 195
572 3300006038 Ga0075365_10015925 Ga0075365_100159258 195
573 3300006038 Ga0075365_10034333 Ga0075365_100343332 195
574 3300006042 Ga0075368_10069582 Ga0075368_100695822 195
575 3300006042 Ga0075368_10074203 Ga0075368_100742032 195
576 3300006048 Ga0075363_100089068 Ga0075363_1000890682 195
577 3300006048 Ga0075363_100246756 Ga0075363_1002467562 195
578 3300006048 Ga0075363_100285269 Ga0075363_1002852692 195
579 3300006051 Ga0075364_10158518 Ga0075364_101585182 195
580 3300006177 Ga0075362_10013087 Ga0075362_100130875 195
581 3300006177 Ga0075362_10086383 Ga0075362_100863832 195
582 3300006178 Ga0075367_10050070 Ga0075367_100500705 195
583 3300006178 Ga0075367_10053778 Ga0075367_100537783 195
584 3300006178 Ga0075367_10155947 Ga0075367_101559472 195
585 3300006186 Ga0075369_10009605 Ga0075369_100096053 195
586 3300006186 Ga0075369_10019280 Ga0075369_100192805 195
587 3300006186 Ga0075369_10115653 Ga0075369_101156531 195
588 3300006195 Ga0075366_10202987 Ga0075366_102029871 195
589 3300006353 Ga0075370_10024096 Ga0075370_100240966 195
590 3300006353 Ga0075370_10063254 Ga0075370_100632542 195
591 3300006353 Ga0075370_10381898 Ga0075370_103818982 195
592 3300009093 Ga0105240_10031594 Ga0105240_100315942 195
593 3300009093 Ga0105240_10118452 Ga0105240_101184525 195
594 3300009093 Ga0105240_10527314 Ga0105240_105273142 195
595 3300009174 Ga0105241_10545483 Ga0105241_105454832 195
596 3300009176 Ga0105242_10591399 Ga0105242_105913992 195
597 3300009177 Ga0105248_10219814 Ga0105248_102198143 195
598 3300009545 Ga0105237_10032528 Ga0105237_100325285 195
599 3300009545 Ga0105237_10174637 Ga0105237_101746373 195
600 3300009545 Ga0105237_10220033 Ga0105237_102200332 195
601 3300009545 Ga0105237_10349530 Ga0105237_103495302 195
602 3300009551 Ga0105238_10155985 Ga0105238_101559853 195
603 3300009766 Ga0123342_1009171 Ga0123342_100917111 195
604 3300009986 Ga0105033_102193 Ga0105033_1021932 195
605 3300010375 Ga0105239_10128575 Ga0105239_101285752 195
606 3300010375 Ga0105239_10214198 Ga0105239_102141983 195
607 3300010375 Ga0105239_10291625 Ga0105239_102916252 195
608 3300010375 Ga0105239_10395079 Ga0105239_103950792 195
609 3300010375 Ga0105239_10581782 Ga0105239_105817822 195
610 3300013100 Ga0157373_10072471 Ga0157373_100724712 195
611 3300013102 Ga0157371_10024423 Ga0157371_100244234 195
612 3300013105 Ga0157369_10307003 Ga0157369_103070032 195
613 3300013297 Ga0157378_10707947 Ga0157378_107079471 195
614 3300013307 Ga0157372_10481303 Ga0157372_104813032 195
615 3300014325 Ga0163163_10087771 Ga0163163_100877714 195
616 3300014325 Ga0163163_11040635 Ga0163163_110406351 195
617 3300014497 Ga0182008_10139732 Ga0182008_101397322 195
618 3300014969 Ga0157376_10236718 Ga0157376_102367182 195
619 3300015262 Ga0182007_10006344 Ga0182007_100063446 195
620 3300015265 Ga0182005_1005418 Ga0182005_10054186 195
621 3300017792 Ga0163161_10555417 Ga0163161_105554172 195
622 3300022739 Ga0228711_1004434 Ga0228711_100443422 195
623 3300022740 Ga0228710_1004658 Ga0228710_100465823 195
