F483027

General Info

Members Datasets Scaffolds Average Seq Length
839 341 1678 254

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0000319|Ga0495607_0000319_17510_18343
Length 277
Sequence MEVRQQAALPGALKEHAMNDTTIYCGIPNRFKRDLREGKLQIGCWSSLASPLSTEILGLAGFDWLMLDGEHSPNDLTSFIQQLMALKDSVSAPVVRPQSNDMVQIKRLLDAGFYNFLIPFVESAEEAARAVAATRYPPDGARGVSLSMRGNRYGTVPDYHRISNQNVVVAVQIESPKGVDNIEAICAVDGVDAIFIGPSDLAAGFGRLGDPGHPEIQGAIQRVFGAAKTAGVPFGILAPAEDDARRYMKMGATMVAVGSDQGLFRGATQSLRDKFAA

Samples

Sample ID Description Type Environment
1 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
74 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
75 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
76 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
250 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
253 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
254 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
257 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
258 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
259 2547132181 Kosakonia sacchari SP1 Isolate Stem
260 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
261 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
262 2561511199 Enterobacter sp. R4-368 Isolate Nodule
263 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
264 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
265 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
266 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
267 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
268 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
269 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
270 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
271 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
272 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
273 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
274 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
275 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
276 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
277 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
278 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
279 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
280 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
281 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
282 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
283 2751185917 Enterobacter sp. HK169 Isolate Unclassified
284 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
285 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
286 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
287 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
288 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
289 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
290 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
291 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
292 2821118458 Enterobacter asburiae 609 Isolate Unclassified
293 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
294 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
295 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
296 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
297 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
298 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
299 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
300 2865014394 Pantoea sp. R-71966 Isolate Unclassified
301 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
302 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
303 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
304 2876601092 Pantoea endophytica 596 Isolate Unclassified
305 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
306 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
307 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
308 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
309 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
310 2904504865 Serratia marcescens 1822 Isolate Unclassified
311 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
312 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
313 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
314 2932406140 Serratia sp. 2723 Isolate Rhizosphere
315 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
316 2937539931 Pantoea sp. LS15 Isolate Unclassified
317 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
318 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
319 2939577877 Serratia sp. 509 Isolate Rhizosphere
320 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
321 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
322 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
323 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
324 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
325 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
326 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
327 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
328 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
329 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
330 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
331 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
332 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
333 8018221730 Enterobacter sp. CM29 Isolate Unclassified
334 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
335 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
336 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
337 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
338 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
339 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
340 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
341 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.75
Metatranscriptomes 0
Isolates 10.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 2.5
Nodule 2.15
Rhizoplane 4.89
Rhizosphere 72.94
Stem 0.12
Stem Tuber 0.72
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495607_0000319 3300046501 Bacteria 50035
2 RicEn_C1845 2010549000 Bacteria 6313
3 SwRhRL2b_contig_2888319 2162886007 Bacteria 3300
4 SwRhRL2b_contig_922063 2162886007 Bacteria 2750
5 JGI24739J22299_10000001 3300001989 Bacteria 99744
6 JGI25152J39213_1000409 3300002773 Bacteria 26002
7 rootH2_10040343 3300003320 Bacteria 17344
8 Ga0058692_1000249 3300003856 Bacteria 29935
9 Ga0058692_1000486 3300003856 Bacteria 17772
10 Ga0058692_1000595 3300003856 Bacteria 15230
11 Ga0058692_1000599 3300003856 Bacteria 15154
12 Ga0058692_1001060 3300003856 Bacteria 10764
13 Ga0058692_1001128 3300003856 Bacteria 10343
14 Ga0058692_1002378 3300003856 Bacteria 6323
15 Ga0058692_1008919 3300003856 Bacteria 2564
16 Ga0058692_1034327 3300003856 Bacteria 932
17 Ga0058692_1034348 3300003856 Bacteria 932
18 Ga0065165_1003438 3300005262 Bacteria 11129
19 Ga0065704_10000814 3300005289 Bacteria 12119
20 Ga0065704_10000919 3300005289 Bacteria 10903
21 Ga0065704_10002360 3300005289 Bacteria 13852
22 Ga0065704_10081576 3300005289 Bacteria 3735
23 Ga0070658_10026859 3300005327 Bacteria 4622
24 Ga0070658_10169195 3300005327 Bacteria 1836
25 Ga0070676_10006595 3300005328 Bacteria 6207
26 Ga0070690_100028963 3300005330 Bacteria 3432
27 Ga0070670_100159472 3300005331 Bacteria 1955
28 Ga0070670_100229980 3300005331 Bacteria 1614
29 Ga0070677_10131155 3300005333 Bacteria 1144
30 Ga0068869_100091142 3300005334 Bacteria 2292
31 Ga0070666_10001342 3300005335 Bacteria 14927
32 Ga0070666_10049807 3300005335 Bacteria 2816
33 Ga0068868_100183270 3300005338 Bacteria 1738
34 Ga0068868_100543585 3300005338 Bacteria 1023
35 Ga0070660_100265379 3300005339 Bacteria 1402
36 Ga0070668_100000561 3300005347 Bacteria 24824
37 Ga0070668_100005676 3300005347 Bacteria 9250
38 Ga0070668_100278470 3300005347 Bacteria 1396
39 Ga0070669_100008965 3300005353 Bacteria 7140
40 Ga0070671_100008011 3300005355 Bacteria 8456
41 Ga0070674_100079190 3300005356 Bacteria 2343
42 Ga0070673_100206492 3300005364 Bacteria 1694
43 Ga0070659_100420588 3300005366 Bacteria 1130
44 Ga0070667_100013076 3300005367 Bacteria 6860
45 Ga0070667_100017549 3300005367 Bacteria 5932
46 Ga0070667_100316446 3300005367 Bacteria 1408
