F483069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 840 | 336 | 1680 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0107438|Ga0501040_0107438_79_1020 |
| Length | 313 |
| Sequence | MPGWRYESAAWHEEGDDMKLVTFGEGEGKVGVLDGEEIAVLDVPTMREYFERDGADETGERVALADTRLRAPIVPKKFFHTAGNFREHEEESKTVDWSHAIAPWINFFQNVDAIVGPDEPVVYPEHLTEELDYELELAVVLKKPGKWFSPEEAMEYIGGYVIFNDLTARDIQRGEMKSGVFSFCKAIDTFCPLGPWIVTPDEIGDPHNLAMQLRVNGEVRQESHSSRMSVTIPEILSNFSALRYSAGDVLSTGTVSGVAGFKSAEERARLYLKPGDVIEAEIESIGVLRNPVISWQEGHGTPPLPRVRPWGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 209 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 331 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 336 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0.12 |
| Rhizoplane | 8.81 |
| Rhizosphere | 90.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0107438 | 3300049576 | Bacteria | 1950 |
| 2 | JGI24738J21930_10025413 | 3300002075 | Bacteria | 1217 |
| 3 | JGI24738J21930_10026083 | 3300002075 | Bacteria | 1200 |
| 4 | JGI25406J46586_10028254 | 3300003203 | Bacteria | 2139 |
| 5 | Ga0070658_10010127 | 3300005327 | Bacteria | 7567 |
| 6 | Ga0070658_10069138 | 3300005327 | Bacteria | 2889 |
| 7 | Ga0070658_10075720 | 3300005327 | Bacteria | 2761 |
| 8 | Ga0070658_10118681 | 3300005327 | Bacteria | 2197 |
| 9 | Ga0070658_10517532 | 3300005327 | Bacteria | 1031 |
| 10 | Ga0070676_10157333 | 3300005328 | Bacteria | 1459 |
| 11 | Ga0070683_100008795 | 3300005329 | Bacteria | 8587 |
| 12 | Ga0070683_100010761 | 3300005329 | Bacteria | 7871 |
| 13 | Ga0070683_100018232 | 3300005329 | Bacteria | 6214 |
| 14 | Ga0070683_100039197 | 3300005329 | Bacteria | 4348 |
| 15 | Ga0070683_100049454 | 3300005329 | Bacteria | 3889 |
| 16 | Ga0070683_100066175 | 3300005329 | Bacteria | 3366 |
| 17 | Ga0070683_100128930 | 3300005329 | Bacteria | 2393 |
| 18 | Ga0070683_100261149 | 3300005329 | Bacteria | 1647 |
| 19 | Ga0068869_100024325 | 3300005334 | Bacteria | 4195 |
| 20 | Ga0070666_10193422 | 3300005335 | Bacteria | 1430 |
| 21 | Ga0070680_100006974 | 3300005336 | Bacteria | 8612 |
| 22 | Ga0070680_100020896 | 3300005336 | Bacteria | 5197 |
| 23 | Ga0070680_100044053 | 3300005336 | Bacteria | 3625 |
| 24 | Ga0070680_100122921 | 3300005336 | Bacteria | 2167 |
| 25 | Ga0070682_100020630 | 3300005337 | Bacteria | 3880 |
| 26 | Ga0070682_100046156 | 3300005337 | Bacteria | 2703 |
| 27 | Ga0070682_100422416 | 3300005337 | Bacteria | 1013 |
| 28 | Ga0068868_100042558 | 3300005338 | Bacteria | 3546 |
| 29 | Ga0068868_100222263 | 3300005338 | Bacteria | 1581 |
| 30 | Ga0068868_100455990 | 3300005338 | Bacteria | 1113 |
| 31 | Ga0070660_100012499 | 3300005339 | Bacteria | 6064 |
| 32 | Ga0070660_100014929 | 3300005339 | Bacteria | 5604 |
| 33 | Ga0070660_100042819 | 3300005339 | Bacteria | 3457 |
| 34 | Ga0070660_100044891 | 3300005339 | Bacteria | 3381 |
| 35 | Ga0070660_100063683 | 3300005339 | Bacteria | 2866 |
| 36 | Ga0070660_100255570 | 3300005339 | Bacteria | 1430 |
| 37 | Ga0070687_100083762 | 3300005343 | Bacteria | 1747 |
| 38 | Ga0070661_100014518 | 3300005344 | Bacteria | 5550 |
| 39 | Ga0070661_100028771 | 3300005344 | Bacteria | 4010 |
| 40 | Ga0070661_100054785 | 3300005344 | Bacteria | 2921 |
| 41 | Ga0070692_10003817 | 3300005345 | Bacteria | 6196 |
| 42 | Ga0070692_10040657 | 3300005345 | Bacteria | 2379 |
| 43 | Ga0070692_10184804 | 3300005345 | Bacteria | 1210 |
| 44 | Ga0070675_100129146 | 3300005354 | Bacteria | 2152 |
| 45 | Ga0070675_100240535 | 3300005354 | Bacteria | 1582 |
| 46 | Ga0070671_100053886 | 3300005355 | Bacteria | 3343 |
| 47 | Ga0070671_100098330 | 3300005355 | Bacteria | 2455 |
| 48 | Ga0070674_100038950 | 3300005356 | Bacteria | 3207 |
| 49 | Ga0070673_100012377 | 3300005364 | Bacteria | 5855 |
| 50 | Ga0070688_100076556 | 3300005365 | Bacteria | 2153 |
| 51 | Ga0070659_100071124 | 3300005366 | Bacteria | 2765 |
| 52 | Ga0070659_100322901 | 3300005366 | Bacteria | 1291 |
| 53 | Ga0070667_100245815 | 3300005367 | Bacteria | 1599 |
| 54 | Ga0070709_10023994 | 3300005434 | Bacteria | 3587 |
| 55 | Ga0070709_10042733 | 3300005434 | Bacteria | 2800 |
| 56 | Ga0070709_10085777 | 3300005434 | Bacteria | 2065 |
| 57 | Ga0070714_100015392 | 3300005435 | Bacteria | 6155 |
| 58 | Ga0070714_100051530 | 3300005435 | Bacteria | 3509 |
| 59 | Ga0070714_100073013 | 3300005435 | Bacteria | 2972 |
| 60 | Ga0070714_100288585 | 3300005435 | Bacteria | 1526 |
| 61 | Ga0070714_100428048 | 3300005435 | Bacteria | 1255 |
| 62 | Ga0070713_100141290 | 3300005436 | Bacteria | 2133 |
| 63 | Ga0070713_100222344 | 3300005436 | Bacteria | 1713 |
| 64 | Ga0070713_100297343 | 3300005436 | Bacteria | 1485 |
| 65 | Ga0070701_10151038 | 3300005438 | Bacteria | 1337 |
| 66 | Ga0070711_100050161 | 3300005439 | Bacteria | 2860 |
| 67 | Ga0070711_100315425 | 3300005439 | Bacteria | 1247 |
| 68 | Ga0070705_100011668 | 3300005440 | Bacteria | 4441 |
| 69 | Ga0070705_100223307 | 3300005440 | Bacteria | 1306 |
| 70 | Ga0070700_100054812 | 3300005441 | Bacteria | 2493 |
| 71 | Ga0070663_100070415 | 3300005455 | Bacteria | 2543 |
| 72 | Ga0070663_100148783 | 3300005455 | Bacteria | 1794 |
| 73 | Ga0070678_100010384 | 3300005456 | Bacteria | 5684 |
| 74 | Ga0070678_100066101 | 3300005456 | Bacteria | 2687 |
| 75 | Ga0070678_100086227 | 3300005456 | Bacteria | 2395 |
| 76 | Ga0070678_100441265 | 3300005456 | Bacteria | 1138 |
| 77 | Ga0070662_100027968 | 3300005457 | Bacteria | 3920 |
| 78 | Ga0070662_100064277 | 3300005457 | Bacteria | 2687 |
| 79 | Ga0070681_10004844 | 3300005458 | Bacteria | 12903 |
| 80 | Ga0070681_10039408 | 3300005458 | Bacteria | 4736 |
| 81 | Ga0070681_10045350 | 3300005458 | Bacteria | 4398 |
| 82 | Ga0070681_10049946 | 3300005458 | Bacteria | 4174 |
| 83 | Ga0070681_10075348 | 3300005458 | Bacteria | 3334 |
| 84 | Ga0070681_10086572 | 3300005458 | Bacteria | 3086 |
| 85 | Ga0070681_10093204 | 3300005458 | Bacteria | 2961 |
| 86 | Ga0070681_10146886 | 3300005458 | Bacteria | 2286 |
| 87 | Ga0068867_100077272 | 3300005459 | Bacteria | 2501 |
| 88 | Ga0070685_10027972 | 3300005466 | Bacteria | 3121 |
| 89 | Ga0070706_100121857 | 3300005467 | Bacteria | 2431 |
| 90 | Ga0070707_100006284 | 3300005468 | Bacteria | 11050 |
| 91 | Ga0070699_100301801 | 3300005518 | Bacteria | 1437 |
| 92 | Ga0070679_100003738 | 3300005530 | Bacteria | 13954 |
| 93 | Ga0070679_100046409 | 3300005530 | Bacteria | 4330 |
| 94 | Ga0070679_100090798 | 3300005530 | Bacteria | 3042 |
| 95 | Ga0070679_100103266 | 3300005530 | Bacteria | 2836 |
| 96 | Ga0070684_100002218 | 3300005535 | Bacteria | 14331 |
| 97 | Ga0070684_100018132 | 3300005535 | Bacteria | 5791 |
| 98 | Ga0070684_100035686 | 3300005535 | Bacteria | 4257 |
| 99 | Ga0070684_100062105 | 3300005535 | Bacteria | 3272 |
| 100 | Ga0070684_100062488 | 3300005535 | Bacteria | 3262 |
| 101 | Ga0070684_100511438 | 3300005535 | Bacteria | 1113 |
| 102 | Ga0068853_100024933 | 3300005539 | Bacteria | 5018 |
| 103 | Ga0068853_100091038 | 3300005539 | Bacteria | 2682 |
| 104 | Ga0068853_100200138 | 3300005539 | Bacteria | 1818 |
| 105 | Ga0068853_100250044 | 3300005539 | Bacteria | 1626 |
| 106 | Ga0070672_100058153 | 3300005543 | Bacteria | 3037 |
| 107 | Ga0070672_100106609 | 3300005543 | Bacteria | 2280 |
| 108 | Ga0070686_100015298 | 3300005544 | Bacteria | 4440 |
| 109 | Ga0070686_100192690 | 3300005544 | Bacteria | 1456 |
| 110 | Ga0070695_100000473 | 3300005545 | Bacteria | 20860 |
| 111 | Ga0070696_100040546 | 3300005546 | Bacteria | 3215 |
| 112 | Ga0070693_100042711 | 3300005547 | Bacteria | 2556 |
| 113 | Ga0070693_100046127 | 3300005547 | Bacteria | 2473 |
| 114 | Ga0070693_100051619 | 3300005547 | Bacteria | 2355 |
| 115 | Ga0070665_100024384 | 3300005548 | Bacteria | 6091 |
| 116 | Ga0070665_100085826 | 3300005548 | Bacteria | 3154 |
| 117 | Ga0070704_100013300 | 3300005549 | Bacteria | 5105 |
| 118 | Ga0070704_100014951 | 3300005549 | Bacteria | 4860 |
| 119 | Ga0070704_100065055 | 3300005549 | Bacteria | 2623 |
| 120 | Ga0068855_100076665 | 3300005563 | Bacteria | 3879 |
| 121 | Ga0068855_100124999 | 3300005563 | Bacteria | 2941 |
| 122 | Ga0068855_100137222 | 3300005563 | Bacteria | 2789 |
| 123 | Ga0068855_100198834 | 3300005563 | Bacteria | 2257 |
| 124 | Ga0068855_100266196 | 3300005563 | Bacteria | 1908 |
| 125 | Ga0068855_100560732 | 3300005563 | Bacteria | 1236 |
| 126 | Ga0070664_100004839 | 3300005564 | Bacteria | 10786 |
| 127 | Ga0070664_100043203 | 3300005564 | Bacteria | 3802 |
| 128 | Ga0068857_100034041 | 3300005577 | Bacteria | 4508 |
| 129 | Ga0068857_100339502 | 3300005577 | Bacteria | 1390 |
| 130 | Ga0068854_100002430 | 3300005578 | Bacteria | 11507 |
| 131 | Ga0068854_100072611 | 3300005578 | Bacteria | 2520 |
| 132 | Ga0068856_100003371 | 3300005614 | Bacteria | 16176 |
| 133 | Ga0068856_100013467 | 3300005614 | Bacteria | 7914 |
| 134 | Ga0068856_100019337 | 3300005614 | Bacteria | 6612 |
| 135 | Ga0068856_100128085 | 3300005614 | Bacteria | 2542 |
| 136 | Ga0068856_100300190 | 3300005614 | Bacteria | 1624 |
| 137 | Ga0068852_100017592 | 3300005616 | Bacteria | 5613 |
| 138 | Ga0068852_100028795 | 3300005616 | Bacteria | 4551 |
| 139 | Ga0068859_100207107 | 3300005617 | Bacteria | 2047 |
| 140 | Ga0068864_100015042 | 3300005618 | Bacteria | 6431 |
| 141 | Ga0068864_100130357 | 3300005618 | Bacteria | 2258 |
| 142 | Ga0068866_10009683 | 3300005718 | Bacteria | 4101 |
| 143 | Ga0068861_100293166 | 3300005719 | Bacteria | 1406 |
| 144 | Ga0068851_10006889 | 3300005834 | Bacteria | 5207 |
| 145 | Ga0068851_10023722 | 3300005834 | Bacteria | 3000 |
| 146 | Ga0068870_10015099 | 3300005840 | Bacteria | 3658 |
| 147 | Ga0068870_10133475 | 3300005840 | Bacteria | 1445 |
| 148 | Ga0068863_100086154 | 3300005841 | Bacteria | 2976 |
| 149 | Ga0068858_100058130 | 3300005842 | Bacteria | 3575 |
| 150 | Ga0068858_100100470 | 3300005842 | Bacteria | 2698 |
| 151 | Ga0081455_10003991 | 3300005937 | Bacteria | 16754 |
| 152 | Ga0081455_10055669 | 3300005937 | Bacteria | 3364 |
| 153 | Ga0081538_10033491 | 3300005981 | Bacteria | 3418 |
| 154 | Ga0081540_1053939 | 3300005983 | Bacteria | 1968 |