624 3300025245 Ga0207425_1000032 Ga0207425_100003274 195
625 3300025245 Ga0207425_1002075 Ga0207425_10020754 195
626 3300025245 Ga0207425_1007448 Ga0207425_10074485 195
627 3300025250 Ga0209026_1000118 Ga0209026_1000118128 195
628 3300025253 Ga0209677_100364 Ga0209677_10036421 195
629 3300025254 Ga0209148_1000212 Ga0209148_100021222 195
630 3300025256 Ga0209759_1000076 Ga0209759_1000076171 195
631 3300025258 Ga0209129_1000056 Ga0209129_100005674 195
632 3300025258 Ga0209129_1000149 Ga0209129_100014936 195
633 3300025258 Ga0209129_1004094 Ga0209129_10040948 195
634 3300025258 Ga0209129_1014147 Ga0209129_10141472 195
635 3300025261 Ga0209233_1000247 Ga0209233_100024744 195
636 3300025261 Ga0209233_1000250 Ga0209233_100025064 195
637 3300025272 Ga0209455_1000170 Ga0209455_100017066 195
638 3300025273 Ga0209673_1002960 Ga0209673_10029603 195
639 3300025273 Ga0209673_1010222 Ga0209673_10102225 195
640 3300025273 Ga0209673_1013245 Ga0209673_10132452 195
641 3300025273 Ga0209673_1052102 Ga0209673_10521021 195
642 3300025291 Ga0209675_1033682 Ga0209675_10336822 195
643 3300025294 Ga0209025_1000090 Ga0209025_100009074 195
644 3300025294 Ga0209025_1000205 Ga0209025_1000205125 195
645 3300025294 Ga0209025_1000253 Ga0209025_10002538 195
646 3300025295 Ga0209564_1002391 Ga0209564_100239118 195
647 3300025295 Ga0209564_1018387 Ga0209564_10183873 195
648 3300025297 Ga0209758_1000084 Ga0209758_100008474 195
649 3300025297 Ga0209758_1000296 Ga0209758_10002968 195
650 3300025297 Ga0209758_1000567 Ga0209758_100056760 195
651 3300025297 Ga0209758_1003899 Ga0209758_10038993 195
652 3300025297 Ga0209758_1009542 Ga0209758_10095421 195
653 3300025297 Ga0209758_1010105 Ga0209758_10101058 195
654 3300025299 Ga0209256_1003442 Ga0209256_100344210 195
655 3300025299 Ga0209256_1015501 Ga0209256_10155012 195
656 3300025302 Ga0207426_1000538 Ga0207426_100053836 195
657 3300025303 Ga0209051_1050104 Ga0209051_10501042 195
658 3300025904 Ga0207647_10031287 Ga0207647_100312872 195
659 3300025904 Ga0207647_10187446 Ga0207647_101874462 195
660 3300025911 Ga0207654_10145889 Ga0207654_101458892 195
661 3300025913 Ga0207695_10072374 Ga0207695_100723743 195
662 3300025914 Ga0207671_10229575 Ga0207671_102295752 195
663 3300025919 Ga0207657_10550164 Ga0207657_105501642 195
664 3300025924 Ga0207694_10098844 Ga0207694_100988442 195
665 3300025924 Ga0207694_10134079 Ga0207694_101340791 195
666 3300025925 Ga0207650_10000592 Ga0207650_1000059230 195
667 3300025925 Ga0207650_10326419 Ga0207650_103264192 195
668 3300025931 Ga0207644_10001838 Ga0207644_100018387 195
669 3300025986 Ga0207658_10132232 Ga0207658_101322322 195
670 3300025986 Ga0207658_10192846 Ga0207658_101928462 195
671 3300026023 Ga0207677_11148917 Ga0207677_111489171 195
672 3300026041 Ga0207639_10148940 Ga0207639_101489403 195
673 3300026078 Ga0207702_10719312 Ga0207702_107193121 195
674 3300026088 Ga0207641_10006236 Ga0207641_100062363 195
675 3300026116 Ga0207674_10312323 Ga0207674_103123232 195
676 3300027866 Ga0209813_10078746 Ga0209813_100787462 195