47 Ga0070700_100043085 3300005441 Bacteria 2775
48 Ga0070678_100013453 3300005456 Bacteria 5131
49 Ga0070662_100018152 3300005457 Bacteria 4755
50 Ga0068867_100002855 3300005459 Bacteria 12149
51 Ga0068867_100123631 3300005459 Bacteria 2003
52 Ga0070672_100016710 3300005543 Bacteria 5260
53 Ga0070672_100052400 3300005543 Bacteria 3185
54 Ga0070665_100000743 3300005548 Bacteria 43398
55 Ga0070665_100027871 3300005548 Bacteria 5688
56 Ga0070665_100261104 3300005548 Bacteria 1733
57 Ga0068855_100041605 3300005563 Bacteria 5446
58 Ga0068857_100000067 3300005577 Bacteria 58903
59 Ga0068852_100290016 3300005616 Bacteria 1580
60 Ga0068864_100107680 3300005618 Bacteria 2479
61 Ga0068861_100013043 3300005719 Bacteria 5811
62 Ga0068851_10023381 3300005834 Bacteria 3020
63 Ga0068863_100036313 3300005841 Bacteria 4694
64 Ga0068858_100024788 3300005842 Bacteria 5586
65 Ga0068858_100103339 3300005842 Bacteria 2658
66 Ga0068862_100072878 3300005844 Bacteria 2967
67 Ga0081538_10080928 3300005981 Bacteria 1730
68 Ga0075365_10005166 3300006038 Bacteria 7017
69 Ga0075364_10012505 3300006051 Bacteria 5195
70 Ga0075364_10027764 3300006051 Bacteria 3618
71 Ga0075366_10031034 3300006195 Bacteria 3144
72 Ga0075366_10049300 3300006195 Bacteria 2499
73 Ga0075434_100128665 3300006871 Bacteria 2550
74 Ga0068865_100014203 3300006881 Bacteria 5055
75 Ga0079104_1000495 3300006946 Bacteria 42708
76 Ga0079104_1000655 3300006946 Bacteria 33091
77 Ga0079104_1001059 3300006946 Bacteria 20805
78 Ga0079104_1001504 3300006946 Bacteria 15481
79 Ga0079104_1001641 3300006946 Bacteria 14502
80 Ga0079104_1001726 3300006946 Bacteria 13922
81 Ga0079104_1005852 3300006946 Bacteria 4801
82 Ga0079104_1010394 3300006946 Bacteria 3070
83 Ga0105251_10000722 3300009011 Bacteria 30473
84 Ga0105251_10001434 3300009011 Bacteria 20536
85 Ga0105251_10001545 3300009011 Bacteria 19750
86 Ga0105251_10002234 3300009011 Bacteria 15443
87 Ga0105251_10005461 3300009011 Bacteria 8295
88 Ga0105251_10022052 3300009011 Bacteria 3315
89 Ga0105251_10025717 3300009011 Bacteria 3007
90 Ga0105251_10030042 3300009011 Bacteria 2732
91 Ga0105251_10032249 3300009011 Bacteria 2613
92 Ga0105251_10035801 3300009011 Bacteria 2446
93 Ga0105244_10000033 3300009036 Bacteria 172219
94 Ga0105244_10000371 3300009036 Bacteria 41651
95 Ga0105244_10002356 3300009036 Bacteria 14345
96 Ga0105244_10002669 3300009036 Bacteria 13351
97 Ga0105244_10004051 3300009036 Bacteria 10233
98 Ga0105244_10004939 3300009036 Bacteria 9017
99 Ga0105244_10010000 3300009036 Bacteria 5779
100 Ga0105244_10020465 3300009036 Bacteria 3675
101 Ga0105244_10028439 3300009036 Bacteria 2997
102 Ga0105244_10040059 3300009036 Bacteria 2435
103 Ga0105244_10062091 3300009036 Bacteria 1879
104 Ga0105244_10200446 3300009036 Bacteria 941
105 Ga0105250_10000042 3300009092 Bacteria 130495
106 Ga0105250_10000171 3300009092 Bacteria 56587
107 Ga0105250_10000367 3300009092 Bacteria 33714
108 Ga0105250_10000602 3300009092 Bacteria 23453
109 Ga0105250_10003171 3300009092 Bacteria 7866
110 Ga0105250_10003650 3300009092 Bacteria 7244
111 Ga0105250_10004305 3300009092 Bacteria 6573
112 Ga0105250_10005392 3300009092 Bacteria 5741
113 Ga0105250_10011656 3300009092 Bacteria 3645
114 Ga0105250_10029973 3300009092 Bacteria 2188
115 Ga0105240_10507222 3300009093 Bacteria 1340
116 Ga0105245_10113487 3300009098 Bacteria 2523
117 Ga0105247_10000211 3300009101 Bacteria 56646
118 Ga0105247_10435804 3300009101 Bacteria 942
119 Ga0105243_10050485 3300009148 Bacteria 3286
120 Ga0105243_10057566 3300009148 Bacteria 3095
121 Ga0105243_10401893 3300009148 Bacteria 1273
122 Ga0105243_10487240 3300009148 Bacteria 1165
123 Ga0105241_10531192 3300009174 Bacteria 1053
124 Ga0105248_10009287 3300009177 Bacteria 10828
125 Ga0105248_10069967 3300009177 Bacteria 3941
126 Ga0105249_10021079 3300009553 Bacteria 5832
127 Ga0105249_10328817 3300009553 Bacteria 1542
128 Ga0105246_10011239 3300011119 Bacteria 5553
129 Ga0105246_10132678 3300011119 Bacteria 1862
130 Ga0157373_10007352 3300013100 Bacteria 8199
131 Ga0157373_10018632 3300013100 Bacteria 5052
132 Ga0157371_10000778 3300013102 Bacteria 36656
133 Ga0157371_10009635 3300013102 Bacteria 7596
134 Ga0157371_10025580 3300013102 Bacteria 4299
135 Ga0157371_10039445 3300013102 Bacteria 3376
136 Ga0157370_10000656 3300013104 Bacteria 43041
137 Ga0157370_10047674 3300013104 Bacteria 4107
138 Ga0157369_10000859 3300013105 Bacteria 38720
139 Ga0157369_10015721 3300013105 Bacteria 8528
140 Ga0157374_10153417 3300013296 Bacteria 2241
141 Ga0163162_10076147 3300013306 Bacteria 3417
142 Ga0163162_10123714 3300013306 Bacteria 2692
143 Ga0157372_10001196 3300013307 Bacteria 28069
144 Ga0157372_10022056 3300013307 Bacteria 6886
145 Ga0157372_10044827 3300013307 Bacteria 4902
146 Ga0157372_10081055 3300013307 Bacteria 3673
147 Ga0157372_10154346 3300013307 Bacteria 2651
148 Ga0157372_10359464 3300013307 Bacteria 1696
149 Ga0157372_10537038 3300013307 Bacteria 1363
150 Ga0157375_10015708 3300013308 Bacteria 6783
151 Ga0157375_10025372 3300013308 Bacteria 5506
152 Ga0157380_10001789 3300014326 Bacteria 14180
153 Ga0182008_10010160 3300014497 Bacteria 5045
154 Ga0157379_10020433 3300014968 Bacteria 5855
155 Ga0157379_10131248 3300014968 Bacteria 2255
156 Ga0157376_10829319 3300014969 Bacteria 939
157 Ga0182006_1000422 3300015261 Bacteria 33862
158 Ga0182007_10007375 3300015262 Bacteria 4619
159 Ga0183366_1002 3300015679 Bacteria 791639
160 Ga0183370_1002 3300015680 Bacteria 791639
161 Ga0183369_1002 3300015685 Bacteria 791621
162 Ga0183368_1005 3300015687 Bacteria 791621
163 Ga0163161_10000002 3300017792 Bacteria 411983
164 Ga0163161_10027894 3300017792 Bacteria 4006
165 Ga0163161_10047476 3300017792 Bacteria 3100
166 Ga0213872_10005750 3300021361 Bacteria 6307
167 Ga0213876_10000013 3300021384 Bacteria 342052
168 Ga0209437_100110 3300025233 Bacteria 215040
169 Ga0207425_1014300 3300025245 Bacteria 1805
170 Ga0209129_1000010 3300025258 Bacteria 583357
171 Ga0207696_1000009 3300025711 Bacteria 564405
172 Ga0207696_1000027 3300025711 Bacteria 412783
173 Ga0207696_1000102 3300025711 Bacteria 167962
174 Ga0207696_1000137 3300025711 Bacteria 127683
175 Ga0207696_1000187 3300025711 Bacteria 96247
176 Ga0207696_1000370 3300025711 Bacteria 44507
177 Ga0207696_1000821 3300025711 Bacteria 19936
178 Ga0207696_1001415 3300025711 Bacteria 13102
179 Ga0207696_1003814 3300025711 Bacteria 6710
180 Ga0207696_1004753 3300025711 Bacteria 5781
181 Ga0207696_1020121 3300025711 Bacteria 2158
182 Ga0207696_1033400 3300025711 Bacteria 1542
183 Ga0207655_1000065 3300025728 Bacteria 252767
184 Ga0207655_1000072 3300025728 Bacteria 236536
185 Ga0207655_1000420 3300025728 Bacteria 57789
186 Ga0207655_1000956 3300025728 Bacteria 29855
187 Ga0207655_1001886 3300025728 Bacteria 18010
188 Ga0207655_1003099 3300025728 Bacteria 12638
189 Ga0207655_1003508 3300025728 Bacteria 11631
190 Ga0207655_1007400 3300025728 Bacteria 7123
191 Ga0207655_1010206 3300025728 Bacteria 5721
192 Ga0207655_1016419 3300025728 Bacteria 4048
193 Ga0207655_1025168 3300025728 Bacteria 2896
194 Ga0207655_1029009 3300025728 Bacteria 2599
195 Ga0207655_1044730 3300025728 Bacteria 1857
196 Ga0207655_1046582 3300025728 Bacteria 1799
197 Ga0207713_1000019 3300025735 Bacteria 361225
198 Ga0207713_1000028 3300025735 Bacteria 309074
199 Ga0207713_1000123 3300025735 Bacteria 122033
200 Ga0207713_1006467 3300025735 Bacteria 7134
201 Ga0207713_1012019 3300025735 Bacteria 4661
202 Ga0207713_1012900 3300025735 Bacteria 4437
203 Ga0207713_1019869 3300025735 Bacteria 3272
204 Ga0207713_1020555 3300025735 Bacteria 3194
205 Ga0207713_1028749 3300025735 Bacteria 2502
206 Ga0207710_10000061 3300025900 Bacteria 166665
207 Ga0207645_10000932 3300025907 Bacteria 24250
208 Ga0207705_10082462 3300025909 Bacteria 2345
209 Ga0207705_10309718 3300025909 Bacteria 1212
210 Ga0207662_10027962 3300025918 Bacteria 3257
211 Ga0207657_10016871 3300025919 Bacteria 7027
212 Ga0207681_10005730 3300025923 Bacteria 7618
213 Ga0207650_10101992 3300025925 Bacteria 2210
214 Ga0207687_10023855 3300025927 Bacteria 4081
215 Ga0207644_10002979 3300025931 Bacteria 10904
216 Ga0207706_10021564 3300025933 Bacteria 5783
217 Ga0207706_10062660 3300025933 Bacteria 3274
218 Ga0207706_10064256 3300025933 Bacteria 3231