| 155 | Ga0081540_1096617 | 3300005983 | Bacteria | 1285 |
| 156 | Ga0081539_10000288 | 3300005985 | Bacteria | 113905 |
| 157 | Ga0070717_10021288 | 3300006028 | Bacteria | 5107 |
| 158 | Ga0070717_10024510 | 3300006028 | Bacteria | 4792 |
| 159 | Ga0070717_10070071 | 3300006028 | Bacteria | 2921 |
| 160 | Ga0070717_10077181 | 3300006028 | Bacteria | 2789 |
| 161 | Ga0070717_10140117 | 3300006028 | Bacteria | 2085 |
| 162 | Ga0075432_10002322 | 3300006058 | Bacteria | 6330 |
| 163 | Ga0075432_10051389 | 3300006058 | Bacteria | 1455 |
| 164 | Ga0070715_10049496 | 3300006163 | Bacteria | 1801 |
| 165 | Ga0070712_100008606 | 3300006175 | Bacteria | 6422 |
| 166 | Ga0097621_100053448 | 3300006237 | Bacteria | 3293 |
| 167 | Ga0097621_100550007 | 3300006237 | Bacteria | 1050 |
| 168 | Ga0068871_100022094 | 3300006358 | Bacteria | 4902 |
| 169 | Ga0075428_100024249 | 3300006844 | Bacteria | 6711 |
| 170 | Ga0075428_100080809 | 3300006844 | Bacteria | 3548 |
| 171 | Ga0075433_10043712 | 3300006852 | Bacteria | 3890 |
| 172 | Ga0075433_10552118 | 3300006852 | Bacteria | 1013 |
| 173 | Ga0075434_100056433 | 3300006871 | Bacteria | 3902 |
| 174 | Ga0075434_100094580 | 3300006871 | Bacteria | 2993 |
| 175 | Ga0075434_100099092 | 3300006871 | Bacteria | 2920 |
| 176 | Ga0075429_100058267 | 3300006880 | Bacteria | 3364 |
| 177 | Ga0068865_100033151 | 3300006881 | Bacteria | 3456 |
| 178 | Ga0068865_100167225 | 3300006881 | Bacteria | 1682 |
| 179 | Ga0075436_100081823 | 3300006914 | Bacteria | 2239 |
| 180 | Ga0097620_100207123 | 3300006931 | Bacteria | 2047 |
| 181 | Ga0075435_100046999 | 3300007076 | Bacteria | 3464 |
| 182 | Ga0075435_100168131 | 3300007076 | Bacteria | 1849 |
| 183 | Ga0075435_100214476 | 3300007076 | Bacteria | 1633 |
| 184 | Ga0075435_100254733 | 3300007076 | Bacteria | 1494 |
| 185 | Ga0111539_10011635 | 3300009094 | Bacteria | 11039 |
| 186 | Ga0111539_10189513 | 3300009094 | Bacteria | 2400 |
| 187 | Ga0111539_10276642 | 3300009094 | Bacteria | 1953 |
| 188 | Ga0105245_10019761 | 3300009098 | Bacteria | 5904 |
| 189 | Ga0105245_10039396 | 3300009098 | Bacteria | 4206 |
| 190 | Ga0105245_10191384 | 3300009098 | Bacteria | 1960 |
| 191 | Ga0105245_10251252 | 3300009098 | Bacteria | 1718 |
| 192 | Ga0105245_10457863 | 3300009098 | Bacteria | 1285 |
| 193 | Ga0105245_10615123 | 3300009098 | Bacteria | 1114 |
| 194 | Ga0105247_10087365 | 3300009101 | Bacteria | 1974 |
| 195 | Ga0114129_10064134 | 3300009147 | Bacteria | 5127 |
| 196 | Ga0114129_10579666 | 3300009147 | Bacteria | 1456 |
| 197 | Ga0114129_10618246 | 3300009147 | Bacteria | 1402 |
| 198 | Ga0105243_10026218 | 3300009148 | Bacteria | 4461 |
| 199 | Ga0105243_10032904 | 3300009148 | Bacteria | 4008 |
| 200 | Ga0105243_10055460 | 3300009148 | Bacteria | 3149 |
| 201 | Ga0105242_10029521 | 3300009176 | Bacteria | 4375 |
| 202 | Ga0105242_10157856 | 3300009176 | Bacteria | 1983 |
| 203 | Ga0105248_10109102 | 3300009177 | Bacteria | 3120 |
| 204 | Ga0105237_10098927 | 3300009545 | Bacteria | 2908 |
| 205 | Ga0105237_10558973 | 3300009545 | Bacteria | 1151 |
| 206 | Ga0105238_10046610 | 3300009551 | Bacteria | 4373 |
| 207 | Ga0105238_10419811 | 3300009551 | Bacteria | 1332 |
| 208 | Ga0105249_10099006 | 3300009553 | Bacteria | 2740 |
| 209 | Ga0105239_10059456 | 3300010375 | Bacteria | 4195 |
| 210 | Ga0105239_10060773 | 3300010375 | Bacteria | 4147 |
| 211 | Ga0105239_10376775 | 3300010375 | Bacteria | 1604 |
| 212 | Ga0105239_10593733 | 3300010375 | Bacteria | 1263 |
| 213 | Ga0105246_10041852 | 3300011119 | Bacteria | 3099 |
| 214 | Ga0105246_10212286 | 3300011119 | Bacteria | 1511 |
| 215 | Ga0157371_10006491 | 3300013102 | Bacteria | 9633 |
| 216 | Ga0157371_10137322 | 3300013102 | Bacteria | 1741 |
| 217 | Ga0157371_10257963 | 3300013102 | Bacteria | 1256 |
| 218 | Ga0157369_10007413 | 3300013105 | Bacteria | 12630 |
| 219 | Ga0157369_10023973 | 3300013105 | Bacteria | 6789 |
| 220 | Ga0157369_10132889 | 3300013105 | Bacteria | 2636 |
| 221 | Ga0157369_10370749 | 3300013105 | Bacteria | 1486 |
| 222 | Ga0157369_10782481 | 3300013105 | Bacteria | 981 |
| 223 | Ga0157374_10109651 | 3300013296 | Bacteria | 2654 |
| 224 | Ga0157372_10003022 | 3300013307 | Bacteria | 18137 |
| 225 | Ga0157372_10351212 | 3300013307 | Bacteria | 1718 |
| 226 | Ga0157375_10014341 | 3300013308 | Bacteria | 7067 |
| 227 | Ga0157375_10081420 | 3300013308 | Bacteria | 3277 |
| 228 | Ga0163163_10321301 | 3300014325 | Bacteria | 1601 |
| 229 | Ga0163163_10659963 | 3300014325 | Bacteria | 1109 |
| 230 | Ga0157377_10012819 | 3300014745 | Bacteria | 4226 |
| 231 | Ga0157376_10033684 | 3300014969 | Bacteria | 4127 |
| 232 | Ga0163161_10203156 | 3300017792 | Bacteria | 1528 |
| 233 | Ga0206356_11192765 | 3300020070 | Bacteria | 1537 |
| 234 | Ga0206356_11827461 | 3300020070 | Bacteria | 1743 |
| 235 | Ga0206353_10249821 | 3300020082 | Bacteria | 2916 |
| 236 | Ga0207656_10105185 | 3300025321 | Bacteria | 1298 |
| 237 | Ga0207653_10009842 | 3300025885 | Bacteria | 2981 |
| 238 | Ga0207692_10015755 | 3300025898 | Bacteria | 3334 |
| 239 | Ga0207692_10059063 | 3300025898 | Bacteria | 1979 |
| 240 | Ga0207688_10013452 | 3300025901 | Bacteria | 4447 |
| 241 | Ga0207688_10103374 | 3300025901 | Bacteria | 1648 |
| 242 | Ga0207685_10056168 | 3300025905 | Bacteria | 1540 |
| 243 | Ga0207699_10001898 | 3300025906 | Bacteria | 9840 |
| 244 | Ga0207643_10010886 | 3300025908 | Bacteria | 4905 |
| 245 | Ga0207643_10026400 | 3300025908 | Bacteria | 3215 |
| 246 | Ga0207643_10139561 | 3300025908 | Bacteria | 1447 |
| 247 | Ga0207705_10028335 | 3300025909 | Bacteria | 3992 |
| 248 | Ga0207705_10042578 | 3300025909 | Bacteria | 3260 |
| 249 | Ga0207684_10103541 | 3300025910 | Bacteria | 2434 |
| 250 | Ga0207654_10209687 | 3300025911 | Bacteria | 1287 |
| 251 | Ga0207707_10033528 | 3300025912 | Bacteria | 4493 |
| 252 | Ga0207707_10078733 | 3300025912 | Bacteria | 2879 |
| 253 | Ga0207707_10144226 | 3300025912 | Bacteria | 2081 |
| 254 | Ga0207707_10183676 | 3300025912 | Bacteria | 1825 |
| 255 | Ga0207707_10267117 | 3300025912 | Bacteria | 1483 |
| 256 | Ga0207707_10314377 | 3300025912 | Bacteria | 1353 |
| 257 | Ga0207671_10260525 | 3300025914 | Bacteria | 1365 |
| 258 | Ga0207693_10000818 | 3300025915 | Bacteria | 27776 |
| 259 | Ga0207693_10013620 | 3300025915 | Bacteria | 6552 |
| 260 | Ga0207693_10353071 | 3300025915 | Bacteria | 1150 |
| 261 | Ga0207663_10003493 | 3300025916 | Bacteria | 7697 |
| 262 | Ga0207663_10096523 | 3300025916 | Bacteria | 1974 |
| 263 | Ga0207660_10004053 | 3300025917 | Bacteria | 9559 |
| 264 | Ga0207660_10018590 | 3300025917 | Bacteria | 4635 |
| 265 | Ga0207662_10102940 | 3300025918 | Bacteria | 1771 |
| 266 | Ga0207657_10001151 | 3300025919 | Bacteria | 28127 |
| 267 | Ga0207657_10005824 | 3300025919 | Bacteria | 12836 |
| 268 | Ga0207657_10006782 | 3300025919 | Bacteria | 11824 |
| 269 | Ga0207657_10020557 | 3300025919 | Bacteria | 6235 |
| 270 | Ga0207657_10049863 | 3300025919 | Bacteria | 3645 |
| 271 | Ga0207657_10053652 | 3300025919 | Bacteria | 3491 |
| 272 | Ga0207657_10236135 | 3300025919 | Bacteria | 1461 |
| 273 | Ga0207649_10031554 | 3300025920 | Bacteria | 3150 |
| 274 | Ga0207649_10070106 | 3300025920 | Bacteria | 2234 |
| 275 | Ga0207649_10207240 | 3300025920 | Bacteria | 1389 |
| 276 | Ga0207652_10110901 | 3300025921 | Bacteria | 2433 |
| 277 | Ga0207646_10001697 | 3300025922 | Bacteria | 26787 |
| 278 | Ga0207681_10313986 | 3300025923 | Bacteria | 1244 |
| 279 | Ga0207694_10031524 | 3300025924 | Bacteria | 4050 |
| 280 | Ga0207694_10036336 | 3300025924 | Bacteria | 3781 |
| 281 | Ga0207694_10084136 | 3300025924 | Bacteria | 2502 |
| 282 | Ga0207659_10016601 | 3300025926 | Bacteria | 4795 |
| 283 | Ga0207687_10023194 | 3300025927 | Bacteria | 4134 |
| 284 | Ga0207687_10155869 | 3300025927 | Bacteria | 1747 |
| 285 | Ga0207687_10210902 | 3300025927 | Bacteria | 1524 |
| 286 | Ga0207687_10297085 | 3300025927 | Bacteria | 1300 |
| 287 | Ga0207687_10344517 | 3300025927 | Bacteria | 1212 |
| 288 | Ga0207700_10124940 | 3300025928 | Bacteria | 2092 |
| 289 | Ga0207664_10011933 | 3300025929 | Bacteria | 6202 |
| 290 | Ga0207664_10014507 | 3300025929 | Bacteria | 5693 |
| 291 | Ga0207664_10071014 | 3300025929 | Bacteria | 2804 |
| 292 | Ga0207664_10088771 | 3300025929 | Bacteria | 2530 |
| 293 | Ga0207690_10027298 | 3300025932 | Bacteria | 3607 |
| 294 | Ga0207690_10056898 | 3300025932 | Bacteria | 2640 |
| 295 | Ga0207706_10003828 | 3300025933 | Bacteria | 14338 |
| 296 | Ga0207706_10016073 | 3300025933 | Bacteria | 6764 |
| 297 | Ga0207686_10015295 | 3300025934 | Bacteria | 4288 |
| 298 | Ga0207709_10010328 | 3300025935 | Bacteria | 5142 |
| 299 | Ga0207670_10202737 | 3300025936 | Bacteria | 1508 |
| 300 | Ga0207670_10378276 | 3300025936 | Bacteria | 1127 |
| 301 | Ga0207704_10024613 | 3300025938 | Bacteria | 3269 |
| 302 | Ga0207704_10038809 | 3300025938 | Bacteria | 2766 |
| 303 | Ga0207665_10004954 | 3300025939 | Bacteria | 8887 |
| 304 | Ga0207691_10008491 | 3300025940 | Bacteria | 9865 |
| 305 | Ga0207691_10026092 | 3300025940 | Bacteria | 5484 |
| 306 | Ga0207691_10026254 | 3300025940 | Bacteria | 5466 |
| 307 | Ga0207689_10018518 | 3300025942 | Bacteria | 5875 |
| 308 | Ga0207661_10000903 | 3300025944 | Bacteria | 19452 |
| 309 | Ga0207661_10012787 | 3300025944 | Bacteria | 6114 |
| 310 | Ga0207661_10066087 | 3300025944 | Bacteria | 2937 |
| 311 | Ga0207661_10113768 | 3300025944 | Bacteria | 2293 |
| 312 | Ga0207661_10137931 | 3300025944 | Bacteria | 2096 |
| 313 | Ga0207661_10146863 | 3300025944 | Bacteria | 2035 |
| 314 | Ga0207661_10245651 | 3300025944 | Bacteria | 1589 |
| 315 | Ga0207679_10005676 | 3300025945 | Bacteria | 7825 |
| 316 | Ga0207679_10011483 | 3300025945 | Bacteria | 5742 |
| 317 | Ga0207667_10174260 | 3300025949 | Bacteria | 2210 |
| 318 | Ga0207667_10565384 | 3300025949 | Bacteria | 1149 |
| 319 | Ga0207651_10034643 | 3300025960 | Bacteria | 3272 |
| 320 | Ga0207712_10087165 | 3300025961 | Bacteria | 2289 |
| 321 | Ga0207640_10026817 | 3300025981 | Bacteria | 3503 |
| 322 | Ga0207677_10013254 | 3300026023 | Bacteria | 4771 |
