F483048

General Info

Members Datasets Scaffolds Average Seq Length
840 313 1680 230

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10225274|Ga0111539_102252742
Length 255
Sequence MSGALQAIVFDFDGVIADSEPLHLRAFQRAFADASLTLTAQDYYSRYLGFDDAGVFAAVSQDCGAALTADQIATLVAKKGEYVQESLRAGEILFPGAADFIRQAAAAVPIAIASGAQRHEIEEILDATQLRSYFVTIVAAGETVRGKPAPDPYARAFQLLQRSNGATTPDRCVAVEDSRWGLESARGAGLRCVGVTNSYPAADLPGAELIVGGLNTLTIQMLDELVRNPAKAGHHGTPVGRVSSPVTTAQGADPA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
212 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
263 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
284 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 3.21
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10225274 3300009094 Bacteria 2184
2 MBSR1b_contig_9574644 2162886012 Unclassified 1829
3 Ga0065714_10109942 3300005288 Bacteria 1492
4 Ga0065704_10309465 3300005289 Bacteria 871
5 Ga0065712_10000910 3300005290 Bacteria 8234
6 Ga0065712_10005068 3300005290 Bacteria 4361
7 Ga0065715_10091660 3300005293 Bacteria 5634
8 Ga0065707_10001606 3300005295 Bacteria 11821
9 Ga0065707_10003829 3300005295 Bacteria 7776
10 Ga0065707_10124873 3300005295 Bacteria 2035
11 Ga0070676_10012476 3300005328 Bacteria 4641
12 Ga0070676_10020524 3300005328 Bacteria 3689
13 Ga0070676_10022591 3300005328 Bacteria 3528
14 Ga0070676_10043017 3300005328 Bacteria 2624
15 Ga0070683_100007922 3300005329 Bacteria 9008
16 Ga0070683_100125280 3300005329 Bacteria 2428
17 Ga0070690_100006740 3300005330 Bacteria 6527
18 Ga0070690_100018607 3300005330 Bacteria 4199
19 Ga0070690_100049448 3300005330 Bacteria 2680
20 Ga0070670_100006348 3300005331 Bacteria 10006
21 Ga0070670_100059175 3300005331 Bacteria 3289
22 Ga0070670_100153622 3300005331 Bacteria 1993
23 Ga0070670_100580409 3300005331 Bacteria 1002
24 Ga0070677_10018771 3300005333 Bacteria 2495
25 Ga0070677_10183731 3300005333 Bacteria 998
26 Ga0068869_100025000 3300005334 Bacteria 4142
27 Ga0068869_100070453 3300005334 Bacteria 2587
28 Ga0068869_100207515 3300005334 Bacteria 1547
29 Ga0068869_100367918 3300005334 Bacteria 1176
30 Ga0070666_10076098 3300005335 Bacteria 2289
31 Ga0070666_10138677 3300005335 Bacteria 1693
32 Ga0070682_100352106 3300005337 Bacteria 1098
33 Ga0068868_100089958 3300005338 Bacteria 2471
34 Ga0068868_100384813 3300005338 Bacteria 1208
35 Ga0068868_100404909 3300005338 Bacteria 1178
36 Ga0070660_100701952 3300005339 Unclassified 848
37 Ga0070689_100004535 3300005340 Bacteria 9403
38 Ga0070689_100048793 3300005340 Bacteria 3267
39 Ga0070689_100217648 3300005340 Bacteria 1566
40 Ga0070691_10009673 3300005341 Bacteria 4399
41 Ga0070687_100003788 3300005343 Bacteria 5931
42 Ga0070687_100140524 3300005343 Bacteria 1406
43 Ga0070687_100277776 3300005343 Unclassified 1053
44 Ga0070661_100261557 3300005344 Bacteria 1338
45 Ga0070692_10018834 3300005345 Bacteria 3327
46 Ga0070692_10058819 3300005345 Bacteria 2019
47 Ga0070692_10150819 3300005345 Bacteria 1324
48 Ga0070668_100164036 3300005347 Bacteria 1805
49 Ga0070668_100410170 3300005347 Bacteria 1158
50 Ga0070669_100001192 3300005353 Bacteria 18941
51 Ga0070669_100040729 3300005353 Bacteria 3377
52 Ga0070669_100050503 3300005353 Bacteria 3038
53 Ga0070669_100077287 3300005353 Bacteria 2472
54 Ga0070669_100335975 3300005353 Unclassified 1223
55 Ga0070669_100644905 3300005353 Bacteria 890
56 Ga0070675_100000206 3300005354 Bacteria 37528
57 Ga0070675_100013178 3300005354 Bacteria 6496
58 Ga0070675_100018751 3300005354 Bacteria 5508
59 Ga0070675_100039166 3300005354 Bacteria 3866
60 Ga0070675_100066173 3300005354 Bacteria 2989
61 Ga0070675_100251984 3300005354 Bacteria 1545
62 Ga0070675_100308015 3300005354 Bacteria 1397
63 Ga0070675_100388126 3300005354 Bacteria 1244
64 Ga0070675_100589210 3300005354 Unclassified 1008
65 Ga0070671_100010149 3300005355 Bacteria 7564
66 Ga0070671_100020196 3300005355 Bacteria 5429
67 Ga0070671_100078410 3300005355 Bacteria 2761
68 Ga0070671_100326555 3300005355 Bacteria 1308
69 Ga0070671_100452240 3300005355 Archaea 1102
70 Ga0070674_100005602 3300005356 Bacteria 7271
71 Ga0070674_100488807 3300005356 Bacteria 1023
72 Ga0070674_100682605 3300005356 Bacteria 876
73 Ga0070674_100716060 3300005356 Bacteria 857
74 Ga0070673_100004944 3300005364 Bacteria 8491
75 Ga0070673_100010484 3300005364 Bacteria 6275
76 Ga0070673_100018060 3300005364 Bacteria 5031
77 Ga0070673_100382706 3300005364 Bacteria 1255
78 Ga0070673_100815520 3300005364 Unclassified 862
79 Ga0070688_100013941 3300005365 Bacteria 4547
80 Ga0070688_100015737 3300005365 Bacteria 4311
81 Ga0070688_100016705 3300005365 Bacteria 4201
82 Ga0070688_100030556 3300005365 Bacteria 3234
83 Ga0070688_100118288 3300005365 Unclassified 1771
84 Ga0070667_100147550 3300005367 Bacteria 2064
85 Ga0070667_100201779 3300005367 Unclassified 1765
86 Ga0070709_10256089 3300005434 Bacteria 1263
87 Ga0070713_100282326 3300005436 Bacteria 1524
88 Ga0070713_100300830 3300005436 Bacteria 1477
89 Ga0070701_10003212 3300005438 Bacteria 6436
90 Ga0070701_10006900 3300005438 Bacteria 4809
91 Ga0070701_10009073 3300005438 Bacteria 4341
92 Ga0070701_10022495 3300005438 Bacteria 3022
93 Ga0070701_10039603 3300005438 Bacteria 2392
94 Ga0070705_100053308 3300005440 Bacteria 2367
95 Ga0070700_100090189 3300005441 Bacteria 1999
96 Ga0070700_100091845 3300005441 Bacteria 1983
97 Ga0070700_100175422 3300005441 Bacteria 1487
98 Ga0070700_100441918 3300005441 Bacteria 988
99 Ga0070694_100004830 3300005444 Bacteria 8110
100 Ga0070694_100067906 3300005444 Bacteria 2449
101 Ga0070694_100373207 3300005444 Bacteria 1111
102 Ga0070708_100033954 3300005445 Bacteria 4434
103 Ga0070708_100375607 3300005445 Unclassified 1340
104 Ga0070708_100576639 3300005445 Bacteria 1061
105 Ga0070663_100007672 3300005455 Bacteria 6585
106 Ga0070663_100313245 3300005455 Bacteria 1260
107 Ga0070678_100022569 3300005456 Bacteria 4174
108 Ga0070678_100098510 3300005456 Bacteria 2260
109 Ga0070678_100449513 3300005456 Bacteria 1128
110 Ga0070662_100101620 3300005457 Bacteria 2177
111 Ga0070662_100125529 3300005457 Bacteria 1972
112 Ga0070662_100293853 3300005457 Bacteria 1318
113 Ga0068867_100005997 3300005459 Bacteria 8616
114 Ga0068867_100008016 3300005459 Bacteria 7464
115 Ga0068867_100012021 3300005459 Bacteria 6113
116 Ga0068867_100360999 3300005459 Unclassified 1215
117 Ga0070685_10014731 3300005466 Bacteria 4146
118 Ga0070685_10028459 3300005466 Bacteria 3096
119 Ga0070706_100185970 3300005467 Bacteria 1941
120 Ga0070707_100052395 3300005468 Bacteria 3913
121 Ga0070707_100216200 3300005468 Unclassified 1868
122 Ga0070707_100744184 3300005468 Bacteria 944
123 Ga0070707_100889402 3300005468 Bacteria 855
124 Ga0070698_100002805 3300005471 Bacteria 19173
125 Ga0070698_100082707 3300005471 Bacteria 3202
126 Ga0070698_100135646 3300005471 Bacteria 2415
127 Ga0070698_100146038 3300005471 Bacteria 2315
128 Ga0070698_100160638 3300005471 Bacteria 2191
129 Ga0070698_100250294 3300005471 Unclassified 1705
130 Ga0070698_100388661 3300005471 Bacteria 1328
131 Ga0070699_100017513 3300005518 Bacteria 6149
132 Ga0070699_100090264 3300005518 Bacteria 2678
133 Ga0070699_100182224 3300005518 Bacteria 1864
134 Ga0070699_100303672 3300005518 Bacteria 1432
135 Ga0070684_100017777 3300005535 Bacteria 5843
136 Ga0070684_100116588 3300005535 Bacteria 2399
137 Ga0070684_100165429 3300005535 Bacteria 2007
138 Ga0070684_100277941 3300005535 Bacteria 1534
139 Ga0070697_100024978 3300005536 Bacteria 4761
140 Ga0070697_100330437 3300005536 Unclassified 1314
141 Ga0068853_100100186 3300005539 Bacteria 2561
142 Ga0068853_100136667 3300005539 Bacteria 2198
143 Ga0068853_100235514 3300005539 Unclassified 1676
144 Ga0070672_100009511 3300005543 Bacteria 6706
145 Ga0070672_100023354 3300005543 Bacteria 4557
146 Ga0070672_100028040 3300005543 Bacteria 4208
147 Ga0070672_100042170 3300005543 Bacteria 3512
148 Ga0070672_100108508 3300005543 Bacteria 2260
149 Ga0070672_100172141 3300005543 Bacteria 1801