219 Ga0207709_10029334 3300025935 Bacteria 3190
220 Ga0207709_10245176 3300025935 Bacteria 1305
221 Ga0207669_10033114 3300025937 Bacteria 2912
222 Ga0207691_10012375 3300025940 Bacteria 8178
223 Ga0207691_10036077 3300025940 Bacteria 4582
224 Ga0207711_10012730 3300025941 Bacteria 6986
225 Ga0207711_10047402 3300025941 Bacteria 3673
226 Ga0207689_10013142 3300025942 Bacteria 7065
227 Ga0207667_10002798 3300025949 Bacteria 21602
228 Ga0207651_10016613 3300025960 Bacteria 4318
229 Ga0207651_10360365 3300025960 Bacteria 1227
230 Ga0207651_10608885 3300025960 Bacteria 955
231 Ga0207712_10002594 3300025961 Bacteria 11603
232 Ga0207668_10018596 3300025972 Bacteria 4377
233 Ga0207658_10015270 3300025986 Bacteria 5269
234 Ga0207658_10055068 3300025986 Bacteria 2945
235 Ga0207658_10080670 3300025986 Bacteria 2493
236 Ga0207677_10013173 3300026023 Bacteria 4782
237 Ga0207677_10062014 3300026023 Bacteria 2592
238 Ga0207703_10010862 3300026035 Bacteria 7100
239 Ga0207708_10022289 3300026075 Bacteria 4782
240 Ga0207641_10005423 3300026088 Bacteria 10888
241 Ga0207648_10012092 3300026089 Bacteria 8095
242 Ga0207648_10046257 3300026089 Bacteria 3815
243 Ga0207674_10004150 3300026116 Bacteria 17517
244 Ga0207675_100011212 3300026118 Bacteria 8394
245 Ga0207675_100259360 3300026118 Bacteria 1684
246 Ga0207683_10009534 3300026121 Bacteria 8274
247 Ga0207683_10038389 3300026121 Bacteria 4174
248 Ga0209281_1000025 3300027111 Bacteria 488275
249 Ga0209281_1000089 3300027111 Bacteria 243650
250 Ga0209281_1000105 3300027111 Bacteria 220052
251 Ga0209281_1000559 3300027111 Bacteria 45161
252 Ga0209281_1000768 3300027111 Bacteria 30641
253 Ga0209281_1001450 3300027111 Bacteria 13935
254 Ga0209281_1002003 3300027111 Bacteria 9302
255 Ga0209281_1002943 3300027111 Bacteria 6125
256 Ga0209281_1003785 3300027111 Bacteria 4809
257 Ga0209371_1000010 3300027312 Bacteria 922021
258 Ga0209371_1000013 3300027312 Bacteria 691516
259 Ga0209371_1000019 3300027312 Bacteria 583561
260 Ga0209371_1000126 3300027312 Bacteria 127214
261 Ga0209371_1000149 3300027312 Bacteria 110455
262 Ga0209371_1000254 3300027312 Bacteria 64787
263 Ga0209371_1000335 3300027312 Bacteria 51288
264 Ga0209371_1000718 3300027312 Bacteria 27957
265 Ga0209371_1000795 3300027312 Bacteria 26072
266 Ga0209371_1001352 3300027312 Bacteria 16987
267 Ga0209371_1001485 3300027312 Bacteria 15666
268 Ga0209371_1001753 3300027312 Bacteria 13656
269 Ga0209371_1002033 3300027312 Bacteria 12097
270 Ga0209371_1002452 3300027312 Bacteria 10346
271 Ga0209371_1003488 3300027312 Bacteria 7601
272 Ga0209371_1008461 3300027312 Bacteria 3417
273 Ga0209371_1008697 3300027312 Bacteria 3328
274 Ga0209371_1014225 3300027312 Bacteria 2191
275 Ga0209371_1016172 3300027312 Bacteria 1977
276 Ga0268266_10000041 3300028379 Bacteria 322311
277 Ga0268266_10035813 3300028379 Bacteria 4221
278 Ga0268266_10064513 3300028379 Bacteria 3164
279 Ga0268265_10253636 3300028380 Bacteria 1560
280 Ga0268264_10001710 3300028381 Bacteria 20233
281 Ga0265338_10223382 3300028800 Bacteria 1405
282 Ga0268256_1000014 3300030500 Bacteria 691435
283 Ga0268256_1000022 3300030500 Bacteria 531115
284 Ga0268256_1000024 3300030500 Bacteria 488637
285 Ga0268256_1000105 3300030500 Bacteria 126344
286 Ga0268256_1000110 3300030500 Bacteria 119426
287 Ga0268256_1000559 3300030500 Bacteria 30224
288 Ga0268256_1000635 3300030500 Bacteria 27069
289 Ga0268256_1000709 3300030500 Bacteria 24859
290 Ga0268256_1000767 3300030500 Bacteria 23409
291 Ga0268256_1001840 3300030500 Bacteria 11849
292 Ga0268256_1002442 3300030500 Bacteria 9486
293 Ga0268256_1003121 3300030500 Bacteria 7721
294 Ga0268256_1005368 3300030500 Bacteria 5038
295 Ga0268256_1008638 3300030500 Bacteria 3467
296 Ga0268256_1008694 3300030500 Bacteria 3454
297 Ga0268256_1009783 3300030500 Bacteria 3147
298 Ga0268256_1015768 3300030500 Bacteria 2191
299 Ga0268256_1016253 3300030500 Bacteria 2140
300 Ga0316183_1053585 3300030742 Bacteria 1079
301 Ga0307413_10298248 3300031824 Bacteria 1221
302 Ga0307416_100607667 3300032002 Bacteria 1174
303 Ga0307416_100706520 3300032002 Bacteria 1098
304 Ga0395899_0043099 3300037312 Bacteria 3366
305 Ga0395899_0149998 3300037312 Bacteria 1653
306 Ga0395901_0153598 3300038443 Bacteria 2418
307 Ga0436365_0471682 3300039437 Bacteria 352256
308 Ga0436361_0995447 3300039447 Bacteria 133902
309 Ga0439438_000059 3300041405 Bacteria 51384
310 Ga0439438_007349 3300041405 Bacteria 3773
311 Ga0439438_020412 3300041405 Bacteria 1859
312 Ga0439438_024994 3300041405 Bacteria 1631
313 Ga0439447_000863 3300041407 Bacteria 11130
314 Ga0439447_005242 3300041407 Bacteria 4329
315 Ga0439447_006174 3300041407 Bacteria 3911
316 Ga0439466_0000004 3300041411 Bacteria 462654
317 Ga0451853_2456147 3300041512 Bacteria 5603
318 Ga0439448_0006624 3300042005 Bacteria 3335
319 Ga0439432_003141 3300042006 Bacteria 6142
320 Ga0439432_004840 3300042006 Bacteria 4882
321 Ga0439449_0072347 3300042007 Bacteria 1270
322 Ga0439450_009891 3300042008 Bacteria 1824
323 Ga0439452_000006 3300042010 Bacteria 645083
324 Ga0439452_000009 3300042010 Bacteria 569493
325 Ga0439452_000011 3300042010 Bacteria 428451
326 Ga0439452_000272 3300042010 Bacteria 34192
327 Ga0439452_003757 3300042010 Bacteria 5229
328 Ga0439463_005230 3300042016 Bacteria 3226
329 Ga0450907_000024 3300042146 Bacteria 73273
330 Ga0439464_0001001 3300042439 Bacteria 6430
331 Ga0439464_0053990 3300042439 Bacteria 1167
332 Ga0466981_0000001 3300044669 Bacteria 367980
333 Ga0466965_0007746 3300044683 Bacteria 4942
334 Ga0466966_0019529 3300044684 Bacteria 4458
335 Ga0466971_0051382 3300044719 Bacteria 1855
336 Ga0466959_0182467 3300045049 Bacteria 1467
337 Ga0451576_0030242 3300045051 Bacteria 5791
338 Ga0466958_0174061 3300045836 Bacteria 1364
339 Ga0466967_0513746 3300045976 Bacteria 1177
340 Ga0495617_000002 3300046452 Bacteria 710121
341 Ga0495617_000362 3300046452 Bacteria 25053
342 Ga0495617_069510 3300046452 Bacteria 1158
343 Ga0495627_000111 3300046453 Bacteria 101652
344 Ga0495627_000344 3300046453 Bacteria 43801
345 Ga0495627_022241 3300046453 Bacteria 2088
346 Ga0495603_0014885 3300046455 Bacteria 4705
347 Ga0495603_0136129 3300046455 Bacteria 1429
348 Ga0495590_0000007 3300046457 Bacteria 331108
349 Ga0495590_0042440 3300046457 Bacteria 1585
350 Ga0495590_0088393 3300046457 Bacteria 1095
351 Ga0495591_000045 3300046458 Bacteria 145091
352 Ga0495591_000062 3300046458 Bacteria 124615
353 Ga0495591_020797 3300046458 Bacteria 2158
354 Ga0495591_026163 3300046458 Bacteria 1818
355 Ga0495629_0019494 3300046459 Bacteria 4844
356 Ga0495629_0047544 3300046459 Bacteria 3010
357 Ga0495638_0004537 3300046460 Bacteria 10516
358 Ga0495653_0013262 3300046463 Bacteria 6719
359 Ga0495653_0141892 3300046463 Bacteria 1688
360 Ga0495650_0000008 3300046471 Bacteria 688246
361 Ga0495650_0000040 3300046471 Bacteria 366254
362 Ga0495650_0019534 3300046471 Bacteria 3330
363 Ga0495580_0069933 3300046472 Bacteria 2452
364 Ga0495582_0023795 3300046473 Bacteria 3348
365 Ga0495605_0000092 3300046474 Bacteria 115315
366 Ga0495605_0003289 3300046474 Bacteria 9687
367 Ga0495605_0013027 3300046474 Bacteria 4597
368 Ga0495605_0111993 3300046474 Bacteria 1244
369 Ga0495605_0112845 3300046474 Bacteria 1238
370 Ga0495584_0000007 3300046491 Bacteria 294820
371 Ga0495584_0000238 3300046491 Bacteria 39636
372 Ga0495584_0013955 3300046491 Bacteria 4093
373 Ga0495584_0020413 3300046491 Bacteria 3366
374 Ga0495584_0094690 3300046491 Bacteria 1507
375 Ga0495584_0102855 3300046491 Bacteria 1444
376 Ga0495584_0248369 3300046491 Bacteria 904
377 Ga0495585_0000090 3300046492 Bacteria 95790
378 Ga0495585_0000812 3300046492 Bacteria 27226
379 Ga0495585_0003197 3300046492 Bacteria 11187
380 Ga0495585_0013108 3300046492 Bacteria 4860
381 Ga0495585_0019777 3300046492 Bacteria 3878
382 Ga0495585_0028690 3300046492 Bacteria 3172
383 Ga0495585_0030105 3300046492 Bacteria 3088
384 Ga0495585_0088314 3300046492 Bacteria 1672
385 Ga0495585_0095011 3300046492 Bacteria 1601
386 Ga0495585_0152042 3300046492 Bacteria 1206
387 Ga0495585_0170495 3300046492 Bacteria 1124
388 Ga0495594_0137780 3300046499 Bacteria 1383
389 Ga0495594_0138380 3300046499 Bacteria 1380
390 Ga0495596_0001144 3300046500 Bacteria 15594