| 323 | Ga0207703_10147399 | 3300026035 | Bacteria | 2048 |
| 324 | Ga0207678_10029462 | 3300026067 | Bacteria | 4791 |
| 325 | Ga0207678_10044253 | 3300026067 | Bacteria | 3851 |
| 326 | Ga0207678_10108165 | 3300026067 | Bacteria | 2372 |
| 327 | Ga0207678_10192563 | 3300026067 | Bacteria | 1743 |
| 328 | Ga0207678_10340874 | 3300026067 | Bacteria | 1291 |
| 329 | Ga0207702_10009768 | 3300026078 | Bacteria | 8053 |
| 330 | Ga0207702_10028980 | 3300026078 | Bacteria | 4604 |
| 331 | Ga0207641_10153700 | 3300026088 | Bacteria | 2086 |
| 332 | Ga0207648_10018847 | 3300026089 | Bacteria | 6237 |
| 333 | Ga0207648_10310646 | 3300026089 | Bacteria | 1415 |
| 334 | Ga0207676_10080997 | 3300026095 | Bacteria | 2637 |
| 335 | Ga0207674_10015159 | 3300026116 | Bacteria | 8481 |
| 336 | Ga0207674_10073309 | 3300026116 | Bacteria | 3437 |
| 337 | Ga0207674_10180127 | 3300026116 | Bacteria | 2065 |
| 338 | Ga0207675_100008588 | 3300026118 | Bacteria | 9607 |
| 339 | Ga0207675_100014621 | 3300026118 | Bacteria | 7317 |
| 340 | Ga0207675_100210188 | 3300026118 | Bacteria | 1871 |
| 341 | Ga0207683_10020230 | 3300026121 | Bacteria | 5690 |
| 342 | Ga0207683_10485805 | 3300026121 | Bacteria | 1140 |
| 343 | Ga0207698_10027760 | 3300026142 | Bacteria | 4024 |
| 344 | Ga0207698_10047129 | 3300026142 | Bacteria | 3262 |
| 345 | Ga0207428_10003615 | 3300027907 | Bacteria | 14923 |
| 346 | Ga0207428_10008323 | 3300027907 | Bacteria | 9372 |
| 347 | Ga0207428_10079429 | 3300027907 | Bacteria | 2565 |
| 348 | Ga0207428_10080318 | 3300027907 | Bacteria | 2548 |
| 349 | Ga0268264_10152122 | 3300028381 | Bacteria | 2076 |
| 350 | Ga0265337_1002622 | 3300028556 | Bacteria | 8110 |
| 351 | Ga0265326_10002075 | 3300028558 | Bacteria | 6825 |
| 352 | Ga0265319_1003587 | 3300028563 | Bacteria | 8046 |
| 353 | Ga0265319_1007435 | 3300028563 | Bacteria | 4928 |
| 354 | Ga0265334_10000697 | 3300028573 | Bacteria | 16839 |
| 355 | Ga0265334_10008449 | 3300028573 | Bacteria | 4375 |
| 356 | Ga0265334_10054195 | 3300028573 | Bacteria | 1529 |
| 357 | Ga0265318_10001580 | 3300028577 | Bacteria | 13181 |
| 358 | Ga0265322_10022059 | 3300028654 | Bacteria | 1823 |
| 359 | Ga0265322_10030297 | 3300028654 | Bacteria | 1545 |
| 360 | Ga0265336_10001906 | 3300028666 | Bacteria | 9015 |
| 361 | Ga0265338_10000634 | 3300028800 | Bacteria | 60990 |
| 362 | Ga0265338_10003841 | 3300028800 | Bacteria | 20854 |
| 363 | Ga0265338_10005145 | 3300028800 | Bacteria | 17221 |
| 364 | Ga0265338_10007327 | 3300028800 | Bacteria | 13755 |
| 365 | Ga0265338_10037406 | 3300028800 | Bacteria | 4619 |
| 366 | Ga0265324_10004949 | 3300029957 | Bacteria | 5856 |
| 367 | Ga0265330_10009651 | 3300031235 | Bacteria | 4576 |
| 368 | Ga0265332_10010707 | 3300031238 | Bacteria | 4077 |
| 369 | Ga0265332_10026345 | 3300031238 | Bacteria | 2550 |
| 370 | Ga0265328_10027387 | 3300031239 | Bacteria | 2136 |
| 371 | Ga0265320_10001998 | 3300031240 | Bacteria | 14391 |
| 372 | Ga0265325_10011051 | 3300031241 | Bacteria | 5196 |
| 373 | Ga0265325_10011878 | 3300031241 | Bacteria | 4993 |
| 374 | Ga0265329_10014532 | 3300031242 | Bacteria | 2776 |
| 375 | Ga0265340_10008049 | 3300031247 | Bacteria | 5710 |
| 376 | Ga0265339_10079371 | 3300031249 | Bacteria | 1736 |
| 377 | Ga0265327_10040207 | 3300031251 | Bacteria | 2531 |
| 378 | Ga0265313_10036237 | 3300031595 | Bacteria | 2477 |
| 379 | Ga0265313_10040081 | 3300031595 | Bacteria | 2318 |
| 380 | Ga0265313_10078092 | 3300031595 | Bacteria | 1510 |
| 381 | Ga0265314_10010490 | 3300031711 | Bacteria | 7724 |
| 382 | Ga0265314_10033078 | 3300031711 | Bacteria | 3796 |
| 383 | Ga0265314_10049649 | 3300031711 | Bacteria | 2935 |
| 384 | Ga0265342_10004798 | 3300031712 | Bacteria | 10494 |
| 385 | Ga0307405_10061464 | 3300031731 | Bacteria | 2375 |
| 386 | Ga0307413_10390876 | 3300031824 | Bacteria | 1087 |
| 387 | Ga0307415_100374456 | 3300032126 | Bacteria | 1207 |
| 388 | Ga0373928_0026440 | 3300035084 | Bacteria | 1257 |
| 389 | Ga0373929_0028945 | 3300035085 | Bacteria | 1173 |
| 390 | Ga0373944_0030475 | 3300035089 | Bacteria | 1618 |
| 391 | Ga0373952_0038338 | 3300035092 | Bacteria | 1097 |
| 392 | Ga0373939_0005177 | 3300035114 | Bacteria | 3100 |
| 393 | Ga0373939_0006400 | 3300035114 | Bacteria | 2836 |
| 394 | Ga0373945_0001608 | 3300035116 | Bacteria | 6921 |
| 395 | Ga0373945_0046538 | 3300035116 | Bacteria | 1583 |
| 396 | Ga0373956_0040998 | 3300035119 | Bacteria | 2055 |
| 397 | Ga0373943_0000939 | 3300035170 | Bacteria | 12864 |
| 398 | Ga0373943_0005099 | 3300035170 | Bacteria | 5914 |
| 399 | Ga0373946_0002830 | 3300035171 | Bacteria | 6143 |
| 400 | Ga0373955_0037804 | 3300035172 | Bacteria | 2568 |
| 401 | Ga0373961_0009590 | 3300035241 | Bacteria | 2371 |
| 402 | Ga0373962_0015492 | 3300035242 | Bacteria | 1955 |
| 403 | Ga0373924_0050420 | 3300035410 | Bacteria | 1724 |
| 404 | Ga0373931_0049430 | 3300035691 | Bacteria | 2233 |
| 405 | Ga0373931_0204067 | 3300035691 | Bacteria | 1182 |
| 406 | Ga0373927_0098860 | 3300035695 | Bacteria | 1897 |
| 407 | Ga0373947_0002001 | 3300035725 | Bacteria | 12442 |
| 408 | Ga0373937_0000749 | 3300036401 | Bacteria | 28028 |
| 409 | Ga0373925_0005743 | 3300037068 | Bacteria | 9221 |
| 410 | Ga0373925_0064886 | 3300037068 | Bacteria | 2749 |
| 411 | Ga0395899_0095195 | 3300037312 | Bacteria | 2154 |
| 412 | Ga0395899_0241616 | 3300037312 | Bacteria | 1242 |
| 413 | Ga0395899_0286756 | 3300037312 | Bacteria | 1118 |
| 414 | Ga0395900_0001894 | 3300037418 | Bacteria | 23794 |
| 415 | Ga0395900_0005497 | 3300037418 | Bacteria | 13261 |
| 416 | Ga0395900_0064424 | 3300037418 | Bacteria | 3766 |
| 417 | Ga0395900_0074022 | 3300037418 | Bacteria | 3502 |
| 418 | Ga0395900_0127818 | 3300037418 | Bacteria | 2605 |
| 419 | Ga0395900_0344030 | 3300037418 | Bacteria | 1466 |
| 420 | Ga0395898_0003598 | 3300037466 | Bacteria | 17277 |
| 421 | Ga0395898_0008350 | 3300037466 | Bacteria | 10948 |
| 422 | Ga0395898_0049223 | 3300037466 | Bacteria | 4129 |
| 423 | Ga0395898_0155490 | 3300037466 | Bacteria | 2187 |
| 424 | Ga0395898_0353432 | 3300037466 | Bacteria | 1401 |
| 425 | Ga0395905_0001553 | 3300037471 | Bacteria | 27432 |
| 426 | Ga0395905_0095700 | 3300037471 | Bacteria | 2787 |
| 427 | Ga0395905_0106246 | 3300037471 | Bacteria | 2636 |
| 428 | Ga0395901_0002743 | 3300038443 | Bacteria | 17767 |
| 429 | Ga0395901_0003280 | 3300038443 | Bacteria | 16285 |
| 430 | Ga0395901_0007911 | 3300038443 | Bacteria | 10726 |
| 431 | Ga0395901_0009920 | 3300038443 | Bacteria | 9653 |
| 432 | Ga0395901_0034752 | 3300038443 | Bacteria | 5207 |
| 433 | Ga0395901_0634850 | 3300038443 | Bacteria | 1073 |
| 434 | Ga0436365_0703538 | 3300039437 | Bacteria | 1384 |
| 435 | Ga0436365_1041337 | 3300039437 | Bacteria | 2564 |
| 436 | Ga0439442_012972 | 3300042002 | Bacteria | 1708 |
| 437 | Ga0439448_0027100 | 3300042005 | Bacteria | 1805 |
| 438 | Ga0450906_007946 | 3300042145 | Bacteria | 2074 |
| 439 | Ga0439446_0007189 | 3300042156 | Bacteria | 2921 |
| 440 | Ga0466969_0003938 | 3300044656 | Bacteria | 7885 |
| 441 | Ga0466972_0139118 | 3300044658 | Bacteria | 1143 |
| 442 | Ga0466965_0016827 | 3300044683 | Bacteria | 3487 |
| 443 | Ga0466965_0022863 | 3300044683 | Bacteria | 3016 |
| 444 | Ga0466966_0002763 | 3300044684 | Bacteria | 11529 |
| 445 | Ga0466966_0185735 | 3300044684 | Bacteria | 1260 |
| 446 | Ga0466961_0001608 | 3300044693 | Bacteria | 13999 |
| 447 | Ga0466961_0005689 | 3300044693 | Bacteria | 7884 |
| 448 | Ga0466961_0008352 | 3300044693 | Bacteria | 6594 |
| 449 | Ga0466961_0140122 | 3300044693 | Bacteria | 1514 |
| 450 | Ga0466963_0004706 | 3300044694 | Bacteria | 7969 |
| 451 | Ga0466963_0006644 | 3300044694 | Bacteria | 6866 |
| 452 | Ga0466963_0007281 | 3300044694 | Bacteria | 6599 |
| 453 | Ga0466963_0010087 | 3300044694 | Bacteria | 5711 |
| 454 | Ga0466963_0025184 | 3300044694 | Bacteria | 3792 |
| 455 | Ga0466963_0031061 | 3300044694 | Bacteria | 3450 |
| 456 | Ga0466963_0032819 | 3300044694 | Bacteria | 3365 |
| 457 | Ga0466963_0036782 | 3300044694 | Bacteria | 3193 |
| 458 | Ga0466963_0037171 | 3300044694 | Bacteria | 3178 |
| 459 | Ga0466963_0045186 | 3300044694 | Bacteria | 2900 |
| 460 | Ga0466963_0045419 | 3300044694 | Bacteria | 2893 |
| 461 | Ga0466963_0046370 | 3300044694 | Bacteria | 2865 |
| 462 | Ga0466963_0073801 | 3300044694 | Bacteria | 2300 |
| 463 | Ga0466963_0088521 | 3300044694 | Bacteria | 2106 |
| 464 | Ga0466963_0184119 | 3300044694 | Bacteria | 1458 |
| 465 | Ga0466963_0286831 | 3300044694 | Bacteria | 1157 |
| 466 | Ga0466964_0010579 | 3300044706 | Bacteria | 3481 |
| 467 | Ga0466964_0014900 | 3300044706 | Bacteria | 2960 |
| 468 | Ga0466964_0016769 | 3300044706 | Bacteria | 2799 |
| 469 | Ga0466964_0024835 | 3300044706 | Bacteria | 2336 |
| 470 | Ga0466964_0081354 | 3300044706 | Bacteria | 1391 |
| 471 | Ga0466964_0113191 | 3300044706 | Bacteria | 1213 |
| 472 | Ga0453684_0003111 | 3300044712 | Bacteria | 38224 |
| 473 | Ga0466971_0000934 | 3300044719 | Bacteria | 11989 |
| 474 | Ga0466971_0003831 | 3300044719 | Bacteria | 6443 |
| 475 | Ga0466971_0006941 | 3300044719 | Bacteria | 4924 |
| 476 | Ga0466971_0011652 | 3300044719 | Bacteria | 3850 |
| 477 | Ga0466971_0024625 | 3300044719 | Bacteria | 2686 |
| 478 | Ga0466971_0078032 | 3300044719 | Bacteria | 1508 |
| 479 | Ga0466968_0011305 | 3300044735 | Bacteria | 3476 |
| 480 | Ga0466968_0016584 | 3300044735 | Bacteria | 2935 |
| 481 | Ga0466968_0016911 | 3300044735 | Bacteria | 2908 |
| 482 | Ga0466968_0025570 | 3300044735 | Bacteria | 2418 |
| 483 | Ga0466970_0010356 | 3300044765 | Bacteria | 4732 |
| 484 | Ga0466957_0044529 | 3300044842 | Bacteria | 2689 |
| 485 | Ga0466957_0082626 | 3300044842 | Bacteria | 2002 |
| 486 | Ga0466957_0086989 | 3300044842 | Bacteria | 1953 |
| 487 | Ga0466957_0094598 | 3300044842 | Bacteria | 1876 |
| 488 | Ga0466957_0099988 | 3300044842 | Bacteria | 1827 |
| 489 | Ga0466960_0027869 | 3300044901 | Bacteria | 2581 |
| 490 | Ga0466959_0005675 | 3300045049 | Bacteria | 8584 |
| 491 | Ga0466959_0006965 | 3300045049 | Bacteria | 7900 |
| 492 | Ga0466959_0026726 | 3300045049 | Bacteria | 4279 |