677 3300028379 Ga0268266_10093857 Ga0268266_100938571 195
678 3300028381 Ga0268264_10218603 Ga0268264_102186033 195
679 3300032004 Ga0307414_10469113 Ga0307414_104691132 195
680 3300037418 Ga0395900_0059101 Ga0395900_0059101_199_792 195
681 3300038443 Ga0395901_0411471 Ga0395901_0411471_199_792 195
682 3300041413 Ga0439465_0088021 Ga0439465_0088021_284_883 195
683 3300041443 Ga0451789_0536031 Ga0451789_0536031_449_1039 195
684 3300041453 Ga0451797_1166613 Ga0451797_1166613_736_1326 195
685 3300041491 Ga0451833_0974868 Ga0451833_0974868_814_1404 195
686 3300041494 Ga0451837_0287631 Ga0451837_0287631_676_1266 195
687 3300041496 Ga0451839_0896053 Ga0451839_0896053_355_945 195
688 3300041496 Ga0451839_0907431 Ga0451839_0907431_274_864 195
689 3300041498 Ga0451841_0483661 Ga0451841_0483661_355_945 195
690 3300041501 Ga0451845_0285311 Ga0451845_0285311_298_888 195
691 3300041503 Ga0451847_0030482 Ga0451847_0030482_132_722 195
692 3300041503 Ga0451847_0032234 Ga0451847_0032234_353_943 195
693 3300041505 Ga0451849_1090712 Ga0451849_1090712_890_1480 195
694 3300041505 Ga0451849_1413358 Ga0451849_1413358_368_958 195
695 3300041507 Ga0451851_0713013 Ga0451851_0713013_579_1169 195
696 3300041507 Ga0451851_0979460 Ga0451851_0979460_265_855 195
697 3300041509 Ga0451843_0175228 Ga0451843_0175228_47_637 195
698 3300041509 Ga0451843_0179076 Ga0451843_0179076_325_915 195
699 3300041509 Ga0451843_0637164 Ga0451843_0637164_740_1330 195
700 3300041509 Ga0451843_0781011 Ga0451843_0781011_16_606 195
701 3300041512 Ga0451853_2319690 Ga0451853_2319690_2701_3291 195
702 3300041997 Ga0439431_0010346 Ga0439431_0010346_841_1467 195
703 3300042002 Ga0439442_013133 Ga0439442_013133_935_1561 195
704 3300044658 Ga0466972_0022345 Ga0466972_0022345_1474_2073 195
705 3300044683 Ga0466965_0046487 Ga0466965_0046487_63_674 195
706 3300046453 Ga0495627_013893 Ga0495627_013893_122_712 195
707 3300046460 Ga0495638_0000169 Ga0495638_0000169_93848_94438 195
708 3300046471 Ga0495650_0129695 Ga0495650_0129695_72_659 195
709 3300046501 Ga0495607_0004276 Ga0495607_0004276_6971_7573 195
710 3300046501 Ga0495607_0019127 Ga0495607_0019127_2772_3362 195
711 3300046501 Ga0495607_0053369 Ga0495607_0053369_1202_1792 195
712 3300046506 Ga0495583_0025877 Ga0495583_0025877_2045_2635 195
713 3300046506 Ga0495583_0046605 Ga0495583_0046605_367_957 195
714 3300046506 Ga0495583_0222822 Ga0495583_0222822_31_621 195
715 3300046507 Ga0495606_0112336 Ga0495606_0112336_833_1423 195
716 3300046507 Ga0495606_0138844 Ga0495606_0138844_112_699 195
717 3300046507 Ga0495606_0321685 Ga0495606_0321685_144_755 195
718 3300046512 Ga0495610_0062161 Ga0495610_0062161_734_1330 195
719 3300046512 Ga0495610_0090555 Ga0495610_0090555_362_952 195
720 3300046513 Ga0495616_0092503 Ga0495616_0092503_56_646 195
721 3300046515 Ga0495620_0054470 Ga0495620_0054470_836_1426 195
722 3300046515 Ga0495620_0125466 Ga0495620_0125466_37_624 195
723 3300046519 Ga0495632_0225862 Ga0495632_0225862_57_644 195
724 3300046522 Ga0495643_0066315 Ga0495643_0066315_814_1404 195