150 Ga0070672_100287844 3300005543 Unclassified 1391
151 Ga0070672_100497714 3300005543 Bacteria 1054
152 Ga0070686_100066996 3300005544 Bacteria 2337
153 Ga0070686_100467374 3300005544 Bacteria 973
154 Ga0070695_100023227 3300005545 Bacteria 3808
155 Ga0070695_100072157 3300005545 Unclassified 2263
156 Ga0070695_100127241 3300005545 Bacteria 1751
157 Ga0070695_100307976 3300005545 Unclassified 1173
158 Ga0070695_100402371 3300005545 Bacteria 1038
159 Ga0070696_100052106 3300005546 Unclassified 2846
160 Ga0070696_100156371 3300005546 Bacteria 1677
161 Ga0070693_100109124 3300005547 Bacteria 1699
162 Ga0070665_100016208 3300005548 Bacteria 7477
163 Ga0070665_100051447 3300005548 Unclassified 4131
164 Ga0070704_100001112 3300005549 Bacteria 13983
165 Ga0070704_100013850 3300005549 Bacteria 5022
166 Ga0070704_100049904 3300005549 Bacteria 2938
167 Ga0070704_100355070 3300005549 Bacteria 1239
168 Ga0068855_100596238 3300005563 Bacteria 1192
169 Ga0070664_100003040 3300005564 Bacteria 13569
170 Ga0070664_100020704 3300005564 Bacteria 5418
171 Ga0070664_100038724 3300005564 Bacteria 4015
172 Ga0070664_100053251 3300005564 Bacteria 3430
173 Ga0070664_100064346 3300005564 Bacteria 3128
174 Ga0070664_100979580 3300005564 Bacteria 794
175 Ga0068857_100666739 3300005577 Bacteria 987
176 Ga0068854_100003713 3300005578 Bacteria 9549
177 Ga0068854_100293529 3300005578 Bacteria 1313
178 Ga0070702_100081780 3300005615 Bacteria 1936
179 Ga0070702_100158024 3300005615 Bacteria 1462
180 Ga0068859_100016091 3300005617 Bacteria 7514
181 Ga0068859_100030261 3300005617 Bacteria 5432
182 Ga0068859_100588879 3300005617 Bacteria 1206
183 Ga0068864_100021467 3300005618 Bacteria 5410
184 Ga0068864_100024865 3300005618 Bacteria 5038
185 Ga0068864_100043007 3300005618 Bacteria 3867
186 Ga0068864_100069727 3300005618 Bacteria 3057
187 Ga0068864_100083903 3300005618 Bacteria 2798
188 Ga0068864_100237070 3300005618 Bacteria 1689
189 Ga0068866_10022349 3300005718 Unclassified 2926
190 Ga0068866_10080133 3300005718 Unclassified 1751
191 Ga0068866_10232996 3300005718 Bacteria 1118
192 Ga0068861_100005603 3300005719 Bacteria 8510
193 Ga0068861_100026746 3300005719 Bacteria 4197
194 Ga0068861_100160334 3300005719 Bacteria 1855
195 Ga0068861_100268866 3300005719 Bacteria 1463
196 Ga0068861_100281873 3300005719 Bacteria 1431
197 Ga0068870_10002305 3300005840 Bacteria 7927
198 Ga0068870_10096698 3300005840 Bacteria 1661
199 Ga0068863_100286077 3300005841 Bacteria 1598
200 Ga0068863_100406338 3300005841 Bacteria 1332
201 Ga0068863_100641184 3300005841 Unclassified 1053
202 Ga0068858_100009240 3300005842 Bacteria 9414
203 Ga0068858_100041853 3300005842 Bacteria 4247
204 Ga0068858_100052950 3300005842 Bacteria 3755
205 Ga0068858_100063971 3300005842 Bacteria 3404
206 Ga0068858_100078444 3300005842 Bacteria 3069
207 Ga0068858_100113069 3300005842 Bacteria 2536
208 Ga0068860_100046431 3300005843 Bacteria 4141
209 Ga0068860_100111786 3300005843 Unclassified 2612
210 Ga0068860_100150257 3300005843 Bacteria 2243
211 Ga0068860_100279709 3300005843 Bacteria 1630
212 Ga0068860_100507153 3300005843 Bacteria 1205
213 Ga0068860_100628203 3300005843 Bacteria 1081
214 Ga0068862_100001571 3300005844 Bacteria 20810
215 Ga0068862_100030062 3300005844 Bacteria 4577
216 Ga0068862_100079871 3300005844 Bacteria 2836
217 Ga0068862_100116607 3300005844 Bacteria 2349
218 Ga0068862_100195945 3300005844 Bacteria 1820
219 Ga0068862_100459091 3300005844 Bacteria 1202
220 Ga0068862_100462985 3300005844 Bacteria 1197
221 Ga0081538_10056204 3300005981 Bacteria 2307
222 Ga0081539_10189775 3300005985 Bacteria 957
223 Ga0075368_10067001 3300006042 Bacteria 1445
224 Ga0075363_100473256 3300006048 Bacteria 742
225 Ga0075364_10050905 3300006051 Bacteria 2704
226 Ga0075432_10026544 3300006058 Bacteria 1990
227 Ga0070712_100194576 3300006175 Bacteria 1589
228 Ga0097621_100101918 3300006237 Bacteria 2416
229 Ga0097621_100341007 3300006237 Unclassified 1331
230 Ga0075370_10002263 3300006353 Bacteria 8863
231 Ga0068871_100015620 3300006358 Bacteria 5689
232 Ga0068871_100050475 3300006358 Unclassified 3365
233 Ga0068871_100059211 3300006358 Unclassified 3120
234 Ga0068871_100249143 3300006358 Bacteria 1547
235 Ga0068871_100461965 3300006358 Bacteria 1139
236 Ga0068871_100520344 3300006358 Bacteria 1074
237 Ga0075428_100000007 3300006844 Bacteria 273226
238 Ga0075428_100000080 3300006844 Bacteria 80349
239 Ga0075428_100003353 3300006844 Bacteria 17522
240 Ga0075428_100007739 3300006844 Bacteria 11908
241 Ga0075428_100070866 3300006844 Unclassified 3810
242 Ga0075428_100182557 3300006844 Bacteria 2271
243 Ga0075428_100609829 3300006844 Bacteria 1165
244 Ga0075430_100000632 3300006846 Bacteria 26776
245 Ga0075430_100005792 3300006846 Bacteria 10424
246 Ga0075430_100067848 3300006846 Bacteria 2993
247 Ga0075431_100008574 3300006847 Bacteria 10235
248 Ga0075431_100041811 3300006847 Bacteria 4727
249 Ga0075431_100085542 3300006847 Unclassified 3255
250 Ga0075431_100189614 3300006847 Bacteria 2107
251 Ga0075433_10033427 3300006852 Bacteria 4409
252 Ga0075433_10299228 3300006852 Bacteria 1425
253 Ga0075433_10584227 3300006852 Bacteria 981
254 Ga0075434_100002096 3300006871 Bacteria 17342
255 Ga0075434_100010094 3300006871 Bacteria 8843
256 Ga0075434_100016921 3300006871 Bacteria 7013
257 Ga0075434_100034442 3300006871 Bacteria 5000
258 Ga0075434_100048388 3300006871 Unclassified 4219
259 Ga0075434_100261687 3300006871 Unclassified 1749
260 Ga0075434_100398190 3300006871 Bacteria 1398
261 Ga0075429_100000411 3300006880 Bacteria 31783
262 Ga0075429_100002380 3300006880 Bacteria 15838
263 Ga0075429_100004082 3300006880 Bacteria 12517
264 Ga0075429_100098396 3300006880 Bacteria 2552
265 Ga0075429_100232324 3300006880 Bacteria 1616
266 Ga0068865_100012596 3300006881 Bacteria 5328
267 Ga0068865_100022580 3300006881 Bacteria 4107
268 Ga0068865_100022694 3300006881 Bacteria 4098
269 Ga0068865_100091936 3300006881 Bacteria 2203
270 Ga0068865_100157700 3300006881 Bacteria 1728
271 Ga0075436_100010719 3300006914 Bacteria 6287
272 Ga0075436_100119454 3300006914 Unclassified 1843
273 Ga0075436_100231513 3300006914 Bacteria 1313
274 Ga0097620_100016090 3300006931 Bacteria 7514
275 Ga0097620_100030261 3300006931 Bacteria 5432
276 Ga0097620_100588868 3300006931 Bacteria 1206
277 Ga0075435_100003130 3300007076 Bacteria 11178
278 Ga0075435_100009595 3300007076 Bacteria 7022
279 Ga0075435_100032838 3300007076 Bacteria 4101
280 Ga0075435_100104456 3300007076 Unclassified 2350
281 Ga0075435_100631977 3300007076 Bacteria 929
282 Ga0105240_10009773 3300009093 Bacteria 13541
283 Ga0105240_10364647 3300009093 Unclassified 1635
284 Ga0111539_10000181 3300009094 Bacteria 73457
285 Ga0111539_10000209 3300009094 Bacteria 69503
286 Ga0111539_10003328 3300009094 Bacteria 21227
287 Ga0111539_10005065 3300009094 Bacteria 17116
288 Ga0111539_10011332 3300009094 Bacteria 11199
289 Ga0111539_10037183 3300009094 Bacteria 5881
290 Ga0111539_10055901 3300009094 Bacteria 4692
291 Ga0105245_10103481 3300009098 Unclassified 2638
292 Ga0105247_10278714 3300009101 Unclassified 1153
293 Ga0114129_10000077 3300009147 Bacteria 90951
294 Ga0114129_10010731 3300009147 Bacteria 13060
295 Ga0114129_10013454 3300009147 Bacteria 11657
296 Ga0114129_10036869 3300009147 Bacteria 6904
297 Ga0114129_10132391 3300009147 Bacteria 3424
298 Ga0114129_10293685 3300009147 Bacteria 2168
299 Ga0114129_10378863 3300009147 Unclassified 1869
300 Ga0114129_10396430 3300009147 Unclassified 1820
301 Ga0114129_10399353 3300009147 Bacteria 1812
302 Ga0114129_10434602 3300009147 Bacteria 1724
303 Ga0114129_10733088 3300009147 Bacteria 1267
304 Ga0105243_10019426 3300009148 Bacteria 5152
305 Ga0105243_10043256 3300009148 Bacteria 3530
306 Ga0105243_10194460 3300009148 Bacteria 1774
307 Ga0105241_10726280 3300009174 Bacteria 909
308 Ga0105242_10009410 3300009176 Bacteria 7494
309 Ga0105242_10016448 3300009176 Bacteria 5751
310 Ga0105242_10038931 3300009176 Bacteria 3826