391 Ga0495596_0003412 3300046500 Bacteria 8056
392 Ga0495596_0004492 3300046500 Bacteria 6779
393 Ga0495596_0004525 3300046500 Bacteria 6758
394 Ga0495596_0010126 3300046500 Bacteria 4120
395 Ga0495596_0011749 3300046500 Bacteria 3761
396 Ga0495596_0054090 3300046500 Bacteria 1570
397 Ga0495607_0000811 3300046501 Bacteria 29602
398 Ga0495607_0000887 3300046501 Bacteria 27907
399 Ga0495607_0002622 3300046501 Bacteria 14447
400 Ga0495607_0032797 3300046501 Bacteria 3166
401 Ga0495607_0049037 3300046501 Bacteria 2465
402 Ga0495607_0094901 3300046501 Bacteria 1608
403 Ga0495607_0210408 3300046501 Bacteria 957
404 Ga0495583_0000075 3300046506 Bacteria 177074
405 Ga0495583_0000302 3300046506 Bacteria 78475
406 Ga0495583_0000462 3300046506 Bacteria 60161
407 Ga0495583_0000520 3300046506 Bacteria 54664
408 Ga0495583_0050584 3300046506 Bacteria 1898
409 Ga0495583_0114721 3300046506 Bacteria 1139
410 Ga0495606_0001700 3300046507 Bacteria 28418
411 Ga0495606_0022090 3300046507 Bacteria 4647
412 Ga0495606_0051953 3300046507 Bacteria 2669
413 Ga0495606_0073446 3300046507 Bacteria 2146
414 Ga0495610_0007411 3300046512 Bacteria 7309
415 Ga0495616_0000171 3300046513 Bacteria 55006
416 Ga0495616_0000241 3300046513 Bacteria 44479
417 Ga0495616_0001157 3300046513 Bacteria 18664
418 Ga0495616_0012785 3300046513 Bacteria 4751
419 Ga0495616_0021816 3300046513 Bacteria 3463
420 Ga0495616_0033345 3300046513 Bacteria 2684
421 Ga0495616_0051445 3300046513 Bacteria 2054
422 Ga0495616_0112099 3300046513 Bacteria 1266
423 Ga0495620_0013112 3300046515 Bacteria 4254
424 Ga0495620_0026872 3300046515 Bacteria 2701
425 Ga0495630_0183705 3300046517 Bacteria 1595
426 Ga0495631_0003035 3300046518 Bacteria 9278
427 Ga0495631_0010395 3300046518 Bacteria 4606
428 Ga0495631_0014348 3300046518 Bacteria 3826
429 Ga0495631_0081636 3300046518 Bacteria 1394
430 Ga0495631_0132559 3300046518 Bacteria 1070
431 Ga0495632_0000068 3300046519 Bacteria 108872
432 Ga0495632_0000768 3300046519 Bacteria 28760
433 Ga0495632_0001646 3300046519 Bacteria 18311
434 Ga0495632_0004545 3300046519 Bacteria 9402
435 Ga0495632_0007063 3300046519 Bacteria 7114
436 Ga0495632_0025534 3300046519 Bacteria 3123
437 Ga0495637_0000019 3300046520 Bacteria 185953
438 Ga0495637_0045269 3300046520 Bacteria 1868
439 Ga0495637_0101186 3300046520 Bacteria 1125
440 Ga0495643_0002408 3300046522 Bacteria 14881
441 Ga0495643_0005881 3300046522 Bacteria 8203
442 Ga0495643_0026600 3300046522 Bacteria 3262
443 Ga0495643_0072042 3300046522 Bacteria 1813
444 Ga0495643_0197885 3300046522 Bacteria 966
445 Ga0495644_0000354 3300046523 Bacteria 20756
446 Ga0495644_0006372 3300046523 Bacteria 4578
447 Ga0495644_0047395 3300046523 Bacteria 1614
448 Ga0495644_0050621 3300046523 Bacteria 1559
449 Ga0495648_0000091 3300046524 Bacteria 113822
450 Ga0495648_0000193 3300046524 Bacteria 70395
451 Ga0495648_0000934 3300046524 Bacteria 30369
452 Ga0495648_0001612 3300046524 Bacteria 21954
453 Ga0495648_0029763 3300046524 Bacteria 3619
454 Ga0495648_0084608 3300046524 Bacteria 1794
455 Ga0495666_0000511 3300046526 Bacteria 17250
456 Ga0495666_0007365 3300046526 Bacteria 5516
457 Ga0495642_0000217 3300046528 Bacteria 33101
458 Ga0495642_0003097 3300046528 Bacteria 6603
459 Ga0495642_0007047 3300046528 Bacteria 4314
460 Ga0495642_0008426 3300046528 Bacteria 3946
461 Ga0495642_0014656 3300046528 Bacteria 3040
462 Ga0495654_0000073 3300046530 Bacteria 115044
463 Ga0495654_0000171 3300046530 Bacteria 63960
464 Ga0495654_0125259 3300046530 Bacteria 1158
465 Ga0495665_0008709 3300046531 Bacteria 5508
466 Ga0495665_0046155 3300046531 Bacteria 2314
467 Ga0495640_0034754 3300046533 Bacteria 3570
468 Ga0495640_0171574 3300046533 Bacteria 1386
469 Ga0495586_0015955 3300046535 Bacteria 3996
470 Ga0495587_0093649 3300046536 Bacteria 1734
471 Ga0495609_0000716 3300046538 Bacteria 25241
472 Ga0495609_0022169 3300046538 Bacteria 2927
473 Ga0495609_0085952 3300046538 Bacteria 1371
474 Ga0495609_0093881 3300046538 Bacteria 1303
475 Ga0495609_0126713 3300046538 Bacteria 1095
476 Ga0495597_0000738 3300046542 Bacteria 26102
477 Ga0495597_0001122 3300046542 Bacteria 20254
478 Ga0495597_0001580 3300046542 Bacteria 16010
479 Ga0495597_0009125 3300046542 Bacteria 4923
480 Ga0495622_0003617 3300046557 Bacteria 7257
481 Ga0495622_0175168 3300046557 Bacteria 963
482 Ga0495633_0010347 3300046558 Bacteria 5096
483 Ga0495633_0020436 3300046558 Bacteria 3330
484 Ga0495633_0036783 3300046558 Bacteria 2344
485 Ga0495633_0094860 3300046558 Bacteria 1386
486 Ga0495656_0032664 3300046615 Bacteria 2119
487 Ga0495668_0000139 3300046616 Bacteria 109589
488 Ga0495668_0000975 3300046616 Bacteria 31474
489 Ga0495668_0138976 3300046616 Bacteria 1329
490 Ga0495611_0000295 3300046648 Bacteria 33712
491 Ga0495611_0018440 3300046648 Bacteria 2993
492 Ga0495611_0020696 3300046648 Bacteria 2834
493 Ga0495625_0003007 3300046660 Bacteria 17392
494 Ga0495625_0029671 3300046660 Bacteria 4087
495 Ga0495625_0037354 3300046660 Bacteria 3564
496 Ga0495625_0286500 3300046660 Bacteria 1058
497 Ga0495661_0000495 3300046665 Bacteria 40972
498 Ga0495661_0001229 3300046665 Bacteria 22212
499 Ga0495661_0007744 3300046665 Bacteria 7481
500 Ga0495661_0015501 3300046665 Bacteria 5085
501 Ga0495661_0020745 3300046665 Bacteria 4286
502 Ga0495661_0026067 3300046665 Bacteria 3766
503 Ga0495661_0092152 3300046665 Bacteria 1722
504 Ga0495661_0100969 3300046665 Bacteria 1623
505 Ga0495588_0004154 3300046674 Bacteria 6380
506 Ga0495588_0032101 3300046674 Bacteria 2645
507 Ga0495588_0073701 3300046674 Bacteria 1777
508 Ga0495588_0079904 3300046674 Bacteria 1706
509 Ga0495588_0110247 3300046674 Bacteria 1449
510 Ga0495588_0130522 3300046674 Bacteria 1325
511 Ga0495646_0133826 3300046680 Bacteria 1393
512 Ga0495669_0000423 3300046684 Bacteria 20308
513 Ga0495669_0000945 3300046684 Bacteria 12145
514 Ga0495669_0023680 3300046684 Bacteria 2674
515 Ga0495669_0024049 3300046684 Bacteria 2654
516 Ga0495669_0064568 3300046684 Bacteria 1661
517 Ga0495669_0083928 3300046684 Bacteria 1464
518 Ga0495613_0042447 3300046689 Bacteria 3365
519 Ga0495613_0236864 3300046689 Bacteria 1277
520 Ga0495670_0000504 3300046691 Bacteria 18527
521 Ga0495670_0003055 3300046691 Bacteria 8256
522 Ga0495670_0028623 3300046691 Bacteria 2762
523 Ga0495670_0050843 3300046691 Bacteria 2075
524 Ga0495670_0111209 3300046691 Bacteria 1417
525 Ga0495671_0000067 3300046692 Bacteria 103441
526 Ga0495671_0004592 3300046692 Bacteria 8217
527 Ga0495671_0027165 3300046692 Bacteria 2958
528 Ga0495671_0039870 3300046692 Bacteria 2369
529 Ga0495671_0084105 3300046692 Bacteria 1559
530 Ga0495671_0084450 3300046692 Bacteria 1555
531 Ga0495649_0000196 3300046694 Bacteria 53380
532 Ga0495649_0000862 3300046694 Bacteria 24390
533 Ga0495649_0001555 3300046694 Bacteria 17215
534 Ga0495649_0075753 3300046694 Bacteria 1801
535 Ga0495589_0000079 3300046794 Bacteria 89713
536 Ga0495589_0003250 3300046794 Bacteria 8858
537 Ga0495589_0007544 3300046794 Bacteria 5699
538 Ga0495589_0012110 3300046794 Bacteria 4472
539 Ga0495589_0020685 3300046794 Bacteria 3364
540 Ga0495589_0021565 3300046794 Bacteria 3291
541 Ga0495589_0064421 3300046794 Bacteria 1797
542 Ga0495589_0116676 3300046794 Bacteria 1286
543 Ga0495600_0029880 3300046809 Bacteria 3529
544 Ga0495660_0000019 3300046810 Bacteria 311047
545 Ga0495660_0008204 3300046810 Bacteria 6122
546 Ga0495660_0011483 3300046810 Bacteria 5138
547 Ga0495660_0077996 3300046810 Bacteria 1742
548 Ga0495581_0001697 3300047315 Bacteria 12261
549 Ga0495581_0211700 3300047315 Bacteria 1133
550 Ga0495604_0018117 3300047317 Bacteria 5637
551 Ga0495604_0068660 3300047317 Bacteria 2689
552 Ga0495604_0187737 3300047317 Bacteria 1442
553 Ga0495672_0000003 3300047320 Bacteria 728845
554 Ga0495672_0000025 3300047320 Bacteria 365425
555 Ga0495672_0000041 3300047320 Bacteria 267545
556 Ga0495672_0000362 3300047320 Bacteria 58046
557 Ga0495676_0000092 3300047321 Bacteria 66361
558 Ga0495676_0287904 3300047321 Bacteria 1111
559 Ga0495680_0001486 3300047322 Bacteria 25240
560 Ga0495683_0008503 3300047323 Bacteria 5489
561 Ga0495683_0015048 3300047323 Bacteria 4029
562 Ga0495683_0023499 3300047323 Bacteria 3168
563 Ga0495683_0118418 3300047323 Bacteria 1259
564 Ga0495687_000133 3300047443 Bacteria 113757