725 3300046524 Ga0495648_0002883 Ga0495648_0002883_8456_9061 195
726 3300046525 Ga0495663_0090743 Ga0495663_0090743_198_788 195
727 3300046530 Ga0495654_0012778 Ga0495654_0012778_2388_2978 195
728 3300046530 Ga0495654_0180559 Ga0495654_0180559_240_845 195
729 3300046538 Ga0495609_0011230 Ga0495609_0011230_1353_1943 195
730 3300046557 Ga0495622_0061210 Ga0495622_0061210_758_1348 195
731 3300046558 Ga0495633_0001911 Ga0495633_0001911_13388_13984 195
732 3300046616 Ga0495668_0038840 Ga0495668_0038840_97_702 195
733 3300046616 Ga0495668_0532785 Ga0495668_0532785_45_635 195
734 3300046660 Ga0495625_0025457 Ga0495625_0025457_2715_3305 195
735 3300046660 Ga0495625_0041146 Ga0495625_0041146_2742_3329 195
736 3300046660 Ga0495625_0130465 Ga0495625_0130465_475_1062 195
737 3300046660 Ga0495625_0188241 Ga0495625_0188241_757_1347 195
738 3300046660 Ga0495625_0223534 Ga0495625_0223534_41_631 195
739 3300046665 Ga0495661_0033658 Ga0495661_0033658_2244_2834 195
740 3300046674 Ga0495588_0014578 Ga0495588_0014578_464_1054 195
741 3300046694 Ga0495649_0011304 Ga0495649_0011304_1828_2418 195
742 3300046694 Ga0495649_0095780 Ga0495649_0095780_201_791 195
743 3300046810 Ga0495660_0044555 Ga0495660_0044555_1604_2194 195
744 3300047320 Ga0495672_0061166 Ga0495672_0061166_294_899 195
745 3300047443 Ga0495687_027801 Ga0495687_027801_1770_2360 195
746 3300047469 Ga0495673_0000243 Ga0495673_0000243_26437_27042 195
747 3300047470 Ga0495681_0002453 Ga0495681_0002453_5951_6541 195
748 3300047472 Ga0495686_0013882 Ga0495686_0013882_4667_5257 195
749 3300047472 Ga0495686_0053471 Ga0495686_0053471_1529_2140 195
750 3300048091 Ga0495626_0101622 Ga0495626_0101622_423_1010 195
751 3300048905 Ga0496102_0378775 Ga0496102_0378775_34_621 195
752 3300048911 Ga0496108_0267916 Ga0496108_0267916_832_1419 195
753 3300048913 Ga0496110_0091361 Ga0496110_0091361_1189_1794 195
754 3300048914 Ga0496111_0058413 Ga0496111_0058413_978_1583 195
755 3300048915 Ga0496112_0316885 Ga0496112_0316885_842_1429 195
756 3300048919 Ga0496116_0003539 Ga0496116_0003539_11740_12330 195
757 3300048919 Ga0496116_0037378 Ga0496116_0037378_52_639 195
758 3300048920 Ga0496117_0065358 Ga0496117_0065358_1256_1846 195
759 3300048921 Ga0496118_0069457 Ga0496118_0069457_1764_2351 195
760 3300048921 Ga0496118_0185131 Ga0496118_0185131_505_1092 195
761 3300048922 Ga0496119_0233240 Ga0496119_0233240_55_651 195
762 3300048924 Ga0496121_0000115 Ga0496121_0000115_9596_10186 195
763 3300048924 Ga0496121_0000732 Ga0496121_0000732_38036_38647 195
764 3300048924 Ga0496121_0003073 Ga0496121_0003073_16745_17335 195
765 3300048924 Ga0496121_0003099 Ga0496121_0003099_1316_1906 195
766 3300048924 Ga0496121_0108896 Ga0496121_0108896_941_1528 195
767 3300048924 Ga0496121_0164941 Ga0496121_0164941_1010_1600 195
768 3300048924 Ga0496121_0200413 Ga0496121_0200413_656_1246 195
769 3300048924 Ga0496121_0293755 Ga0496121_0293755_375_962 195
770 3300048925 Ga0496122_0002345 Ga0496122_0002345_14037_14627 195
771 3300048925 Ga0496122_0003047 Ga0496122_0003047_8413_9003 195