311 Ga0105242_10050153 3300009176 Bacteria 3398
312 Ga0105242_10134886 3300009176 Bacteria 2135
313 Ga0105242_10231460 3300009176 Bacteria 1656
314 Ga0105242_10566912 3300009176 Bacteria 1091
315 Ga0105248_10000664 3300009177 Bacteria 39095
316 Ga0105248_10087537 3300009177 Bacteria 3505
317 Ga0105248_10100845 3300009177 Bacteria 3254
318 Ga0105248_10101946 3300009177 Bacteria 3235
319 Ga0105248_10136158 3300009177 Bacteria 2770
320 Ga0105248_10140805 3300009177 Bacteria 2721
321 Ga0105248_10263156 3300009177 Unclassified 1941
322 Ga0105248_10717473 3300009177 Bacteria 1128
323 Ga0105248_11150424 3300009177 Unclassified 877
324 Ga0105237_10123728 3300009545 Unclassified 2581
325 Ga0105238_10269409 3300009551 Bacteria 1683
326 Ga0105238_10453290 3300009551 Unclassified 1280
327 Ga0105238_10658259 3300009551 Bacteria 1058
328 Ga0105249_10011683 3300009553 Bacteria 7722
329 Ga0105249_10014963 3300009553 Bacteria 6861
330 Ga0105249_10278884 3300009553 Bacteria 1668
331 Ga0105239_10290394 3300010375 Unclassified 1841
332 Ga0105246_10103919 3300011119 Bacteria 2074
333 Ga0105246_10164858 3300011119 Unclassified 1691
334 Ga0105246_10297703 3300011119 Bacteria 1301
335 Ga0157374_10047903 3300013296 Bacteria 3964
336 Ga0157374_10163268 3300013296 Unclassified 2170
337 Ga0157378_10019405 3300013297 Bacteria 5977
338 Ga0157378_10050510 3300013297 Unclassified 3701
339 Ga0157378_10159660 3300013297 Bacteria 2107
340 Ga0157378_11157963 3300013297 Bacteria 812
341 Ga0163162_10008545 3300013306 Bacteria 9983
342 Ga0163162_10075091 3300013306 Bacteria 3440
343 Ga0163162_10290552 3300013306 Unclassified 1767
344 Ga0157375_10013991 3300013308 Bacteria 7155
345 Ga0157375_10198502 3300013308 Unclassified 2161
346 Ga0157375_10237346 3300013308 Bacteria 1982
347 Ga0157375_10458954 3300013308 Bacteria 1439
348 Ga0157375_11043153 3300013308 Bacteria 955
349 Ga0163163_10070802 3300014325 Bacteria 3474
350 Ga0163163_10112721 3300014325 Bacteria 2749
351 Ga0163163_10227288 3300014325 Bacteria 1915
352 Ga0163163_10452202 3300014325 Bacteria 1345
353 Ga0163163_10664185 3300014325 Unclassified 1106
354 Ga0157380_10001986 3300014326 Bacteria 13614
355 Ga0157380_10012368 3300014326 Bacteria 6192
356 Ga0157380_10051763 3300014326 Bacteria 3249
357 Ga0157380_10209254 3300014326 Bacteria 1737
358 Ga0157380_10394207 3300014326 Bacteria 1311
359 Ga0157380_10417435 3300014326 Bacteria 1279
360 Ga0157377_10064153 3300014745 Unclassified 2106
361 Ga0157377_10070050 3300014745 Bacteria 2025
362 Ga0157377_10706510 3300014745 Unclassified 733
363 Ga0157379_10011426 3300014968 Bacteria 7750
364 Ga0157379_10049540 3300014968 Bacteria 3751
365 Ga0157379_10099823 3300014968 Unclassified 2606
366 Ga0157379_10188317 3300014968 Unclassified 1865
367 Ga0157379_10295565 3300014968 Unclassified 1475
368 Ga0157376_10014912 3300014969 Bacteria 5854
369 Ga0157376_10206198 3300014969 Unclassified 1812
370 Ga0163161_10057136 3300017792 Bacteria 2835
371 Ga0207682_10011010 3300025893 Bacteria 3540
372 Ga0207642_10037261 3300025899 Unclassified 2094
373 Ga0207642_10184843 3300025899 Bacteria 1139
374 Ga0207710_10110505 3300025900 Bacteria 1305
375 Ga0207710_10205167 3300025900 Unclassified 975
376 Ga0207688_10110456 3300025901 Bacteria 1595
377 Ga0207680_10060425 3300025903 Bacteria 2307
378 Ga0207680_10187273 3300025903 Bacteria 1403
379 Ga0207680_10385844 3300025903 Bacteria 988
380 Ga0207647_10072926 3300025904 Bacteria 2070
381 Ga0207645_10006720 3300025907 Bacteria 8222
382 Ga0207645_10014141 3300025907 Bacteria 5347
383 Ga0207645_10058272 3300025907 Bacteria 2466
384 Ga0207643_10002349 3300025908 Bacteria 10283
385 Ga0207643_10097319 3300025908 Bacteria 1722
386 Ga0207707_10182328 3300025912 Bacteria 1833
387 Ga0207695_10042303 3300025913 Bacteria 4868
388 Ga0207695_10259488 3300025913 Unclassified 1635
389 Ga0207662_10004150 3300025918 Bacteria 7580
390 Ga0207662_10016788 3300025918 Bacteria 4133
391 Ga0207662_10045802 3300025918 Bacteria 2586
392 Ga0207662_10088247 3300025918 Unclassified 1904
393 Ga0207662_10267345 3300025918 Unclassified 1127
394 Ga0207649_10077867 3300025920 Bacteria 2138
395 Ga0207649_10175929 3300025920 Bacteria 1494
396 Ga0207646_10073038 3300025922 Bacteria 3064
397 Ga0207646_10186075 3300025922 Unclassified 1876
398 Ga0207681_10004007 3300025923 Bacteria 9139
399 Ga0207681_10008989 3300025923 Bacteria 6102
400 Ga0207681_10049560 3300025923 Bacteria 2839
401 Ga0207681_10105674 3300025923 Unclassified 2039
402 Ga0207681_10373362 3300025923 Bacteria 1147
403 Ga0207694_10611844 3300025924 Unclassified 916
404 Ga0207650_10025889 3300025925 Bacteria 4181
405 Ga0207650_10039489 3300025925 Bacteria 3449
406 Ga0207650_10088954 3300025925 Bacteria 2356
407 Ga0207650_10163741 3300025925 Bacteria 1764
408 Ga0207650_10583189 3300025925 Bacteria 939
409 Ga0207659_10000471 3300025926 Bacteria 24162
410 Ga0207659_10015657 3300025926 Bacteria 4921
411 Ga0207659_10054886 3300025926 Bacteria 2847
412 Ga0207659_10163102 3300025926 Bacteria 1752
413 Ga0207659_10339460 3300025926 Bacteria 1244
414 Ga0207659_10341452 3300025926 Bacteria 1240
415 Ga0207659_10480511 3300025926 Bacteria 1050
416 Ga0207687_10139340 3300025927 Unclassified 1838
417 Ga0207700_10163933 3300025928 Bacteria 1848
418 Ga0207644_10028267 3300025931 Bacteria 3880
419 Ga0207644_10099295 3300025931 Bacteria 2184
420 Ga0207644_10205896 3300025931 Bacteria 1553
421 Ga0207644_10307712 3300025931 Unclassified 1279
422 Ga0207706_10042517 3300025933 Bacteria 4027
423 Ga0207706_10098957 3300025933 Unclassified 2566
424 Ga0207706_10138751 3300025933 Bacteria 2139
425 Ga0207706_10315268 3300025933 Bacteria 1361
426 Ga0207686_10010469 3300025934 Bacteria 5051
427 Ga0207686_10024783 3300025934 Bacteria 3481
428 Ga0207709_10035857 3300025935 Bacteria 2936
429 Ga0207709_10047851 3300025935 Bacteria 2602
430 Ga0207670_10030418 3300025936 Bacteria 3450
431 Ga0207670_10096727 3300025936 Bacteria 2100
432 Ga0207670_10203520 3300025936 Bacteria 1505
433 Ga0207670_10217913 3300025936 Unclassified 1459
434 Ga0207670_10365370 3300025936 Bacteria 1146
435 Ga0207669_10008788 3300025937 Bacteria 4764
436 Ga0207669_10112104 3300025937 Bacteria 1830
437 Ga0207669_10487980 3300025937 Bacteria 983
438 Ga0207704_10005959 3300025938 Bacteria 5651
439 Ga0207704_10070859 3300025938 Bacteria 2209
440 Ga0207704_10116119 3300025938 Bacteria 1821
441 Ga0207704_10195927 3300025938 Unclassified 1474
442 Ga0207704_10408134 3300025938 Unclassified 1074
443 Ga0207665_10183001 3300025939 Unclassified 1518
444 Ga0207691_10040959 3300025940 Bacteria 4279
445 Ga0207691_10061649 3300025940 Bacteria 3406
446 Ga0207691_10086568 3300025940 Bacteria 2811
447 Ga0207691_10089872 3300025940 Bacteria 2753
448 Ga0207691_10117315 3300025940 Bacteria 2362
449 Ga0207691_10176405 3300025940 Bacteria 1869
450 Ga0207691_10231651 3300025940 Unclassified 1599
451 Ga0207691_10274460 3300025940 Bacteria 1451
452 Ga0207691_10658048 3300025940 Bacteria 885
453 Ga0207711_10031433 3300025941 Bacteria 4481
454 Ga0207711_10083063 3300025941 Bacteria 2801
455 Ga0207711_10092504 3300025941 Bacteria 2662
456 Ga0207711_10136645 3300025941 Bacteria 2202
457 Ga0207711_10171447 3300025941 Unclassified 1969
458 Ga0207711_10292101 3300025941 Unclassified 1502
459 Ga0207711_10810223 3300025941 Bacteria 872
460 Ga0207689_10006551 3300025942 Bacteria 10273
461 Ga0207689_10065563 3300025942 Bacteria 2987
462 Ga0207689_10109017 3300025942 Bacteria 2275
463 Ga0207689_10447055 3300025942 Bacteria 1080
464 Ga0207661_10015731 3300025944 Bacteria 5573
465 Ga0207661_10021914 3300025944 Bacteria 4797
466 Ga0207679_10039442 3300025945 Bacteria 3372
467 Ga0207679_10057603 3300025945 Bacteria 2875
468 Ga0207679_10161198 3300025945 Bacteria 1836
469 Ga0207679_10350424 3300025945 Unclassified 1287
470 Ga0207667_10539923 3300025949 Bacteria 1180
471 Ga0207651_10004772 3300025960 Bacteria 6891
472 Ga0207651_10010918 3300025960 Bacteria 5057
473 Ga0207651_10013285 3300025960 Bacteria 4705
