F483027
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 341 | 1678 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300046501|Ga0495607_0000319|Ga0495607_0000319_17510_18343 |
| Length | 277 |
| Sequence | MEVRQQAALPGALKEHAMNDTTIYCGIPNRFKRDLREGKLQIGCWSSLASPLSTEILGLAGFDWLMLDGEHSPNDLTSFIQQLMALKDSVSAPVVRPQSNDMVQIKRLLDAGFYNFLIPFVESAEEAARAVAATRYPPDGARGVSLSMRGNRYGTVPDYHRISNQNVVVAVQIESPKGVDNIEAICAVDGVDAIFIGPSDLAAGFGRLGDPGHPEIQGAIQRVFGAAKTAGVPFGILAPAEDDARRYMKMGATMVAVGSDQGLFRGATQSLRDKFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 74 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 75 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 76 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 129 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 130 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 134 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 135 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 136 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 137 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 138 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 139 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 140 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 239 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 250 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 251 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 252 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 253 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 254 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 256 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 257 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 258 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 259 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 260 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 261 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 262 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 263 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 264 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 265 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 266 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 267 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 268 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 269 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 270 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 271 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 272 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 273 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 274 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 275 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 276 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 277 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 278 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 279 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 280 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 281 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 282 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 283 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 284 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 285 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 286 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 287 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 288 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 289 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 290 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 291 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 292 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 293 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 294 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 295 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 296 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 297 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 298 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 299 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 300 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 301 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 302 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 303 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 304 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 305 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 306 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 307 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 308 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 309 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 310 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 311 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 312 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 313 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 314 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 315 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 316 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 317 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 318 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 319 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 320 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 321 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 322 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 323 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 324 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 325 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 326 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 327 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 328 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 329 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 330 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 331 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 332 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 333 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 334 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 335 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 336 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 337 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 338 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 339 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 340 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 341 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.75 |
| Metatranscriptomes | 0 |
| Isolates | 10.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 2.15 |
| Rhizoplane | 4.89 |
| Rhizosphere | 72.94 |
| Stem | 0.12 |
| Stem Tuber | 0.72 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495607_0000319 | 3300046501 | Bacteria | 50035 |
| 2 | RicEn_C1845 | 2010549000 | Bacteria | 6313 |
| 3 | SwRhRL2b_contig_2888319 | 2162886007 | Bacteria | 3300 |
| 4 | SwRhRL2b_contig_922063 | 2162886007 | Bacteria | 2750 |
| 5 | JGI24739J22299_10000001 | 3300001989 | Bacteria | 99744 |
| 6 | JGI25152J39213_1000409 | 3300002773 | Bacteria | 26002 |
| 7 | rootH2_10040343 | 3300003320 | Bacteria | 17344 |
| 8 | Ga0058692_1000249 | 3300003856 | Bacteria | 29935 |
| 9 | Ga0058692_1000486 | 3300003856 | Bacteria | 17772 |
| 10 | Ga0058692_1000595 | 3300003856 | Bacteria | 15230 |
| 11 | Ga0058692_1000599 | 3300003856 | Bacteria | 15154 |
| 12 | Ga0058692_1001060 | 3300003856 | Bacteria | 10764 |
| 13 | Ga0058692_1001128 | 3300003856 | Bacteria | 10343 |
| 14 | Ga0058692_1002378 | 3300003856 | Bacteria | 6323 |
| 15 | Ga0058692_1008919 | 3300003856 | Bacteria | 2564 |
| 16 | Ga0058692_1034327 | 3300003856 | Bacteria | 932 |
| 17 | Ga0058692_1034348 | 3300003856 | Bacteria | 932 |
| 18 | Ga0065165_1003438 | 3300005262 | Bacteria | 11129 |
| 19 | Ga0065704_10000814 | 3300005289 | Bacteria | 12119 |
| 20 | Ga0065704_10000919 | 3300005289 | Bacteria | 10903 |
| 21 | Ga0065704_10002360 | 3300005289 | Bacteria | 13852 |
| 22 | Ga0065704_10081576 | 3300005289 | Bacteria | 3735 |