565 Ga0495687_000537 3300047443 Bacteria 45261
566 Ga0495687_054822 3300047443 Bacteria 1670
567 Ga0495675_0159493 3300047444 Bacteria 1389
568 Ga0495677_0000304 3300047445 Bacteria 21356
569 Ga0495677_0003623 3300047445 Bacteria 5987
570 Ga0495677_0022004 3300047445 Bacteria 2310
571 Ga0495679_000125 3300047446 Bacteria 68330
572 Ga0495679_000813 3300047446 Bacteria 19820
573 Ga0495679_014746 3300047446 Bacteria 2882
574 Ga0495679_026229 3300047446 Bacteria 1937
575 Ga0495679_033633 3300047446 Bacteria 1636
576 Ga0495679_035330 3300047446 Bacteria 1584
577 Ga0495685_004310 3300047447 Bacteria 4589
578 Ga0495673_0000011 3300047469 Bacteria 674140
579 Ga0495673_0000055 3300047469 Bacteria 247894
580 Ga0495681_0000057 3300047470 Bacteria 103340
581 Ga0495681_0001196 3300047470 Bacteria 19735
582 Ga0495681_0001604 3300047470 Bacteria 16823
583 Ga0495681_0029171 3300047470 Bacteria 2827
584 Ga0495681_0077306 3300047470 Bacteria 1494
585 Ga0495686_0000479 3300047472 Bacteria 59585
586 Ga0495686_0098527 3300047472 Bacteria 1766
587 Ga0495686_0123956 3300047472 Bacteria 1537
588 Ga0495593_0006097 3300047673 Bacteria 7090
589 Ga0495602_0092282 3300048088 Bacteria 2509
590 Ga0495602_0201934 3300048088 Bacteria 1516
591 Ga0495614_0001353 3300048089 Bacteria 10580
592 Ga0495626_0001302 3300048091 Bacteria 20364
593 Ga0495626_0005515 3300048091 Bacteria 7371
594 Ga0495626_0005730 3300048091 Bacteria 7176
595 Ga0495626_0007600 3300048091 Bacteria 6011
596 Ga0495626_0019271 3300048091 Bacteria 3413
597 Ga0495626_0036348 3300048091 Bacteria 2346
598 Ga0495626_0066993 3300048091 Bacteria 1622
599 Ga0495626_0069900 3300048091 Bacteria 1580
600 Ga0495626_0096875 3300048091 Bacteria 1290
601 Ga0495626_0106988 3300048091 Bacteria 1214
602 Ga0495626_0117264 3300048091 Bacteria 1148
603 Ga0496100_0062139 3300048903 Bacteria 2464
604 Ga0496101_0000070 3300048904 Bacteria 120089
605 Ga0496102_0011022 3300048905 Bacteria 7787
606 Ga0496102_0024889 3300048905 Bacteria 5324
607 Ga0496102_0214727 3300048905 Bacteria 1813
608 Ga0496102_0303943 3300048905 Bacteria 1503
609 Ga0496102_0493895 3300048905 Bacteria 1146
610 Ga0496103_0111351 3300048906 Bacteria 1739
611 Ga0496104_0000784 3300048907 Bacteria 27184
612 Ga0496104_0533861 3300048907 Bacteria 1084
613 Ga0496105_0001684 3300048908 Bacteria 15770
614 Ga0496105_0002815 3300048908 Bacteria 12715
615 Ga0496105_0078383 3300048908 Bacteria 2728
616 Ga0496105_0146738 3300048908 Bacteria 1940
617 Ga0496106_0137080 3300048909 Bacteria 1923
618 Ga0496106_0378060 3300048909 Bacteria 1138
619 Ga0496107_0367535 3300048910 Bacteria 1070
620 Ga0496108_0127944 3300048911 Bacteria 2182
621 Ga0496108_0288670 3300048911 Bacteria 1428
622 Ga0496110_0000041 3300048913 Bacteria 62623
623 Ga0496110_0085270 3300048913 Bacteria 2819
624 Ga0496110_0396101 3300048913 Bacteria 1259
625 Ga0496111_0124406 3300048914 Bacteria 1906
626 Ga0496113_0003151 3300048916 Bacteria 9818
627 Ga0496116_0000015 3300048919 Bacteria 560702
628 Ga0496116_0000308 3300048919 Bacteria 82039
629 Ga0496116_0001206 3300048919 Bacteria 30232
630 Ga0496116_0008765 3300048919 Bacteria 8724
631 Ga0496116_0012638 3300048919 Bacteria 6876
632 Ga0496116_0071530 3300048919 Bacteria 2195
633 Ga0496116_0098690 3300048919 Bacteria 1751
634 Ga0496116_0117880 3300048919 Bacteria 1543
635 Ga0496116_0141374 3300048919 Bacteria 1353
636 Ga0496117_0000043 3300048920 Bacteria 309583
637 Ga0496117_0000680 3300048920 Bacteria 54289
638 Ga0496117_0005315 3300048920 Bacteria 13611
639 Ga0496117_0006484 3300048920 Bacteria 11814
640 Ga0496117_0012853 3300048920 Bacteria 7341
641 Ga0496117_0026290 3300048920 Bacteria 4556
642 Ga0496117_0034334 3300048920 Bacteria 3822
643 Ga0496117_0036218 3300048920 Bacteria 3695
644 Ga0496117_0041200 3300048920 Bacteria 3386
645 Ga0496117_0043194 3300048920 Bacteria 3280
646 Ga0496117_0141147 3300048920 Bacteria 1442
647 Ga0496117_0157617 3300048920 Bacteria 1334
648 Ga0496118_0000075 3300048921 Bacteria 196228
649 Ga0496118_0002357 3300048921 Bacteria 25603
650 Ga0496118_0003898 3300048921 Bacteria 18290
651 Ga0496118_0005445 3300048921 Bacteria 14466
652 Ga0496118_0046672 3300048921 Bacteria 3366
653 Ga0496118_0129377 3300048921 Bacteria 1625
654 Ga0496118_0153428 3300048921 Bacteria 1437
655 Ga0496119_0000096 3300048922 Bacteria 129464
656 Ga0496119_0000324 3300048922 Bacteria 67043
657 Ga0496119_0001622 3300048922 Bacteria 26597
658 Ga0496119_0002543 3300048922 Bacteria 19843
659 Ga0496119_0002626 3300048922 Bacteria 19506
660 Ga0496119_0003023 3300048922 Bacteria 17807
661 Ga0496119_0008155 3300048922 Bacteria 9271
662 Ga0496119_0023352 3300048922 Bacteria 4390
663 Ga0496119_0032034 3300048922 Bacteria 3510
664 Ga0496119_0044583 3300048922 Bacteria 2790
665 Ga0496119_0047715 3300048922 Bacteria 2662
666 Ga0496120_0000414 3300048923 Bacteria 68051
667 Ga0496120_0000805 3300048923 Bacteria 45144
668 Ga0496120_0001565 3300048923 Bacteria 26766
669 Ga0496120_0002290 3300048923 Bacteria 19860
670 Ga0496120_0007007 3300048923 Bacteria 8477
671 Ga0496120_0022121 3300048923 Bacteria 4003
672 Ga0496120_0026009 3300048923 Bacteria 3622
673 Ga0496120_0041470 3300048923 Bacteria 2695
674 Ga0496120_0042161 3300048923 Bacteria 2667
675 Ga0496120_0122365 3300048923 Bacteria 1343
676 Ga0496121_0000057 3300048924 Bacteria 294291
677 Ga0496121_0001878 3300048924 Bacteria 33739
678 Ga0496121_0002032 3300048924 Bacteria 32040
679 Ga0496121_0004592 3300048924 Bacteria 18406
680 Ga0496121_0006182 3300048924 Bacteria 15016
681 Ga0496121_0007418 3300048924 Bacteria 13251
682 Ga0496121_0008060 3300048924 Bacteria 12552
683 Ga0496121_0011195 3300048924 Bacteria 9998
684 Ga0496122_0000016 3300048925 Bacteria 443353
685 Ga0496122_0000988 3300048925 Bacteria 50798
686 Ga0496122_0003346 3300048925 Bacteria 21148
687 Ga0496122_0008283 3300048925 Bacteria 11273
688 Ga0496122_0011751 3300048925 Bacteria 8821
689 Ga0496122_0011840 3300048925 Bacteria 8767
690 Ga0496122_0019814 3300048925 Bacteria 6123
691 Ga0496122_0032610 3300048925 Bacteria 4303
692 Ga0496122_0040471 3300048925 Bacteria 3702
693 Ga0496122_0047847 3300048925 Bacteria 3295
694 Ga0496122_0054640 3300048925 Bacteria 2996
695 Ga0496122_0197731 3300048925 Bacteria 1179
696 Ga0496123_0000017 3300048926 Bacteria 415261
697 Ga0496123_0000195 3300048926 Bacteria 123066
698 Ga0496123_0000198 3300048926 Bacteria 122508
699 Ga0496123_0001702 3300048926 Bacteria 29390
700 Ga0496123_0002965 3300048926 Bacteria 19757
701 Ga0496123_0006820 3300048926 Bacteria 10960
702 Ga0496123_0009791 3300048926 Bacteria 8563
703 Ga0496123_0010368 3300048926 Bacteria 8248
704 Ga0496123_0036775 3300048926 Bacteria 3464
705 Ga0496123_0050150 3300048926 Bacteria 2791
706 Ga0496123_0057697 3300048926 Bacteria 2524
707 Ga0496123_0080604 3300048926 Bacteria 1982
708 Ga0496124_0000246 3300048927 Bacteria 104777
709 Ga0496124_0000342 3300048927 Bacteria 85288
710 Ga0496124_0001425 3300048927 Bacteria 35407
711 Ga0496124_0002044 3300048927 Bacteria 27417
712 Ga0496124_0011023 3300048927 Bacteria 9079
713 Ga0496124_0015844 3300048927 Bacteria 7200
714 Ga0496124_0024609 3300048927 Bacteria 5469
715 Ga0496124_0032630 3300048927 Bacteria 4594
716 Ga0496124_0142628 3300048927 Bacteria 1888
717 Ga0496124_0167696 3300048927 Bacteria 1704
718 Ga0496124_0175516 3300048927 Bacteria 1654
719 Ga0496125_0000257 3300048928 Bacteria 109544
720 Ga0496125_0002401 3300048928 Bacteria 24385
721 Ga0496125_0002508 3300048928 Bacteria 23738
722 Ga0496125_0004530 3300048928 Bacteria 15961
723 Ga0496125_0008673 3300048928 Bacteria 10591
724 Ga0496125_0030552 3300048928 Bacteria 4817
725 Ga0496125_0036882 3300048928 Bacteria 4258
726 Ga0496125_0043350 3300048928 Bacteria 3820
727 Ga0496125_0076493 3300048928 Bacteria 2584
728 Ga0496125_0157828 3300048928 Bacteria 1546
729 Ga0496126_0001485 3300048929 Bacteria 36383
730 Ga0496126_0003691 3300048929 Bacteria 19126
731 Ga0496126_0021288 3300048929 Bacteria 6335
732 Ga0496126_0143279 3300048929 Bacteria 2055
733 Ga0496126_0169557 3300048929 Bacteria 1860
734 Ga0496126_0276688 3300048929 Bacteria 1391
735 Ga0496126_0401492 3300048929 Bacteria 1111
736 Ga0495678_000070 3300049459 Bacteria 131437
737 Ga0495678_000105 3300049459 Bacteria 103599
738 Ga0495678_000486 3300049459 Bacteria 39405