| 493 | Ga0451576_0030811 | 3300045051 | Bacteria | 5725 |
| 494 | Ga0451576_0093626 | 3300045051 | Bacteria | 3124 |
| 495 | Ga0466958_0000119 | 3300045836 | Bacteria | 25649 |
| 496 | Ga0466958_0003286 | 3300045836 | Bacteria | 8368 |
| 497 | Ga0466958_0009735 | 3300045836 | Bacteria | 5362 |
| 498 | Ga0466958_0010196 | 3300045836 | Bacteria | 5254 |
| 499 | Ga0466958_0032216 | 3300045836 | Bacteria | 3117 |
| 500 | Ga0466958_0057057 | 3300045836 | Bacteria | 2373 |
| 501 | Ga0466958_0094375 | 3300045836 | Bacteria | 1854 |
| 502 | Ga0466958_0114713 | 3300045836 | Bacteria | 1683 |
| 503 | Ga0466958_0216831 | 3300045836 | Bacteria | 1220 |
| 504 | Ga0466967_0000297 | 3300045976 | Bacteria | 22234 |
| 505 | Ga0466967_0001423 | 3300045976 | Bacteria | 13858 |
| 506 | Ga0466967_0004005 | 3300045976 | Bacteria | 9819 |
| 507 | Ga0466967_0004781 | 3300045976 | Bacteria | 9222 |
| 508 | Ga0466967_0013268 | 3300045976 | Bacteria | 6357 |
| 509 | Ga0466967_0026836 | 3300045976 | Bacteria | 4779 |
| 510 | Ga0466967_0034528 | 3300045976 | Bacteria | 4294 |
| 511 | Ga0466967_0040175 | 3300045976 | Bacteria | 4026 |
| 512 | Ga0466967_0048266 | 3300045976 | Bacteria | 3716 |
| 513 | Ga0466967_0060230 | 3300045976 | Bacteria | 3363 |
| 514 | Ga0466967_0065858 | 3300045976 | Bacteria | 3226 |
| 515 | Ga0466967_0096357 | 3300045976 | Bacteria | 2698 |
| 516 | Ga0466967_0115577 | 3300045976 | Bacteria | 2471 |
| 517 | Ga0466967_0119501 | 3300045976 | Bacteria | 2432 |
| 518 | Ga0466967_0130080 | 3300045976 | Bacteria | 2336 |
| 519 | Ga0466967_0251759 | 3300045976 | Bacteria | 1687 |
| 520 | Ga0466967_0540303 | 3300045976 | Bacteria | 1146 |
| 521 | Ga0495592_0000728 | 3300046454 | Bacteria | 23022 |
| 522 | Ga0495592_0084898 | 3300046454 | Bacteria | 2283 |
| 523 | Ga0495603_0091890 | 3300046455 | Bacteria | 1774 |
| 524 | Ga0495629_0003632 | 3300046459 | Bacteria | 11668 |
| 525 | Ga0495629_0008328 | 3300046459 | Bacteria | 7623 |
| 526 | Ga0495629_0073972 | 3300046459 | Bacteria | 2379 |
| 527 | Ga0495629_0199514 | 3300046459 | Bacteria | 1383 |
| 528 | Ga0495629_0332416 | 3300046459 | Bacteria | 1038 |
| 529 | Ga0495641_0002963 | 3300046461 | Bacteria | 13059 |
| 530 | Ga0495641_0008615 | 3300046461 | Bacteria | 6180 |
| 531 | Ga0495651_0000699 | 3300046462 | Bacteria | 26062 |
| 532 | Ga0495651_0057940 | 3300046462 | Bacteria | 2973 |
| 533 | Ga0495651_0075895 | 3300046462 | Bacteria | 2547 |
| 534 | Ga0495653_0007059 | 3300046463 | Bacteria | 9217 |
| 535 | Ga0495653_0022580 | 3300046463 | Bacteria | 5088 |
| 536 | Ga0495653_0064755 | 3300046463 | Bacteria | 2753 |
| 537 | Ga0495653_0086776 | 3300046463 | Bacteria | 2299 |
| 538 | Ga0495580_0020002 | 3300046472 | Bacteria | 4962 |
| 539 | Ga0495582_0000127 | 3300046473 | Bacteria | 40540 |
| 540 | Ga0495582_0005440 | 3300046473 | Bacteria | 7104 |
| 541 | Ga0495639_0001052 | 3300046475 | Bacteria | 12448 |
| 542 | Ga0495639_0003732 | 3300046475 | Bacteria | 6553 |
| 543 | Ga0495662_0000770 | 3300046476 | Bacteria | 15464 |
| 544 | Ga0495662_0004554 | 3300046476 | Bacteria | 6953 |
| 545 | Ga0495664_0005414 | 3300046477 | Bacteria | 7011 |
| 546 | Ga0495664_0026476 | 3300046477 | Bacteria | 3377 |
| 547 | Ga0495594_0024010 | 3300046499 | Bacteria | 3271 |
| 548 | Ga0495607_0080055 | 3300046501 | Bacteria | 1798 |
| 549 | Ga0495608_0008112 | 3300046511 | Bacteria | 7382 |
| 550 | Ga0495608_0011441 | 3300046511 | Bacteria | 6175 |
| 551 | Ga0495608_0015592 | 3300046511 | Bacteria | 5265 |
| 552 | Ga0495608_0027791 | 3300046511 | Bacteria | 3847 |
| 553 | Ga0495618_0000821 | 3300046514 | Bacteria | 21621 |
| 554 | Ga0495618_0025728 | 3300046514 | Bacteria | 3654 |
| 555 | Ga0495618_0042747 | 3300046514 | Bacteria | 2857 |
| 556 | Ga0495628_0001050 | 3300046516 | Bacteria | 25288 |
| 557 | Ga0495628_0037464 | 3300046516 | Bacteria | 3888 |
| 558 | Ga0495628_0146602 | 3300046516 | Bacteria | 1799 |
| 559 | Ga0495630_0003376 | 3300046517 | Bacteria | 11119 |
| 560 | Ga0495630_0013173 | 3300046517 | Bacteria | 6011 |
| 561 | Ga0495630_0044170 | 3300046517 | Bacteria | 3329 |
| 562 | Ga0495630_0122770 | 3300046517 | Bacteria | 1970 |
| 563 | Ga0495630_0185728 | 3300046517 | Bacteria | 1586 |
| 564 | Ga0495666_0027752 | 3300046526 | Bacteria | 2786 |
| 565 | Ga0495652_0000187 | 3300046529 | Bacteria | 70410 |
| 566 | Ga0495652_0126018 | 3300046529 | Bacteria | 2034 |
| 567 | Ga0495652_0235146 | 3300046529 | Bacteria | 1367 |
| 568 | Ga0495652_0242943 | 3300046529 | Bacteria | 1338 |
| 569 | Ga0495652_0247890 | 3300046529 | Bacteria | 1321 |
| 570 | Ga0495665_0000469 | 3300046531 | Bacteria | 20320 |
| 571 | Ga0495665_0002749 | 3300046531 | Bacteria | 9496 |
| 572 | Ga0495640_0002077 | 3300046533 | Bacteria | 15973 |
| 573 | Ga0495640_0014609 | 3300046533 | Bacteria | 5933 |
| 574 | Ga0495640_0027594 | 3300046533 | Bacteria | 4092 |
| 575 | Ga0495640_0044921 | 3300046533 | Bacteria | 3068 |
| 576 | Ga0495640_0084211 | 3300046533 | Bacteria | 2109 |
| 577 | Ga0495586_0013275 | 3300046535 | Bacteria | 4366 |
| 578 | Ga0495586_0149898 | 3300046535 | Bacteria | 1312 |
| 579 | Ga0495587_0000467 | 3300046536 | Bacteria | 28207 |
| 580 | Ga0495587_0020700 | 3300046536 | Bacteria | 4057 |
| 581 | Ga0495587_0026508 | 3300046536 | Bacteria | 3534 |
| 582 | Ga0495587_0040736 | 3300046536 | Bacteria | 2774 |
| 583 | Ga0495645_0000700 | 3300046543 | Bacteria | 22971 |
| 584 | Ga0495645_0228909 | 3300046543 | Bacteria | 1246 |
| 585 | Ga0495667_0008702 | 3300046559 | Bacteria | 6891 |
| 586 | Ga0495667_0021833 | 3300046559 | Bacteria | 4317 |
| 587 | Ga0495667_0034209 | 3300046559 | Bacteria | 3398 |
| 588 | Ga0495667_0040558 | 3300046559 | Bacteria | 3090 |
| 589 | Ga0495667_0053082 | 3300046559 | Bacteria | 2670 |
| 590 | Ga0495667_0060356 | 3300046559 | Bacteria | 2487 |
| 591 | Ga0495667_0141062 | 3300046559 | Bacteria | 1553 |
| 592 | Ga0495656_0119241 | 3300046615 | Bacteria | 1243 |
| 593 | Ga0495634_0006110 | 3300046642 | Bacteria | 9174 |
| 594 | Ga0495634_0013610 | 3300046642 | Bacteria | 5876 |
| 595 | Ga0495634_0097028 | 3300046642 | Bacteria | 1908 |
| 596 | Ga0495611_0030774 | 3300046648 | Bacteria | 2361 |
| 597 | Ga0495635_0005592 | 3300046663 | Bacteria | 8754 |
| 598 | Ga0495635_0009065 | 3300046663 | Bacteria | 6943 |
| 599 | Ga0495635_0121382 | 3300046663 | Bacteria | 1782 |
| 600 | Ga0495657_0005150 | 3300046675 | Bacteria | 10356 |
| 601 | Ga0495657_0028782 | 3300046675 | Bacteria | 3903 |
| 602 | Ga0495657_0041042 | 3300046675 | Bacteria | 3169 |
| 603 | Ga0495599_0000333 | 3300046678 | Bacteria | 28098 |
| 604 | Ga0495599_0033366 | 3300046678 | Bacteria | 3234 |
| 605 | Ga0495623_0000045 | 3300046679 | Bacteria | 76108 |
| 606 | Ga0495623_0135874 | 3300046679 | Bacteria | 1467 |
| 607 | Ga0495646_0001574 | 3300046680 | Bacteria | 13601 |
| 608 | Ga0495647_0001706 | 3300046681 | Bacteria | 6801 |
| 609 | Ga0495647_0041836 | 3300046681 | Bacteria | 1747 |
| 610 | Ga0495658_0000744 | 3300046683 | Bacteria | 17574 |
| 611 | Ga0495658_0004421 | 3300046683 | Bacteria | 6920 |
| 612 | Ga0495658_0154682 | 3300046683 | Bacteria | 1411 |
| 613 | Ga0495613_0004408 | 3300046689 | Bacteria | 10541 |
| 614 | Ga0495613_0024915 | 3300046689 | Bacteria | 4457 |
| 615 | Ga0495613_0045822 | 3300046689 | Bacteria | 3233 |
| 616 | Ga0495613_0125233 | 3300046689 | Bacteria | 1843 |
| 617 | Ga0495624_0005308 | 3300046690 | Bacteria | 9308 |
| 618 | Ga0495624_0122646 | 3300046690 | Bacteria | 1595 |
| 619 | Ga0495600_0013302 | 3300046809 | Bacteria | 5167 |
| 620 | Ga0495600_0067558 | 3300046809 | Bacteria | 2336 |
| 621 | Ga0495600_0205560 | 3300046809 | Bacteria | 1263 |
| 622 | Ga0495581_0003783 | 3300047315 | Bacteria | 8706 |
| 623 | Ga0495581_0087005 | 3300047315 | Bacteria | 1812 |
| 624 | Ga0495604_0000221 | 3300047317 | Bacteria | 52090 |
| 625 | Ga0495604_0035438 | 3300047317 | Bacteria | 3941 |
| 626 | Ga0495604_0148731 | 3300047317 | Bacteria | 1666 |
| 627 | Ga0495674_0014568 | 3300047319 | Bacteria | 7357 |
| 628 | Ga0495674_0027350 | 3300047319 | Bacteria | 5212 |
| 629 | Ga0495674_0033316 | 3300047319 | Bacteria | 4668 |
| 630 | Ga0495674_0213148 | 3300047319 | Bacteria | 1599 |
| 631 | Ga0495674_0289292 | 3300047319 | Bacteria | 1340 |
| 632 | Ga0495674_0438609 | 3300047319 | Bacteria | 1050 |
| 633 | Ga0495676_0003082 | 3300047321 | Bacteria | 15076 |
| 634 | Ga0495676_0038501 | 3300047321 | Bacteria | 3970 |
| 635 | Ga0495680_0008375 | 3300047322 | Bacteria | 9402 |
| 636 | Ga0495680_0010437 | 3300047322 | Bacteria | 8285 |
| 637 | Ga0495680_0023725 | 3300047322 | Bacteria | 5097 |
| 638 | Ga0495680_0028331 | 3300047322 | Bacteria | 4593 |
| 639 | Ga0495680_0028821 | 3300047322 | Bacteria | 4550 |
| 640 | Ga0495680_0040576 | 3300047322 | Bacteria | 3707 |
| 641 | Ga0495680_0244258 | 3300047322 | Bacteria | 1274 |
| 642 | Ga0495675_0000301 | 3300047444 | Bacteria | 35499 |
| 643 | Ga0495675_0014555 | 3300047444 | Bacteria | 4973 |
| 644 | Ga0495675_0040483 | 3300047444 | Bacteria | 2970 |
| 645 | Ga0495684_0016067 | 3300047471 | Bacteria | 5762 |
| 646 | Ga0495684_0018289 | 3300047471 | Bacteria | 5401 |
| 647 | Ga0495684_0029339 | 3300047471 | Bacteria | 4222 |
| 648 | Ga0495684_0043435 | 3300047471 | Bacteria | 3441 |
| 649 | Ga0495684_0175149 | 3300047471 | Bacteria | 1593 |
| 650 | Ga0495593_0000798 | 3300047673 | Bacteria | 18229 |
| 651 | Ga0495593_0011696 | 3300047673 | Bacteria | 5036 |
| 652 | Ga0495602_0000515 | 3300048088 | Bacteria | 36065 |
| 653 | Ga0495602_0015412 | 3300048088 | Bacteria | 7715 |
| 654 | Ga0495602_0172003 | 3300048088 | Bacteria | 1680 |
| 655 | Ga0495602_0281302 | 3300048088 | Bacteria | 1225 |
| 656 | Ga0495614_0001575 | 3300048089 | Bacteria | 9905 |
| 657 | Ga0496100_0019067 | 3300048903 | Bacteria | 4084 |
| 658 | Ga0496100_0026411 | 3300048903 | Bacteria | 3560 |
| 659 | Ga0496100_0037174 | 3300048903 | Bacteria | 3076 |
| 660 | Ga0496100_0101962 | 3300048903 | Bacteria | 1979 |
| 661 | Ga0496101_0049568 | 3300048904 | Bacteria | 3021 |
| 662 | Ga0496101_0052216 | 3300048904 | Bacteria | 2947 |