| 23 | Ga0070658_10026859 | 3300005327 | Bacteria | 4622 |
| 24 | Ga0070658_10169195 | 3300005327 | Bacteria | 1836 |
| 25 | Ga0070676_10006595 | 3300005328 | Bacteria | 6207 |
| 26 | Ga0070690_100028963 | 3300005330 | Bacteria | 3432 |
| 27 | Ga0070670_100159472 | 3300005331 | Bacteria | 1955 |
| 28 | Ga0070670_100229980 | 3300005331 | Bacteria | 1614 |
| 29 | Ga0070677_10131155 | 3300005333 | Bacteria | 1144 |
| 30 | Ga0068869_100091142 | 3300005334 | Bacteria | 2292 |
| 31 | Ga0070666_10001342 | 3300005335 | Bacteria | 14927 |
| 32 | Ga0070666_10049807 | 3300005335 | Bacteria | 2816 |
| 33 | Ga0068868_100183270 | 3300005338 | Bacteria | 1738 |
| 34 | Ga0068868_100543585 | 3300005338 | Bacteria | 1023 |
| 35 | Ga0070660_100265379 | 3300005339 | Bacteria | 1402 |
| 36 | Ga0070668_100000561 | 3300005347 | Bacteria | 24824 |
| 37 | Ga0070668_100005676 | 3300005347 | Bacteria | 9250 |
| 38 | Ga0070668_100278470 | 3300005347 | Bacteria | 1396 |
| 39 | Ga0070669_100008965 | 3300005353 | Bacteria | 7140 |
| 40 | Ga0070671_100008011 | 3300005355 | Bacteria | 8456 |
| 41 | Ga0070674_100079190 | 3300005356 | Bacteria | 2343 |
| 42 | Ga0070673_100206492 | 3300005364 | Bacteria | 1694 |
| 43 | Ga0070659_100420588 | 3300005366 | Bacteria | 1130 |
| 44 | Ga0070667_100013076 | 3300005367 | Bacteria | 6860 |
| 45 | Ga0070667_100017549 | 3300005367 | Bacteria | 5932 |
| 46 | Ga0070667_100316446 | 3300005367 | Bacteria | 1408 |
| 47 | Ga0070700_100043085 | 3300005441 | Bacteria | 2775 |
| 48 | Ga0070678_100013453 | 3300005456 | Bacteria | 5131 |
| 49 | Ga0070662_100018152 | 3300005457 | Bacteria | 4755 |
| 50 | Ga0068867_100002855 | 3300005459 | Bacteria | 12149 |
| 51 | Ga0068867_100123631 | 3300005459 | Bacteria | 2003 |
| 52 | Ga0070672_100016710 | 3300005543 | Bacteria | 5260 |
| 53 | Ga0070672_100052400 | 3300005543 | Bacteria | 3185 |
| 54 | Ga0070665_100000743 | 3300005548 | Bacteria | 43398 |
| 55 | Ga0070665_100027871 | 3300005548 | Bacteria | 5688 |
| 56 | Ga0070665_100261104 | 3300005548 | Bacteria | 1733 |
| 57 | Ga0068855_100041605 | 3300005563 | Bacteria | 5446 |
| 58 | Ga0068857_100000067 | 3300005577 | Bacteria | 58903 |
| 59 | Ga0068852_100290016 | 3300005616 | Bacteria | 1580 |
| 60 | Ga0068864_100107680 | 3300005618 | Bacteria | 2479 |
| 61 | Ga0068861_100013043 | 3300005719 | Bacteria | 5811 |
| 62 | Ga0068851_10023381 | 3300005834 | Bacteria | 3020 |
| 63 | Ga0068863_100036313 | 3300005841 | Bacteria | 4694 |
| 64 | Ga0068858_100024788 | 3300005842 | Bacteria | 5586 |
| 65 | Ga0068858_100103339 | 3300005842 | Bacteria | 2658 |
| 66 | Ga0068862_100072878 | 3300005844 | Bacteria | 2967 |
| 67 | Ga0081538_10080928 | 3300005981 | Bacteria | 1730 |
| 68 | Ga0075365_10005166 | 3300006038 | Bacteria | 7017 |
| 69 | Ga0075364_10012505 | 3300006051 | Bacteria | 5195 |
| 70 | Ga0075364_10027764 | 3300006051 | Bacteria | 3618 |
| 71 | Ga0075366_10031034 | 3300006195 | Bacteria | 3144 |
| 72 | Ga0075366_10049300 | 3300006195 | Bacteria | 2499 |
| 73 | Ga0075434_100128665 | 3300006871 | Bacteria | 2550 |
| 74 | Ga0068865_100014203 | 3300006881 | Bacteria | 5055 |
| 75 | Ga0079104_1000495 | 3300006946 | Bacteria | 42708 |
| 76 | Ga0079104_1000655 | 3300006946 | Bacteria | 33091 |
| 77 | Ga0079104_1001059 | 3300006946 | Bacteria | 20805 |
| 78 | Ga0079104_1001504 | 3300006946 | Bacteria | 15481 |
| 79 | Ga0079104_1001641 | 3300006946 | Bacteria | 14502 |
| 80 | Ga0079104_1001726 | 3300006946 | Bacteria | 13922 |
| 81 | Ga0079104_1005852 | 3300006946 | Bacteria | 4801 |
| 82 | Ga0079104_1010394 | 3300006946 | Bacteria | 3070 |
| 83 | Ga0105251_10000722 | 3300009011 | Bacteria | 30473 |
| 84 | Ga0105251_10001434 | 3300009011 | Bacteria | 20536 |
| 85 | Ga0105251_10001545 | 3300009011 | Bacteria | 19750 |
| 86 | Ga0105251_10002234 | 3300009011 | Bacteria | 15443 |
| 87 | Ga0105251_10005461 | 3300009011 | Bacteria | 8295 |
| 88 | Ga0105251_10022052 | 3300009011 | Bacteria | 3315 |
| 89 | Ga0105251_10025717 | 3300009011 | Bacteria | 3007 |
| 90 | Ga0105251_10030042 | 3300009011 | Bacteria | 2732 |
| 91 | Ga0105251_10032249 | 3300009011 | Bacteria | 2613 |
| 92 | Ga0105251_10035801 | 3300009011 | Bacteria | 2446 |
| 93 | Ga0105244_10000033 | 3300009036 | Bacteria | 172219 |
| 94 | Ga0105244_10000371 | 3300009036 | Bacteria | 41651 |
| 95 | Ga0105244_10002356 | 3300009036 | Bacteria | 14345 |
| 96 | Ga0105244_10002669 | 3300009036 | Bacteria | 13351 |
| 97 | Ga0105244_10004051 | 3300009036 | Bacteria | 10233 |
| 98 | Ga0105244_10004939 | 3300009036 | Bacteria | 9017 |
| 99 | Ga0105244_10010000 | 3300009036 | Bacteria | 5779 |
| 100 | Ga0105244_10020465 | 3300009036 | Bacteria | 3675 |
| 101 | Ga0105244_10028439 | 3300009036 | Bacteria | 2997 |
| 102 | Ga0105244_10040059 | 3300009036 | Bacteria | 2435 |
| 103 | Ga0105244_10062091 | 3300009036 | Bacteria | 1879 |
| 104 | Ga0105244_10200446 | 3300009036 | Bacteria | 941 |
| 105 | Ga0105250_10000042 | 3300009092 | Bacteria | 130495 |
| 106 | Ga0105250_10000171 | 3300009092 | Bacteria | 56587 |
| 107 | Ga0105250_10000367 | 3300009092 | Bacteria | 33714 |
| 108 | Ga0105250_10000602 | 3300009092 | Bacteria | 23453 |
| 109 | Ga0105250_10003171 | 3300009092 | Bacteria | 7866 |
| 110 | Ga0105250_10003650 | 3300009092 | Bacteria | 7244 |
| 111 | Ga0105250_10004305 | 3300009092 | Bacteria | 6573 |
| 112 | Ga0105250_10005392 | 3300009092 | Bacteria | 5741 |
| 113 | Ga0105250_10011656 | 3300009092 | Bacteria | 3645 |
| 114 | Ga0105250_10029973 | 3300009092 | Bacteria | 2188 |
| 115 | Ga0105240_10507222 | 3300009093 | Bacteria | 1340 |
| 116 | Ga0105245_10113487 | 3300009098 | Bacteria | 2523 |
| 117 | Ga0105247_10000211 | 3300009101 | Bacteria | 56646 |
| 118 | Ga0105247_10435804 | 3300009101 | Bacteria | 942 |
| 119 | Ga0105243_10050485 | 3300009148 | Bacteria | 3286 |
| 120 | Ga0105243_10057566 | 3300009148 | Bacteria | 3095 |
| 121 | Ga0105243_10401893 | 3300009148 | Bacteria | 1273 |
| 122 | Ga0105243_10487240 | 3300009148 | Bacteria | 1165 |
| 123 | Ga0105241_10531192 | 3300009174 | Bacteria | 1053 |
| 124 | Ga0105248_10009287 | 3300009177 | Bacteria | 10828 |
| 125 | Ga0105248_10069967 | 3300009177 | Bacteria | 3941 |
| 126 | Ga0105249_10021079 | 3300009553 | Bacteria | 5832 |
| 127 | Ga0105249_10328817 | 3300009553 | Bacteria | 1542 |
| 128 | Ga0105246_10011239 | 3300011119 | Bacteria | 5553 |
| 129 | Ga0105246_10132678 | 3300011119 | Bacteria | 1862 |
| 130 | Ga0157373_10007352 | 3300013100 | Bacteria | 8199 |
| 131 | Ga0157373_10018632 | 3300013100 | Bacteria | 5052 |
| 132 | Ga0157371_10000778 | 3300013102 | Bacteria | 36656 |
| 133 | Ga0157371_10009635 | 3300013102 | Bacteria | 7596 |
| 134 | Ga0157371_10025580 | 3300013102 | Bacteria | 4299 |
| 135 | Ga0157371_10039445 | 3300013102 | Bacteria | 3376 |
| 136 | Ga0157370_10000656 | 3300013104 | Bacteria | 43041 |
| 137 | Ga0157370_10047674 | 3300013104 | Bacteria | 4107 |
| 138 | Ga0157369_10000859 | 3300013105 | Bacteria | 38720 |
| 139 | Ga0157369_10015721 | 3300013105 | Bacteria | 8528 |
| 140 | Ga0157374_10153417 | 3300013296 | Bacteria | 2241 |
| 141 | Ga0163162_10076147 | 3300013306 | Bacteria | 3417 |
| 142 | Ga0163162_10123714 | 3300013306 | Bacteria | 2692 |
| 143 | Ga0157372_10001196 | 3300013307 | Bacteria | 28069 |
| 144 | Ga0157372_10022056 | 3300013307 | Bacteria | 6886 |
| 145 | Ga0157372_10044827 | 3300013307 | Bacteria | 4902 |
| 146 | Ga0157372_10081055 | 3300013307 | Bacteria | 3673 |
| 147 | Ga0157372_10154346 | 3300013307 | Bacteria | 2651 |
| 148 | Ga0157372_10359464 | 3300013307 | Bacteria | 1696 |
| 149 | Ga0157372_10537038 | 3300013307 | Bacteria | 1363 |
| 150 | Ga0157375_10015708 | 3300013308 | Bacteria | 6783 |
| 151 | Ga0157375_10025372 | 3300013308 | Bacteria | 5506 |
| 152 | Ga0157380_10001789 | 3300014326 | Bacteria | 14180 |
| 153 | Ga0182008_10010160 | 3300014497 | Bacteria | 5045 |
| 154 | Ga0157379_10020433 | 3300014968 | Bacteria | 5855 |
| 155 | Ga0157379_10131248 | 3300014968 | Bacteria | 2255 |
| 156 | Ga0157376_10829319 | 3300014969 | Bacteria | 939 |
| 157 | Ga0182006_1000422 | 3300015261 | Bacteria | 33862 |