739 Ga0495678_030330 3300049459 Bacteria 2264
740 Ga0495682_0000017 3300049460 Bacteria 233333
741 Ga0495682_0000362 3300049460 Bacteria 33117
742 nmdc:mga00v17_182327_c1 3300050491 Bacteria 1355
743 nmdc:mga0k408_10650_c1 3300050493 Bacteria 4978
744 nmdc:mga0k408_73277_c1 3300050493 Bacteria 2000
745 nmdc:mga0n895_225416_c1 3300050512 Bacteria 1902
746 Ga0500618_000081 3300053125 Bacteria 77777
747 Ga0500621_000004 3300053126 Bacteria 485792
748 Ga0500559_0001601 3300053136 Bacteria 12596
749 Ga0500622_0032842 3300053156 Bacteria 2721
750 Ga0500639_007555 3300053163 Bacteria 5647
751 Ga0500576_097623 3300053725 Bacteria 1206
752 Ga0500596_011788 3300053735 Bacteria 1333
753 Ga0466962_0076173 3300061719 Bacteria 1603
754 2511378171 2511231025 Bacteria 5324661
755 2511436696 2511231035 Bacteria 5341610
756 2538427663 2537561728 Bacteria 5149301
757 2547696048 2547132181 Bacteria 4945084
758 2548649987 2547132416 Bacteria 4633861
759 2555258842 2554235234 Bacteria 5762085
760 2562464571 2561511199 Bacteria 5155034
761 2599928827 2599185299 Bacteria 4854625
762 2601534376 2600255256 Bacteria 5597742
763 2601538845 2600255257 Bacteria 5597196
764 2601757194 2600255310 Bacteria 5600903
765 2601762205 2600255311 Bacteria 5598766
766 2603639543 2602042046 Bacteria 5483348
767 2603644277 2602042047 Bacteria 4697674
768 2603701201 2602042066 Bacteria 4423871
769 2603704880 2602042067 Bacteria 4863713
770 2608670967 2608642108 Bacteria 4104624
771 2609911455 2609459761 Bacteria 5513740
772 2650897577 2648501693 Bacteria 5069560
773 2656278013 2654587920 Bacteria 5475511
774 2671104600 2667528172 Bacteria 5170840
775 2681998051 2681812866 Bacteria 4552357
776 2682008158 2681812869 Bacteria 5014465
777 2686354953 2684622997 Bacteria 4624240
778 2689443145 2687453601 Bacteria 5546041
779 2707098108 2706794495 Bacteria 4536932
780 2712471249 2711768156 Bacteria 4471618
781 2753857683 2751185917 Bacteria 4551186
782 2765590785 2765235842 Bacteria 4799256
783 2775540343 2775506706 Bacteria 4873073
784 2791925249 2791354903 Bacteria 4937680
785 2792312633 2791355010 Bacteria 4864581
786 2793403925 2791355275 Bacteria 4429597
787 2809126338 2808606414 Bacteria 4917181
788 2813726829 2811995292 Bacteria 5303342
789 2814694202 2814123068 Bacteria 5687681
790 2821120671 2821118458 Bacteria 4714306
791 2823376546 2823373977 Bacteria 4779415
792 2844429172 2844425489 Bacteria 4854065
793 2844530328 2844528606 Bacteria 4733806
794 2847798498 2847797336 Bacteria 5176640
795 2854605640 2854601825 Bacteria 4797592
796 2855199116 2855195626 Bacteria 4927512
797 2858467204 2858466076 Bacteria 4722413
798 2865016316 2865014394 Bacteria 4764573
799 2869552553 2869551831 Bacteria 5474685
800 2871273043 2871272651 Bacteria 5042015
801 2871283101 2871282230 Bacteria 4917173
802 2876601537 2876601092 Bacteria 5114497
803 2881613890 2881609920 Bacteria 4405319
804 2884087088 2884086401 Bacteria 5005459
805 2888374961 2888373701 Bacteria 5098052
806 2891671616 2891670763 Bacteria 4967099
807 2900053443 2900051742 Bacteria 4985156
808 2904506924 2904504865 Bacteria 5152820
809 2919113409 2919108558 Bacteria 5897419
810 2923636676 2923634449 Bacteria 4753480
811 2927836851 2927833300 Bacteria 4923934
812 2932406683 2932406140 Bacteria 5134491
813 2935629449 2935625433 Bacteria 5042964
814 2937544058 2937539931 Bacteria 4639830
815 2939572359 2939568625 Bacteria 4542555
816 2939576533 2939573065 Bacteria 4926053
817 2939577895 2939577877 Bacteria 5132791
818 2939604549 2939602548 Bacteria 4950493
819 2939610506 2939607340 Bacteria 4719256
820 2939620512 2939617950 Bacteria 4820956
821 2939645564 2939642701 Bacteria 4475280
822 2945875886 2945874760 Bacteria 5527237
823 2945951753 2945951305 Bacteria 4918162
824 2971821597 2971820967 Bacteria 5823634
825 2974440244 2974435778 Bacteria 4876478
826 2978978290 2978975091 Bacteria 4704313
827 2984495316 2984494565 Bacteria 5000175
828 2990265027 2990261002 Bacteria 4919493
829 3000380642 3000376612 Bacteria 4705565
830 8016734682 8016733728 Bacteria 5274317
831 8018225656 8018221730 Bacteria 4616064
832 8018407023 8018405270 Bacteria 4978981
833 8019503854 8019499862 Bacteria 5169538
834 8019507531 8019504834 Bacteria 4819156
835 8054848244 8054844752 Bacteria 4450330
836 8054853666 8054849141 Bacteria 5232694
837 8055089588 8055087960 Bacteria 4784273
838 8055095926 8055092621 Bacteria 4873875
839 8055101676 8055097453 Bacteria 4865496
840 Ga0495607_0000319
841 RicEn_C1845
842 SwRhRL2b_contig_2888319
843 SwRhRL2b_contig_922063
844 JGI24739J22299_10000001
845 JGI25152J39213_1000409
846 rootH2_10040343
847 Ga0058692_1000249
848 Ga0058692_1000486
849 Ga0058692_1000595
850 Ga0058692_1000599
851 Ga0058692_1001060
852 Ga0058692_1001128
853 Ga0058692_1002378
854 Ga0058692_1008919
855 Ga0058692_1034327
856 Ga0058692_1034348
857 Ga0065165_1003438
858 Ga0065704_10000814
859 Ga0065704_10000919
860 Ga0065704_10002360
861 Ga0065704_10081576
862 Ga0070658_10026859
863 Ga0070658_10169195
864 Ga0070676_10006595
865 Ga0070690_100028963
866 Ga0070670_100159472
867 Ga0070670_100229980
868 Ga0070677_10131155
869 Ga0068869_100091142
870 Ga0070666_10001342
871 Ga0070666_10049807
872 Ga0068868_100183270
873 Ga0068868_100543585
874 Ga0070660_100265379
875 Ga0070668_100000561
876 Ga0070668_100005676
877 Ga0070668_100278470
878 Ga0070669_100008965
879 Ga0070671_100008011
880 Ga0070674_100079190
881 Ga0070673_100206492
882 Ga0070659_100420588
883 Ga0070667_100013076
884 Ga0070667_100017549
885 Ga0070667_100316446
886 Ga0070700_100043085
887 Ga0070678_100013453
888 Ga0070662_100018152
889 Ga0068867_100002855
890 Ga0068867_100123631
891 Ga0070672_100016710
892 Ga0070672_100052400
893 Ga0070665_100000743
894 Ga0070665_100027871
895 Ga0070665_100261104
896 Ga0068855_100041605
897 Ga0068857_100000067
898 Ga0068852_100290016
899 Ga0068864_100107680
900 Ga0068861_100013043
901 Ga0068851_10023381
902 Ga0068863_100036313
903 Ga0068858_100024788
904 Ga0068858_100103339
905 Ga0068862_100072878
906 Ga0081538_10080928
907 Ga0075365_10005166
908 Ga0075364_10012505
909 Ga0075364_10027764
910 Ga0075366_10031034
911 Ga0075366_10049300
912 Ga0075434_100128665
913 Ga0068865_100014203
914 Ga0079104_1000495
915 Ga0079104_1000655
916 Ga0079104_1001059
917 Ga0079104_1001504
918 Ga0079104_1001641
919 Ga0079104_1001726
920 Ga0079104_1005852
921 Ga0079104_1010394
922 Ga0105251_10000722
923 Ga0105251_10001434
924 Ga0105251_10001545
925 Ga0105251_10002234
926 Ga0105251_10005461
927 Ga0105251_10022052
928 Ga0105251_10025717
929 Ga0105251_10030042
930 Ga0105251_10032249
931 Ga0105251_10035801
932 Ga0105244_10000033
933 Ga0105244_10000371
934 Ga0105244_10002356
935 Ga0105244_10002669
936 Ga0105244_10004051
937 Ga0105244_10004939
938 Ga0105244_10010000
939 Ga0105244_10020465
940 Ga0105244_10028439
941 Ga0105244_10040059
942 Ga0105244_10062091
943 Ga0105244_10200446
944 Ga0105250_10000042
945 Ga0105250_10000171
946 Ga0105250_10000367
947 Ga0105250_10000602
948 Ga0105250_10003171
949 Ga0105250_10003650
950 Ga0105250_10004305
951 Ga0105250_10005392
952 Ga0105250_10011656
953 Ga0105250_10029973
954 Ga0105240_10507222
955 Ga0105245_10113487
956 Ga0105247_10000211
957 Ga0105247_10435804
958 Ga0105243_10050485
959 Ga0105243_10057566
960 Ga0105243_10401893
961 Ga0105243_10487240
962 Ga0105241_10531192
963 Ga0105248_10009287
964 Ga0105248_10069967
965 Ga0105249_10021079
966 Ga0105249_10328817
967 Ga0105246_10011239
968 Ga0105246_10132678
969 Ga0157373_10007352
970 Ga0157373_10018632
971 Ga0157371_10000778
972 Ga0157371_10009635
973 Ga0157371_10025580
974 Ga0157371_10039445
975 Ga0157370_10000656
976 Ga0157370_10047674
977 Ga0157369_10000859
978 Ga0157369_10015721
979 Ga0157374_10153417
980 Ga0163162_10076147
981 Ga0163162_10123714
982 Ga0157372_10001196
983 Ga0157372_10022056
984 Ga0157372_10044827
985 Ga0157372_10081055
986 Ga0157372_10154346
987 Ga0157372_10359464
988 Ga0157372_10537038
989 Ga0157375_10015708
990 Ga0157375_10025372
991 Ga0157380_10001789
992 Ga0182008_10010160
993 Ga0157379_10020433
994 Ga0157379_10131248
995 Ga0157376_10829319
996 Ga0182006_1000422
997 Ga0182007_10007375
998 Ga0183366_1002
999 Ga0183370_1002
1000 Ga0183369_1002
1001 Ga0183368_1005
1002 Ga0163161_10000002
1003 Ga0163161_10027894