| 663 | Ga0496101_0064042 | 3300048904 | Bacteria | 2677 |
| 664 | Ga0496101_0160608 | 3300048904 | Bacteria | 1723 |
| 665 | Ga0496101_0185378 | 3300048904 | Bacteria | 1604 |
| 666 | Ga0496101_0224238 | 3300048904 | Bacteria | 1459 |
| 667 | Ga0496102_0036466 | 3300048905 | Bacteria | 4430 |
| 668 | Ga0496102_0081335 | 3300048905 | Bacteria | 2986 |
| 669 | Ga0496102_0217148 | 3300048905 | Bacteria | 1802 |
| 670 | Ga0496102_0362995 | 3300048905 | Bacteria | 1364 |
| 671 | Ga0496103_0008204 | 3300048906 | Bacteria | 6198 |
| 672 | Ga0496103_0056672 | 3300048906 | Bacteria | 2433 |
| 673 | Ga0496103_0100313 | 3300048906 | Bacteria | 1832 |
| 674 | Ga0496103_0115809 | 3300048906 | Bacteria | 1705 |
| 675 | Ga0496104_0041528 | 3300048907 | Bacteria | 4313 |
| 676 | Ga0496104_0047081 | 3300048907 | Bacteria | 4063 |
| 677 | Ga0496104_0104551 | 3300048907 | Bacteria | 2713 |
| 678 | Ga0496104_0109106 | 3300048907 | Bacteria | 2652 |
| 679 | Ga0496104_0159801 | 3300048907 | Bacteria | 2162 |
| 680 | Ga0496104_0262224 | 3300048907 | Bacteria | 1641 |
| 681 | Ga0496104_0428593 | 3300048907 | Bacteria | 1234 |
| 682 | Ga0496105_0026183 | 3300048908 | Bacteria | 4754 |
| 683 | Ga0496105_0026439 | 3300048908 | Bacteria | 4733 |
| 684 | Ga0496105_0038633 | 3300048908 | Bacteria | 3933 |
| 685 | Ga0496105_0061555 | 3300048908 | Bacteria | 3097 |
| 686 | Ga0496105_0150778 | 3300048908 | Bacteria | 1911 |
| 687 | Ga0496106_0033345 | 3300048909 | Bacteria | 3842 |
| 688 | Ga0496106_0096622 | 3300048909 | Bacteria | 2286 |
| 689 | Ga0496106_0635465 | 3300048909 | Bacteria | 853 |
| 690 | Ga0496107_0013890 | 3300048910 | Bacteria | 5629 |
| 691 | Ga0496107_0139721 | 3300048910 | Bacteria | 1790 |
| 692 | Ga0496108_0024383 | 3300048911 | Bacteria | 4979 |
| 693 | Ga0496108_0027735 | 3300048911 | Bacteria | 4680 |
| 694 | Ga0496108_0136278 | 3300048911 | Bacteria | 2113 |
| 695 | Ga0496109_0003495 | 3300048912 | Bacteria | 13129 |
| 696 | Ga0496109_0006317 | 3300048912 | Bacteria | 9979 |
| 697 | Ga0496109_0265966 | 3300048912 | Bacteria | 1615 |
| 698 | Ga0496110_0003644 | 3300048913 | Bacteria | 11849 |
| 699 | Ga0496110_0034753 | 3300048913 | Bacteria | 4369 |
| 700 | Ga0496110_0106652 | 3300048913 | Bacteria | 2514 |
| 701 | Ga0496110_0119671 | 3300048913 | Bacteria | 2372 |
| 702 | Ga0496110_0215319 | 3300048913 | Bacteria | 1747 |
| 703 | Ga0496111_0005722 | 3300048914 | Bacteria | 8015 |
| 704 | Ga0496111_0010010 | 3300048914 | Bacteria | 6345 |
| 705 | Ga0496111_0013251 | 3300048914 | Bacteria | 5605 |
| 706 | Ga0496111_0070614 | 3300048914 | Bacteria | 2540 |
| 707 | Ga0496111_0307872 | 3300048914 | Bacteria | 1174 |
| 708 | Ga0496112_0051091 | 3300048915 | Bacteria | 4055 |
| 709 | Ga0496112_0255319 | 3300048915 | Bacteria | 1703 |
| 710 | Ga0496112_0279221 | 3300048915 | Bacteria | 1618 |
| 711 | Ga0496112_0380116 | 3300048915 | Bacteria | 1353 |
| 712 | Ga0496113_0025451 | 3300048916 | Bacteria | 4218 |
| 713 | Ga0496113_0046533 | 3300048916 | Bacteria | 3221 |
| 714 | Ga0496113_0227349 | 3300048916 | Bacteria | 1487 |
| 715 | Ga0496114_0000364 | 3300048917 | Bacteria | 33204 |
| 716 | Ga0496114_0013305 | 3300048917 | Bacteria | 6595 |
| 717 | Ga0496114_0028079 | 3300048917 | Bacteria | 4615 |
| 718 | Ga0496114_0033212 | 3300048917 | Bacteria | 4250 |
| 719 | Ga0496114_0034191 | 3300048917 | Bacteria | 4192 |
| 720 | Ga0496114_0054448 | 3300048917 | Bacteria | 3336 |
| 721 | Ga0496114_0081271 | 3300048917 | Bacteria | 2737 |
| 722 | Ga0496114_0094973 | 3300048917 | Bacteria | 2536 |
| 723 | Ga0496114_0104172 | 3300048917 | Bacteria | 2426 |
| 724 | Ga0496114_0270187 | 3300048917 | Bacteria | 1498 |
| 725 | Ga0496115_0021888 | 3300048918 | Bacteria | 4944 |
| 726 | Ga0496115_0035956 | 3300048918 | Bacteria | 3920 |
| 727 | Ga0496115_0052998 | 3300048918 | Bacteria | 3255 |
| 728 | Ga0496115_0081804 | 3300048918 | Bacteria | 2630 |
| 729 | Ga0496115_0085206 | 3300048918 | Bacteria | 2577 |
| 730 | Ga0496115_0117604 | 3300048918 | Bacteria | 2186 |
| 731 | Ga0501031_0007366 | 3300049568 | Bacteria | 7172 |
| 732 | Ga0501031_0038412 | 3300049568 | Bacteria | 3124 |
| 733 | Ga0501032_0087693 | 3300049569 | Bacteria | 2066 |
| 734 | Ga0501033_0006390 | 3300049570 | Bacteria | 9231 |
| 735 | Ga0501036_0007757 | 3300049572 | Bacteria | 8774 |
| 736 | Ga0501036_0027767 | 3300049572 | Bacteria | 4783 |
| 737 | Ga0501037_0084879 | 3300049573 | Bacteria | 2293 |
| 738 | Ga0501038_0016863 | 3300049574 | Bacteria | 6611 |
| 739 | Ga0501039_0001821 | 3300049575 | Bacteria | 15764 |
| 740 | Ga0501040_0014174 | 3300049576 | Bacteria | 5247 |
| 741 | Ga0501040_0050467 | 3300049576 | Bacteria | 2846 |
| 742 | Ga0501041_0028489 | 3300049577 | Bacteria | 3369 |
| 743 | Ga0501041_0253188 | 3300049577 | Bacteria | 1107 |
| 744 | Ga0501042_0013206 | 3300049578 | Bacteria | 5623 |
| 745 | Ga0501042_0022436 | 3300049578 | Bacteria | 4408 |
| 746 | Ga0501042_0218301 | 3300049578 | Bacteria | 1375 |
| 747 | Ga0501046_0004344 | 3300049580 | Bacteria | 12906 |
| 748 | Ga0501046_0005337 | 3300049580 | Bacteria | 11497 |
| 749 | Ga0501046_0050892 | 3300049580 | Bacteria | 3271 |
| 750 | Ga0501047_0089460 | 3300049581 | Bacteria | 2956 |
| 751 | Ga0501047_0142863 | 3300049581 | Bacteria | 2271 |
| 752 | Ga0501047_0239047 | 3300049581 | Bacteria | 1667 |
| 753 | Ga0501048_0002165 | 3300049582 | Bacteria | 14963 |
| 754 | Ga0501048_0020564 | 3300049582 | Bacteria | 4837 |
| 755 | Ga0501067_0000920 | 3300049583 | Bacteria | 15796 |
| 756 | Ga0501067_0028652 | 3300049583 | Bacteria | 3086 |
| 757 | Ga0501068_0034388 | 3300049584 | Bacteria | 3022 |
| 758 | Ga0501068_0044468 | 3300049584 | Bacteria | 2674 |
| 759 | Ga0501068_0273748 | 3300049584 | Bacteria | 1078 |
| 760 | Ga0501069_0018712 | 3300049585 | Bacteria | 3741 |
| 761 | Ga0501069_0034394 | 3300049585 | Bacteria | 2791 |
| 762 | Ga0501069_0115155 | 3300049585 | Bacteria | 1533 |
| 763 | Ga0501070_0001662 | 3300049586 | Bacteria | 19695 |
| 764 | Ga0501071_0007321 | 3300049587 | Bacteria | 7232 |
| 765 | Ga0501073_0006156 | 3300049589 | Bacteria | 8954 |
| 766 | Ga0501073_0132197 | 3300049589 | Bacteria | 1730 |
| 767 | Ga0501073_0181200 | 3300049589 | Bacteria | 1458 |
| 768 | Ga0501074_0018530 | 3300049590 | Bacteria | 5057 |
| 769 | Ga0501074_0107789 | 3300049590 | Bacteria | 1994 |
| 770 | Ga0501075_0015873 | 3300049591 | Bacteria | 5415 |
| 771 | Ga0501076_0033828 | 3300049592 | Bacteria | 3991 |
| 772 | Ga0501076_0190726 | 3300049592 | Bacteria | 1672 |
| 773 | Ga0501076_0203448 | 3300049592 | Bacteria | 1617 |
| 774 | Ga0501077_0011865 | 3300049593 | Bacteria | 5448 |
| 775 | Ga0501077_0024475 | 3300049593 | Bacteria | 3834 |
| 776 | Ga0501079_0007483 | 3300049741 | Bacteria | 8259 |
| 777 | Ga0501079_0011327 | 3300049741 | Bacteria | 6803 |
| 778 | Ga0501079_0036480 | 3300049741 | Bacteria | 3787 |
| 779 | Ga0501079_0040850 | 3300049741 | Bacteria | 3579 |
| 780 | Ga0501079_0354641 | 3300049741 | Bacteria | 1149 |
| 781 | Ga0501079_0497450 | 3300049741 | Bacteria | 958 |
| 782 | Ga0501080_0027838 | 3300049742 | Bacteria | 5255 |
| 783 | Ga0501080_0133651 | 3300049742 | Bacteria | 2296 |
| 784 | Ga0501080_0259316 | 3300049742 | Bacteria | 1584 |
| 785 | Ga0501081_0016982 | 3300049743 | Bacteria | 4810 |
| 786 | Ga0501081_0028413 | 3300049743 | Bacteria | 3774 |
| 787 | Ga0501083_0039626 | 3300049744 | Bacteria | 3199 |
| 788 | Ga0501035_0033929 | 3300049822 | Bacteria | 4639 |
| 789 | Ga0501045_0004728 | 3300049824 | Bacteria | 9393 |
| 790 | Ga0501045_0360941 | 3300049824 | Bacteria | 1081 |
| 791 | nmdc:mga00v17_34476_c1 | 3300050491 | Bacteria | 3007 |
| 792 | nmdc:mga05p37_193536_c1 | 3300050507 | Bacteria | 2467 |
| 793 | nmdc:mga05p37_261065_c1 | 3300050507 | Bacteria | 2073 |
| 794 | nmdc:mga05p37_475962_c1 | 3300050507 | Bacteria | 1440 |
| 795 | nmdc:mga08y16_113485_c1 | 3300050511 | Bacteria | 2821 |
| 796 | nmdc:mga08y16_11993_c1 | 3300050511 | Bacteria | 9102 |
| 797 | nmdc:mga08y16_17746_c1 | 3300050511 | Bacteria | 7494 |
| 798 | nmdc:mga08y16_187396_c1 | 3300050511 | Bacteria | 2147 |
| 799 | nmdc:mga08y16_374741_c1 | 3300050511 | Bacteria | 1460 |
| 800 | nmdc:mga0n895_45400_c1 | 3300050512 | Bacteria | 4288 |
| 801 | nmdc:mga0n895_97573_c1 | 3300050512 | Bacteria | 2945 |
| 802 | nmdc:mga0rr50_190190_c1 | 3300050513 | Bacteria | 1682 |
| 803 | nmdc:mga08x19_159419_c1 | 3300050514 | Bacteria | 1532 |
| 804 | nmdc:mga0a205_139871_c1 | 3300050515 | Bacteria | 2321 |
| 805 | nmdc:mga0a205_29673_c1 | 3300050515 | Bacteria | 5235 |
| 806 | nmdc:mga0a205_91618_c1 | 3300050515 | Bacteria | 2938 |
| 807 | Ga0495601_0001384 | 3300053077 | Bacteria | 13334 |
| 808 | Ga0495601_0008325 | 3300053077 | Bacteria | 6122 |
| 809 | Ga0495601_0025754 | 3300053077 | Bacteria | 3629 |
| 810 | Ga0495601_0048459 | 3300053077 | Bacteria | 2676 |
| 811 | Ga0495601_0173355 | 3300053077 | Bacteria | 1410 |
| 812 | Ga0495612_0026986 | 3300053078 | Bacteria | 2308 |
| 813 | Ga0495619_0015113 | 3300053085 | Bacteria | 4879 |
| 814 | Ga0495619_0016315 | 3300053085 | Bacteria | 4700 |
| 815 | Ga0495619_0025164 | 3300053085 | Bacteria | 3820 |
| 816 | Ga0495619_0027899 | 3300053085 | Bacteria | 3641 |
| 817 | Ga0495619_0079155 | 3300053085 | Bacteria | 2210 |
| 818 | Ga0495619_0083832 | 3300053085 | Bacteria | 2150 |
| 819 | Ga0501084_0001737 | 3300054114 | Bacteria | 17297 |
| 820 | Ga0501084_0021516 | 3300054114 | Bacteria | 5376 |
| 821 | Ga0501084_0074442 | 3300054114 | Bacteria | 2843 |
| 822 | Ga0501084_0223457 | 3300054114 | Bacteria | 1589 |
| 823 | Ga0590071_033111 | 3300059421 | Bacteria | 1235 |
| 824 | Ga0590075_010926 | 3300059424 | Bacteria | 2191 |
| 825 | Ga0590075_024546 | 3300059424 | Bacteria | 1513 |
| 826 | Ga0501082_0014276 | 3300060353 | Bacteria | 6835 |
| 827 | Ga0501082_0024133 | 3300060353 | Bacteria | 5245 |
| 828 | Ga0501082_0216609 | 3300060353 | Bacteria | 1666 |
| 829 | Ga0466962_0003247 | 3300061719 | Bacteria | 7728 |
| 830 | Ga0466962_0005650 | 3300061719 | Bacteria | 6007 |
| 831 | Ga0466962_0013061 | 3300061719 | Bacteria | 3995 |
| 832 | Ga0466962_0021899 | 3300061719 | Bacteria | 3068 |