| 158 | Ga0182007_10007375 | 3300015262 | Bacteria | 4619 |
| 159 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 160 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 161 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 162 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 163 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 164 | Ga0163161_10027894 | 3300017792 | Bacteria | 4006 |
| 165 | Ga0163161_10047476 | 3300017792 | Bacteria | 3100 |
| 166 | Ga0213872_10005750 | 3300021361 | Bacteria | 6307 |
| 167 | Ga0213876_10000013 | 3300021384 | Bacteria | 342052 |
| 168 | Ga0209437_100110 | 3300025233 | Bacteria | 215040 |
| 169 | Ga0207425_1014300 | 3300025245 | Bacteria | 1805 |
| 170 | Ga0209129_1000010 | 3300025258 | Bacteria | 583357 |
| 171 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 172 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 173 | Ga0207696_1000102 | 3300025711 | Bacteria | 167962 |
| 174 | Ga0207696_1000137 | 3300025711 | Bacteria | 127683 |
| 175 | Ga0207696_1000187 | 3300025711 | Bacteria | 96247 |
| 176 | Ga0207696_1000370 | 3300025711 | Bacteria | 44507 |
| 177 | Ga0207696_1000821 | 3300025711 | Bacteria | 19936 |
| 178 | Ga0207696_1001415 | 3300025711 | Bacteria | 13102 |
| 179 | Ga0207696_1003814 | 3300025711 | Bacteria | 6710 |
| 180 | Ga0207696_1004753 | 3300025711 | Bacteria | 5781 |
| 181 | Ga0207696_1020121 | 3300025711 | Bacteria | 2158 |
| 182 | Ga0207696_1033400 | 3300025711 | Bacteria | 1542 |
| 183 | Ga0207655_1000065 | 3300025728 | Bacteria | 252767 |
| 184 | Ga0207655_1000072 | 3300025728 | Bacteria | 236536 |
| 185 | Ga0207655_1000420 | 3300025728 | Bacteria | 57789 |
| 186 | Ga0207655_1000956 | 3300025728 | Bacteria | 29855 |
| 187 | Ga0207655_1001886 | 3300025728 | Bacteria | 18010 |
| 188 | Ga0207655_1003099 | 3300025728 | Bacteria | 12638 |
| 189 | Ga0207655_1003508 | 3300025728 | Bacteria | 11631 |
| 190 | Ga0207655_1007400 | 3300025728 | Bacteria | 7123 |
| 191 | Ga0207655_1010206 | 3300025728 | Bacteria | 5721 |
| 192 | Ga0207655_1016419 | 3300025728 | Bacteria | 4048 |
| 193 | Ga0207655_1025168 | 3300025728 | Bacteria | 2896 |
| 194 | Ga0207655_1029009 | 3300025728 | Bacteria | 2599 |
| 195 | Ga0207655_1044730 | 3300025728 | Bacteria | 1857 |
| 196 | Ga0207655_1046582 | 3300025728 | Bacteria | 1799 |
| 197 | Ga0207713_1000019 | 3300025735 | Bacteria | 361225 |
| 198 | Ga0207713_1000028 | 3300025735 | Bacteria | 309074 |
| 199 | Ga0207713_1000123 | 3300025735 | Bacteria | 122033 |
| 200 | Ga0207713_1006467 | 3300025735 | Bacteria | 7134 |
| 201 | Ga0207713_1012019 | 3300025735 | Bacteria | 4661 |
| 202 | Ga0207713_1012900 | 3300025735 | Bacteria | 4437 |
| 203 | Ga0207713_1019869 | 3300025735 | Bacteria | 3272 |
| 204 | Ga0207713_1020555 | 3300025735 | Bacteria | 3194 |
| 205 | Ga0207713_1028749 | 3300025735 | Bacteria | 2502 |
| 206 | Ga0207710_10000061 | 3300025900 | Bacteria | 166665 |
| 207 | Ga0207645_10000932 | 3300025907 | Bacteria | 24250 |
| 208 | Ga0207705_10082462 | 3300025909 | Bacteria | 2345 |
| 209 | Ga0207705_10309718 | 3300025909 | Bacteria | 1212 |
| 210 | Ga0207662_10027962 | 3300025918 | Bacteria | 3257 |
| 211 | Ga0207657_10016871 | 3300025919 | Bacteria | 7027 |
| 212 | Ga0207681_10005730 | 3300025923 | Bacteria | 7618 |
| 213 | Ga0207650_10101992 | 3300025925 | Bacteria | 2210 |
| 214 | Ga0207687_10023855 | 3300025927 | Bacteria | 4081 |
| 215 | Ga0207644_10002979 | 3300025931 | Bacteria | 10904 |
| 216 | Ga0207706_10021564 | 3300025933 | Bacteria | 5783 |
| 217 | Ga0207706_10062660 | 3300025933 | Bacteria | 3274 |
| 218 | Ga0207706_10064256 | 3300025933 | Bacteria | 3231 |
| 219 | Ga0207709_10029334 | 3300025935 | Bacteria | 3190 |
| 220 | Ga0207709_10245176 | 3300025935 | Bacteria | 1305 |
| 221 | Ga0207669_10033114 | 3300025937 | Bacteria | 2912 |
| 222 | Ga0207691_10012375 | 3300025940 | Bacteria | 8178 |
| 223 | Ga0207691_10036077 | 3300025940 | Bacteria | 4582 |
| 224 | Ga0207711_10012730 | 3300025941 | Bacteria | 6986 |
| 225 | Ga0207711_10047402 | 3300025941 | Bacteria | 3673 |
| 226 | Ga0207689_10013142 | 3300025942 | Bacteria | 7065 |
| 227 | Ga0207667_10002798 | 3300025949 | Bacteria | 21602 |
| 228 | Ga0207651_10016613 | 3300025960 | Bacteria | 4318 |
| 229 | Ga0207651_10360365 | 3300025960 | Bacteria | 1227 |
| 230 | Ga0207651_10608885 | 3300025960 | Bacteria | 955 |
| 231 | Ga0207712_10002594 | 3300025961 | Bacteria | 11603 |
| 232 | Ga0207668_10018596 | 3300025972 | Bacteria | 4377 |
| 233 | Ga0207658_10015270 | 3300025986 | Bacteria | 5269 |
| 234 | Ga0207658_10055068 | 3300025986 | Bacteria | 2945 |
| 235 | Ga0207658_10080670 | 3300025986 | Bacteria | 2493 |
| 236 | Ga0207677_10013173 | 3300026023 | Bacteria | 4782 |
| 237 | Ga0207677_10062014 | 3300026023 | Bacteria | 2592 |
| 238 | Ga0207703_10010862 | 3300026035 | Bacteria | 7100 |
| 239 | Ga0207708_10022289 | 3300026075 | Bacteria | 4782 |
| 240 | Ga0207641_10005423 | 3300026088 | Bacteria | 10888 |
| 241 | Ga0207648_10012092 | 3300026089 | Bacteria | 8095 |
| 242 | Ga0207648_10046257 | 3300026089 | Bacteria | 3815 |
| 243 | Ga0207674_10004150 | 3300026116 | Bacteria | 17517 |
| 244 | Ga0207675_100011212 | 3300026118 | Bacteria | 8394 |
| 245 | Ga0207675_100259360 | 3300026118 | Bacteria | 1684 |
| 246 | Ga0207683_10009534 | 3300026121 | Bacteria | 8274 |
| 247 | Ga0207683_10038389 | 3300026121 | Bacteria | 4174 |
| 248 | Ga0209281_1000025 | 3300027111 | Bacteria | 488275 |
| 249 | Ga0209281_1000089 | 3300027111 | Bacteria | 243650 |
| 250 | Ga0209281_1000105 | 3300027111 | Bacteria | 220052 |
| 251 | Ga0209281_1000559 | 3300027111 | Bacteria | 45161 |
| 252 | Ga0209281_1000768 | 3300027111 | Bacteria | 30641 |
| 253 | Ga0209281_1001450 | 3300027111 | Bacteria | 13935 |
| 254 | Ga0209281_1002003 | 3300027111 | Bacteria | 9302 |
| 255 | Ga0209281_1002943 | 3300027111 | Bacteria | 6125 |
| 256 | Ga0209281_1003785 | 3300027111 | Bacteria | 4809 |
| 257 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 258 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 259 | Ga0209371_1000019 | 3300027312 | Bacteria | 583561 |
| 260 | Ga0209371_1000126 | 3300027312 | Bacteria | 127214 |
| 261 | Ga0209371_1000149 | 3300027312 | Bacteria | 110455 |
| 262 | Ga0209371_1000254 | 3300027312 | Bacteria | 64787 |
| 263 | Ga0209371_1000335 | 3300027312 | Bacteria | 51288 |
| 264 | Ga0209371_1000718 | 3300027312 | Bacteria | 27957 |
| 265 | Ga0209371_1000795 | 3300027312 | Bacteria | 26072 |
| 266 | Ga0209371_1001352 | 3300027312 | Bacteria | 16987 |
| 267 | Ga0209371_1001485 | 3300027312 | Bacteria | 15666 |
| 268 | Ga0209371_1001753 | 3300027312 | Bacteria | 13656 |
| 269 | Ga0209371_1002033 | 3300027312 | Bacteria | 12097 |
| 270 | Ga0209371_1002452 | 3300027312 | Bacteria | 10346 |
| 271 | Ga0209371_1003488 | 3300027312 | Bacteria | 7601 |
| 272 | Ga0209371_1008461 | 3300027312 | Bacteria | 3417 |
| 273 | Ga0209371_1008697 | 3300027312 | Bacteria | 3328 |
| 274 | Ga0209371_1014225 | 3300027312 | Bacteria | 2191 |
| 275 | Ga0209371_1016172 | 3300027312 | Bacteria | 1977 |
| 276 | Ga0268266_10000041 | 3300028379 | Bacteria | 322311 |
| 277 | Ga0268266_10035813 | 3300028379 | Bacteria | 4221 |
| 278 | Ga0268266_10064513 | 3300028379 | Bacteria | 3164 |
| 279 | Ga0268265_10253636 | 3300028380 | Bacteria | 1560 |
| 280 | Ga0268264_10001710 | 3300028381 | Bacteria | 20233 |
| 281 | Ga0265338_10223382 | 3300028800 | Bacteria | 1405 |
| 282 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 283 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 284 | Ga0268256_1000024 | 3300030500 | Bacteria | 488637 |
| 285 | Ga0268256_1000105 | 3300030500 | Bacteria | 126344 |
| 286 | Ga0268256_1000110 | 3300030500 | Bacteria | 119426 |
| 287 | Ga0268256_1000559 | 3300030500 | Bacteria | 30224 |
| 288 | Ga0268256_1000635 | 3300030500 | Bacteria | 27069 |
| 289 | Ga0268256_1000709 | 3300030500 | Bacteria | 24859 |
| 290 | Ga0268256_1000767 | 3300030500 | Bacteria | 23409 |
| 291 | Ga0268256_1001840 | 3300030500 | Bacteria | 11849 |
| 292 | Ga0268256_1002442 | 3300030500 | Bacteria | 9486 |