1004 Ga0163161_10047476
1005 Ga0213872_10005750
1006 Ga0213876_10000013
1007 Ga0209437_100110
1008 Ga0207425_1014300
1009 Ga0209129_1000010
1010 Ga0207696_1000009
1011 Ga0207696_1000027
1012 Ga0207696_1000102
1013 Ga0207696_1000137
1014 Ga0207696_1000187
1015 Ga0207696_1000370
1016 Ga0207696_1000821
1017 Ga0207696_1001415
1018 Ga0207696_1003814
1019 Ga0207696_1004753
1020 Ga0207696_1020121
1021 Ga0207696_1033400
1022 Ga0207655_1000065
1023 Ga0207655_1000072
1024 Ga0207655_1000420
1025 Ga0207655_1000956
1026 Ga0207655_1001886
1027 Ga0207655_1003099
1028 Ga0207655_1003508
1029 Ga0207655_1007400
1030 Ga0207655_1010206
1031 Ga0207655_1016419
1032 Ga0207655_1025168
1033 Ga0207655_1029009
1034 Ga0207655_1044730
1035 Ga0207655_1046582
1036 Ga0207713_1000019
1037 Ga0207713_1000028
1038 Ga0207713_1000123
1039 Ga0207713_1006467
1040 Ga0207713_1012019
1041 Ga0207713_1012900
1042 Ga0207713_1019869
1043 Ga0207713_1020555
1044 Ga0207713_1028749
1045 Ga0207710_10000061
1046 Ga0207645_10000932
1047 Ga0207705_10082462
1048 Ga0207705_10309718
1049 Ga0207662_10027962
1050 Ga0207657_10016871
1051 Ga0207681_10005730
1052 Ga0207650_10101992
1053 Ga0207687_10023855
1054 Ga0207644_10002979
1055 Ga0207706_10021564
1056 Ga0207706_10062660
1057 Ga0207706_10064256
1058 Ga0207709_10029334
1059 Ga0207709_10245176
1060 Ga0207669_10033114
1061 Ga0207691_10012375
1062 Ga0207691_10036077
1063 Ga0207711_10012730
1064 Ga0207711_10047402
1065 Ga0207689_10013142
1066 Ga0207667_10002798
1067 Ga0207651_10016613
1068 Ga0207651_10360365
1069 Ga0207651_10608885
1070 Ga0207712_10002594
1071 Ga0207668_10018596
1072 Ga0207658_10015270
1073 Ga0207658_10055068
1074 Ga0207658_10080670
1075 Ga0207677_10013173
1076 Ga0207677_10062014
1077 Ga0207703_10010862
1078 Ga0207708_10022289
1079 Ga0207641_10005423
1080 Ga0207648_10012092
1081 Ga0207648_10046257
1082 Ga0207674_10004150
1083 Ga0207675_100011212
1084 Ga0207675_100259360
1085 Ga0207683_10009534
1086 Ga0207683_10038389
1087 Ga0209281_1000025
1088 Ga0209281_1000089
1089 Ga0209281_1000105
1090 Ga0209281_1000559
1091 Ga0209281_1000768
1092 Ga0209281_1001450
1093 Ga0209281_1002003
1094 Ga0209281_1002943
1095 Ga0209281_1003785
1096 Ga0209371_1000010
1097 Ga0209371_1000013
1098 Ga0209371_1000019
1099 Ga0209371_1000126
1100 Ga0209371_1000149
1101 Ga0209371_1000254
1102 Ga0209371_1000335
1103 Ga0209371_1000718
1104 Ga0209371_1000795
1105 Ga0209371_1001352
1106 Ga0209371_1001485
1107 Ga0209371_1001753
1108 Ga0209371_1002033
1109 Ga0209371_1002452
1110 Ga0209371_1003488
1111 Ga0209371_1008461
1112 Ga0209371_1008697
1113 Ga0209371_1014225
1114 Ga0209371_1016172
1115 Ga0268266_10000041
1116 Ga0268266_10035813
1117 Ga0268266_10064513
1118 Ga0268265_10253636
1119 Ga0268264_10001710
1120 Ga0265338_10223382
1121 Ga0268256_1000014
1122 Ga0268256_1000022
1123 Ga0268256_1000024
1124 Ga0268256_1000105
1125 Ga0268256_1000110
1126 Ga0268256_1000559
1127 Ga0268256_1000635
1128 Ga0268256_1000709
1129 Ga0268256_1000767
1130 Ga0268256_1001840
1131 Ga0268256_1002442
1132 Ga0268256_1003121
1133 Ga0268256_1005368
1134 Ga0268256_1008638
1135 Ga0268256_1008694
1136 Ga0268256_1009783
1137 Ga0268256_1015768
1138 Ga0268256_1016253
1139 Ga0316183_1053585
1140 Ga0307413_10298248
1141 Ga0307416_100607667
1142 Ga0307416_100706520
1143 Ga0395899_0043099
1144 Ga0395899_0149998
1145 Ga0395901_0153598
1146 Ga0436365_0471682
1147 Ga0436361_0995447
1148 Ga0439438_000059
1149 Ga0439438_007349
1150 Ga0439438_020412
1151 Ga0439438_024994
1152 Ga0439447_000863
1153 Ga0439447_005242
1154 Ga0439447_006174
1155 Ga0439466_0000004
1156 Ga0451853_2456147
1157 Ga0439448_0006624
1158 Ga0439432_003141
1159 Ga0439432_004840
1160 Ga0439449_0072347
1161 Ga0439450_009891
1162 Ga0439452_000006
1163 Ga0439452_000009
1164 Ga0439452_000011
1165 Ga0439452_000272
1166 Ga0439452_003757
1167 Ga0439463_005230
1168 Ga0450907_000024
1169 Ga0439464_0001001
1170 Ga0439464_0053990
1171 Ga0466981_0000001
1172 Ga0466965_0007746
1173 Ga0466966_0019529
1174 Ga0466971_0051382
1175 Ga0466959_0182467
1176 Ga0451576_0030242
1177 Ga0466958_0174061
1178 Ga0466967_0513746
1179 Ga0495617_000002
1180 Ga0495617_000362
1181 Ga0495617_069510
1182 Ga0495627_000111
1183 Ga0495627_000344
1184 Ga0495627_022241
1185 Ga0495603_0014885
1186 Ga0495603_0136129
1187 Ga0495590_0000007
1188 Ga0495590_0042440
1189 Ga0495590_0088393
1190 Ga0495591_000045
1191 Ga0495591_000062
1192 Ga0495591_020797
1193 Ga0495591_026163
1194 Ga0495629_0019494
1195 Ga0495629_0047544
1196 Ga0495638_0004537
1197 Ga0495653_0013262
1198 Ga0495653_0141892
1199 Ga0495650_0000008
1200 Ga0495650_0000040
1201 Ga0495650_0019534
1202 Ga0495580_0069933
1203 Ga0495582_0023795
1204 Ga0495605_0000092
1205 Ga0495605_0003289
1206 Ga0495605_0013027
1207 Ga0495605_0111993
1208 Ga0495605_0112845
1209 Ga0495584_0000007
1210 Ga0495584_0000238
1211 Ga0495584_0013955
1212 Ga0495584_0020413
1213 Ga0495584_0094690
1214 Ga0495584_0102855
1215 Ga0495584_0248369
1216 Ga0495585_0000090
1217 Ga0495585_0000812
1218 Ga0495585_0003197
1219 Ga0495585_0013108
1220 Ga0495585_0019777
1221 Ga0495585_0028690
1222 Ga0495585_0030105
1223 Ga0495585_0088314
1224 Ga0495585_0095011
1225 Ga0495585_0152042
1226 Ga0495585_0170495
1227 Ga0495594_0137780
1228 Ga0495594_0138380
1229 Ga0495596_0001144
1230 Ga0495596_0003412
1231 Ga0495596_0004492
1232 Ga0495596_0004525
1233 Ga0495596_0010126
1234 Ga0495596_0011749
1235 Ga0495596_0054090
1236 Ga0495607_0000811
1237 Ga0495607_0000887
1238 Ga0495607_0002622
1239 Ga0495607_0032797
1240 Ga0495607_0049037
1241 Ga0495607_0094901
1242 Ga0495607_0210408
1243 Ga0495583_0000075
1244 Ga0495583_0000302
1245 Ga0495583_0000462
1246 Ga0495583_0000520
1247 Ga0495583_0050584
1248 Ga0495583_0114721
1249 Ga0495606_0001700
1250 Ga0495606_0022090
1251 Ga0495606_0051953
1252 Ga0495606_0073446
1253 Ga0495610_0007411
1254 Ga0495616_0000171
1255 Ga0495616_0000241
1256 Ga0495616_0001157
1257 Ga0495616_0012785
1258 Ga0495616_0021816
1259 Ga0495616_0033345
1260 Ga0495616_0051445
1261 Ga0495616_0112099
1262 Ga0495620_0013112
1263 Ga0495620_0026872
1264 Ga0495630_0183705
1265 Ga0495631_0003035
1266 Ga0495631_0010395
1267 Ga0495631_0014348
1268 Ga0495631_0081636
1269 Ga0495631_0132559
1270 Ga0495632_0000068
1271 Ga0495632_0000768
1272 Ga0495632_0001646
1273 Ga0495632_0004545
1274 Ga0495632_0007063
1275 Ga0495632_0025534
1276 Ga0495637_0000019
1277 Ga0495637_0045269
1278 Ga0495637_0101186
1279 Ga0495643_0002408
1280 Ga0495643_0005881
1281 Ga0495643_0026600
1282 Ga0495643_0072042
1283 Ga0495643_0197885
1284 Ga0495644_0000354
1285 Ga0495644_0006372
1286 Ga0495644_0047395
1287 Ga0495644_0050621
1288 Ga0495648_0000091
1289 Ga0495648_0000193
1290 Ga0495648_0000934
1291 Ga0495648_0001612
1292 Ga0495648_0029763
1293 Ga0495648_0084608
1294 Ga0495666_0000511
1295 Ga0495666_0007365
1296 Ga0495642_0000217
1297 Ga0495642_0003097
1298 Ga0495642_0007047
1299 Ga0495642_0008426
1300 Ga0495642_0014656
1301 Ga0495654_0000073
1302 Ga0495654_0000171
1303 Ga0495654_0125259
1304 Ga0495665_0008709
1305 Ga0495665_0046155
1306 Ga0495640_0034754
1307 Ga0495640_0171574
1308 Ga0495586_0015955
1309 Ga0495587_0093649
1310 Ga0495609_0000716
1311 Ga0495609_0022169
1312 Ga0495609_0085952
1313 Ga0495609_0093881
1314 Ga0495609_0126713
1315 Ga0495597_0000738
1316 Ga0495597_0001122
1317 Ga0495597_0001580
1318 Ga0495597_0009125
1319 Ga0495622_0003617
1320 Ga0495622_0175168
1321 Ga0495633_0010347
1322 Ga0495633_0020436
1323 Ga0495633_0036783
1324 Ga0495633_0094860
1325 Ga0495656_0032664
1326 Ga0495668_0000139
1327 Ga0495668_0000975
1328 Ga0495668_0138976
1329 Ga0495611_0000295
1330 Ga0495611_0018440
1331 Ga0495611_0020696
1332 Ga0495625_0003007
1333 Ga0495625_0029671
1334 Ga0495625_0037354
1335 Ga0495625_0286500
1336 Ga0495661_0000495
1337 Ga0495661_0001229
1338 Ga0495661_0007744
1339 Ga0495661_0015501
1340 Ga0495661_0020745
1341 Ga0495661_0026067
1342 Ga0495661_0092152
1343 Ga0495661_0100969
1344 Ga0495588_0004154
1345 Ga0495588_0032101
1346 Ga0495588_0073701
1347 Ga0495588_0079904
1348 Ga0495588_0110247
1349 Ga0495588_0130522
1350 Ga0495646_0133826
1351 Ga0495669_0000423
1352 Ga0495669_0000945
1353 Ga0495669_0023680
1354 Ga0495669_0024049
1355 Ga0495669_0064568
1356 Ga0495669_0083928
1357 Ga0495613_0042447
1358 Ga0495613_0236864
1359 Ga0495670_0000504
1360 Ga0495670_0003055