| 833 | Ga0466962_0028781 | 3300061719 | Bacteria | 2661 |
| 834 | Ga0466962_0059126 | 3300061719 | Bacteria | 1829 |
| 835 | Ga0530510_0021185 | 3300061734 | Bacteria | 4624 |
| 836 | Ga0530510_0024214 | 3300061734 | Bacteria | 4331 |
| 837 | Ga0530510_0106352 | 3300061734 | Bacteria | 2053 |
| 838 | Ga0530510_0186372 | 3300061734 | Bacteria | 1540 |
| 839 | 2837185848 | 2837183177 | Bacteria | 4637169 |
| 840 | 3005600416 | 3005594810 | Bacteria | 8716512 |
| 841 | Ga0501040_0107438 | |||
| 842 | JGI24738J21930_10025413 | |||
| 843 | JGI24738J21930_10026083 | |||
| 844 | JGI25406J46586_10028254 | |||
| 845 | Ga0070658_10010127 | |||
| 846 | Ga0070658_10069138 | |||
| 847 | Ga0070658_10075720 | |||
| 848 | Ga0070658_10118681 | |||
| 849 | Ga0070658_10517532 | |||
| 850 | Ga0070676_10157333 | |||
| 851 | Ga0070683_100008795 | |||
| 852 | Ga0070683_100010761 | |||
| 853 | Ga0070683_100018232 | |||
| 854 | Ga0070683_100039197 | |||
| 855 | Ga0070683_100049454 | |||
| 856 | Ga0070683_100066175 | |||
| 857 | Ga0070683_100128930 | |||
| 858 | Ga0070683_100261149 | |||
| 859 | Ga0068869_100024325 | |||
| 860 | Ga0070666_10193422 | |||
| 861 | Ga0070680_100006974 | |||
| 862 | Ga0070680_100020896 | |||
| 863 | Ga0070680_100044053 | |||
| 864 | Ga0070680_100122921 | |||
| 865 | Ga0070682_100020630 | |||
| 866 | Ga0070682_100046156 | |||
| 867 | Ga0070682_100422416 | |||
| 868 | Ga0068868_100042558 | |||
| 869 | Ga0068868_100222263 | |||
| 870 | Ga0068868_100455990 | |||
| 871 | Ga0070660_100012499 | |||
| 872 | Ga0070660_100014929 | |||
| 873 | Ga0070660_100042819 | |||
| 874 | Ga0070660_100044891 | |||
| 875 | Ga0070660_100063683 | |||
| 876 | Ga0070660_100255570 | |||
| 877 | Ga0070687_100083762 | |||
| 878 | Ga0070661_100014518 | |||
| 879 | Ga0070661_100028771 | |||
| 880 | Ga0070661_100054785 | |||
| 881 | Ga0070692_10003817 | |||
| 882 | Ga0070692_10040657 | |||
| 883 | Ga0070692_10184804 | |||
| 884 | Ga0070675_100129146 | |||
| 885 | Ga0070675_100240535 | |||
| 886 | Ga0070671_100053886 | |||
| 887 | Ga0070671_100098330 | |||
| 888 | Ga0070674_100038950 | |||
| 889 | Ga0070673_100012377 | |||
| 890 | Ga0070688_100076556 | |||
| 891 | Ga0070659_100071124 | |||
| 892 | Ga0070659_100322901 | |||
| 893 | Ga0070667_100245815 | |||
| 894 | Ga0070709_10023994 | |||
| 895 | Ga0070709_10042733 | |||
| 896 | Ga0070709_10085777 | |||
| 897 | Ga0070714_100015392 | |||
| 898 | Ga0070714_100051530 | |||
| 899 | Ga0070714_100073013 | |||
| 900 | Ga0070714_100288585 | |||
| 901 | Ga0070714_100428048 | |||
| 902 | Ga0070713_100141290 | |||
| 903 | Ga0070713_100222344 | |||
| 904 | Ga0070713_100297343 | |||
| 905 | Ga0070701_10151038 | |||
| 906 | Ga0070711_100050161 | |||
| 907 | Ga0070711_100315425 | |||
| 908 | Ga0070705_100011668 | |||
| 909 | Ga0070705_100223307 | |||
| 910 | Ga0070700_100054812 | |||
| 911 | Ga0070663_100070415 | |||
| 912 | Ga0070663_100148783 | |||
| 913 | Ga0070678_100010384 | |||
| 914 | Ga0070678_100066101 | |||
| 915 | Ga0070678_100086227 | |||
| 916 | Ga0070678_100441265 | |||
| 917 | Ga0070662_100027968 | |||
| 918 | Ga0070662_100064277 | |||
| 919 | Ga0070681_10004844 | |||
| 920 | Ga0070681_10039408 | |||
| 921 | Ga0070681_10045350 | |||
| 922 | Ga0070681_10049946 | |||
| 923 | Ga0070681_10075348 | |||
| 924 | Ga0070681_10086572 | |||
| 925 | Ga0070681_10093204 | |||
| 926 | Ga0070681_10146886 | |||
| 927 | Ga0068867_100077272 | |||
| 928 | Ga0070685_10027972 | |||
| 929 | Ga0070706_100121857 | |||
| 930 | Ga0070707_100006284 | |||
| 931 | Ga0070699_100301801 | |||
| 932 | Ga0070679_100003738 | |||
| 933 | Ga0070679_100046409 | |||
| 934 | Ga0070679_100090798 | |||
| 935 | Ga0070679_100103266 | |||
| 936 | Ga0070684_100002218 | |||
| 937 | Ga0070684_100018132 | |||
| 938 | Ga0070684_100035686 | |||
| 939 | Ga0070684_100062105 | |||
| 940 | Ga0070684_100062488 | |||
| 941 | Ga0070684_100511438 | |||
| 942 | Ga0068853_100024933 | |||
| 943 | Ga0068853_100091038 | |||
| 944 | Ga0068853_100200138 | |||
| 945 | Ga0068853_100250044 | |||
| 946 | Ga0070672_100058153 | |||
| 947 | Ga0070672_100106609 | |||
| 948 | Ga0070686_100015298 | |||
| 949 | Ga0070686_100192690 | |||
| 950 | Ga0070695_100000473 | |||
| 951 | Ga0070696_100040546 | |||
| 952 | Ga0070693_100042711 | |||
| 953 | Ga0070693_100046127 | |||
| 954 | Ga0070693_100051619 | |||
| 955 | Ga0070665_100024384 | |||
| 956 | Ga0070665_100085826 | |||
| 957 | Ga0070704_100013300 | |||
| 958 | Ga0070704_100014951 | |||
| 959 | Ga0070704_100065055 | |||
| 960 | Ga0068855_100076665 | |||
| 961 | Ga0068855_100124999 | |||
| 962 | Ga0068855_100137222 | |||
| 963 | Ga0068855_100198834 | |||
| 964 | Ga0068855_100266196 | |||
| 965 | Ga0068855_100560732 | |||
| 966 | Ga0070664_100004839 | |||
| 967 | Ga0070664_100043203 | |||
| 968 | Ga0068857_100034041 | |||
| 969 | Ga0068857_100339502 | |||
| 970 | Ga0068854_100002430 | |||
| 971 | Ga0068854_100072611 | |||
| 972 | Ga0068856_100003371 | |||
| 973 | Ga0068856_100013467 | |||
| 974 | Ga0068856_100019337 | |||
| 975 | Ga0068856_100128085 | |||
| 976 | Ga0068856_100300190 | |||
| 977 | Ga0068852_100017592 | |||
| 978 | Ga0068852_100028795 | |||
| 979 | Ga0068859_100207107 | |||
| 980 | Ga0068864_100015042 | |||
| 981 | Ga0068864_100130357 | |||
| 982 | Ga0068866_10009683 | |||
| 983 | Ga0068861_100293166 | |||
| 984 | Ga0068851_10006889 | |||
| 985 | Ga0068851_10023722 | |||
| 986 | Ga0068870_10015099 | |||
| 987 | Ga0068870_10133475 | |||
| 988 | Ga0068863_100086154 | |||
| 989 | Ga0068858_100058130 | |||
| 990 | Ga0068858_100100470 | |||
| 991 | Ga0081455_10003991 | |||
| 992 | Ga0081455_10055669 | |||
| 993 | Ga0081538_10033491 | |||
| 994 | Ga0081540_1053939 | |||
| 995 | Ga0081540_1096617 | |||
| 996 | Ga0081539_10000288 | |||
| 997 | Ga0070717_10021288 | |||
| 998 | Ga0070717_10024510 | |||
| 999 | Ga0070717_10070071 | |||
| 1000 | Ga0070717_10077181 | |||
| 1001 | Ga0070717_10140117 | |||
| 1002 | Ga0075432_10002322 | |||
| 1003 | Ga0075432_10051389 | |||
| 1004 | Ga0070715_10049496 | |||
| 1005 | Ga0070712_100008606 | |||
| 1006 | Ga0097621_100053448 | |||
| 1007 | Ga0097621_100550007 | |||
| 1008 | Ga0068871_100022094 | |||
| 1009 | Ga0075428_100024249 | |||
| 1010 | Ga0075428_100080809 | |||
| 1011 | Ga0075433_10043712 | |||
| 1012 | Ga0075433_10552118 | |||
| 1013 | Ga0075434_100056433 | |||
| 1014 | Ga0075434_100094580 | |||
| 1015 | Ga0075434_100099092 | |||
| 1016 | Ga0075429_100058267 | |||
| 1017 | Ga0068865_100033151 | |||
| 1018 | Ga0068865_100167225 | |||
| 1019 | Ga0075436_100081823 | |||
| 1020 | Ga0097620_100207123 | |||
| 1021 | Ga0075435_100046999 | |||
| 1022 | Ga0075435_100168131 | |||
| 1023 | Ga0075435_100214476 | |||
| 1024 | Ga0075435_100254733 | |||
| 1025 | Ga0111539_10011635 | |||
| 1026 | Ga0111539_10189513 | |||
| 1027 | Ga0111539_10276642 | |||
| 1028 | Ga0105245_10019761 | |||
| 1029 | Ga0105245_10039396 | |||
| 1030 | Ga0105245_10191384 | |||
| 1031 | Ga0105245_10251252 | |||
| 1032 | Ga0105245_10457863 | |||
| 1033 | Ga0105245_10615123 | |||
| 1034 | Ga0105247_10087365 | |||
| 1035 | Ga0114129_10064134 | |||
| 1036 | Ga0114129_10579666 | |||
| 1037 | Ga0114129_10618246 | |||
| 1038 | Ga0105243_10026218 | |||
| 1039 | Ga0105243_10032904 | |||
| 1040 | Ga0105243_10055460 | |||
| 1041 | Ga0105242_10029521 | |||
| 1042 | Ga0105242_10157856 | |||
| 1043 | Ga0105248_10109102 | |||
| 1044 | Ga0105237_10098927 | |||
| 1045 | Ga0105237_10558973 | |||
| 1046 | Ga0105238_10046610 | |||
| 1047 | Ga0105238_10419811 | |||
| 1048 | Ga0105249_10099006 | |||
| 1049 | Ga0105239_10059456 | |||
| 1050 | Ga0105239_10060773 | |||
| 1051 | Ga0105239_10376775 | |||
| 1052 | Ga0105239_10593733 | |||
| 1053 | Ga0105246_10041852 | |||
| 1054 | Ga0105246_10212286 | |||
| 1055 | Ga0157371_10006491 | |||
| 1056 | Ga0157371_10137322 | |||
| 1057 | Ga0157371_10257963 | |||
| 1058 | Ga0157369_10007413 | |||
| 1059 | Ga0157369_10023973 | |||
| 1060 | Ga0157369_10132889 | |||
| 1061 | Ga0157369_10370749 | |||
| 1062 | Ga0157369_10782481 | |||
| 1063 | Ga0157374_10109651 | |||
| 1064 | Ga0157372_10003022 | |||
| 1065 | Ga0157372_10351212 | |||
| 1066 | Ga0157375_10014341 | |||
| 1067 | Ga0157375_10081420 | |||
| 1068 | Ga0163163_10321301 | |||
| 1069 | Ga0163163_10659963 | |||
| 1070 | Ga0157377_10012819 | |||
| 1071 | Ga0157376_10033684 | |||
| 1072 | Ga0163161_10203156 | |||
| 1073 | Ga0206356_11192765 | |||
| 1074 | Ga0206356_11827461 | |||
| 1075 | Ga0206353_10249821 | |||
| 1076 | Ga0207656_10105185 | |||
| 1077 | Ga0207653_10009842 | |||
| 1078 | Ga0207692_10015755 | |||
| 1079 | Ga0207692_10059063 | |||
| 1080 | Ga0207688_10013452 | |||
| 1081 | Ga0207688_10103374 | |||
| 1082 | Ga0207685_10056168 | |||
| 1083 | Ga0207699_10001898 | |||
| 1084 | Ga0207643_10010886 | |||
| 1085 | Ga0207643_10026400 | |||
| 1086 | Ga0207643_10139561 | |||
| 1087 | Ga0207705_10028335 | |||
| 1088 | Ga0207705_10042578 | |||
| 1089 | Ga0207684_10103541 | |||
| 1090 | Ga0207654_10209687 | |||
| 1091 | Ga0207707_10033528 | |||
| 1092 | Ga0207707_10078733 | |||
| 1093 | Ga0207707_10144226 | |||
| 1094 | Ga0207707_10183676 | |||
| 1095 | Ga0207707_10267117 | |||
| 1096 | Ga0207707_10314377 | |||
| 1097 | Ga0207671_10260525 | |||
| 1098 | Ga0207693_10000818 | |||
| 1099 | Ga0207693_10013620 | |||
| 1100 | Ga0207693_10353071 | |||
| 1101 | Ga0207663_10003493 | |||
| 1102 | Ga0207663_10096523 | |||
| 1103 | Ga0207660_10004053 | |||
| 1104 | Ga0207660_10018590 | |||
| 1105 | Ga0207662_10102940 | |||
| 1106 | Ga0207657_10001151 | |||
| 1107 | Ga0207657_10005824 | |||
| 1108 | Ga0207657_10006782 | |||
| 1109 | Ga0207657_10020557 | |||
| 1110 | Ga0207657_10049863 | |||
| 1111 | Ga0207657_10053652 | |||
| 1112 | Ga0207657_10236135 | |||
| 1113 | Ga0207649_10031554 | |||
| 1114 | Ga0207649_10070106 | |||
| 1115 | Ga0207649_10207240 | |||
| 1116 | Ga0207652_10110901 | |||
| 1117 | Ga0207646_10001697 | |||
| 1118 | Ga0207681_10313986 | |||
| 1119 | Ga0207694_10031524 | |||
| 1120 | Ga0207694_10036336 | |||
| 1121 | Ga0207694_10084136 | |||
| 1122 | Ga0207659_10016601 | |||
| 1123 | Ga0207687_10023194 | |||
| 1124 | Ga0207687_10155869 | |||