| 293 | Ga0268256_1003121 | 3300030500 | Bacteria | 7721 |
| 294 | Ga0268256_1005368 | 3300030500 | Bacteria | 5038 |
| 295 | Ga0268256_1008638 | 3300030500 | Bacteria | 3467 |
| 296 | Ga0268256_1008694 | 3300030500 | Bacteria | 3454 |
| 297 | Ga0268256_1009783 | 3300030500 | Bacteria | 3147 |
| 298 | Ga0268256_1015768 | 3300030500 | Bacteria | 2191 |
| 299 | Ga0268256_1016253 | 3300030500 | Bacteria | 2140 |
| 300 | Ga0316183_1053585 | 3300030742 | Bacteria | 1079 |
| 301 | Ga0307413_10298248 | 3300031824 | Bacteria | 1221 |
| 302 | Ga0307416_100607667 | 3300032002 | Bacteria | 1174 |
| 303 | Ga0307416_100706520 | 3300032002 | Bacteria | 1098 |
| 304 | Ga0395899_0043099 | 3300037312 | Bacteria | 3366 |
| 305 | Ga0395899_0149998 | 3300037312 | Bacteria | 1653 |
| 306 | Ga0395901_0153598 | 3300038443 | Bacteria | 2418 |
| 307 | Ga0436365_0471682 | 3300039437 | Bacteria | 352256 |
| 308 | Ga0436361_0995447 | 3300039447 | Bacteria | 133902 |
| 309 | Ga0439438_000059 | 3300041405 | Bacteria | 51384 |
| 310 | Ga0439438_007349 | 3300041405 | Bacteria | 3773 |
| 311 | Ga0439438_020412 | 3300041405 | Bacteria | 1859 |
| 312 | Ga0439438_024994 | 3300041405 | Bacteria | 1631 |
| 313 | Ga0439447_000863 | 3300041407 | Bacteria | 11130 |
| 314 | Ga0439447_005242 | 3300041407 | Bacteria | 4329 |
| 315 | Ga0439447_006174 | 3300041407 | Bacteria | 3911 |
| 316 | Ga0439466_0000004 | 3300041411 | Bacteria | 462654 |
| 317 | Ga0451853_2456147 | 3300041512 | Bacteria | 5603 |
| 318 | Ga0439448_0006624 | 3300042005 | Bacteria | 3335 |
| 319 | Ga0439432_003141 | 3300042006 | Bacteria | 6142 |
| 320 | Ga0439432_004840 | 3300042006 | Bacteria | 4882 |
| 321 | Ga0439449_0072347 | 3300042007 | Bacteria | 1270 |
| 322 | Ga0439450_009891 | 3300042008 | Bacteria | 1824 |
| 323 | Ga0439452_000006 | 3300042010 | Bacteria | 645083 |
| 324 | Ga0439452_000009 | 3300042010 | Bacteria | 569493 |
| 325 | Ga0439452_000011 | 3300042010 | Bacteria | 428451 |
| 326 | Ga0439452_000272 | 3300042010 | Bacteria | 34192 |
| 327 | Ga0439452_003757 | 3300042010 | Bacteria | 5229 |
| 328 | Ga0439463_005230 | 3300042016 | Bacteria | 3226 |
| 329 | Ga0450907_000024 | 3300042146 | Bacteria | 73273 |
| 330 | Ga0439464_0001001 | 3300042439 | Bacteria | 6430 |
| 331 | Ga0439464_0053990 | 3300042439 | Bacteria | 1167 |
| 332 | Ga0466981_0000001 | 3300044669 | Bacteria | 367980 |
| 333 | Ga0466965_0007746 | 3300044683 | Bacteria | 4942 |
| 334 | Ga0466966_0019529 | 3300044684 | Bacteria | 4458 |
| 335 | Ga0466971_0051382 | 3300044719 | Bacteria | 1855 |
| 336 | Ga0466959_0182467 | 3300045049 | Bacteria | 1467 |
| 337 | Ga0451576_0030242 | 3300045051 | Bacteria | 5791 |
| 338 | Ga0466958_0174061 | 3300045836 | Bacteria | 1364 |
| 339 | Ga0466967_0513746 | 3300045976 | Bacteria | 1177 |
| 340 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 341 | Ga0495617_000362 | 3300046452 | Bacteria | 25053 |
| 342 | Ga0495617_069510 | 3300046452 | Bacteria | 1158 |
| 343 | Ga0495627_000111 | 3300046453 | Bacteria | 101652 |
| 344 | Ga0495627_000344 | 3300046453 | Bacteria | 43801 |
| 345 | Ga0495627_022241 | 3300046453 | Bacteria | 2088 |
| 346 | Ga0495603_0014885 | 3300046455 | Bacteria | 4705 |
| 347 | Ga0495603_0136129 | 3300046455 | Bacteria | 1429 |
| 348 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 349 | Ga0495590_0042440 | 3300046457 | Bacteria | 1585 |
| 350 | Ga0495590_0088393 | 3300046457 | Bacteria | 1095 |
| 351 | Ga0495591_000045 | 3300046458 | Bacteria | 145091 |
| 352 | Ga0495591_000062 | 3300046458 | Bacteria | 124615 |
| 353 | Ga0495591_020797 | 3300046458 | Bacteria | 2158 |
| 354 | Ga0495591_026163 | 3300046458 | Bacteria | 1818 |
| 355 | Ga0495629_0019494 | 3300046459 | Bacteria | 4844 |
| 356 | Ga0495629_0047544 | 3300046459 | Bacteria | 3010 |
| 357 | Ga0495638_0004537 | 3300046460 | Bacteria | 10516 |
| 358 | Ga0495653_0013262 | 3300046463 | Bacteria | 6719 |
| 359 | Ga0495653_0141892 | 3300046463 | Bacteria | 1688 |
| 360 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 361 | Ga0495650_0000040 | 3300046471 | Bacteria | 366254 |
| 362 | Ga0495650_0019534 | 3300046471 | Bacteria | 3330 |
| 363 | Ga0495580_0069933 | 3300046472 | Bacteria | 2452 |
| 364 | Ga0495582_0023795 | 3300046473 | Bacteria | 3348 |
| 365 | Ga0495605_0000092 | 3300046474 | Bacteria | 115315 |
| 366 | Ga0495605_0003289 | 3300046474 | Bacteria | 9687 |
| 367 | Ga0495605_0013027 | 3300046474 | Bacteria | 4597 |
| 368 | Ga0495605_0111993 | 3300046474 | Bacteria | 1244 |
| 369 | Ga0495605_0112845 | 3300046474 | Bacteria | 1238 |
| 370 | Ga0495584_0000007 | 3300046491 | Bacteria | 294820 |
| 371 | Ga0495584_0000238 | 3300046491 | Bacteria | 39636 |
| 372 | Ga0495584_0013955 | 3300046491 | Bacteria | 4093 |
| 373 | Ga0495584_0020413 | 3300046491 | Bacteria | 3366 |
| 374 | Ga0495584_0094690 | 3300046491 | Bacteria | 1507 |
| 375 | Ga0495584_0102855 | 3300046491 | Bacteria | 1444 |
| 376 | Ga0495584_0248369 | 3300046491 | Bacteria | 904 |
| 377 | Ga0495585_0000090 | 3300046492 | Bacteria | 95790 |
| 378 | Ga0495585_0000812 | 3300046492 | Bacteria | 27226 |
| 379 | Ga0495585_0003197 | 3300046492 | Bacteria | 11187 |
| 380 | Ga0495585_0013108 | 3300046492 | Bacteria | 4860 |
| 381 | Ga0495585_0019777 | 3300046492 | Bacteria | 3878 |
| 382 | Ga0495585_0028690 | 3300046492 | Bacteria | 3172 |
| 383 | Ga0495585_0030105 | 3300046492 | Bacteria | 3088 |
| 384 | Ga0495585_0088314 | 3300046492 | Bacteria | 1672 |
| 385 | Ga0495585_0095011 | 3300046492 | Bacteria | 1601 |
| 386 | Ga0495585_0152042 | 3300046492 | Bacteria | 1206 |
| 387 | Ga0495585_0170495 | 3300046492 | Bacteria | 1124 |
| 388 | Ga0495594_0137780 | 3300046499 | Bacteria | 1383 |
| 389 | Ga0495594_0138380 | 3300046499 | Bacteria | 1380 |
| 390 | Ga0495596_0001144 | 3300046500 | Bacteria | 15594 |
| 391 | Ga0495596_0003412 | 3300046500 | Bacteria | 8056 |
| 392 | Ga0495596_0004492 | 3300046500 | Bacteria | 6779 |
| 393 | Ga0495596_0004525 | 3300046500 | Bacteria | 6758 |
| 394 | Ga0495596_0010126 | 3300046500 | Bacteria | 4120 |
| 395 | Ga0495596_0011749 | 3300046500 | Bacteria | 3761 |
| 396 | Ga0495596_0054090 | 3300046500 | Bacteria | 1570 |
| 397 | Ga0495607_0000811 | 3300046501 | Bacteria | 29602 |
| 398 | Ga0495607_0000887 | 3300046501 | Bacteria | 27907 |
| 399 | Ga0495607_0002622 | 3300046501 | Bacteria | 14447 |
| 400 | Ga0495607_0032797 | 3300046501 | Bacteria | 3166 |
| 401 | Ga0495607_0049037 | 3300046501 | Bacteria | 2465 |
| 402 | Ga0495607_0094901 | 3300046501 | Bacteria | 1608 |
| 403 | Ga0495607_0210408 | 3300046501 | Bacteria | 957 |
| 404 | Ga0495583_0000075 | 3300046506 | Bacteria | 177074 |
| 405 | Ga0495583_0000302 | 3300046506 | Bacteria | 78475 |
| 406 | Ga0495583_0000462 | 3300046506 | Bacteria | 60161 |
| 407 | Ga0495583_0000520 | 3300046506 | Bacteria | 54664 |
| 408 | Ga0495583_0050584 | 3300046506 | Bacteria | 1898 |
| 409 | Ga0495583_0114721 | 3300046506 | Bacteria | 1139 |
| 410 | Ga0495606_0001700 | 3300046507 | Bacteria | 28418 |
| 411 | Ga0495606_0022090 | 3300046507 | Bacteria | 4647 |
| 412 | Ga0495606_0051953 | 3300046507 | Bacteria | 2669 |
| 413 | Ga0495606_0073446 | 3300046507 | Bacteria | 2146 |
| 414 | Ga0495610_0007411 | 3300046512 | Bacteria | 7309 |
| 415 | Ga0495616_0000171 | 3300046513 | Bacteria | 55006 |
| 416 | Ga0495616_0000241 | 3300046513 | Bacteria | 44479 |
| 417 | Ga0495616_0001157 | 3300046513 | Bacteria | 18664 |
| 418 | Ga0495616_0012785 | 3300046513 | Bacteria | 4751 |
| 419 | Ga0495616_0021816 | 3300046513 | Bacteria | 3463 |
| 420 | Ga0495616_0033345 | 3300046513 | Bacteria | 2684 |
| 421 | Ga0495616_0051445 | 3300046513 | Bacteria | 2054 |
| 422 | Ga0495616_0112099 | 3300046513 | Bacteria | 1266 |
| 423 | Ga0495620_0013112 | 3300046515 | Bacteria | 4254 |
| 424 | Ga0495620_0026872 | 3300046515 | Bacteria | 2701 |
| 425 | Ga0495630_0183705 | 3300046517 | Bacteria | 1595 |
| 426 | Ga0495631_0003035 | 3300046518 | Bacteria | 9278 |
| 427 | Ga0495631_0010395 | 3300046518 | Bacteria | 4606 |
| 428 | Ga0495631_0014348 | 3300046518 | Bacteria | 3826 |