474 Ga0207651_10046848 3300025960 Bacteria 2911
475 Ga0207651_10080228 3300025960 Bacteria 2348
476 Ga0207651_10098553 3300025960 Bacteria 2162
477 Ga0207651_10322827 3300025960 Bacteria 1291
478 Ga0207651_10415659 3300025960 Bacteria 1147
479 Ga0207712_10004752 3300025961 Bacteria 8584
480 Ga0207712_10026530 3300025961 Bacteria 3861
481 Ga0207712_10071579 3300025961 Bacteria 2494
482 Ga0207668_10316427 3300025972 Bacteria 1294
483 Ga0207668_10428474 3300025972 Bacteria 1124
484 Ga0207668_10471533 3300025972 Bacteria 1075
485 Ga0207640_10234725 3300025981 Bacteria 1413
486 Ga0207640_10479416 3300025981 Bacteria 1031
487 Ga0207658_10299359 3300025986 Bacteria 1385
488 Ga0207658_10607262 3300025986 Bacteria 983
489 Ga0207677_10153809 3300026023 Bacteria 1778
490 Ga0207677_10163999 3300026023 Bacteria 1730
491 Ga0207677_10199159 3300026023 Unclassified 1590
492 Ga0207677_10432385 3300026023 Bacteria 1124
493 Ga0207703_10017930 3300026035 Bacteria 5529
494 Ga0207703_10030855 3300026035 Bacteria 4236
495 Ga0207703_10054646 3300026035 Bacteria 3248
496 Ga0207703_10060565 3300026035 Bacteria 3096
497 Ga0207703_10371237 3300026035 Bacteria 1321
498 Ga0207703_10486322 3300026035 Unclassified 1157
499 Ga0207639_10041021 3300026041 Bacteria 3460
500 Ga0207639_10105680 3300026041 Bacteria 2284
501 Ga0207639_10207178 3300026041 Bacteria 1686
502 Ga0207639_10300105 3300026041 Unclassified 1420
503 Ga0207678_10342245 3300026067 Bacteria 1289
504 Ga0207708_10025804 3300026075 Bacteria 4446
505 Ga0207708_10048780 3300026075 Bacteria 3223
506 Ga0207708_10120112 3300026075 Bacteria 2047
507 Ga0207708_10155718 3300026075 Bacteria 1802
508 Ga0207708_10297068 3300026075 Bacteria 1313
509 Ga0207708_10333482 3300026075 Bacteria 1240
510 Ga0207641_10191247 3300026088 Bacteria 1881
511 Ga0207641_10214112 3300026088 Bacteria 1783
512 Ga0207641_10236160 3300026088 Bacteria 1701
513 Ga0207641_10341967 3300026088 Bacteria 1424
514 Ga0207641_10454714 3300026088 Unclassified 1238
515 Ga0207641_10581270 3300026088 Bacteria 1095
516 Ga0207648_10000280 3300026089 Bacteria 55313
517 Ga0207648_10001579 3300026089 Bacteria 24975
518 Ga0207648_10006656 3300026089 Bacteria 11469
519 Ga0207648_10187950 3300026089 Bacteria 1830
520 Ga0207648_11066418 3300026089 Bacteria 757
521 Ga0207676_10016359 3300026095 Bacteria 5369
522 Ga0207676_10019731 3300026095 Bacteria 4923
523 Ga0207676_10033802 3300026095 Bacteria 3867
524 Ga0207676_10069176 3300026095 Bacteria 2826
525 Ga0207676_10184870 3300026095 Bacteria 1828
526 Ga0207676_10204778 3300026095 Bacteria 1746
527 Ga0207676_10210435 3300026095 Bacteria 1725
528 Ga0207674_10009475 3300026116 Bacteria 11123
529 Ga0207674_10609619 3300026116 Bacteria 1054
530 Ga0207675_100004493 3300026118 Bacteria 13478
531 Ga0207675_100005112 3300026118 Bacteria 12628
532 Ga0207675_100014801 3300026118 Bacteria 7279
533 Ga0207675_100050377 3300026118 Bacteria 3885
534 Ga0207675_100109162 3300026118 Bacteria 2610
535 Ga0207675_100130025 3300026118 Bacteria 2387
536 Ga0207675_100136412 3300026118 Unclassified 2329
537 Ga0207683_10043725 3300026121 Bacteria 3915
538 Ga0207683_10262506 3300026121 Bacteria 1577
539 Ga0207698_10291325 3300026142 Unclassified 1515
540 Ga0207428_10000022 3300027907 Bacteria 273333
541 Ga0207428_10000481 3300027907 Bacteria 48194
542 Ga0207428_10012056 3300027907 Bacteria 7607
543 Ga0207428_10014489 3300027907 Bacteria 6845
544 Ga0207428_10018756 3300027907 Bacteria 5903
545 Ga0207428_10054410 3300027907 Unclassified 3188
546 Ga0268266_10008433 3300028379 Bacteria 9162
547 Ga0268266_10019932 3300028379 Bacteria 5715
548 Ga0268265_10003942 3300028380 Bacteria 10455
549 Ga0268265_10183737 3300028380 Bacteria 1799
550 Ga0268265_10307945 3300028380 Bacteria 1429
551 Ga0268265_10407300 3300028380 Bacteria 1259
552 Ga0268264_10002874 3300028381 Bacteria 14997
553 Ga0268264_10028177 3300028381 Bacteria 4593
554 Ga0268264_10282674 3300028381 Bacteria 1555
555 Ga0268264_10343966 3300028381 Bacteria 1418
556 Ga0268264_10734958 3300028381 Bacteria 982
557 Ga0307408_100011218 3300031548 Bacteria 5918
558 Ga0307408_100012736 3300031548 Bacteria 5577
559 Ga0307408_100191670 3300031548 Unclassified 1647
560 Ga0307405_10027069 3300031731 Bacteria 3319
561 Ga0307405_10102533 3300031731 Bacteria 1922
562 Ga0307413_10060122 3300031824 Bacteria 2338
563 Ga0307410_10023642 3300031852 Bacteria 3825
564 Ga0307410_10148857 3300031852 Bacteria 1740
565 Ga0307406_10453557 3300031901 Bacteria 1029
566 Ga0307407_10001825 3300031903 Bacteria 7993
567 Ga0307407_10057981 3300031903 Bacteria 2249
568 Ga0307412_10107721 3300031911 Bacteria 1984
569 Ga0307412_10116590 3300031911 Bacteria 1916
570 Ga0307412_10122711 3300031911 Bacteria 1873
571 Ga0307416_100003790 3300032002 Bacteria 8973
572 Ga0307416_100093223 3300032002 Bacteria 2593
573 Ga0307416_100145745 3300032002 Bacteria 2161
574 Ga0307416_100213212 3300032002 Bacteria 1844
575 Ga0307414_10298633 3300032004 Bacteria 1361
576 Ga0307411_10005511 3300032005 Bacteria 6227
577 Ga0307411_10020458 3300032005 Bacteria 3850
578 Ga0307411_10150176 3300032005 Unclassified 1730
579 Ga0307411_10455408 3300032005 Bacteria 1071
580 Ga0307415_100115730 3300032126 Unclassified 1999
581 Ga0307415_100380692 3300032126 Bacteria 1198
582 Ga0373948_0031638 3300034817 Bacteria 1070
583 Ga0373958_0013844 3300034819 Bacteria 1403
584 Ga0373929_0063844 3300035085 Bacteria 867
585 Ga0373940_0001254 3300035088 Bacteria 4505
586 Ga0373949_0067954 3300035090 Bacteria 928
587 Ga0373951_0000205 3300035091 Bacteria 21388
588 Ga0373952_0000336 3300035092 Bacteria 7944
589 Ga0373923_0071207 3300035111 Bacteria 1493
590 Ga0373932_0005622 3300035112 Bacteria 2948
591 Ga0373939_0061277 3300035114 Bacteria 1198
592 Ga0373941_0005793 3300035115 Bacteria 2933
593 Ga0373956_0020235 3300035119 Bacteria 2830
594 Ga0373956_0096609 3300035119 Bacteria 1367
595 Ga0373957_0088915 3300035120 Unclassified 1226
596 Ga0373960_0000362 3300035121 Bacteria 8753
597 Ga0373943_0001725 3300035170 Bacteria 9911
598 Ga0373943_0127651 3300035170 Unclassified 1358
599 Ga0373943_0158960 3300035170 Bacteria 1229
600 Ga0373946_0001902 3300035171 Bacteria 7279
601 Ga0373955_0061561 3300035172 Bacteria 2073
602 Ga0373961_0001032 3300035241 Bacteria 9048
603 Ga0373962_0006540 3300035242 Bacteria 2824
604 Ga0373924_0018446 3300035410 Bacteria 2688
605 Ga0373924_0079164 3300035410 Bacteria 1396
606 Ga0373931_0143963 3300035691 Bacteria 1383
607 Ga0373935_0187209 3300035692 Unclassified 1424
608 Ga0373927_0101194 3300035695 Bacteria 1874
609 Ga0373933_0039940 3300035724 Bacteria 2762
610 Ga0373947_0008942 3300035725 Bacteria 5757
611 Ga0373937_0000331 3300036401 Bacteria 44847
612 Ga0373937_0047494 3300036401 Bacteria 3928
613 Ga0373937_0112133 3300036401 Bacteria 2537
614 Ga0373937_0219440 3300036401 Bacteria 1790
615 Ga0373925_0000666 3300037068 Bacteria 32236
616 Ga0373925_0002901 3300037068 Bacteria 13546
617 Ga0436365_0561650 3300039437 Bacteria 3975
618 Ga0439453_0000514 3300041408 Bacteria 4277
619 Ga0451853_1658423 3300041512 Bacteria 2853
620 Ga0439462_0031430 3300042015 Bacteria 1406
621 Ga0450923_000960 3300042125 Bacteria 3573
622 Ga0450894_001319 3300042131 Bacteria 3602
623 Ga0450898_001371 3300042134 Bacteria 3189
624 Ga0439435_0003025 3300042436 Bacteria 3436
625 Ga0439464_0003970 3300042439 Bacteria 3763
626 Ga0439460_0009359 3300042461 Bacteria 2487
627 Ga0439460_0019594 3300042461 Bacteria 1834
628 Ga0450893_0024336 3300042532 Bacteria 1057
629 Ga0451576_0017978 3300045051 Bacteria 7758
630 Ga0495592_0072356 3300046454 Bacteria 2508
631 Ga0495629_0058617 3300046459 Bacteria 2692
632 Ga0495629_0311911 3300046459 Bacteria 1076
633 Ga0495651_0101967 3300046462 Bacteria 2135
634 Ga0495580_0022585 3300046472 Bacteria 4629
635 Ga0495662_0187923 3300046476 Bacteria 1019
636 Ga0495608_0007910 3300046511 Bacteria 7470
637 Ga0495628_0105903 3300046516 Bacteria 2166
638 Ga0495630_0084588 3300046517 Bacteria 2395