| 1125 | Ga0207687_10210902 | |||
| 1126 | Ga0207687_10297085 | |||
| 1127 | Ga0207687_10344517 | |||
| 1128 | Ga0207700_10124940 | |||
| 1129 | Ga0207664_10011933 | |||
| 1130 | Ga0207664_10014507 | |||
| 1131 | Ga0207664_10071014 | |||
| 1132 | Ga0207664_10088771 | |||
| 1133 | Ga0207690_10027298 | |||
| 1134 | Ga0207690_10056898 | |||
| 1135 | Ga0207706_10003828 | |||
| 1136 | Ga0207706_10016073 | |||
| 1137 | Ga0207686_10015295 | |||
| 1138 | Ga0207709_10010328 | |||
| 1139 | Ga0207670_10202737 | |||
| 1140 | Ga0207670_10378276 | |||
| 1141 | Ga0207704_10024613 | |||
| 1142 | Ga0207704_10038809 | |||
| 1143 | Ga0207665_10004954 | |||
| 1144 | Ga0207691_10008491 | |||
| 1145 | Ga0207691_10026092 | |||
| 1146 | Ga0207691_10026254 | |||
| 1147 | Ga0207689_10018518 | |||
| 1148 | Ga0207661_10000903 | |||
| 1149 | Ga0207661_10012787 | |||
| 1150 | Ga0207661_10066087 | |||
| 1151 | Ga0207661_10113768 | |||
| 1152 | Ga0207661_10137931 | |||
| 1153 | Ga0207661_10146863 | |||
| 1154 | Ga0207661_10245651 | |||
| 1155 | Ga0207679_10005676 | |||
| 1156 | Ga0207679_10011483 | |||
| 1157 | Ga0207667_10174260 | |||
| 1158 | Ga0207667_10565384 | |||
| 1159 | Ga0207651_10034643 | |||
| 1160 | Ga0207712_10087165 | |||
| 1161 | Ga0207640_10026817 | |||
| 1162 | Ga0207677_10013254 | |||
| 1163 | Ga0207703_10147399 | |||
| 1164 | Ga0207678_10029462 | |||
| 1165 | Ga0207678_10044253 | |||
| 1166 | Ga0207678_10108165 | |||
| 1167 | Ga0207678_10192563 | |||
| 1168 | Ga0207678_10340874 | |||
| 1169 | Ga0207702_10009768 | |||
| 1170 | Ga0207702_10028980 | |||
| 1171 | Ga0207641_10153700 | |||
| 1172 | Ga0207648_10018847 | |||
| 1173 | Ga0207648_10310646 | |||
| 1174 | Ga0207676_10080997 | |||
| 1175 | Ga0207674_10015159 | |||
| 1176 | Ga0207674_10073309 | |||
| 1177 | Ga0207674_10180127 | |||
| 1178 | Ga0207675_100008588 | |||
| 1179 | Ga0207675_100014621 | |||
| 1180 | Ga0207675_100210188 | |||
| 1181 | Ga0207683_10020230 | |||
| 1182 | Ga0207683_10485805 | |||
| 1183 | Ga0207698_10027760 | |||
| 1184 | Ga0207698_10047129 | |||
| 1185 | Ga0207428_10003615 | |||
| 1186 | Ga0207428_10008323 | |||
| 1187 | Ga0207428_10079429 | |||
| 1188 | Ga0207428_10080318 | |||
| 1189 | Ga0268264_10152122 | |||
| 1190 | Ga0265337_1002622 | |||
| 1191 | Ga0265326_10002075 | |||
| 1192 | Ga0265319_1003587 | |||
| 1193 | Ga0265319_1007435 | |||
| 1194 | Ga0265334_10000697 | |||
| 1195 | Ga0265334_10008449 | |||
| 1196 | Ga0265334_10054195 | |||
| 1197 | Ga0265318_10001580 | |||
| 1198 | Ga0265322_10022059 | |||
| 1199 | Ga0265322_10030297 | |||
| 1200 | Ga0265336_10001906 | |||
| 1201 | Ga0265338_10000634 | |||
| 1202 | Ga0265338_10003841 | |||
| 1203 | Ga0265338_10005145 | |||
| 1204 | Ga0265338_10007327 | |||
| 1205 | Ga0265338_10037406 | |||
| 1206 | Ga0265324_10004949 | |||
| 1207 | Ga0265330_10009651 | |||
| 1208 | Ga0265332_10010707 | |||
| 1209 | Ga0265332_10026345 | |||
| 1210 | Ga0265328_10027387 | |||
| 1211 | Ga0265320_10001998 | |||
| 1212 | Ga0265325_10011051 | |||
| 1213 | Ga0265325_10011878 | |||
| 1214 | Ga0265329_10014532 | |||
| 1215 | Ga0265340_10008049 | |||
| 1216 | Ga0265339_10079371 | |||
| 1217 | Ga0265327_10040207 | |||
| 1218 | Ga0265313_10036237 | |||
| 1219 | Ga0265313_10040081 | |||
| 1220 | Ga0265313_10078092 | |||
| 1221 | Ga0265314_10010490 | |||
| 1222 | Ga0265314_10033078 | |||
| 1223 | Ga0265314_10049649 | |||
| 1224 | Ga0265342_10004798 | |||
| 1225 | Ga0307405_10061464 | |||
| 1226 | Ga0307413_10390876 | |||
| 1227 | Ga0307415_100374456 | |||
| 1228 | Ga0373928_0026440 | |||
| 1229 | Ga0373929_0028945 | |||
| 1230 | Ga0373944_0030475 | |||
| 1231 | Ga0373952_0038338 | |||
| 1232 | Ga0373939_0005177 | |||
| 1233 | Ga0373939_0006400 | |||
| 1234 | Ga0373945_0001608 | |||
| 1235 | Ga0373945_0046538 | |||
| 1236 | Ga0373956_0040998 | |||
| 1237 | Ga0373943_0000939 | |||
| 1238 | Ga0373943_0005099 | |||
| 1239 | Ga0373946_0002830 | |||
| 1240 | Ga0373955_0037804 | |||
| 1241 | Ga0373961_0009590 | |||
| 1242 | Ga0373962_0015492 | |||
| 1243 | Ga0373924_0050420 | |||
| 1244 | Ga0373931_0049430 | |||
| 1245 | Ga0373931_0204067 | |||
| 1246 | Ga0373927_0098860 | |||
| 1247 | Ga0373947_0002001 | |||
| 1248 | Ga0373937_0000749 | |||
| 1249 | Ga0373925_0005743 | |||
| 1250 | Ga0373925_0064886 | |||
| 1251 | Ga0395899_0095195 | |||
| 1252 | Ga0395899_0241616 | |||
| 1253 | Ga0395899_0286756 | |||
| 1254 | Ga0395900_0001894 | |||
| 1255 | Ga0395900_0005497 | |||
| 1256 | Ga0395900_0064424 | |||
| 1257 | Ga0395900_0074022 | |||
| 1258 | Ga0395900_0127818 | |||
| 1259 | Ga0395900_0344030 | |||
| 1260 | Ga0395898_0003598 | |||
| 1261 | Ga0395898_0008350 | |||
| 1262 | Ga0395898_0049223 | |||
| 1263 | Ga0395898_0155490 | |||
| 1264 | Ga0395898_0353432 | |||
| 1265 | Ga0395905_0001553 | |||
| 1266 | Ga0395905_0095700 | |||
| 1267 | Ga0395905_0106246 | |||
| 1268 | Ga0395901_0002743 | |||
| 1269 | Ga0395901_0003280 | |||
| 1270 | Ga0395901_0007911 | |||
| 1271 | Ga0395901_0009920 | |||
| 1272 | Ga0395901_0034752 | |||
| 1273 | Ga0395901_0634850 | |||
| 1274 | Ga0436365_0703538 | |||
| 1275 | Ga0436365_1041337 | |||
| 1276 | Ga0439442_012972 | |||
| 1277 | Ga0439448_0027100 | |||
| 1278 | Ga0450906_007946 | |||
| 1279 | Ga0439446_0007189 | |||
| 1280 | Ga0466969_0003938 | |||
| 1281 | Ga0466972_0139118 | |||
| 1282 | Ga0466965_0016827 | |||
| 1283 | Ga0466965_0022863 | |||
| 1284 | Ga0466966_0002763 | |||
| 1285 | Ga0466966_0185735 | |||
| 1286 | Ga0466961_0001608 | |||
| 1287 | Ga0466961_0005689 | |||
| 1288 | Ga0466961_0008352 | |||
| 1289 | Ga0466961_0140122 | |||
| 1290 | Ga0466963_0004706 | |||
| 1291 | Ga0466963_0006644 | |||
| 1292 | Ga0466963_0007281 | |||
| 1293 | Ga0466963_0010087 | |||
| 1294 | Ga0466963_0025184 | |||
| 1295 | Ga0466963_0031061 | |||
| 1296 | Ga0466963_0032819 | |||
| 1297 | Ga0466963_0036782 | |||
| 1298 | Ga0466963_0037171 | |||
| 1299 | Ga0466963_0045186 | |||
| 1300 | Ga0466963_0045419 | |||
| 1301 | Ga0466963_0046370 | |||
| 1302 | Ga0466963_0073801 | |||
| 1303 | Ga0466963_0088521 | |||
| 1304 | Ga0466963_0184119 | |||
| 1305 | Ga0466963_0286831 | |||
| 1306 | Ga0466964_0010579 | |||
| 1307 | Ga0466964_0014900 | |||
| 1308 | Ga0466964_0016769 | |||
| 1309 | Ga0466964_0024835 | |||
| 1310 | Ga0466964_0081354 | |||
| 1311 | Ga0466964_0113191 | |||
| 1312 | Ga0453684_0003111 | |||
| 1313 | Ga0466971_0000934 | |||
| 1314 | Ga0466971_0003831 | |||
| 1315 | Ga0466971_0006941 | |||
| 1316 | Ga0466971_0011652 | |||
| 1317 | Ga0466971_0024625 | |||
| 1318 | Ga0466971_0078032 | |||
| 1319 | Ga0466968_0011305 | |||
| 1320 | Ga0466968_0016584 | |||
| 1321 | Ga0466968_0016911 | |||
| 1322 | Ga0466968_0025570 | |||
| 1323 | Ga0466970_0010356 | |||
| 1324 | Ga0466957_0044529 | |||
| 1325 | Ga0466957_0082626 | |||
| 1326 | Ga0466957_0086989 | |||
| 1327 | Ga0466957_0094598 | |||
| 1328 | Ga0466957_0099988 | |||
| 1329 | Ga0466960_0027869 | |||
| 1330 | Ga0466959_0005675 | |||
| 1331 | Ga0466959_0006965 | |||
| 1332 | Ga0466959_0026726 | |||
| 1333 | Ga0451576_0030811 | |||
| 1334 | Ga0451576_0093626 | |||
| 1335 | Ga0466958_0000119 | |||
| 1336 | Ga0466958_0003286 | |||
| 1337 | Ga0466958_0009735 | |||
| 1338 | Ga0466958_0010196 | |||
| 1339 | Ga0466958_0032216 | |||
| 1340 | Ga0466958_0057057 | |||
| 1341 | Ga0466958_0094375 | |||
| 1342 | Ga0466958_0114713 | |||
| 1343 | Ga0466958_0216831 | |||
| 1344 | Ga0466967_0000297 | |||
| 1345 | Ga0466967_0001423 | |||
| 1346 | Ga0466967_0004005 | |||
| 1347 | Ga0466967_0004781 | |||
| 1348 | Ga0466967_0013268 | |||
| 1349 | Ga0466967_0026836 | |||
| 1350 | Ga0466967_0034528 | |||
| 1351 | Ga0466967_0040175 | |||
| 1352 | Ga0466967_0048266 | |||
| 1353 | Ga0466967_0060230 | |||
| 1354 | Ga0466967_0065858 | |||
| 1355 | Ga0466967_0096357 | |||
| 1356 | Ga0466967_0115577 | |||
| 1357 | Ga0466967_0119501 | |||
| 1358 | Ga0466967_0130080 | |||
| 1359 | Ga0466967_0251759 | |||
| 1360 | Ga0466967_0540303 | |||
| 1361 | Ga0495592_0000728 | |||
| 1362 | Ga0495592_0084898 | |||
| 1363 | Ga0495603_0091890 | |||
| 1364 | Ga0495629_0003632 | |||
| 1365 | Ga0495629_0008328 | |||
| 1366 | Ga0495629_0073972 | |||
| 1367 | Ga0495629_0199514 | |||
| 1368 | Ga0495629_0332416 | |||
| 1369 | Ga0495641_0002963 | |||
| 1370 | Ga0495641_0008615 | |||
| 1371 | Ga0495651_0000699 | |||
| 1372 | Ga0495651_0057940 | |||
| 1373 | Ga0495651_0075895 | |||
| 1374 | Ga0495653_0007059 | |||
| 1375 | Ga0495653_0022580 | |||
| 1376 | Ga0495653_0064755 | |||
| 1377 | Ga0495653_0086776 | |||
| 1378 | Ga0495580_0020002 | |||
| 1379 | Ga0495582_0000127 | |||
| 1380 | Ga0495582_0005440 | |||
| 1381 | Ga0495639_0001052 | |||
| 1382 | Ga0495639_0003732 | |||
| 1383 | Ga0495662_0000770 | |||
| 1384 | Ga0495662_0004554 | |||
| 1385 | Ga0495664_0005414 | |||
| 1386 | Ga0495664_0026476 | |||
| 1387 | Ga0495594_0024010 | |||
| 1388 | Ga0495607_0080055 | |||
| 1389 | Ga0495608_0008112 | |||
| 1390 | Ga0495608_0011441 | |||
| 1391 | Ga0495608_0015592 | |||
| 1392 | Ga0495608_0027791 | |||
| 1393 | Ga0495618_0000821 | |||
| 1394 | Ga0495618_0025728 | |||
| 1395 | Ga0495618_0042747 | |||
| 1396 | Ga0495628_0001050 | |||
| 1397 | Ga0495628_0037464 | |||
| 1398 | Ga0495628_0146602 | |||
| 1399 | Ga0495630_0003376 | |||
| 1400 | Ga0495630_0013173 | |||
| 1401 | Ga0495630_0044170 | |||
| 1402 | Ga0495630_0122770 | |||
| 1403 | Ga0495630_0185728 | |||
| 1404 | Ga0495666_0027752 | |||
| 1405 | Ga0495652_0000187 | |||
| 1406 | Ga0495652_0126018 | |||
| 1407 | Ga0495652_0235146 | |||
| 1408 | Ga0495652_0242943 | |||
| 1409 | Ga0495652_0247890 | |||
| 1410 | Ga0495665_0000469 | |||
| 1411 | Ga0495665_0002749 | |||
| 1412 | Ga0495640_0002077 | |||
| 1413 | Ga0495640_0014609 | |||
| 1414 | Ga0495640_0027594 | |||
| 1415 | Ga0495640_0044921 | |||
| 1416 | Ga0495640_0084211 | |||
| 1417 | Ga0495586_0013275 | |||
| 1418 | Ga0495586_0149898 | |||
| 1419 | Ga0495587_0000467 | |||
| 1420 | Ga0495587_0020700 | |||
| 1421 | Ga0495587_0026508 | |||
| 1422 | Ga0495587_0040736 | |||
| 1423 | Ga0495645_0000700 | |||
| 1424 | Ga0495645_0228909 | |||
| 1425 | Ga0495667_0008702 | |||
| 1426 | Ga0495667_0021833 | |||
| 1427 | Ga0495667_0034209 | |||