| 429 | Ga0495631_0081636 | 3300046518 | Bacteria | 1394 |
| 430 | Ga0495631_0132559 | 3300046518 | Bacteria | 1070 |
| 431 | Ga0495632_0000068 | 3300046519 | Bacteria | 108872 |
| 432 | Ga0495632_0000768 | 3300046519 | Bacteria | 28760 |
| 433 | Ga0495632_0001646 | 3300046519 | Bacteria | 18311 |
| 434 | Ga0495632_0004545 | 3300046519 | Bacteria | 9402 |
| 435 | Ga0495632_0007063 | 3300046519 | Bacteria | 7114 |
| 436 | Ga0495632_0025534 | 3300046519 | Bacteria | 3123 |
| 437 | Ga0495637_0000019 | 3300046520 | Bacteria | 185953 |
| 438 | Ga0495637_0045269 | 3300046520 | Bacteria | 1868 |
| 439 | Ga0495637_0101186 | 3300046520 | Bacteria | 1125 |
| 440 | Ga0495643_0002408 | 3300046522 | Bacteria | 14881 |
| 441 | Ga0495643_0005881 | 3300046522 | Bacteria | 8203 |
| 442 | Ga0495643_0026600 | 3300046522 | Bacteria | 3262 |
| 443 | Ga0495643_0072042 | 3300046522 | Bacteria | 1813 |
| 444 | Ga0495643_0197885 | 3300046522 | Bacteria | 966 |
| 445 | Ga0495644_0000354 | 3300046523 | Bacteria | 20756 |
| 446 | Ga0495644_0006372 | 3300046523 | Bacteria | 4578 |
| 447 | Ga0495644_0047395 | 3300046523 | Bacteria | 1614 |
| 448 | Ga0495644_0050621 | 3300046523 | Bacteria | 1559 |
| 449 | Ga0495648_0000091 | 3300046524 | Bacteria | 113822 |
| 450 | Ga0495648_0000193 | 3300046524 | Bacteria | 70395 |
| 451 | Ga0495648_0000934 | 3300046524 | Bacteria | 30369 |
| 452 | Ga0495648_0001612 | 3300046524 | Bacteria | 21954 |
| 453 | Ga0495648_0029763 | 3300046524 | Bacteria | 3619 |
| 454 | Ga0495648_0084608 | 3300046524 | Bacteria | 1794 |
| 455 | Ga0495666_0000511 | 3300046526 | Bacteria | 17250 |
| 456 | Ga0495666_0007365 | 3300046526 | Bacteria | 5516 |
| 457 | Ga0495642_0000217 | 3300046528 | Bacteria | 33101 |
| 458 | Ga0495642_0003097 | 3300046528 | Bacteria | 6603 |
| 459 | Ga0495642_0007047 | 3300046528 | Bacteria | 4314 |
| 460 | Ga0495642_0008426 | 3300046528 | Bacteria | 3946 |
| 461 | Ga0495642_0014656 | 3300046528 | Bacteria | 3040 |
| 462 | Ga0495654_0000073 | 3300046530 | Bacteria | 115044 |
| 463 | Ga0495654_0000171 | 3300046530 | Bacteria | 63960 |
| 464 | Ga0495654_0125259 | 3300046530 | Bacteria | 1158 |
| 465 | Ga0495665_0008709 | 3300046531 | Bacteria | 5508 |
| 466 | Ga0495665_0046155 | 3300046531 | Bacteria | 2314 |
| 467 | Ga0495640_0034754 | 3300046533 | Bacteria | 3570 |
| 468 | Ga0495640_0171574 | 3300046533 | Bacteria | 1386 |
| 469 | Ga0495586_0015955 | 3300046535 | Bacteria | 3996 |
| 470 | Ga0495587_0093649 | 3300046536 | Bacteria | 1734 |
| 471 | Ga0495609_0000716 | 3300046538 | Bacteria | 25241 |
| 472 | Ga0495609_0022169 | 3300046538 | Bacteria | 2927 |
| 473 | Ga0495609_0085952 | 3300046538 | Bacteria | 1371 |
| 474 | Ga0495609_0093881 | 3300046538 | Bacteria | 1303 |
| 475 | Ga0495609_0126713 | 3300046538 | Bacteria | 1095 |
| 476 | Ga0495597_0000738 | 3300046542 | Bacteria | 26102 |
| 477 | Ga0495597_0001122 | 3300046542 | Bacteria | 20254 |
| 478 | Ga0495597_0001580 | 3300046542 | Bacteria | 16010 |
| 479 | Ga0495597_0009125 | 3300046542 | Bacteria | 4923 |
| 480 | Ga0495622_0003617 | 3300046557 | Bacteria | 7257 |
| 481 | Ga0495622_0175168 | 3300046557 | Bacteria | 963 |
| 482 | Ga0495633_0010347 | 3300046558 | Bacteria | 5096 |
| 483 | Ga0495633_0020436 | 3300046558 | Bacteria | 3330 |
| 484 | Ga0495633_0036783 | 3300046558 | Bacteria | 2344 |
| 485 | Ga0495633_0094860 | 3300046558 | Bacteria | 1386 |
| 486 | Ga0495656_0032664 | 3300046615 | Bacteria | 2119 |
| 487 | Ga0495668_0000139 | 3300046616 | Bacteria | 109589 |
| 488 | Ga0495668_0000975 | 3300046616 | Bacteria | 31474 |
| 489 | Ga0495668_0138976 | 3300046616 | Bacteria | 1329 |
| 490 | Ga0495611_0000295 | 3300046648 | Bacteria | 33712 |
| 491 | Ga0495611_0018440 | 3300046648 | Bacteria | 2993 |
| 492 | Ga0495611_0020696 | 3300046648 | Bacteria | 2834 |
| 493 | Ga0495625_0003007 | 3300046660 | Bacteria | 17392 |
| 494 | Ga0495625_0029671 | 3300046660 | Bacteria | 4087 |
| 495 | Ga0495625_0037354 | 3300046660 | Bacteria | 3564 |
| 496 | Ga0495625_0286500 | 3300046660 | Bacteria | 1058 |
| 497 | Ga0495661_0000495 | 3300046665 | Bacteria | 40972 |
| 498 | Ga0495661_0001229 | 3300046665 | Bacteria | 22212 |
| 499 | Ga0495661_0007744 | 3300046665 | Bacteria | 7481 |
| 500 | Ga0495661_0015501 | 3300046665 | Bacteria | 5085 |
| 501 | Ga0495661_0020745 | 3300046665 | Bacteria | 4286 |
| 502 | Ga0495661_0026067 | 3300046665 | Bacteria | 3766 |
| 503 | Ga0495661_0092152 | 3300046665 | Bacteria | 1722 |
| 504 | Ga0495661_0100969 | 3300046665 | Bacteria | 1623 |
| 505 | Ga0495588_0004154 | 3300046674 | Bacteria | 6380 |
| 506 | Ga0495588_0032101 | 3300046674 | Bacteria | 2645 |
| 507 | Ga0495588_0073701 | 3300046674 | Bacteria | 1777 |
| 508 | Ga0495588_0079904 | 3300046674 | Bacteria | 1706 |
| 509 | Ga0495588_0110247 | 3300046674 | Bacteria | 1449 |
| 510 | Ga0495588_0130522 | 3300046674 | Bacteria | 1325 |
| 511 | Ga0495646_0133826 | 3300046680 | Bacteria | 1393 |
| 512 | Ga0495669_0000423 | 3300046684 | Bacteria | 20308 |
| 513 | Ga0495669_0000945 | 3300046684 | Bacteria | 12145 |
| 514 | Ga0495669_0023680 | 3300046684 | Bacteria | 2674 |
| 515 | Ga0495669_0024049 | 3300046684 | Bacteria | 2654 |
| 516 | Ga0495669_0064568 | 3300046684 | Bacteria | 1661 |
| 517 | Ga0495669_0083928 | 3300046684 | Bacteria | 1464 |
| 518 | Ga0495613_0042447 | 3300046689 | Bacteria | 3365 |
| 519 | Ga0495613_0236864 | 3300046689 | Bacteria | 1277 |
| 520 | Ga0495670_0000504 | 3300046691 | Bacteria | 18527 |
| 521 | Ga0495670_0003055 | 3300046691 | Bacteria | 8256 |
| 522 | Ga0495670_0028623 | 3300046691 | Bacteria | 2762 |
| 523 | Ga0495670_0050843 | 3300046691 | Bacteria | 2075 |
| 524 | Ga0495670_0111209 | 3300046691 | Bacteria | 1417 |
| 525 | Ga0495671_0000067 | 3300046692 | Bacteria | 103441 |
| 526 | Ga0495671_0004592 | 3300046692 | Bacteria | 8217 |
| 527 | Ga0495671_0027165 | 3300046692 | Bacteria | 2958 |
| 528 | Ga0495671_0039870 | 3300046692 | Bacteria | 2369 |
| 529 | Ga0495671_0084105 | 3300046692 | Bacteria | 1559 |
| 530 | Ga0495671_0084450 | 3300046692 | Bacteria | 1555 |
| 531 | Ga0495649_0000196 | 3300046694 | Bacteria | 53380 |
| 532 | Ga0495649_0000862 | 3300046694 | Bacteria | 24390 |
| 533 | Ga0495649_0001555 | 3300046694 | Bacteria | 17215 |
| 534 | Ga0495649_0075753 | 3300046694 | Bacteria | 1801 |
| 535 | Ga0495589_0000079 | 3300046794 | Bacteria | 89713 |
| 536 | Ga0495589_0003250 | 3300046794 | Bacteria | 8858 |
| 537 | Ga0495589_0007544 | 3300046794 | Bacteria | 5699 |
| 538 | Ga0495589_0012110 | 3300046794 | Bacteria | 4472 |
| 539 | Ga0495589_0020685 | 3300046794 | Bacteria | 3364 |
| 540 | Ga0495589_0021565 | 3300046794 | Bacteria | 3291 |
| 541 | Ga0495589_0064421 | 3300046794 | Bacteria | 1797 |
| 542 | Ga0495589_0116676 | 3300046794 | Bacteria | 1286 |
| 543 | Ga0495600_0029880 | 3300046809 | Bacteria | 3529 |
| 544 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 545 | Ga0495660_0008204 | 3300046810 | Bacteria | 6122 |
| 546 | Ga0495660_0011483 | 3300046810 | Bacteria | 5138 |
| 547 | Ga0495660_0077996 | 3300046810 | Bacteria | 1742 |
| 548 | Ga0495581_0001697 | 3300047315 | Bacteria | 12261 |
| 549 | Ga0495581_0211700 | 3300047315 | Bacteria | 1133 |
| 550 | Ga0495604_0018117 | 3300047317 | Bacteria | 5637 |
| 551 | Ga0495604_0068660 | 3300047317 | Bacteria | 2689 |
| 552 | Ga0495604_0187737 | 3300047317 | Bacteria | 1442 |
| 553 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 554 | Ga0495672_0000025 | 3300047320 | Bacteria | 365425 |
| 555 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 556 | Ga0495672_0000362 | 3300047320 | Bacteria | 58046 |
| 557 | Ga0495676_0000092 | 3300047321 | Bacteria | 66361 |
| 558 | Ga0495676_0287904 | 3300047321 | Bacteria | 1111 |
| 559 | Ga0495680_0001486 | 3300047322 | Bacteria | 25240 |
| 560 | Ga0495683_0008503 | 3300047323 | Bacteria | 5489 |
| 561 | Ga0495683_0015048 | 3300047323 | Bacteria | 4029 |
| 562 | Ga0495683_0023499 | 3300047323 | Bacteria | 3168 |
| 563 | Ga0495683_0118418 | 3300047323 | Bacteria | 1259 |
| 564 | Ga0495687_000133 | 3300047443 | Bacteria | 113757 |
| 565 | Ga0495687_000537 | 3300047443 | Bacteria | 45261 |