772 3300048925 Ga0496122_0006437 Ga0496122_0006437_2436_3023 195
773 3300048925 Ga0496122_0033637 Ga0496122_0033637_161_751 195
774 3300048925 Ga0496122_0056585 Ga0496122_0056585_1350_1940 195
775 3300048926 Ga0496123_0001894 Ga0496123_0001894_12676_13266 195
776 3300048926 Ga0496123_0002549 Ga0496123_0002549_17742_18332 195
777 3300048926 Ga0496123_0004684 Ga0496123_0004684_9313_9900 195
778 3300048926 Ga0496123_0017127 Ga0496123_0017127_3941_4531 195
779 3300048926 Ga0496123_0155944 Ga0496123_0155944_220_810 195
780 3300048926 Ga0496123_0285417 Ga0496123_0285417_60_650 195
781 3300048927 Ga0496124_0006984 Ga0496124_0006984_5299_5886 195
782 3300048927 Ga0496124_0036011 Ga0496124_0036011_3651_4241 195
783 3300048927 Ga0496124_0069909 Ga0496124_0069909_1890_2480 195
784 3300048927 Ga0496124_0317854 Ga0496124_0317854_350_940 195
785 3300048928 Ga0496125_0005889 Ga0496125_0005889_10981_11568 195
786 3300048928 Ga0496125_0054813 Ga0496125_0054813_1029_1619 195
787 3300048928 Ga0496125_0109079 Ga0496125_0109079_38_625 195
788 3300048929 Ga0496126_0008699 Ga0496126_0008699_3469_4056 195
789 3300048929 Ga0496126_0113740 Ga0496126_0113740_1044_1631 195
790 3300048929 Ga0496126_0348803 Ga0496126_0348803_517_1116 195
791 3300048929 Ga0496126_0418313 Ga0496126_0418313_63_650 195
792 3300049571 Ga0501034_0072221 Ga0501034_0072221_46_633 195
793 3300049571 Ga0501034_0117686 Ga0501034_0117686_1082_1669 195
794 3300049572 Ga0501036_0106295 Ga0501036_0106295_56_646 195
795 3300049572 Ga0501036_0179945 Ga0501036_0179945_351_938 195
796 3300049573 Ga0501037_0086717 Ga0501037_0086717_210_797 195
797 3300049575 Ga0501039_0225718 Ga0501039_0225718_43_630 195
798 3300049579 Ga0501043_0011739 Ga0501043_0011739_3071_3661 195
799 3300049579 Ga0501043_0425390 Ga0501043_0425390_404_991 195
800 3300049671 Ga0501238_005046 Ga0501238_005046_456_1046 195
801 3300049822 Ga0501035_0522056 Ga0501035_0522056_306_896 195
802 3300050489 nmdc:mga03683_38234_c1 nmdc:mga03683_38234_c1_639_1229 195
803 3300050490 nmdc:mga03n38_24298_c1 nmdc:mga03n38_24298_c1_1405_1992 195
804 3300050491 nmdc:mga00v17_278059_c1 nmdc:mga00v17_278059_c1_350_937 195
805 3300050491 nmdc:mga00v17_79470_c1 nmdc:mga00v17_79470_c1_566_1153 195
806 3300050492 nmdc:mga0yw44_232903_c1 nmdc:mga0yw44_232903_c1_281_868 195
807 3300050492 nmdc:mga0yw44_42549_c1 nmdc:mga0yw44_42549_c1_1043_1633 195
808 3300050492 nmdc:mga0yw44_45675_c1 nmdc:mga0yw44_45675_c1_1889_2476 195
809 3300050493 nmdc:mga0k408_22463_c1 nmdc:mga0k408_22463_c1_2848_3438 195
810 3300050494 nmdc:mga06z11_123663_c1 nmdc:mga06z11_123663_c1_279_869 195
811 3300050494 nmdc:mga06z11_14867_c1 nmdc:mga06z11_14867_c1_916_1506 195
812 3300050494 nmdc:mga06z11_149601_c1 nmdc:mga06z11_149601_c1_352_939 195
813 3300050494 nmdc:mga06z11_265596_c1 nmdc:mga06z11_265596_c1_151_738 195
814 3300050495 nmdc:mga04h51_55368_c1 nmdc:mga04h51_55368_c1_552_1139 195
815 3300050495 nmdc:mga04h51_73920_c1 nmdc:mga04h51_73920_c1_209_799 195