1361 Ga0495670_0028623
1362 Ga0495670_0050843
1363 Ga0495670_0111209
1364 Ga0495671_0000067
1365 Ga0495671_0004592
1366 Ga0495671_0027165
1367 Ga0495671_0039870
1368 Ga0495671_0084105
1369 Ga0495671_0084450
1370 Ga0495649_0000196
1371 Ga0495649_0000862
1372 Ga0495649_0001555
1373 Ga0495649_0075753
1374 Ga0495589_0000079
1375 Ga0495589_0003250
1376 Ga0495589_0007544
1377 Ga0495589_0012110
1378 Ga0495589_0020685
1379 Ga0495589_0021565
1380 Ga0495589_0064421
1381 Ga0495589_0116676
1382 Ga0495600_0029880
1383 Ga0495660_0000019
1384 Ga0495660_0008204
1385 Ga0495660_0011483
1386 Ga0495660_0077996
1387 Ga0495581_0001697
1388 Ga0495581_0211700
1389 Ga0495604_0018117
1390 Ga0495604_0068660
1391 Ga0495604_0187737
1392 Ga0495672_0000003
1393 Ga0495672_0000025
1394 Ga0495672_0000041
1395 Ga0495672_0000362
1396 Ga0495676_0000092
1397 Ga0495676_0287904
1398 Ga0495680_0001486
1399 Ga0495683_0008503
1400 Ga0495683_0015048
1401 Ga0495683_0023499
1402 Ga0495683_0118418
1403 Ga0495687_000133
1404 Ga0495687_000537
1405 Ga0495687_054822
1406 Ga0495675_0159493
1407 Ga0495677_0000304
1408 Ga0495677_0003623
1409 Ga0495677_0022004
1410 Ga0495679_000125
1411 Ga0495679_000813
1412 Ga0495679_014746
1413 Ga0495679_026229
1414 Ga0495679_033633
1415 Ga0495679_035330
1416 Ga0495685_004310
1417 Ga0495673_0000011
1418 Ga0495673_0000055
1419 Ga0495681_0000057
1420 Ga0495681_0001196
1421 Ga0495681_0001604
1422 Ga0495681_0029171
1423 Ga0495681_0077306
1424 Ga0495686_0000479
1425 Ga0495686_0098527
1426 Ga0495686_0123956
1427 Ga0495593_0006097
1428 Ga0495602_0092282
1429 Ga0495602_0201934
1430 Ga0495614_0001353
1431 Ga0495626_0001302
1432 Ga0495626_0005515
1433 Ga0495626_0005730
1434 Ga0495626_0007600
1435 Ga0495626_0019271
1436 Ga0495626_0036348
1437 Ga0495626_0066993
1438 Ga0495626_0069900
1439 Ga0495626_0096875
1440 Ga0495626_0106988
1441 Ga0495626_0117264
1442 Ga0496100_0062139
1443 Ga0496101_0000070
1444 Ga0496102_0011022
1445 Ga0496102_0024889
1446 Ga0496102_0214727
1447 Ga0496102_0303943
1448 Ga0496102_0493895
1449 Ga0496103_0111351
1450 Ga0496104_0000784
1451 Ga0496104_0533861
1452 Ga0496105_0001684
1453 Ga0496105_0002815
1454 Ga0496105_0078383
1455 Ga0496105_0146738
1456 Ga0496106_0137080
1457 Ga0496106_0378060
1458 Ga0496107_0367535
1459 Ga0496108_0127944
1460 Ga0496108_0288670
1461 Ga0496110_0000041
1462 Ga0496110_0085270
1463 Ga0496110_0396101
1464 Ga0496111_0124406
1465 Ga0496113_0003151
1466 Ga0496116_0000015
1467 Ga0496116_0000308
1468 Ga0496116_0001206
1469 Ga0496116_0008765
1470 Ga0496116_0012638
1471 Ga0496116_0071530
1472 Ga0496116_0098690
1473 Ga0496116_0117880
1474 Ga0496116_0141374
1475 Ga0496117_0000043
1476 Ga0496117_0000680
1477 Ga0496117_0005315
1478 Ga0496117_0006484
1479 Ga0496117_0012853
1480 Ga0496117_0026290
1481 Ga0496117_0034334
1482 Ga0496117_0036218
1483 Ga0496117_0041200
1484 Ga0496117_0043194
1485 Ga0496117_0141147
1486 Ga0496117_0157617
1487 Ga0496118_0000075
1488 Ga0496118_0002357
1489 Ga0496118_0003898
1490 Ga0496118_0005445
1491 Ga0496118_0046672
1492 Ga0496118_0129377
1493 Ga0496118_0153428
1494 Ga0496119_0000096
1495 Ga0496119_0000324
1496 Ga0496119_0001622
1497 Ga0496119_0002543
1498 Ga0496119_0002626
1499 Ga0496119_0003023
1500 Ga0496119_0008155
1501 Ga0496119_0023352
1502 Ga0496119_0032034
1503 Ga0496119_0044583
1504 Ga0496119_0047715
1505 Ga0496120_0000414
1506 Ga0496120_0000805
1507 Ga0496120_0001565
1508 Ga0496120_0002290
1509 Ga0496120_0007007
1510 Ga0496120_0022121
1511 Ga0496120_0026009
1512 Ga0496120_0041470
1513 Ga0496120_0042161
1514 Ga0496120_0122365
1515 Ga0496121_0000057
1516 Ga0496121_0001878
1517 Ga0496121_0002032
1518 Ga0496121_0004592
1519 Ga0496121_0006182
1520 Ga0496121_0007418
1521 Ga0496121_0008060
1522 Ga0496121_0011195
1523 Ga0496122_0000016
1524 Ga0496122_0000988
1525 Ga0496122_0003346
1526 Ga0496122_0008283
1527 Ga0496122_0011751
1528 Ga0496122_0011840
1529 Ga0496122_0019814
1530 Ga0496122_0032610
1531 Ga0496122_0040471
1532 Ga0496122_0047847
1533 Ga0496122_0054640
1534 Ga0496122_0197731
1535 Ga0496123_0000017
1536 Ga0496123_0000195
1537 Ga0496123_0000198
1538 Ga0496123_0001702
1539 Ga0496123_0002965
1540 Ga0496123_0006820
1541 Ga0496123_0009791
1542 Ga0496123_0010368
1543 Ga0496123_0036775
1544 Ga0496123_0050150
1545 Ga0496123_0057697
1546 Ga0496123_0080604
1547 Ga0496124_0000246
1548 Ga0496124_0000342
1549 Ga0496124_0001425
1550 Ga0496124_0002044
1551 Ga0496124_0011023
1552 Ga0496124_0015844
1553 Ga0496124_0024609
1554 Ga0496124_0032630
1555 Ga0496124_0142628
1556 Ga0496124_0167696
1557 Ga0496124_0175516
1558 Ga0496125_0000257
1559 Ga0496125_0002401
1560 Ga0496125_0002508
1561 Ga0496125_0004530
1562 Ga0496125_0008673
1563 Ga0496125_0030552
1564 Ga0496125_0036882
1565 Ga0496125_0043350
1566 Ga0496125_0076493
1567 Ga0496125_0157828
1568 Ga0496126_0001485
1569 Ga0496126_0003691
1570 Ga0496126_0021288
1571 Ga0496126_0143279
1572 Ga0496126_0169557
1573 Ga0496126_0276688
1574 Ga0496126_0401492
1575 Ga0495678_000070
1576 Ga0495678_000105
1577 Ga0495678_000486
1578 Ga0495678_030330
1579 Ga0495682_0000017
1580 Ga0495682_0000362
1581 nmdc:mga00v17_182327_c1
1582 nmdc:mga0k408_10650_c1
1583 nmdc:mga0k408_73277_c1
1584 nmdc:mga0n895_225416_c1
1585 Ga0500618_000081
1586 Ga0500621_000004
1587 Ga0500559_0001601
1588 Ga0500622_0032842
1589 Ga0500639_007555
1590 Ga0500576_097623
1591 Ga0500596_011788
1592 Ga0466962_0076173
1593 2511378171
1594 2511436696
1595 2538427663
1596 2547696048
1597 2548649987
1598 2555258842
1599 2562464571
1600 2599928827
1601 2601534376
1602 2601538845
1603 2601757194
1604 2601762205
1605 2603639543
1606 2603644277
1607 2603701201
1608 2603704880
1609 2608670967
1610 2609911455
1611 2650897577
1612 2656278013
1613 2671104600
1614 2681998051
1615 2682008158
1616 2686354953
1617 2689443145
1618 2707098108
1619 2712471249
1620 2753857683
1621 2765590785
1622 2775540343
1623 2791925249
1624 2792312633
1625 2793403925
1626 2809126338
1627 2813726829
1628 2814694202
1629 2821120671
1630 2823376546
1631 2844429172
1632 2844530328
1633 2847798498
1634 2854605640
1635 2855199116
1636 2858467204
1637 2865016316
1638 2869552553
1639 2871273043
1640 2871283101
1641 2876601537
1642 2881613890
1643 2884087088
1644 2888374961
1645 2891671616
1646 2900053443
1647 2904506924
1648 2919113409
1649 2923636676
1650 2927836851
1651 2932406683
1652 2935629449
1653 2937544058
1654 2939572359
1655 2939576533
1656 2939577895
1657 2939604549
1658 2939610506
1659 2939620512
1660 2939645564
1661 2945875886
1662 2945951753
1663 2971821597
1664 2974440244
1665 2978978290
1666 2984495316
1667 2990265027
1668 3000380642
1669 8016734682
1670 8018225656
1671 8018407023
1672 8019503854
1673 8019507531
1674 8054848244
1675 8054853666
1676 8055089588
1677 8055095926
1678 8055101676

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

41

267

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9772 4 256
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9734 4 256
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9729 8 256
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9708 8 254
2v5j-assembly1.cif.gz_B apo class ii aldolase hpch 0.9642 8 256
ID Description Score Start End Superfamily
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9746 4 256 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9711 3 254 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9708 4 256 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9561 8 256 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9525 3 254 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A242MTS3-F1-model_v4 2-dehydro-3-deoxyglucarate aldolase 0.981 6 256 GO:0005737
GO:0008672
GO:0019394
AF-A0A4R2YX13-F1-model_v4 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) 0.9806 5 256 GO:0000287
GO:0005737
GO:0008672
GO:0042838
GO:0046392
AF-A0A7W6KNN9-F1-model_v4 2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20) 0.9806 6 255 GO:0005737
GO:0008672
GO:0019394
AF-A0A5B9AQ54-F1-model_v4 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) 0.9804 10 256 GO:0000287
GO:0005737
GO:0005886
GO:0008672
GO:0022857
GO:0042838
GO:0046392
AF-D4DX30-F1-model_v4 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) 0.9799 8 256 GO:0000287
GO:0005737
GO:0008672
GO:0042838
GO:0046392

Map