| 566 | Ga0495687_054822 | 3300047443 | Bacteria | 1670 |
| 567 | Ga0495675_0159493 | 3300047444 | Bacteria | 1389 |
| 568 | Ga0495677_0000304 | 3300047445 | Bacteria | 21356 |
| 569 | Ga0495677_0003623 | 3300047445 | Bacteria | 5987 |
| 570 | Ga0495677_0022004 | 3300047445 | Bacteria | 2310 |
| 571 | Ga0495679_000125 | 3300047446 | Bacteria | 68330 |
| 572 | Ga0495679_000813 | 3300047446 | Bacteria | 19820 |
| 573 | Ga0495679_014746 | 3300047446 | Bacteria | 2882 |
| 574 | Ga0495679_026229 | 3300047446 | Bacteria | 1937 |
| 575 | Ga0495679_033633 | 3300047446 | Bacteria | 1636 |
| 576 | Ga0495679_035330 | 3300047446 | Bacteria | 1584 |
| 577 | Ga0495685_004310 | 3300047447 | Bacteria | 4589 |
| 578 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 579 | Ga0495673_0000055 | 3300047469 | Bacteria | 247894 |
| 580 | Ga0495681_0000057 | 3300047470 | Bacteria | 103340 |
| 581 | Ga0495681_0001196 | 3300047470 | Bacteria | 19735 |
| 582 | Ga0495681_0001604 | 3300047470 | Bacteria | 16823 |
| 583 | Ga0495681_0029171 | 3300047470 | Bacteria | 2827 |
| 584 | Ga0495681_0077306 | 3300047470 | Bacteria | 1494 |
| 585 | Ga0495686_0000479 | 3300047472 | Bacteria | 59585 |
| 586 | Ga0495686_0098527 | 3300047472 | Bacteria | 1766 |
| 587 | Ga0495686_0123956 | 3300047472 | Bacteria | 1537 |
| 588 | Ga0495593_0006097 | 3300047673 | Bacteria | 7090 |
| 589 | Ga0495602_0092282 | 3300048088 | Bacteria | 2509 |
| 590 | Ga0495602_0201934 | 3300048088 | Bacteria | 1516 |
| 591 | Ga0495614_0001353 | 3300048089 | Bacteria | 10580 |
| 592 | Ga0495626_0001302 | 3300048091 | Bacteria | 20364 |
| 593 | Ga0495626_0005515 | 3300048091 | Bacteria | 7371 |
| 594 | Ga0495626_0005730 | 3300048091 | Bacteria | 7176 |
| 595 | Ga0495626_0007600 | 3300048091 | Bacteria | 6011 |
| 596 | Ga0495626_0019271 | 3300048091 | Bacteria | 3413 |
| 597 | Ga0495626_0036348 | 3300048091 | Bacteria | 2346 |
| 598 | Ga0495626_0066993 | 3300048091 | Bacteria | 1622 |
| 599 | Ga0495626_0069900 | 3300048091 | Bacteria | 1580 |
| 600 | Ga0495626_0096875 | 3300048091 | Bacteria | 1290 |
| 601 | Ga0495626_0106988 | 3300048091 | Bacteria | 1214 |
| 602 | Ga0495626_0117264 | 3300048091 | Bacteria | 1148 |
| 603 | Ga0496100_0062139 | 3300048903 | Bacteria | 2464 |
| 604 | Ga0496101_0000070 | 3300048904 | Bacteria | 120089 |
| 605 | Ga0496102_0011022 | 3300048905 | Bacteria | 7787 |
| 606 | Ga0496102_0024889 | 3300048905 | Bacteria | 5324 |
| 607 | Ga0496102_0214727 | 3300048905 | Bacteria | 1813 |
| 608 | Ga0496102_0303943 | 3300048905 | Bacteria | 1503 |
| 609 | Ga0496102_0493895 | 3300048905 | Bacteria | 1146 |
| 610 | Ga0496103_0111351 | 3300048906 | Bacteria | 1739 |
| 611 | Ga0496104_0000784 | 3300048907 | Bacteria | 27184 |
| 612 | Ga0496104_0533861 | 3300048907 | Bacteria | 1084 |
| 613 | Ga0496105_0001684 | 3300048908 | Bacteria | 15770 |
| 614 | Ga0496105_0002815 | 3300048908 | Bacteria | 12715 |
| 615 | Ga0496105_0078383 | 3300048908 | Bacteria | 2728 |
| 616 | Ga0496105_0146738 | 3300048908 | Bacteria | 1940 |
| 617 | Ga0496106_0137080 | 3300048909 | Bacteria | 1923 |
| 618 | Ga0496106_0378060 | 3300048909 | Bacteria | 1138 |
| 619 | Ga0496107_0367535 | 3300048910 | Bacteria | 1070 |
| 620 | Ga0496108_0127944 | 3300048911 | Bacteria | 2182 |
| 621 | Ga0496108_0288670 | 3300048911 | Bacteria | 1428 |
| 622 | Ga0496110_0000041 | 3300048913 | Bacteria | 62623 |
| 623 | Ga0496110_0085270 | 3300048913 | Bacteria | 2819 |
| 624 | Ga0496110_0396101 | 3300048913 | Bacteria | 1259 |
| 625 | Ga0496111_0124406 | 3300048914 | Bacteria | 1906 |
| 626 | Ga0496113_0003151 | 3300048916 | Bacteria | 9818 |
| 627 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 628 | Ga0496116_0000308 | 3300048919 | Bacteria | 82039 |
| 629 | Ga0496116_0001206 | 3300048919 | Bacteria | 30232 |
| 630 | Ga0496116_0008765 | 3300048919 | Bacteria | 8724 |
| 631 | Ga0496116_0012638 | 3300048919 | Bacteria | 6876 |
| 632 | Ga0496116_0071530 | 3300048919 | Bacteria | 2195 |
| 633 | Ga0496116_0098690 | 3300048919 | Bacteria | 1751 |
| 634 | Ga0496116_0117880 | 3300048919 | Bacteria | 1543 |
| 635 | Ga0496116_0141374 | 3300048919 | Bacteria | 1353 |
| 636 | Ga0496117_0000043 | 3300048920 | Bacteria | 309583 |
| 637 | Ga0496117_0000680 | 3300048920 | Bacteria | 54289 |
| 638 | Ga0496117_0005315 | 3300048920 | Bacteria | 13611 |
| 639 | Ga0496117_0006484 | 3300048920 | Bacteria | 11814 |
| 640 | Ga0496117_0012853 | 3300048920 | Bacteria | 7341 |
| 641 | Ga0496117_0026290 | 3300048920 | Bacteria | 4556 |
| 642 | Ga0496117_0034334 | 3300048920 | Bacteria | 3822 |
| 643 | Ga0496117_0036218 | 3300048920 | Bacteria | 3695 |
| 644 | Ga0496117_0041200 | 3300048920 | Bacteria | 3386 |
| 645 | Ga0496117_0043194 | 3300048920 | Bacteria | 3280 |
| 646 | Ga0496117_0141147 | 3300048920 | Bacteria | 1442 |
| 647 | Ga0496117_0157617 | 3300048920 | Bacteria | 1334 |
| 648 | Ga0496118_0000075 | 3300048921 | Bacteria | 196228 |
| 649 | Ga0496118_0002357 | 3300048921 | Bacteria | 25603 |
| 650 | Ga0496118_0003898 | 3300048921 | Bacteria | 18290 |
| 651 | Ga0496118_0005445 | 3300048921 | Bacteria | 14466 |
| 652 | Ga0496118_0046672 | 3300048921 | Bacteria | 3366 |
| 653 | Ga0496118_0129377 | 3300048921 | Bacteria | 1625 |
| 654 | Ga0496118_0153428 | 3300048921 | Bacteria | 1437 |
| 655 | Ga0496119_0000096 | 3300048922 | Bacteria | 129464 |
| 656 | Ga0496119_0000324 | 3300048922 | Bacteria | 67043 |
| 657 | Ga0496119_0001622 | 3300048922 | Bacteria | 26597 |
| 658 | Ga0496119_0002543 | 3300048922 | Bacteria | 19843 |
| 659 | Ga0496119_0002626 | 3300048922 | Bacteria | 19506 |
| 660 | Ga0496119_0003023 | 3300048922 | Bacteria | 17807 |
| 661 | Ga0496119_0008155 | 3300048922 | Bacteria | 9271 |
| 662 | Ga0496119_0023352 | 3300048922 | Bacteria | 4390 |
| 663 | Ga0496119_0032034 | 3300048922 | Bacteria | 3510 |
| 664 | Ga0496119_0044583 | 3300048922 | Bacteria | 2790 |
| 665 | Ga0496119_0047715 | 3300048922 | Bacteria | 2662 |
| 666 | Ga0496120_0000414 | 3300048923 | Bacteria | 68051 |
| 667 | Ga0496120_0000805 | 3300048923 | Bacteria | 45144 |
| 668 | Ga0496120_0001565 | 3300048923 | Bacteria | 26766 |
| 669 | Ga0496120_0002290 | 3300048923 | Bacteria | 19860 |
| 670 | Ga0496120_0007007 | 3300048923 | Bacteria | 8477 |
| 671 | Ga0496120_0022121 | 3300048923 | Bacteria | 4003 |
| 672 | Ga0496120_0026009 | 3300048923 | Bacteria | 3622 |
| 673 | Ga0496120_0041470 | 3300048923 | Bacteria | 2695 |
| 674 | Ga0496120_0042161 | 3300048923 | Bacteria | 2667 |
| 675 | Ga0496120_0122365 | 3300048923 | Bacteria | 1343 |
| 676 | Ga0496121_0000057 | 3300048924 | Bacteria | 294291 |
| 677 | Ga0496121_0001878 | 3300048924 | Bacteria | 33739 |
| 678 | Ga0496121_0002032 | 3300048924 | Bacteria | 32040 |
| 679 | Ga0496121_0004592 | 3300048924 | Bacteria | 18406 |
| 680 | Ga0496121_0006182 | 3300048924 | Bacteria | 15016 |
| 681 | Ga0496121_0007418 | 3300048924 | Bacteria | 13251 |
| 682 | Ga0496121_0008060 | 3300048924 | Bacteria | 12552 |
| 683 | Ga0496121_0011195 | 3300048924 | Bacteria | 9998 |
| 684 | Ga0496122_0000016 | 3300048925 | Bacteria | 443353 |
| 685 | Ga0496122_0000988 | 3300048925 | Bacteria | 50798 |
| 686 | Ga0496122_0003346 | 3300048925 | Bacteria | 21148 |
| 687 | Ga0496122_0008283 | 3300048925 | Bacteria | 11273 |
| 688 | Ga0496122_0011751 | 3300048925 | Bacteria | 8821 |
| 689 | Ga0496122_0011840 | 3300048925 | Bacteria | 8767 |
| 690 | Ga0496122_0019814 | 3300048925 | Bacteria | 6123 |
| 691 | Ga0496122_0032610 | 3300048925 | Bacteria | 4303 |
| 692 | Ga0496122_0040471 | 3300048925 | Bacteria | 3702 |
| 693 | Ga0496122_0047847 | 3300048925 | Bacteria | 3295 |
| 694 | Ga0496122_0054640 | 3300048925 | Bacteria | 2996 |
| 695 | Ga0496122_0197731 | 3300048925 | Bacteria | 1179 |
| 696 | Ga0496123_0000017 | 3300048926 | Bacteria | 415261 |
| 697 | Ga0496123_0000195 | 3300048926 | Bacteria | 123066 |
| 698 | Ga0496123_0000198 | 3300048926 | Bacteria | 122508 |
| 699 | Ga0496123_0001702 | 3300048926 | Bacteria | 29390 |
| 700 | Ga0496123_0002965 | 3300048926 | Bacteria | 19757 |
| 701 | Ga0496123_0006820 | 3300048926 | Bacteria | 10960 |