| 1428 | Ga0495667_0040558 | |||
| 1429 | Ga0495667_0053082 | |||
| 1430 | Ga0495667_0060356 | |||
| 1431 | Ga0495667_0141062 | |||
| 1432 | Ga0495656_0119241 | |||
| 1433 | Ga0495634_0006110 | |||
| 1434 | Ga0495634_0013610 | |||
| 1435 | Ga0495634_0097028 | |||
| 1436 | Ga0495611_0030774 | |||
| 1437 | Ga0495635_0005592 | |||
| 1438 | Ga0495635_0009065 | |||
| 1439 | Ga0495635_0121382 | |||
| 1440 | Ga0495657_0005150 | |||
| 1441 | Ga0495657_0028782 | |||
| 1442 | Ga0495657_0041042 | |||
| 1443 | Ga0495599_0000333 | |||
| 1444 | Ga0495599_0033366 | |||
| 1445 | Ga0495623_0000045 | |||
| 1446 | Ga0495623_0135874 | |||
| 1447 | Ga0495646_0001574 | |||
| 1448 | Ga0495647_0001706 | |||
| 1449 | Ga0495647_0041836 | |||
| 1450 | Ga0495658_0000744 | |||
| 1451 | Ga0495658_0004421 | |||
| 1452 | Ga0495658_0154682 | |||
| 1453 | Ga0495613_0004408 | |||
| 1454 | Ga0495613_0024915 | |||
| 1455 | Ga0495613_0045822 | |||
| 1456 | Ga0495613_0125233 | |||
| 1457 | Ga0495624_0005308 | |||
| 1458 | Ga0495624_0122646 | |||
| 1459 | Ga0495600_0013302 | |||
| 1460 | Ga0495600_0067558 | |||
| 1461 | Ga0495600_0205560 | |||
| 1462 | Ga0495581_0003783 | |||
| 1463 | Ga0495581_0087005 | |||
| 1464 | Ga0495604_0000221 | |||
| 1465 | Ga0495604_0035438 | |||
| 1466 | Ga0495604_0148731 | |||
| 1467 | Ga0495674_0014568 | |||
| 1468 | Ga0495674_0027350 | |||
| 1469 | Ga0495674_0033316 | |||
| 1470 | Ga0495674_0213148 | |||
| 1471 | Ga0495674_0289292 | |||
| 1472 | Ga0495674_0438609 | |||
| 1473 | Ga0495676_0003082 | |||
| 1474 | Ga0495676_0038501 | |||
| 1475 | Ga0495680_0008375 | |||
| 1476 | Ga0495680_0010437 | |||
| 1477 | Ga0495680_0023725 | |||
| 1478 | Ga0495680_0028331 | |||
| 1479 | Ga0495680_0028821 | |||
| 1480 | Ga0495680_0040576 | |||
| 1481 | Ga0495680_0244258 | |||
| 1482 | Ga0495675_0000301 | |||
| 1483 | Ga0495675_0014555 | |||
| 1484 | Ga0495675_0040483 | |||
| 1485 | Ga0495684_0016067 | |||
| 1486 | Ga0495684_0018289 | |||
| 1487 | Ga0495684_0029339 | |||
| 1488 | Ga0495684_0043435 | |||
| 1489 | Ga0495684_0175149 | |||
| 1490 | Ga0495593_0000798 | |||
| 1491 | Ga0495593_0011696 | |||
| 1492 | Ga0495602_0000515 | |||
| 1493 | Ga0495602_0015412 | |||
| 1494 | Ga0495602_0172003 | |||
| 1495 | Ga0495602_0281302 | |||
| 1496 | Ga0495614_0001575 | |||
| 1497 | Ga0496100_0019067 | |||
| 1498 | Ga0496100_0026411 | |||
| 1499 | Ga0496100_0037174 | |||
| 1500 | Ga0496100_0101962 | |||
| 1501 | Ga0496101_0049568 | |||
| 1502 | Ga0496101_0052216 | |||
| 1503 | Ga0496101_0064042 | |||
| 1504 | Ga0496101_0160608 | |||
| 1505 | Ga0496101_0185378 | |||
| 1506 | Ga0496101_0224238 | |||
| 1507 | Ga0496102_0036466 | |||
| 1508 | Ga0496102_0081335 | |||
| 1509 | Ga0496102_0217148 | |||
| 1510 | Ga0496102_0362995 | |||
| 1511 | Ga0496103_0008204 | |||
| 1512 | Ga0496103_0056672 | |||
| 1513 | Ga0496103_0100313 | |||
| 1514 | Ga0496103_0115809 | |||
| 1515 | Ga0496104_0041528 | |||
| 1516 | Ga0496104_0047081 | |||
| 1517 | Ga0496104_0104551 | |||
| 1518 | Ga0496104_0109106 | |||
| 1519 | Ga0496104_0159801 | |||
| 1520 | Ga0496104_0262224 | |||
| 1521 | Ga0496104_0428593 | |||
| 1522 | Ga0496105_0026183 | |||
| 1523 | Ga0496105_0026439 | |||
| 1524 | Ga0496105_0038633 | |||
| 1525 | Ga0496105_0061555 | |||
| 1526 | Ga0496105_0150778 | |||
| 1527 | Ga0496106_0033345 | |||
| 1528 | Ga0496106_0096622 | |||
| 1529 | Ga0496106_0635465 | |||
| 1530 | Ga0496107_0013890 | |||
| 1531 | Ga0496107_0139721 | |||
| 1532 | Ga0496108_0024383 | |||
| 1533 | Ga0496108_0027735 | |||
| 1534 | Ga0496108_0136278 | |||
| 1535 | Ga0496109_0003495 | |||
| 1536 | Ga0496109_0006317 | |||
| 1537 | Ga0496109_0265966 | |||
| 1538 | Ga0496110_0003644 | |||
| 1539 | Ga0496110_0034753 | |||
| 1540 | Ga0496110_0106652 | |||
| 1541 | Ga0496110_0119671 | |||
| 1542 | Ga0496110_0215319 | |||
| 1543 | Ga0496111_0005722 | |||
| 1544 | Ga0496111_0010010 | |||
| 1545 | Ga0496111_0013251 | |||
| 1546 | Ga0496111_0070614 | |||
| 1547 | Ga0496111_0307872 | |||
| 1548 | Ga0496112_0051091 | |||
| 1549 | Ga0496112_0255319 | |||
| 1550 | Ga0496112_0279221 | |||
| 1551 | Ga0496112_0380116 | |||
| 1552 | Ga0496113_0025451 | |||
| 1553 | Ga0496113_0046533 | |||
| 1554 | Ga0496113_0227349 | |||
| 1555 | Ga0496114_0000364 | |||
| 1556 | Ga0496114_0013305 | |||
| 1557 | Ga0496114_0028079 | |||
| 1558 | Ga0496114_0033212 | |||
| 1559 | Ga0496114_0034191 | |||
| 1560 | Ga0496114_0054448 | |||
| 1561 | Ga0496114_0081271 | |||
| 1562 | Ga0496114_0094973 | |||
| 1563 | Ga0496114_0104172 | |||
| 1564 | Ga0496114_0270187 | |||
| 1565 | Ga0496115_0021888 | |||
| 1566 | Ga0496115_0035956 | |||
| 1567 | Ga0496115_0052998 | |||
| 1568 | Ga0496115_0081804 | |||
| 1569 | Ga0496115_0085206 | |||
| 1570 | Ga0496115_0117604 | |||
| 1571 | Ga0501031_0007366 | |||
| 1572 | Ga0501031_0038412 | |||
| 1573 | Ga0501032_0087693 | |||
| 1574 | Ga0501033_0006390 | |||
| 1575 | Ga0501036_0007757 | |||
| 1576 | Ga0501036_0027767 | |||
| 1577 | Ga0501037_0084879 | |||
| 1578 | Ga0501038_0016863 | |||
| 1579 | Ga0501039_0001821 | |||
| 1580 | Ga0501040_0014174 | |||
| 1581 | Ga0501040_0050467 | |||
| 1582 | Ga0501041_0028489 | |||
| 1583 | Ga0501041_0253188 | |||
| 1584 | Ga0501042_0013206 | |||
| 1585 | Ga0501042_0022436 | |||
| 1586 | Ga0501042_0218301 | |||
| 1587 | Ga0501046_0004344 | |||
| 1588 | Ga0501046_0005337 | |||
| 1589 | Ga0501046_0050892 | |||
| 1590 | Ga0501047_0089460 | |||
| 1591 | Ga0501047_0142863 | |||
| 1592 | Ga0501047_0239047 | |||
| 1593 | Ga0501048_0002165 | |||
| 1594 | Ga0501048_0020564 | |||
| 1595 | Ga0501067_0000920 | |||
| 1596 | Ga0501067_0028652 | |||
| 1597 | Ga0501068_0034388 | |||
| 1598 | Ga0501068_0044468 | |||
| 1599 | Ga0501068_0273748 | |||
| 1600 | Ga0501069_0018712 | |||
| 1601 | Ga0501069_0034394 | |||
| 1602 | Ga0501069_0115155 | |||
| 1603 | Ga0501070_0001662 | |||
| 1604 | Ga0501071_0007321 | |||
| 1605 | Ga0501073_0006156 | |||
| 1606 | Ga0501073_0132197 | |||
| 1607 | Ga0501073_0181200 | |||
| 1608 | Ga0501074_0018530 | |||
| 1609 | Ga0501074_0107789 | |||
| 1610 | Ga0501075_0015873 | |||
| 1611 | Ga0501076_0033828 | |||
| 1612 | Ga0501076_0190726 | |||
| 1613 | Ga0501076_0203448 | |||
| 1614 | Ga0501077_0011865 | |||
| 1615 | Ga0501077_0024475 | |||
| 1616 | Ga0501079_0007483 | |||
| 1617 | Ga0501079_0011327 | |||
| 1618 | Ga0501079_0036480 | |||
| 1619 | Ga0501079_0040850 | |||
| 1620 | Ga0501079_0354641 | |||
| 1621 | Ga0501079_0497450 | |||
| 1622 | Ga0501080_0027838 | |||
| 1623 | Ga0501080_0133651 | |||
| 1624 | Ga0501080_0259316 | |||
| 1625 | Ga0501081_0016982 | |||
| 1626 | Ga0501081_0028413 | |||
| 1627 | Ga0501083_0039626 | |||
| 1628 | Ga0501035_0033929 | |||
| 1629 | Ga0501045_0004728 | |||
| 1630 | Ga0501045_0360941 | |||
| 1631 | nmdc:mga00v17_34476_c1 | |||
| 1632 | nmdc:mga05p37_193536_c1 | |||
| 1633 | nmdc:mga05p37_261065_c1 | |||
| 1634 | nmdc:mga05p37_475962_c1 | |||
| 1635 | nmdc:mga08y16_113485_c1 | |||
| 1636 | nmdc:mga08y16_11993_c1 | |||
| 1637 | nmdc:mga08y16_17746_c1 | |||
| 1638 | nmdc:mga08y16_187396_c1 | |||
| 1639 | nmdc:mga08y16_374741_c1 | |||
| 1640 | nmdc:mga0n895_45400_c1 | |||
| 1641 | nmdc:mga0n895_97573_c1 | |||
| 1642 | nmdc:mga0rr50_190190_c1 | |||
| 1643 | nmdc:mga08x19_159419_c1 | |||
| 1644 | nmdc:mga0a205_139871_c1 | |||
| 1645 | nmdc:mga0a205_29673_c1 | |||
| 1646 | nmdc:mga0a205_91618_c1 | |||
| 1647 | Ga0495601_0001384 | |||
| 1648 | Ga0495601_0008325 | |||
| 1649 | Ga0495601_0025754 | |||
| 1650 | Ga0495601_0048459 | |||
| 1651 | Ga0495601_0173355 | |||
| 1652 | Ga0495612_0026986 | |||
| 1653 | Ga0495619_0015113 | |||
| 1654 | Ga0495619_0016315 | |||
| 1655 | Ga0495619_0025164 | |||
| 1656 | Ga0495619_0027899 | |||
| 1657 | Ga0495619_0079155 | |||
| 1658 | Ga0495619_0083832 | |||
| 1659 | Ga0501084_0001737 | |||
| 1660 | Ga0501084_0021516 | |||
| 1661 | Ga0501084_0074442 | |||
| 1662 | Ga0501084_0223457 | |||
| 1663 | Ga0590071_033111 | |||
| 1664 | Ga0590075_010926 | |||
| 1665 | Ga0590075_024546 | |||
| 1666 | Ga0501082_0014276 | |||
| 1667 | Ga0501082_0024133 | |||
| 1668 | Ga0501082_0216609 | |||
| 1669 | Ga0466962_0003247 | |||
| 1670 | Ga0466962_0005650 | |||
| 1671 | Ga0466962_0013061 | |||
| 1672 | Ga0466962_0021899 | |||
| 1673 | Ga0466962_0028781 | |||
| 1674 | Ga0466962_0059126 | |||
| 1675 | Ga0530510_0021185 | |||
| 1676 | Ga0530510_0024214 | |||
| 1677 | Ga0530510_0106352 | |||
| 1678 | Ga0530510_0186372 | |||
| 1679 | 2837185848 | |||
| 1680 | 3005600416 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sbj-assembly2.cif.gz_C | x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed | 0.8776 | 57 | 276 |
| 1saw-assembly1.cif.gz_A | x-ray structure of homo sapiens protein flj36880 | 0.8765 | 57 | 276 |
| 3s52-assembly2.cif.gz_B | crystal structure of a putative fumarylacetoacetate hydrolase family protein from yersinia pestis co92 | 0.8714 | 55 | 275 |
| 6sbj-assembly1.cif.gz_A | x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed | 0.8708 | 57 | 276 |
| 3rr6-assembly1.cif.gz_A | structure of a putative uncharacterized protein from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.8694 | 1 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9161 | 56 | 275 | 3.90.850.10 |
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9078 | 56 | 275 | 3.90.850.10 |
| 6jvvA02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9035 | 57 | 276 | 3.90.850.10 |
| af_P34673_5_211_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.888 | 57 | 271 | 3.90.850.10 |
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8831 | 55 | 276 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9IYY9-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9652 | 1 | 125 |
GO:0016787
GO:0044281 |
| AF-A0A7Y6CW50-F1-model_v4 | DUF2437 domain-containing protein | 0.9599 | 1 | 155 |
GO:0003824
GO:0044281 |
| AF-A0A7Y6CW50-F1-model_v4 | DUF2437 domain-containing protein | 0.9539 | 1 | 155 |
GO:0003824
GO:0044281 |
| AF-A0A846YUF1-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9538 | 1 | 292 |
GO:0016787
GO:0044281 |
| AF-A0A538ME32-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9537 | 2 | 292 |
GO:0016787
GO:0044281 |