639 Ga0495644_0070854 3300046523 Bacteria 1310
640 Ga0495642_0018624 3300046528 Bacteria 2719
641 Ga0495609_0042718 3300046538 Bacteria 2036
642 Ga0495621_0026645 3300046539 Bacteria 1953
643 Ga0495621_0083205 3300046539 Bacteria 1196
644 Ga0495621_0100106 3300046539 Unclassified 1102
645 Ga0495645_0002684 3300046543 Bacteria 12075
646 Ga0495645_0012855 3300046543 Bacteria 5909
647 Ga0495667_0140554 3300046559 Bacteria 1556
648 Ga0495656_0179308 3300046615 Bacteria 1040
649 Ga0495634_0236278 3300046642 Bacteria 1123
650 Ga0495635_0148902 3300046663 Bacteria 1593
651 Ga0495659_0003292 3300046664 Bacteria 5177
652 Ga0495659_0061787 3300046664 Unclassified 1385
653 Ga0495647_0033881 3300046681 Bacteria 1911
654 Ga0495658_0145887 3300046683 Bacteria 1450
655 Ga0495658_0224031 3300046683 Unclassified 1178
656 Ga0495658_0381738 3300046683 Bacteria 897
657 Ga0495669_0003074 3300046684 Bacteria 6865
658 Ga0495669_0016593 3300046684 Bacteria 3155
659 Ga0495613_0006956 3300046689 Bacteria 8437
660 Ga0495613_0109088 3300046689 Bacteria 1996
661 Ga0495613_0219191 3300046689 Bacteria 1336
662 Ga0495613_0388854 3300046689 Bacteria 953
663 Ga0495600_0061429 3300046809 Bacteria 2454
664 Ga0495604_0142247 3300047317 Bacteria 1713
665 Ga0495674_0024135 3300047319 Bacteria 5595
666 Ga0495674_0058613 3300047319 Bacteria 3366
667 Ga0495680_0091104 3300047322 Bacteria 2286
668 Ga0495675_0068565 3300047444 Bacteria 2241
669 Ga0495684_0423208 3300047471 Bacteria 931
670 Ga0495602_0418034 3300048088 Bacteria 953
671 Ga0496100_0064463 3300048903 Bacteria 2425
672 Ga0496100_0453161 3300048903 Bacteria 984
673 Ga0496101_0135180 3300048904 Unclassified 1876
674 Ga0496102_0039241 3300048905 Bacteria 4278
675 Ga0496102_0576499 3300048905 Bacteria 1048
676 Ga0496103_0217740 3300048906 Bacteria 1228
677 Ga0496104_0028934 3300048907 Bacteria 5138
678 Ga0496104_0131411 3300048907 Unclassified 2405
679 Ga0496105_0078304 3300048908 Bacteria 2730
680 Ga0496105_0516619 3300048908 Bacteria 936
681 Ga0496106_0107357 3300048909 Bacteria 2171
682 Ga0496106_0330956 3300048909 Unclassified 1223
683 Ga0496107_0035305 3300048910 Bacteria 3585
684 Ga0496108_0076124 3300048911 Unclassified 2836
685 Ga0496109_0030192 3300048912 Bacteria 4859
686 Ga0496109_0429652 3300048912 Bacteria 1248
687 Ga0496110_0254261 3300048913 Unclassified 1599
688 Ga0496112_0204386 3300048915 Bacteria 1933
689 Ga0496112_0561615 3300048915 Bacteria 1075
690 Ga0496113_0006167 3300048916 Bacteria 7567
691 Ga0496114_0019564 3300048917 Bacteria 5486
692 Ga0496114_0029758 3300048917 Bacteria 4489
693 Ga0496114_0058242 3300048917 Bacteria 3225
694 Ga0496114_0060266 3300048917 Bacteria 3172
695 Ga0496114_0358792 3300048917 Unclassified 1289
696 Ga0496115_0016366 3300048918 Bacteria 5646
697 Ga0496115_0472532 3300048918 Unclassified 1010
698 Ga0501292_011655 3300049515 Unclassified 1334
699 Ga0501296_018916 3300049519 Unclassified 871
700 Ga0501033_0477354 3300049570 Bacteria 864
701 Ga0501036_0002621 3300049572 Bacteria 14178
702 Ga0501036_0128683 3300049572 Unclassified 2138
703 Ga0501037_0104028 3300049573 Unclassified 2047
704 Ga0501037_0752909 3300049573 Unclassified 645
705 Ga0501038_0108883 3300049574 Unclassified 2297
706 Ga0501039_0036223 3300049575 Bacteria 3807
707 Ga0501039_0872502 3300049575 Bacteria 701
708 Ga0501040_0004631 3300049576 Bacteria 8923
709 Ga0501040_0064138 3300049576 Unclassified 2529
710 Ga0501040_0357669 3300049576 Bacteria 1046
711 Ga0501041_0044806 3300049577 Unclassified 2688
712 Ga0501041_0052165 3300049577 Unclassified 2493
713 Ga0501042_0002992 3300049578 Bacteria 10510
714 Ga0501042_0028766 3300049578 Unclassified 3919
715 Ga0501042_0125519 3300049578 Bacteria 1848
716 Ga0501046_0008383 3300049580 Bacteria 9012
717 Ga0501047_0071241 3300049581 Bacteria 3346
718 Ga0501048_0017085 3300049582 Bacteria 5348
719 Ga0501048_0024020 3300049582 Unclassified 4452
720 Ga0501048_0099691 3300049582 Unclassified 2049
721 Ga0501048_0173291 3300049582 Bacteria 1529
722 Ga0501048_0181179 3300049582 Unclassified 1493
723 Ga0501068_0231398 3300049584 Bacteria 1175
724 Ga0501069_0153984 3300049585 Unclassified 1322
725 Ga0501071_0005860 3300049587 Bacteria 7941
726 Ga0501071_0133496 3300049587 Bacteria 1845
727 Ga0501071_0441907 3300049587 Archaea 995
728 Ga0501072_0078298 3300049588 Bacteria 2617
729 Ga0501074_0026594 3300049590 Bacteria 4196
730 Ga0501074_0130189 3300049590 Unclassified 1800
731 Ga0501075_0002949 3300049591 Bacteria 11398
732 Ga0501075_0022481 3300049591 Bacteria 4607
733 Ga0501075_0027670 3300049591 Bacteria 4180
734 Ga0501075_0062104 3300049591 Bacteria 2816
735 Ga0501075_0207522 3300049591 Bacteria 1494
736 Ga0501076_0010761 3300049592 Bacteria 6800
737 Ga0501076_0023479 3300049592 Bacteria 4754
738 Ga0501076_0085462 3300049592 Bacteria 2535
739 Ga0501076_0277964 3300049592 Bacteria 1372
740 Ga0501077_0220833 3300049593 Unclassified 1204
741 Ga0501207_014371 3300049654 Unclassified 1208
742 Ga0501235_042367 3300049669 Bacteria 1043
743 Ga0501079_0114597 3300049741 Unclassified 2095
744 Ga0501079_0134236 3300049741 Unclassified 1926
745 Ga0501079_0147379 3300049741 Unclassified 1834
746 Ga0501079_0537032 3300049741 Unclassified 919
747 Ga0501081_0018207 3300049743 Bacteria 4663
748 Ga0501081_0061361 3300049743 Bacteria 2606
749 Ga0501273_033077 3300049770 Unclassified 743
750 Ga0501035_0714196 3300049822 Archaea 807
751 Ga0501045_0001751 3300049824 Bacteria 14632
752 Ga0501045_0157566 3300049824 Unclassified 1689
753 Ga0501045_0211216 3300049824 Bacteria 1446
754 Ga0501045_0274314 3300049824 Bacteria 1255
755 Ga0501045_0470760 3300049824 Bacteria 934
756 nmdc:mga03n38_188880_c1 3300050490 Bacteria 1060
757 nmdc:mga0yw44_61110_c1 3300050492 Bacteria 2310
758 nmdc:mga06z11_175288_c1 3300050494 Bacteria 1233
759 nmdc:mga06z11_33249_c1 3300050494 Bacteria 2522
760 nmdc:mga07m45_1298_c1 3300050496 Bacteria 11368
761 nmdc:mga05p37_118643_c1 3300050507 Bacteria 3251
762 nmdc:mga05p37_173899_c1 3300050507 Bacteria 2625
763 nmdc:mga05p37_202092_c1 3300050507 Bacteria 2406
764 nmdc:mga05p37_31138_c1 3300050507 Bacteria 6515
765 nmdc:mga05p37_354784_c1 3300050507 Bacteria 1726
766 nmdc:mga05p37_456106_c1 3300050507 Unclassified 1478
767 nmdc:mga05p37_5323_c1 3300050507 Bacteria 15109
768 nmdc:mga05p37_532709_c1 3300050507 Bacteria 1341
769 nmdc:mga05p37_66571_c1 3300050507 Bacteria 4431
770 nmdc:mga05p37_9253_c1 3300050507 Bacteria 11642
771 nmdc:mga09592_23977_c1 3300050508 Bacteria 5043
772 nmdc:mga09592_2888_c1 3300050508 Bacteria 13923
773 nmdc:mga09592_5817_c1 3300050508 Bacteria 10056
774 nmdc:mga09592_73594_c1 3300050508 Unclassified 2903
775 nmdc:mga0qj67_1042_c1 3300050509 Bacteria 19184
776 nmdc:mga0qj67_10762_c1 3300050509 Bacteria 6841
777 nmdc:mga06r32_12892_c1 3300050510 Bacteria 7557
778 nmdc:mga06r32_445690_c1 3300050510 Bacteria 1274
779 nmdc:mga06r32_8668_c1 3300050510 Bacteria 9166
780 nmdc:mga08y16_15088_c1 3300050511 Bacteria 8124
781 nmdc:mga08y16_19193_c1 3300050511 Bacteria 7203
782 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
783 nmdc:mga08y16_2338_c1 3300050511 Bacteria 12091
784 nmdc:mga08y16_400817_c1 3300050511 Bacteria 1404
785 nmdc:mga08y16_4981_c1 3300050511 Bacteria 13887
786 nmdc:mga08y16_533361_c1 3300050511 Unclassified 1189
787 nmdc:mga08y16_64121_c1 3300050511 Bacteria 3837
788 nmdc:mga08y16_9318_c1 3300050511 Bacteria 10297
789 nmdc:mga0n895_20514_c1 3300050512 Bacteria 6165
790 nmdc:mga0n895_212357_c1 3300050512 Unclassified 1965
791 nmdc:mga0n895_231555_c1 3300050512 Unclassified 1875
792 nmdc:mga0n895_252012_c1 3300050512 Bacteria 1792
793 nmdc:mga0n895_581525_c1 3300050512 Bacteria 1124
794 nmdc:mga0n895_699642_c1 3300050512 Bacteria 1009
795 nmdc:mga0rr50_193159_c1 3300050513 Bacteria 1669
796 nmdc:mga0rr50_27023_c1 3300050513 Bacteria 4014
797 nmdc:mga0rr50_578306_c1 3300050513 Bacteria 957
798 nmdc:mga0rr50_925_c1 3300050513 Bacteria 15860
799 nmdc:mga08x19_213859_c1 3300050514 Unclassified 1324