| 702 | Ga0496123_0009791 | 3300048926 | Bacteria | 8563 |
| 703 | Ga0496123_0010368 | 3300048926 | Bacteria | 8248 |
| 704 | Ga0496123_0036775 | 3300048926 | Bacteria | 3464 |
| 705 | Ga0496123_0050150 | 3300048926 | Bacteria | 2791 |
| 706 | Ga0496123_0057697 | 3300048926 | Bacteria | 2524 |
| 707 | Ga0496123_0080604 | 3300048926 | Bacteria | 1982 |
| 708 | Ga0496124_0000246 | 3300048927 | Bacteria | 104777 |
| 709 | Ga0496124_0000342 | 3300048927 | Bacteria | 85288 |
| 710 | Ga0496124_0001425 | 3300048927 | Bacteria | 35407 |
| 711 | Ga0496124_0002044 | 3300048927 | Bacteria | 27417 |
| 712 | Ga0496124_0011023 | 3300048927 | Bacteria | 9079 |
| 713 | Ga0496124_0015844 | 3300048927 | Bacteria | 7200 |
| 714 | Ga0496124_0024609 | 3300048927 | Bacteria | 5469 |
| 715 | Ga0496124_0032630 | 3300048927 | Bacteria | 4594 |
| 716 | Ga0496124_0142628 | 3300048927 | Bacteria | 1888 |
| 717 | Ga0496124_0167696 | 3300048927 | Bacteria | 1704 |
| 718 | Ga0496124_0175516 | 3300048927 | Bacteria | 1654 |
| 719 | Ga0496125_0000257 | 3300048928 | Bacteria | 109544 |
| 720 | Ga0496125_0002401 | 3300048928 | Bacteria | 24385 |
| 721 | Ga0496125_0002508 | 3300048928 | Bacteria | 23738 |
| 722 | Ga0496125_0004530 | 3300048928 | Bacteria | 15961 |
| 723 | Ga0496125_0008673 | 3300048928 | Bacteria | 10591 |
| 724 | Ga0496125_0030552 | 3300048928 | Bacteria | 4817 |
| 725 | Ga0496125_0036882 | 3300048928 | Bacteria | 4258 |
| 726 | Ga0496125_0043350 | 3300048928 | Bacteria | 3820 |
| 727 | Ga0496125_0076493 | 3300048928 | Bacteria | 2584 |
| 728 | Ga0496125_0157828 | 3300048928 | Bacteria | 1546 |
| 729 | Ga0496126_0001485 | 3300048929 | Bacteria | 36383 |
| 730 | Ga0496126_0003691 | 3300048929 | Bacteria | 19126 |
| 731 | Ga0496126_0021288 | 3300048929 | Bacteria | 6335 |
| 732 | Ga0496126_0143279 | 3300048929 | Bacteria | 2055 |
| 733 | Ga0496126_0169557 | 3300048929 | Bacteria | 1860 |
| 734 | Ga0496126_0276688 | 3300048929 | Bacteria | 1391 |
| 735 | Ga0496126_0401492 | 3300048929 | Bacteria | 1111 |
| 736 | Ga0495678_000070 | 3300049459 | Bacteria | 131437 |
| 737 | Ga0495678_000105 | 3300049459 | Bacteria | 103599 |
| 738 | Ga0495678_000486 | 3300049459 | Bacteria | 39405 |
| 739 | Ga0495678_030330 | 3300049459 | Bacteria | 2264 |
| 740 | Ga0495682_0000017 | 3300049460 | Bacteria | 233333 |
| 741 | Ga0495682_0000362 | 3300049460 | Bacteria | 33117 |
| 742 | nmdc:mga00v17_182327_c1 | 3300050491 | Bacteria | 1355 |
| 743 | nmdc:mga0k408_10650_c1 | 3300050493 | Bacteria | 4978 |
| 744 | nmdc:mga0k408_73277_c1 | 3300050493 | Bacteria | 2000 |
| 745 | nmdc:mga0n895_225416_c1 | 3300050512 | Bacteria | 1902 |
| 746 | Ga0500618_000081 | 3300053125 | Bacteria | 77777 |
| 747 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 748 | Ga0500559_0001601 | 3300053136 | Bacteria | 12596 |
| 749 | Ga0500622_0032842 | 3300053156 | Bacteria | 2721 |
| 750 | Ga0500639_007555 | 3300053163 | Bacteria | 5647 |
| 751 | Ga0500576_097623 | 3300053725 | Bacteria | 1206 |
| 752 | Ga0500596_011788 | 3300053735 | Bacteria | 1333 |
| 753 | Ga0466962_0076173 | 3300061719 | Bacteria | 1603 |
| 754 | 2511378171 | 2511231025 | Bacteria | 5324661 |
| 755 | 2511436696 | 2511231035 | Bacteria | 5341610 |
| 756 | 2538427663 | 2537561728 | Bacteria | 5149301 |
| 757 | 2547696048 | 2547132181 | Bacteria | 4945084 |
| 758 | 2548649987 | 2547132416 | Bacteria | 4633861 |
| 759 | 2555258842 | 2554235234 | Bacteria | 5762085 |
| 760 | 2562464571 | 2561511199 | Bacteria | 5155034 |
| 761 | 2599928827 | 2599185299 | Bacteria | 4854625 |
| 762 | 2601534376 | 2600255256 | Bacteria | 5597742 |
| 763 | 2601538845 | 2600255257 | Bacteria | 5597196 |
| 764 | 2601757194 | 2600255310 | Bacteria | 5600903 |
| 765 | 2601762205 | 2600255311 | Bacteria | 5598766 |
| 766 | 2603639543 | 2602042046 | Bacteria | 5483348 |
| 767 | 2603644277 | 2602042047 | Bacteria | 4697674 |
| 768 | 2603701201 | 2602042066 | Bacteria | 4423871 |
| 769 | 2603704880 | 2602042067 | Bacteria | 4863713 |
| 770 | 2608670967 | 2608642108 | Bacteria | 4104624 |
| 771 | 2609911455 | 2609459761 | Bacteria | 5513740 |
| 772 | 2650897577 | 2648501693 | Bacteria | 5069560 |
| 773 | 2656278013 | 2654587920 | Bacteria | 5475511 |
| 774 | 2671104600 | 2667528172 | Bacteria | 5170840 |
| 775 | 2681998051 | 2681812866 | Bacteria | 4552357 |
| 776 | 2682008158 | 2681812869 | Bacteria | 5014465 |
| 777 | 2686354953 | 2684622997 | Bacteria | 4624240 |
| 778 | 2689443145 | 2687453601 | Bacteria | 5546041 |
| 779 | 2707098108 | 2706794495 | Bacteria | 4536932 |
| 780 | 2712471249 | 2711768156 | Bacteria | 4471618 |
| 781 | 2753857683 | 2751185917 | Bacteria | 4551186 |
| 782 | 2765590785 | 2765235842 | Bacteria | 4799256 |
| 783 | 2775540343 | 2775506706 | Bacteria | 4873073 |
| 784 | 2791925249 | 2791354903 | Bacteria | 4937680 |
| 785 | 2792312633 | 2791355010 | Bacteria | 4864581 |
| 786 | 2793403925 | 2791355275 | Bacteria | 4429597 |
| 787 | 2809126338 | 2808606414 | Bacteria | 4917181 |
| 788 | 2813726829 | 2811995292 | Bacteria | 5303342 |
| 789 | 2814694202 | 2814123068 | Bacteria | 5687681 |
| 790 | 2821120671 | 2821118458 | Bacteria | 4714306 |
| 791 | 2823376546 | 2823373977 | Bacteria | 4779415 |
| 792 | 2844429172 | 2844425489 | Bacteria | 4854065 |
| 793 | 2844530328 | 2844528606 | Bacteria | 4733806 |
| 794 | 2847798498 | 2847797336 | Bacteria | 5176640 |
| 795 | 2854605640 | 2854601825 | Bacteria | 4797592 |
| 796 | 2855199116 | 2855195626 | Bacteria | 4927512 |
| 797 | 2858467204 | 2858466076 | Bacteria | 4722413 |
| 798 | 2865016316 | 2865014394 | Bacteria | 4764573 |
| 799 | 2869552553 | 2869551831 | Bacteria | 5474685 |
| 800 | 2871273043 | 2871272651 | Bacteria | 5042015 |
| 801 | 2871283101 | 2871282230 | Bacteria | 4917173 |
| 802 | 2876601537 | 2876601092 | Bacteria | 5114497 |
| 803 | 2881613890 | 2881609920 | Bacteria | 4405319 |
| 804 | 2884087088 | 2884086401 | Bacteria | 5005459 |
| 805 | 2888374961 | 2888373701 | Bacteria | 5098052 |
| 806 | 2891671616 | 2891670763 | Bacteria | 4967099 |
| 807 | 2900053443 | 2900051742 | Bacteria | 4985156 |
| 808 | 2904506924 | 2904504865 | Bacteria | 5152820 |
| 809 | 2919113409 | 2919108558 | Bacteria | 5897419 |
| 810 | 2923636676 | 2923634449 | Bacteria | 4753480 |
| 811 | 2927836851 | 2927833300 | Bacteria | 4923934 |
| 812 | 2932406683 | 2932406140 | Bacteria | 5134491 |
| 813 | 2935629449 | 2935625433 | Bacteria | 5042964 |
| 814 | 2937544058 | 2937539931 | Bacteria | 4639830 |
| 815 | 2939572359 | 2939568625 | Bacteria | 4542555 |
| 816 | 2939576533 | 2939573065 | Bacteria | 4926053 |
| 817 | 2939577895 | 2939577877 | Bacteria | 5132791 |
| 818 | 2939604549 | 2939602548 | Bacteria | 4950493 |
| 819 | 2939610506 | 2939607340 | Bacteria | 4719256 |
| 820 | 2939620512 | 2939617950 | Bacteria | 4820956 |
| 821 | 2939645564 | 2939642701 | Bacteria | 4475280 |
| 822 | 2945875886 | 2945874760 | Bacteria | 5527237 |
| 823 | 2945951753 | 2945951305 | Bacteria | 4918162 |
| 824 | 2971821597 | 2971820967 | Bacteria | 5823634 |
| 825 | 2974440244 | 2974435778 | Bacteria | 4876478 |
| 826 | 2978978290 | 2978975091 | Bacteria | 4704313 |
| 827 | 2984495316 | 2984494565 | Bacteria | 5000175 |
| 828 | 2990265027 | 2990261002 | Bacteria | 4919493 |
| 829 | 3000380642 | 3000376612 | Bacteria | 4705565 |
| 830 | 8016734682 | 8016733728 | Bacteria | 5274317 |
| 831 | 8018225656 | 8018221730 | Bacteria | 4616064 |
| 832 | 8018407023 | 8018405270 | Bacteria | 4978981 |
| 833 | 8019503854 | 8019499862 | Bacteria | 5169538 |
| 834 | 8019507531 | 8019504834 | Bacteria | 4819156 |
| 835 | 8054848244 | 8054844752 | Bacteria | 4450330 |
| 836 | 8054853666 | 8054849141 | Bacteria | 5232694 |
| 837 | 8055089588 | 8055087960 | Bacteria | 4784273 |
| 838 | 8055095926 | 8055092621 | Bacteria | 4873875 |
| 839 | 8055101676 | 8055097453 | Bacteria | 4865496 |
| 840 | Ga0495607_0000319 | |||
| 841 | RicEn_C1845 | |||
| 842 | SwRhRL2b_contig_2888319 | |||
| 843 | SwRhRL2b_contig_922063 | |||
| 844 | JGI24739J22299_10000001 | |||
| 845 | JGI25152J39213_1000409 | |||
| 846 | rootH2_10040343 | |||