816 3300050496 nmdc:mga07m45_123254_c1 nmdc:mga07m45_123254_c1_642_1232 195
817 3300050496 nmdc:mga07m45_140417_c1 nmdc:mga07m45_140417_c1_760_1347 195
818 3300050496 nmdc:mga07m45_65164_c1 nmdc:mga07m45_65164_c1_1409_1999 195
819 3300050516 nmdc:mga0sz30_109349_c1 nmdc:mga0sz30_109349_c1_23_610 195
820 3300053086 Ga0500578_0052014 Ga0500578_0052014_1874_2464 195
821 3300053086 Ga0500578_0226559 Ga0500578_0226559_386_976 195
822 3300053108 Ga0500562_007425 Ga0500562_007425_1671_2258 195
823 3300053108 Ga0500562_095712 Ga0500562_095712_12_623 195
824 3300053119 Ga0500595_001365 Ga0500595_001365_3835_4446 195
825 3300053125 Ga0500618_000157 Ga0500618_000157_48309_48899 195
826 3300053134 Ga0500658_0002753 Ga0500658_0002753_3458_4048 195
827 3300053139 Ga0500568_0007325 Ga0500568_0007325_2496_3107 195
828 3300053145 Ga0500586_000032 Ga0500586_000032_17670_18266 195
829 3300053153 Ga0500616_0000066 Ga0500616_0000066_144815_145414 195
830 3300053153 Ga0500616_0000104 Ga0500616_0000104_139391_139981 195
831 3300053153 Ga0500616_0004850 Ga0500616_0004850_6793_7383 195
832 3300053153 Ga0500616_0015076 Ga0500616_0015076_1184_1774 195
833 3300053153 Ga0500616_0106963 Ga0500616_0106963_226_816 195
834 3300053158 Ga0500627_0001791 Ga0500627_0001791_4180_4767 195
835 3300053158 Ga0500627_0131148 Ga0500627_0131148_347_937 195
836 3300053158 Ga0500627_0138542 Ga0500627_0138542_183_770 195
837 3300053158 Ga0500627_0245753 Ga0500627_0245753_62_649 195
838 iso_pu_bacteria 2693429783 2694627812 195
839 iso_pu_bacteria 2693429784 2694636062 195
840 iso_pu_bacteria 2876377896 2876383268 195
841 iso_pu_bacteria 2938014810 2938016834 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

11

57

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9761 8 191
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9409 8 191
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.9123 5 191
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8991 5 190
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.8937 5 191
ID Description Score Start End Superfamily
2g7sA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9706 8 191 1.10.357.10
2g7sA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9402 8 191 1.10.357.10
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9389 7 53 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9375 6 48 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9367 8 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I0XTV5-F1-model_v4 Transcriptional regulator, TetR family 0.9815 5 124 GO:0003677
GO:0006355
AF-A0A5Q0C568-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9741 5 191 GO:0003677
GO:0006355
AF-A0A4S1XGL3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9711 22 191 GO:0003677
GO:0006355
AF-A0A529VXQ4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9688 1 176 GO:0003677
GO:0006355
AF-A0A1C0SKT1-F1-model_v4 HTH tetR-type domain-containing protein 0.9652 4 193 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
94.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map