800 nmdc:mga0a205_112312_c1 3300050515 Bacteria 2624
801 nmdc:mga0a205_146002_c1 3300050515 Unclassified 2265
802 nmdc:mga0a205_229269_c1 3300050515 Bacteria 1741
803 nmdc:mga0a205_323_c1 3300050515 Bacteria 35802
804 nmdc:mga0a205_7354_c1 3300050515 Bacteria 9973
805 Ga0495601_0005212 3300053077 Bacteria 7561
806 Ga0495601_0007830 3300053077 Bacteria 6286
807 Ga0495601_0048331 3300053077 Bacteria 2679
808 Ga0495601_0104271 3300053077 Bacteria 1833
809 Ga0495601_0453643 3300053077 Bacteria 829
810 Ga0495612_0045627 3300053078 Bacteria 1794
811 Ga0495595_0007824 3300053084 Bacteria 4377
812 Ga0495619_0000422 3300053085 Bacteria 28636
813 Ga0495619_0032671 3300053085 Bacteria 3378
814 Ga0501084_0002040 3300054114 Bacteria 16122
815 Ga0501084_0016081 3300054114 Bacteria 6212
816 Ga0501084_0184908 3300054114 Bacteria 1759
817 Ga0501084_0197260 3300054114 Unclassified 1698
818 Ga0501084_0205319 3300054114 Bacteria 1663
819 Ga0501084_0459263 3300054114 Bacteria 1077
820 Ga0590071_000104 3300059421 Bacteria 24141
821 Ga0590071_001734 3300059421 Bacteria 5629
822 Ga0590071_034545 3300059421 Bacteria 1210
823 Ga0590074_001947 3300059423 Bacteria 3375
824 Ga0590074_004708 3300059423 Bacteria 2252
825 Ga0590075_000096 3300059424 Bacteria 22788
826 Ga0590075_010113 3300059424 Bacteria 2268
827 Ga0590075_013136 3300059424 Bacteria 2014
828 Ga0590075_033515 3300059424 Unclassified 1304
829 Ga0590077_001434 3300059426 Bacteria 5586
830 Ga0590077_003192 3300059426 Bacteria 3414
831 Ga0501082_0060117 3300060353 Unclassified 3273
832 Ga0501082_0060416 3300060353 Bacteria 3264
833 Ga0501082_0143016 3300060353 Unclassified 2076
834 Ga0501082_0152032 3300060353 Unclassified 2011
835 Ga0501082_0887993 3300060353 Bacteria 780
836 Ga0530510_0000198 3300061734 Bacteria 37256
837 Ga0530510_0001830 3300061734 Bacteria 14520
838 Ga0530510_0160668 3300061734 Bacteria 1662
839 Ga0530510_0196195 3300061734 Bacteria 1499
840 Ga0530510_0503102 3300061734 Bacteria 918
841 Ga0111539_10225274
842 MBSR1b_contig_9574644
843 Ga0065714_10109942
844 Ga0065704_10309465
845 Ga0065712_10000910
846 Ga0065712_10005068
847 Ga0065715_10091660
848 Ga0065707_10001606
849 Ga0065707_10003829
850 Ga0065707_10124873
851 Ga0070676_10012476
852 Ga0070676_10020524
853 Ga0070676_10022591
854 Ga0070676_10043017
855 Ga0070683_100007922
856 Ga0070683_100125280
857 Ga0070690_100006740
858 Ga0070690_100018607
859 Ga0070690_100049448
860 Ga0070670_100006348
861 Ga0070670_100059175
862 Ga0070670_100153622
863 Ga0070670_100580409
864 Ga0070677_10018771
865 Ga0070677_10183731
866 Ga0068869_100025000
867 Ga0068869_100070453
868 Ga0068869_100207515
869 Ga0068869_100367918
870 Ga0070666_10076098
871 Ga0070666_10138677
872 Ga0070682_100352106
873 Ga0068868_100089958
874 Ga0068868_100384813
875 Ga0068868_100404909
876 Ga0070660_100701952
877 Ga0070689_100004535
878 Ga0070689_100048793
879 Ga0070689_100217648
880 Ga0070691_10009673
881 Ga0070687_100003788
882 Ga0070687_100140524
883 Ga0070687_100277776
884 Ga0070661_100261557
885 Ga0070692_10018834
886 Ga0070692_10058819
887 Ga0070692_10150819
888 Ga0070668_100164036
889 Ga0070668_100410170
890 Ga0070669_100001192
891 Ga0070669_100040729
892 Ga0070669_100050503
893 Ga0070669_100077287
894 Ga0070669_100335975
895 Ga0070669_100644905
896 Ga0070675_100000206
897 Ga0070675_100013178
898 Ga0070675_100018751
899 Ga0070675_100039166
900 Ga0070675_100066173
901 Ga0070675_100251984
902 Ga0070675_100308015
903 Ga0070675_100388126
904 Ga0070675_100589210
905 Ga0070671_100010149
906 Ga0070671_100020196
907 Ga0070671_100078410
908 Ga0070671_100326555
909 Ga0070671_100452240
910 Ga0070674_100005602
911 Ga0070674_100488807
912 Ga0070674_100682605
913 Ga0070674_100716060
914 Ga0070673_100004944
915 Ga0070673_100010484
916 Ga0070673_100018060
917 Ga0070673_100382706
918 Ga0070673_100815520
919 Ga0070688_100013941
920 Ga0070688_100015737
921 Ga0070688_100016705
922 Ga0070688_100030556
923 Ga0070688_100118288
924 Ga0070667_100147550
925 Ga0070667_100201779
926 Ga0070709_10256089
927 Ga0070713_100282326
928 Ga0070713_100300830
929 Ga0070701_10003212
930 Ga0070701_10006900
931 Ga0070701_10009073
932 Ga0070701_10022495
933 Ga0070701_10039603
934 Ga0070705_100053308
935 Ga0070700_100090189
936 Ga0070700_100091845
937 Ga0070700_100175422
938 Ga0070700_100441918
939 Ga0070694_100004830
940 Ga0070694_100067906
941 Ga0070694_100373207
942 Ga0070708_100033954
943 Ga0070708_100375607
944 Ga0070708_100576639
945 Ga0070663_100007672
946 Ga0070663_100313245
947 Ga0070678_100022569
948 Ga0070678_100098510
949 Ga0070678_100449513
950 Ga0070662_100101620
951 Ga0070662_100125529
952 Ga0070662_100293853
953 Ga0068867_100005997
954 Ga0068867_100008016
955 Ga0068867_100012021
956 Ga0068867_100360999
957 Ga0070685_10014731
958 Ga0070685_10028459
959 Ga0070706_100185970
960 Ga0070707_100052395
961 Ga0070707_100216200
962 Ga0070707_100744184
963 Ga0070707_100889402
964 Ga0070698_100002805
965 Ga0070698_100082707
966 Ga0070698_100135646
967 Ga0070698_100146038
968 Ga0070698_100160638
969 Ga0070698_100250294
970 Ga0070698_100388661
971 Ga0070699_100017513
972 Ga0070699_100090264
973 Ga0070699_100182224
974 Ga0070699_100303672
975 Ga0070684_100017777
976 Ga0070684_100116588
977 Ga0070684_100165429
978 Ga0070684_100277941
979 Ga0070697_100024978
980 Ga0070697_100330437
981 Ga0068853_100100186
982 Ga0068853_100136667
983 Ga0068853_100235514
984 Ga0070672_100009511
985 Ga0070672_100023354
986 Ga0070672_100028040
987 Ga0070672_100042170
988 Ga0070672_100108508
989 Ga0070672_100172141
990 Ga0070672_100287844
991 Ga0070672_100497714
992 Ga0070686_100066996
993 Ga0070686_100467374
994 Ga0070695_100023227
995 Ga0070695_100072157
996 Ga0070695_100127241
997 Ga0070695_100307976
998 Ga0070695_100402371
999 Ga0070696_100052106
1000 Ga0070696_100156371
1001 Ga0070693_100109124
1002 Ga0070665_100016208
1003 Ga0070665_100051447
1004 Ga0070704_100001112
1005 Ga0070704_100013850
1006 Ga0070704_100049904
1007 Ga0070704_100355070
1008 Ga0068855_100596238
1009 Ga0070664_100003040
1010 Ga0070664_100020704
1011 Ga0070664_100038724
1012 Ga0070664_100053251
1013 Ga0070664_100064346
1014 Ga0070664_100979580
1015 Ga0068857_100666739
1016 Ga0068854_100003713
1017 Ga0068854_100293529
1018 Ga0070702_100081780
1019 Ga0070702_100158024
1020 Ga0068859_100016091
1021 Ga0068859_100030261
1022 Ga0068859_100588879
1023 Ga0068864_100021467
1024 Ga0068864_100024865
1025 Ga0068864_100043007
1026 Ga0068864_100069727
1027 Ga0068864_100083903
1028 Ga0068864_100237070
1029 Ga0068866_10022349
1030 Ga0068866_10080133
1031 Ga0068866_10232996
1032 Ga0068861_100005603
1033 Ga0068861_100026746
1034 Ga0068861_100160334
1035 Ga0068861_100268866
1036 Ga0068861_100281873
1037 Ga0068870_10002305
1038 Ga0068870_10096698
1039 Ga0068863_100286077
1040 Ga0068863_100406338
1041 Ga0068863_100641184
1042 Ga0068858_100009240
1043 Ga0068858_100041853
1044 Ga0068858_100052950
1045 Ga0068858_100063971
1046 Ga0068858_100078444
1047 Ga0068858_100113069
1048 Ga0068860_100046431
1049 Ga0068860_100111786
1050 Ga0068860_100150257
1051 Ga0068860_100279709
1052 Ga0068860_100507153
1053 Ga0068860_100628203
1054 Ga0068862_100001571
1055 Ga0068862_100030062
1056 Ga0068862_100079871
1057 Ga0068862_100116607
1058 Ga0068862_100195945
1059 Ga0068862_100459091
1060 Ga0068862_100462985
1061 Ga0081538_10056204
1062 Ga0081539_10189775
1063 Ga0075368_10067001
1064 Ga0075363_100473256
1065 Ga0075364_10050905
1066 Ga0075432_10026544
1067 Ga0070712_100194576
1068 Ga0097621_100101918
1069 Ga0097621_100341007
1070 Ga0075370_10002263
1071 Ga0068871_100015620
1072 Ga0068871_100050475
1073 Ga0068871_100059211
1074 Ga0068871_100249143
1075 Ga0068871_100461965
1076 Ga0068871_100520344
1077 Ga0075428_100000007
1078 Ga0075428_100000080
1079 Ga0075428_100003353
1080 Ga0075428_100007739
1081 Ga0075428_100070866
1082 Ga0075428_100182557
1083 Ga0075428_100609829
1084 Ga0075430_100000632
1085 Ga0075430_100005792
1086 Ga0075430_100067848
1087 Ga0075431_100008574
1088 Ga0075431_100041811
1089 Ga0075431_100085542
1090 Ga0075431_100189614
1091 Ga0075433_10033427
1092 Ga0075433_10299228
1093 Ga0075433_10584227
1094 Ga0075434_100002096
1095 Ga0075434_100010094
1096 Ga0075434_100016921
1097 Ga0075434_100034442
1098 Ga0075434_100048388
1099 Ga0075434_100261687
1100 Ga0075434_100398190
1101 Ga0075429_100000411
1102 Ga0075429_100002380
1103 Ga0075429_100004082
1104 Ga0075429_100098396
1105 Ga0075429_100232324
1106 Ga0068865_100012596
1107 Ga0068865_100022580
1108 Ga0068865_100022694
1109 Ga0068865_100091936
1110 Ga0068865_100157700
1111 Ga0075436_100010719
1112 Ga0075436_100119454
1113 Ga0075436_100231513
1114 Ga0097620_100016090
1115 Ga0097620_100030261
1116 Ga0097620_100588868
1117 Ga0075435_100003130
1118 Ga0075435_100009595
1119 Ga0075435_100032838
1120 Ga0075435_100104456
1121 Ga0075435_100631977
1122 Ga0105240_10009773
1123 Ga0105240_10364647
1124 Ga0111539_10000181
1125 Ga0111539_10000209
1126 Ga0111539_10003328
1127 Ga0111539_10005065
1128 Ga0111539_10011332
1129 Ga0111539_10037183
1130 Ga0111539_10055901
1131 Ga0105245_10103481
1132 Ga0105247_10278714
1133 Ga0114129_10000077
1134 Ga0114129_10010731
1135 Ga0114129_10013454
1136 Ga0114129_10036869
1137 Ga0114129_10132391
1138 Ga0114129_10293685
1139 Ga0114129_10378863
1140 Ga0114129_10396430
1141 Ga0114129_10399353
1142 Ga0114129_10434602
1143 Ga0114129_10733088
1144 Ga0105243_10019426
1145 Ga0105243_10043256
1146 Ga0105243_10194460
1147 Ga0105241_10726280
1148 Ga0105242_10009410
1149 Ga0105242_10016448
1150 Ga0105242_10038931
1151 Ga0105242_10050153
1152 Ga0105242_10134886
1153 Ga0105242_10231460
1154 Ga0105242_10566912
1155 Ga0105248_10000664
1156 Ga0105248_10087537
1157 Ga0105248_10100845
1158 Ga0105248_10101946
1159 Ga0105248_10136158
1160 Ga0105248_10140805
1161 Ga0105248_10263156
1162 Ga0105248_10717473
1163 Ga0105248_11150424
1164 Ga0105237_10123728
1165 Ga0105238_10269409
1166 Ga0105238_10453290
1167 Ga0105238_10658259
1168 Ga0105249_10011683
1169 Ga0105249_10014963
1170 Ga0105249_10278884
1171 Ga0105239_10290394
1172 Ga0105246_10103919
1173 Ga0105246_10164858
1174 Ga0105246_10297703
1175 Ga0157374_10047903
1176 Ga0157374_10163268
1177 Ga0157378_10019405
1178 Ga0157378_10050510
1179 Ga0157378_10159660
1180 Ga0157378_11157963
1181 Ga0163162_10008545
1182 Ga0163162_10075091
1183 Ga0163162_10290552
1184 Ga0157375_10013991
1185 Ga0157375_10198502
1186 Ga0157375_10237346
1187 Ga0157375_10458954
1188 Ga0157375_11043153
1189 Ga0163163_10070802
1190 Ga0163163_10112721
1191 Ga0163163_10227288
1192 Ga0163163_10452202
1193 Ga0163163_10664185
1194 Ga0157380_10001986
1195 Ga0157380_10012368
1196 Ga0157380_10051763
1197 Ga0157380_10209254
1198 Ga0157380_10394207
1199 Ga0157380_10417435
1200 Ga0157377_10064153
1201 Ga0157377_10070050
1202 Ga0157377_10706510
1203 Ga0157379_10011426
1204 Ga0157379_10049540
1205 Ga0157379_10099823
1206 Ga0157379_10188317
1207 Ga0157379_10295565
1208 Ga0157376_10014912
1209 Ga0157376_10206198
1210 Ga0163161_10057136
1211 Ga0207682_10011010
1212 Ga0207642_10037261
1213 Ga0207642_10184843
1214 Ga0207710_10110505
1215 Ga0207710_10205167
1216 Ga0207688_10110456
1217 Ga0207680_10060425
1218 Ga0207680_10187273
1219 Ga0207680_10385844
1220 Ga0207647_10072926
1221 Ga0207645_10006720
1222 Ga0207645_10014141
1223 Ga0207645_10058272
1224 Ga0207643_10002349
1225 Ga0207643_10097319
1226 Ga0207707_10182328
1227 Ga0207695_10042303
1228 Ga0207695_10259488
1229 Ga0207662_10004150
1230 Ga0207662_10016788
1231 Ga0207662_10045802
1232 Ga0207662_10088247
1233 Ga0207662_10267345
1234 Ga0207649_10077867
1235 Ga0207649_10175929
1236 Ga0207646_10073038
1237 Ga0207646_10186075
1238 Ga0207681_10004007
1239 Ga0207681_10008989
1240 Ga0207681_10049560
1241 Ga0207681_10105674
1242 Ga0207681_10373362
1243 Ga0207694_10611844
1244 Ga0207650_10025889
1245 Ga0207650_10039489
1246 Ga0207650_10088954
1247 Ga0207650_10163741
1248 Ga0207650_10583189
1249 Ga0207659_10000471
1250 Ga0207659_10015657
1251 Ga0207659_10054886
1252 Ga0207659_10163102
1253 Ga0207659_10339460
1254 Ga0207659_10341452
1255 Ga0207659_10480511
1256 Ga0207687_10139340
1257 Ga0207700_10163933
1258 Ga0207644_10028267
1259 Ga0207644_10099295
1260 Ga0207644_10205896
1261 Ga0207644_10307712
1262 Ga0207706_10042517
1263 Ga0207706_10098957
1264 Ga0207706_10138751
1265 Ga0207706_10315268
1266 Ga0207686_10010469
1267 Ga0207686_10024783
1268 Ga0207709_10035857
1269 Ga0207709_10047851
1270 Ga0207670_10030418
1271 Ga0207670_10096727
1272 Ga0207670_10203520
1273 Ga0207670_10217913
1274 Ga0207670_10365370
1275 Ga0207669_10008788
1276 Ga0207669_10112104
1277 Ga0207669_10487980
1278 Ga0207704_10005959
1279 Ga0207704_10070859
1280 Ga0207704_10116119
1281 Ga0207704_10195927
1282 Ga0207704_10408134
1283 Ga0207665_10183001
1284 Ga0207691_10040959
1285 Ga0207691_10061649
1286 Ga0207691_10086568
1287 Ga0207691_10089872
1288 Ga0207691_10117315
1289 Ga0207691_10176405
1290 Ga0207691_10231651
1291 Ga0207691_10274460
1292 Ga0207691_10658048
1293 Ga0207711_10031433
1294 Ga0207711_10083063
1295 Ga0207711_10092504
1296 Ga0207711_10136645
1297 Ga0207711_10171447
1298 Ga0207711_10292101
1299 Ga0207711_10810223
1300 Ga0207689_10006551
1301 Ga0207689_10065563
1302 Ga0207689_10109017
1303 Ga0207689_10447055
1304 Ga0207661_10015731
1305 Ga0207661_10021914
1306 Ga0207679_10039442
1307 Ga0207679_10057603
1308 Ga0207679_10161198
1309 Ga0207679_10350424
1310 Ga0207667_10539923
1311 Ga0207651_10004772
1312 Ga0207651_10010918
1313 Ga0207651_10013285
1314 Ga0207651_10046848
1315 Ga0207651_10080228
1316 Ga0207651_10098553
1317 Ga0207651_10322827
1318 Ga0207651_10415659
1319 Ga0207712_10004752
1320 Ga0207712_10026530
1321 Ga0207712_10071579
1322 Ga0207668_10316427
1323 Ga0207668_10428474
1324 Ga0207668_10471533
1325 Ga0207640_10234725
1326 Ga0207640_10479416
1327 Ga0207658_10299359
1328 Ga0207658_10607262
1329 Ga0207677_10153809
1330 Ga0207677_10163999
1331 Ga0207677_10199159
1332 Ga0207677_10432385
1333 Ga0207703_10017930
1334 Ga0207703_10030855
1335 Ga0207703_10054646
1336 Ga0207703_10060565
1337 Ga0207703_10371237
1338 Ga0207703_10486322
1339 Ga0207639_10041021
1340 Ga0207639_10105680
1341 Ga0207639_10207178
1342 Ga0207639_10300105
1343 Ga0207678_10342245
1344 Ga0207708_10025804
1345 Ga0207708_10048780
1346 Ga0207708_10120112
1347 Ga0207708_10155718
1348 Ga0207708_10297068
1349 Ga0207708_10333482
1350 Ga0207641_10191247
1351 Ga0207641_10214112
1352 Ga0207641_10236160
1353 Ga0207641_10341967
1354 Ga0207641_10454714
1355 Ga0207641_10581270
1356 Ga0207648_10000280
1357 Ga0207648_10001579
1358 Ga0207648_10006656
1359 Ga0207648_10187950
1360 Ga0207648_11066418
1361 Ga0207676_10016359
1362 Ga0207676_10019731
1363 Ga0207676_10033802
1364 Ga0207676_10069176
1365 Ga0207676_10184870
1366 Ga0207676_10204778
1367 Ga0207676_10210435
1368 Ga0207674_10009475
1369 Ga0207674_10609619
1370 Ga0207675_100004493
1371 Ga0207675_100005112
1372 Ga0207675_100014801
1373 Ga0207675_100050377
1374 Ga0207675_100109162
1375 Ga0207675_100130025
1376 Ga0207675_100136412
1377 Ga0207683_10043725
1378 Ga0207683_10262506
1379 Ga0207698_10291325
1380 Ga0207428_10000022
1381 Ga0207428_10000481
1382 Ga0207428_10012056
1383 Ga0207428_10014489
1384 Ga0207428_10018756
1385 Ga0207428_10054410
1386 Ga0268266_10008433
1387 Ga0268266_10019932
1388 Ga0268265_10003942
1389 Ga0268265_10183737
1390 Ga0268265_10307945
1391 Ga0268265_10407300
1392 Ga0268264_10002874
1393 Ga0268264_10028177
1394 Ga0268264_10282674
1395 Ga0268264_10343966
1396 Ga0268264_10734958
1397 Ga0307408_100011218
1398 Ga0307408_100012736
1399 Ga0307408_100191670
1400 Ga0307405_10027069
1401 Ga0307405_10102533
1402 Ga0307413_10060122
1403 Ga0307410_10023642
1404 Ga0307410_10148857
1405 Ga0307406_10453557
1406 Ga0307407_10001825
1407 Ga0307407_10057981
1408 Ga0307412_10107721
1409 Ga0307412_10116590
1410 Ga0307412_10122711
1411 Ga0307416_100003790
1412 Ga0307416_100093223
1413 Ga0307416_100145745
1414 Ga0307416_100213212
1415 Ga0307414_10298633
1416 Ga0307411_10005511
1417 Ga0307411_10020458
1418 Ga0307411_10150176
1419 Ga0307411_10455408
1420 Ga0307415_100115730
1421 Ga0307415_100380692
1422 Ga0373948_0031638
1423 Ga0373958_0013844
1424 Ga0373929_0063844
1425 Ga0373940_0001254
1426 Ga0373949_0067954
1427 Ga0373951_0000205
1428 Ga0373952_0000336
1429 Ga0373923_0071207
1430 Ga0373932_0005622
1431 Ga0373939_0061277
1432 Ga0373941_0005793
1433 Ga0373956_0020235
1434 Ga0373956_0096609
1435 Ga0373957_0088915
1436 Ga0373960_0000362
1437 Ga0373943_0001725
1438 Ga0373943_0127651
1439 Ga0373943_0158960
1440 Ga0373946_0001902
1441 Ga0373955_0061561
1442 Ga0373961_0001032
1443 Ga0373962_0006540
1444 Ga0373924_0018446
1445 Ga0373924_0079164
1446 Ga0373931_0143963
1447 Ga0373935_0187209
1448 Ga0373927_0101194
1449 Ga0373933_0039940
1450 Ga0373947_0008942
1451 Ga0373937_0000331
1452 Ga0373937_0047494
1453 Ga0373937_0112133
1454 Ga0373937_0219440
1455 Ga0373925_0000666
1456 Ga0373925_0002901
1457 Ga0436365_0561650
1458 Ga0439453_0000514
1459 Ga0451853_1658423
1460 Ga0439462_0031430
1461 Ga0450923_000960
1462 Ga0450894_001319
1463 Ga0450898_001371
1464 Ga0439435_0003025
1465 Ga0439464_0003970
1466 Ga0439460_0009359
1467 Ga0439460_0019594
1468 Ga0450893_0024336
1469 Ga0451576_0017978
1470 Ga0495592_0072356
1471 Ga0495629_0058617
1472 Ga0495629_0311911
1473 Ga0495651_0101967
1474 Ga0495580_0022585
1475 Ga0495662_0187923
1476 Ga0495608_0007910
1477 Ga0495628_0105903
1478 Ga0495630_0084588
1479 Ga0495644_0070854
1480 Ga0495642_0018624
1481 Ga0495609_0042718
1482 Ga0495621_0026645
1483 Ga0495621_0083205
1484 Ga0495621_0100106
1485 Ga0495645_0002684
1486 Ga0495645_0012855
1487 Ga0495667_0140554
1488 Ga0495656_0179308
1489 Ga0495634_0236278
1490 Ga0495635_0148902
1491 Ga0495659_0003292
1492 Ga0495659_0061787
1493 Ga0495647_0033881
1494 Ga0495658_0145887
1495 Ga0495658_0224031
1496 Ga0495658_0381738
1497 Ga0495669_0003074
1498 Ga0495669_0016593
1499 Ga0495613_0006956
1500 Ga0495613_0109088
1501 Ga0495613_0219191
1502 Ga0495613_0388854
1503 Ga0495600_0061429
1504 Ga0495604_0142247
1505 Ga0495674_0024135
1506 Ga0495674_0058613
1507 Ga0495680_0091104
1508 Ga0495675_0068565
1509 Ga0495684_0423208
1510 Ga0495602_0418034
1511 Ga0496100_0064463
1512 Ga0496100_0453161
1513 Ga0496101_0135180
1514 Ga0496102_0039241
1515 Ga0496102_0576499
1516 Ga0496103_0217740
1517 Ga0496104_0028934
1518 Ga0496104_0131411
1519 Ga0496105_0078304
1520 Ga0496105_0516619
1521 Ga0496106_0107357
1522 Ga0496106_0330956
1523 Ga0496107_0035305
1524 Ga0496108_0076124
1525 Ga0496109_0030192
1526 Ga0496109_0429652
1527 Ga0496110_0254261
1528 Ga0496112_0204386
1529 Ga0496112_0561615
1530 Ga0496113_0006167
1531 Ga0496114_0019564
1532 Ga0496114_0029758
1533 Ga0496114_0058242
1534 Ga0496114_0060266
1535 Ga0496114_0358792
1536 Ga0496115_0016366
1537 Ga0496115_0472532
1538 Ga0501292_011655
1539 Ga0501296_018916
1540 Ga0501033_0477354
1541 Ga0501036_0002621
1542 Ga0501036_0128683
1543 Ga0501037_0104028
1544 Ga0501037_0752909
1545 Ga0501038_0108883
1546 Ga0501039_0036223
1547 Ga0501039_0872502
1548 Ga0501040_0004631
1549 Ga0501040_0064138
1550 Ga0501040_0357669
1551 Ga0501041_0044806
1552 Ga0501041_0052165
1553 Ga0501042_0002992
1554 Ga0501042_0028766
1555 Ga0501042_0125519
1556 Ga0501046_0008383
1557 Ga0501047_0071241
1558 Ga0501048_0017085
1559 Ga0501048_0024020
1560 Ga0501048_0099691
1561 Ga0501048_0173291
1562 Ga0501048_0181179
1563 Ga0501068_0231398
1564 Ga0501069_0153984
1565 Ga0501071_0005860
1566 Ga0501071_0133496
1567 Ga0501071_0441907
1568 Ga0501072_0078298
1569 Ga0501074_0026594
1570 Ga0501074_0130189
1571 Ga0501075_0002949
1572 Ga0501075_0022481
1573 Ga0501075_0027670
1574 Ga0501075_0062104
1575 Ga0501075_0207522
1576 Ga0501076_0010761
1577 Ga0501076_0023479
1578 Ga0501076_0085462
1579 Ga0501076_0277964
1580 Ga0501077_0220833
1581 Ga0501207_014371
1582 Ga0501235_042367
1583 Ga0501079_0114597
1584 Ga0501079_0134236
1585 Ga0501079_0147379
1586 Ga0501079_0537032
1587 Ga0501081_0018207
1588 Ga0501081_0061361
1589 Ga0501273_033077
1590 Ga0501035_0714196
1591 Ga0501045_0001751
1592 Ga0501045_0157566
1593 Ga0501045_0211216
1594 Ga0501045_0274314
1595 Ga0501045_0470760
1596 nmdc:mga03n38_188880_c1
1597 nmdc:mga0yw44_61110_c1
1598 nmdc:mga06z11_175288_c1
1599 nmdc:mga06z11_33249_c1
1600 nmdc:mga07m45_1298_c1
1601 nmdc:mga05p37_118643_c1
1602 nmdc:mga05p37_173899_c1
1603 nmdc:mga05p37_202092_c1
1604 nmdc:mga05p37_31138_c1
1605 nmdc:mga05p37_354784_c1
1606 nmdc:mga05p37_456106_c1
1607 nmdc:mga05p37_5323_c1
1608 nmdc:mga05p37_532709_c1
1609 nmdc:mga05p37_66571_c1
1610 nmdc:mga05p37_9253_c1
1611 nmdc:mga09592_23977_c1
1612 nmdc:mga09592_2888_c1
1613 nmdc:mga09592_5817_c1
1614 nmdc:mga09592_73594_c1
1615 nmdc:mga0qj67_1042_c1
1616 nmdc:mga0qj67_10762_c1
1617 nmdc:mga06r32_12892_c1
1618 nmdc:mga06r32_445690_c1
1619 nmdc:mga06r32_8668_c1
1620 nmdc:mga08y16_15088_c1
1621 nmdc:mga08y16_19193_c1
1622 nmdc:mga08y16_21_c1
1623 nmdc:mga08y16_2338_c1
1624 nmdc:mga08y16_400817_c1
1625 nmdc:mga08y16_4981_c1
1626 nmdc:mga08y16_533361_c1
1627 nmdc:mga08y16_64121_c1
1628 nmdc:mga08y16_9318_c1
1629 nmdc:mga0n895_20514_c1
1630 nmdc:mga0n895_212357_c1
1631 nmdc:mga0n895_231555_c1
1632 nmdc:mga0n895_252012_c1
1633 nmdc:mga0n895_581525_c1
1634 nmdc:mga0n895_699642_c1
1635 nmdc:mga0rr50_193159_c1
1636 nmdc:mga0rr50_27023_c1
1637 nmdc:mga0rr50_578306_c1
1638 nmdc:mga0rr50_925_c1
1639 nmdc:mga08x19_213859_c1
1640 nmdc:mga0a205_112312_c1
1641 nmdc:mga0a205_146002_c1
1642 nmdc:mga0a205_229269_c1
1643 nmdc:mga0a205_323_c1
1644 nmdc:mga0a205_7354_c1
1645 Ga0495601_0005212
1646 Ga0495601_0007830
1647 Ga0495601_0048331
1648 Ga0495601_0104271
1649 Ga0495601_0453643
1650 Ga0495612_0045627
1651 Ga0495595_0007824
1652 Ga0495619_0000422
1653 Ga0495619_0032671
1654 Ga0501084_0002040
1655 Ga0501084_0016081
1656 Ga0501084_0184908
1657 Ga0501084_0197260
1658 Ga0501084_0205319
1659 Ga0501084_0459263
1660 Ga0590071_000104
1661 Ga0590071_001734
1662 Ga0590071_034545
1663 Ga0590074_001947
1664 Ga0590074_004708
1665 Ga0590075_000096
1666 Ga0590075_010113
1667 Ga0590075_013136
1668 Ga0590075_033515
1669 Ga0590077_001434
1670 Ga0590077_003192
1671 Ga0501082_0060117
1672 Ga0501082_0060416
1673 Ga0501082_0143016
1674 Ga0501082_0152032
1675 Ga0501082_0887993
1676 Ga0530510_0000198
1677 Ga0530510_0001830
1678 Ga0530510_0160668
1679 Ga0530510_0196195
1680 Ga0530510_0503102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

8

195

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

5

189

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hdh-assembly1.cif.gz_A r49k variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer to 1.6 a. 0.8877 1 221
4g9b-assembly1.cif.gz_A-2 crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid 0.8859 2 229
6h8y-assembly1.cif.gz_A t16a variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer complexed with aluminium tetrafluoride to 1.9 a. 0.8822 1 221
1lvh-assembly1.cif.gz_A the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution 0.8811 1 226
1lvh-assembly1.cif.gz_A the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution 0.8737 1 226
ID Description Score Start End Superfamily
af_Q60DU2_197_332_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9236 92 227 3.40.50.1000
3e58A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8988 89 212 3.40.50.1000
1z4nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8986 107 216 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8981 92 218 3.40.50.1000
4gibB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8929 91 228 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W0LGB6-F1-model_v4 HAD family phosphatase 0.9729 2 220 GO:0003824
AF-A0A7V8XR71-F1-model_v4 HAD family phosphatase 0.9708 1 220 GO:0050308
AF-A0A1V5N647-F1-model_v4 Phosphorylated carbohydrates phosphatase (EC 3.1.3.-) 0.9664 1 226 GO:0016787
AF-A0A7W0LGB6-F1-model_v4 HAD family phosphatase 0.9641 2 220 GO:0003824
AF-A0A349URM1-F1-model_v4 HAD family hydrolase 0.9634 2 221 GO:0050308

Map