| 847 | Ga0058692_1000249 | |||
| 848 | Ga0058692_1000486 | |||
| 849 | Ga0058692_1000595 | |||
| 850 | Ga0058692_1000599 | |||
| 851 | Ga0058692_1001060 | |||
| 852 | Ga0058692_1001128 | |||
| 853 | Ga0058692_1002378 | |||
| 854 | Ga0058692_1008919 | |||
| 855 | Ga0058692_1034327 | |||
| 856 | Ga0058692_1034348 | |||
| 857 | Ga0065165_1003438 | |||
| 858 | Ga0065704_10000814 | |||
| 859 | Ga0065704_10000919 | |||
| 860 | Ga0065704_10002360 | |||
| 861 | Ga0065704_10081576 | |||
| 862 | Ga0070658_10026859 | |||
| 863 | Ga0070658_10169195 | |||
| 864 | Ga0070676_10006595 | |||
| 865 | Ga0070690_100028963 | |||
| 866 | Ga0070670_100159472 | |||
| 867 | Ga0070670_100229980 | |||
| 868 | Ga0070677_10131155 | |||
| 869 | Ga0068869_100091142 | |||
| 870 | Ga0070666_10001342 | |||
| 871 | Ga0070666_10049807 | |||
| 872 | Ga0068868_100183270 | |||
| 873 | Ga0068868_100543585 | |||
| 874 | Ga0070660_100265379 | |||
| 875 | Ga0070668_100000561 | |||
| 876 | Ga0070668_100005676 | |||
| 877 | Ga0070668_100278470 | |||
| 878 | Ga0070669_100008965 | |||
| 879 | Ga0070671_100008011 | |||
| 880 | Ga0070674_100079190 | |||
| 881 | Ga0070673_100206492 | |||
| 882 | Ga0070659_100420588 | |||
| 883 | Ga0070667_100013076 | |||
| 884 | Ga0070667_100017549 | |||
| 885 | Ga0070667_100316446 | |||
| 886 | Ga0070700_100043085 | |||
| 887 | Ga0070678_100013453 | |||
| 888 | Ga0070662_100018152 | |||
| 889 | Ga0068867_100002855 | |||
| 890 | Ga0068867_100123631 | |||
| 891 | Ga0070672_100016710 | |||
| 892 | Ga0070672_100052400 | |||
| 893 | Ga0070665_100000743 | |||
| 894 | Ga0070665_100027871 | |||
| 895 | Ga0070665_100261104 | |||
| 896 | Ga0068855_100041605 | |||
| 897 | Ga0068857_100000067 | |||
| 898 | Ga0068852_100290016 | |||
| 899 | Ga0068864_100107680 | |||
| 900 | Ga0068861_100013043 | |||
| 901 | Ga0068851_10023381 | |||
| 902 | Ga0068863_100036313 | |||
| 903 | Ga0068858_100024788 | |||
| 904 | Ga0068858_100103339 | |||
| 905 | Ga0068862_100072878 | |||
| 906 | Ga0081538_10080928 | |||
| 907 | Ga0075365_10005166 | |||
| 908 | Ga0075364_10012505 | |||
| 909 | Ga0075364_10027764 | |||
| 910 | Ga0075366_10031034 | |||
| 911 | Ga0075366_10049300 | |||
| 912 | Ga0075434_100128665 | |||
| 913 | Ga0068865_100014203 | |||
| 914 | Ga0079104_1000495 | |||
| 915 | Ga0079104_1000655 | |||
| 916 | Ga0079104_1001059 | |||
| 917 | Ga0079104_1001504 | |||
| 918 | Ga0079104_1001641 | |||
| 919 | Ga0079104_1001726 | |||
| 920 | Ga0079104_1005852 | |||
| 921 | Ga0079104_1010394 | |||
| 922 | Ga0105251_10000722 | |||
| 923 | Ga0105251_10001434 | |||
| 924 | Ga0105251_10001545 | |||
| 925 | Ga0105251_10002234 | |||
| 926 | Ga0105251_10005461 | |||
| 927 | Ga0105251_10022052 | |||
| 928 | Ga0105251_10025717 | |||
| 929 | Ga0105251_10030042 | |||
| 930 | Ga0105251_10032249 | |||
| 931 | Ga0105251_10035801 | |||
| 932 | Ga0105244_10000033 | |||
| 933 | Ga0105244_10000371 | |||
| 934 | Ga0105244_10002356 | |||
| 935 | Ga0105244_10002669 | |||
| 936 | Ga0105244_10004051 | |||
| 937 | Ga0105244_10004939 | |||
| 938 | Ga0105244_10010000 | |||
| 939 | Ga0105244_10020465 | |||
| 940 | Ga0105244_10028439 | |||
| 941 | Ga0105244_10040059 | |||
| 942 | Ga0105244_10062091 | |||
| 943 | Ga0105244_10200446 | |||
| 944 | Ga0105250_10000042 | |||
| 945 | Ga0105250_10000171 | |||
| 946 | Ga0105250_10000367 | |||
| 947 | Ga0105250_10000602 | |||
| 948 | Ga0105250_10003171 | |||
| 949 | Ga0105250_10003650 | |||
| 950 | Ga0105250_10004305 | |||
| 951 | Ga0105250_10005392 | |||
| 952 | Ga0105250_10011656 | |||
| 953 | Ga0105250_10029973 | |||
| 954 | Ga0105240_10507222 | |||
| 955 | Ga0105245_10113487 | |||
| 956 | Ga0105247_10000211 | |||
| 957 | Ga0105247_10435804 | |||
| 958 | Ga0105243_10050485 | |||
| 959 | Ga0105243_10057566 | |||
| 960 | Ga0105243_10401893 | |||
| 961 | Ga0105243_10487240 | |||
| 962 | Ga0105241_10531192 | |||
| 963 | Ga0105248_10009287 | |||
| 964 | Ga0105248_10069967 | |||
| 965 | Ga0105249_10021079 | |||
| 966 | Ga0105249_10328817 | |||
| 967 | Ga0105246_10011239 | |||
| 968 | Ga0105246_10132678 | |||
| 969 | Ga0157373_10007352 | |||
| 970 | Ga0157373_10018632 | |||
| 971 | Ga0157371_10000778 | |||
| 972 | Ga0157371_10009635 | |||
| 973 | Ga0157371_10025580 | |||
| 974 | Ga0157371_10039445 | |||
| 975 | Ga0157370_10000656 | |||
| 976 | Ga0157370_10047674 | |||
| 977 | Ga0157369_10000859 | |||
| 978 | Ga0157369_10015721 | |||
| 979 | Ga0157374_10153417 | |||
| 980 | Ga0163162_10076147 | |||
| 981 | Ga0163162_10123714 | |||
| 982 | Ga0157372_10001196 | |||
| 983 | Ga0157372_10022056 | |||
| 984 | Ga0157372_10044827 | |||
| 985 | Ga0157372_10081055 | |||
| 986 | Ga0157372_10154346 | |||
| 987 | Ga0157372_10359464 | |||
| 988 | Ga0157372_10537038 | |||
| 989 | Ga0157375_10015708 | |||
| 990 | Ga0157375_10025372 | |||
| 991 | Ga0157380_10001789 | |||
| 992 | Ga0182008_10010160 | |||
| 993 | Ga0157379_10020433 | |||
| 994 | Ga0157379_10131248 | |||
| 995 | Ga0157376_10829319 | |||
| 996 | Ga0182006_1000422 | |||
| 997 | Ga0182007_10007375 | |||
| 998 | Ga0183366_1002 | |||
| 999 | Ga0183370_1002 | |||
| 1000 | Ga0183369_1002 | |||
| 1001 | Ga0183368_1005 | |||
| 1002 | Ga0163161_10000002 | |||
| 1003 | Ga0163161_10027894 | |||
| 1004 | Ga0163161_10047476 | |||
| 1005 | Ga0213872_10005750 | |||
| 1006 | Ga0213876_10000013 | |||
| 1007 | Ga0209437_100110 | |||
| 1008 | Ga0207425_1014300 | |||
| 1009 | Ga0209129_1000010 | |||
| 1010 | Ga0207696_1000009 | |||
| 1011 | Ga0207696_1000027 | |||
| 1012 | Ga0207696_1000102 | |||
| 1013 | Ga0207696_1000137 | |||
| 1014 | Ga0207696_1000187 | |||
| 1015 | Ga0207696_1000370 | |||
| 1016 | Ga0207696_1000821 | |||
| 1017 | Ga0207696_1001415 | |||
| 1018 | Ga0207696_1003814 | |||
| 1019 | Ga0207696_1004753 | |||
| 1020 | Ga0207696_1020121 | |||
| 1021 | Ga0207696_1033400 | |||
| 1022 | Ga0207655_1000065 | |||
| 1023 | Ga0207655_1000072 | |||
| 1024 | Ga0207655_1000420 | |||
| 1025 | Ga0207655_1000956 | |||
| 1026 | Ga0207655_1001886 | |||
| 1027 | Ga0207655_1003099 | |||
| 1028 | Ga0207655_1003508 | |||
| 1029 | Ga0207655_1007400 | |||
| 1030 | Ga0207655_1010206 | |||
| 1031 | Ga0207655_1016419 | |||
| 1032 | Ga0207655_1025168 | |||
| 1033 | Ga0207655_1029009 | |||
| 1034 | Ga0207655_1044730 | |||
| 1035 | Ga0207655_1046582 | |||
| 1036 | Ga0207713_1000019 | |||
| 1037 | Ga0207713_1000028 | |||
| 1038 | Ga0207713_1000123 | |||
| 1039 | Ga0207713_1006467 | |||
| 1040 | Ga0207713_1012019 | |||
| 1041 | Ga0207713_1012900 | |||
| 1042 | Ga0207713_1019869 | |||
| 1043 | Ga0207713_1020555 | |||
| 1044 | Ga0207713_1028749 | |||
| 1045 | Ga0207710_10000061 | |||
| 1046 | Ga0207645_10000932 | |||
| 1047 | Ga0207705_10082462 | |||
| 1048 | Ga0207705_10309718 | |||
| 1049 | Ga0207662_10027962 | |||
| 1050 | Ga0207657_10016871 | |||
| 1051 | Ga0207681_10005730 | |||
| 1052 | Ga0207650_10101992 | |||
| 1053 | Ga0207687_10023855 | |||
| 1054 | Ga0207644_10002979 | |||
| 1055 | Ga0207706_10021564 | |||
| 1056 | Ga0207706_10062660 | |||
| 1057 | Ga0207706_10064256 | |||
| 1058 | Ga0207709_10029334 | |||
| 1059 | Ga0207709_10245176 | |||
| 1060 | Ga0207669_10033114 | |||
| 1061 | Ga0207691_10012375 | |||
| 1062 | Ga0207691_10036077 | |||
| 1063 | Ga0207711_10012730 | |||
| 1064 | Ga0207711_10047402 | |||
| 1065 | Ga0207689_10013142 | |||
| 1066 | Ga0207667_10002798 | |||
| 1067 | Ga0207651_10016613 | |||
| 1068 | Ga0207651_10360365 | |||
| 1069 | Ga0207651_10608885 | |||
| 1070 | Ga0207712_10002594 | |||
| 1071 | Ga0207668_10018596 | |||
| 1072 | Ga0207658_10015270 | |||
| 1073 | Ga0207658_10055068 | |||
| 1074 | Ga0207658_10080670 | |||
| 1075 | Ga0207677_10013173 | |||
| 1076 | Ga0207677_10062014 | |||
| 1077 | Ga0207703_10010862 | |||
| 1078 | Ga0207708_10022289 | |||
| 1079 | Ga0207641_10005423 | |||
| 1080 | Ga0207648_10012092 | |||
| 1081 | Ga0207648_10046257 | |||
| 1082 | Ga0207674_10004150 | |||
| 1083 | Ga0207675_100011212 | |||
| 1084 | Ga0207675_100259360 | |||
| 1085 | Ga0207683_10009534 | |||
| 1086 | Ga0207683_10038389 | |||
| 1087 | Ga0209281_1000025 | |||
| 1088 | Ga0209281_1000089 | |||
| 1089 | Ga0209281_1000105 | |||
| 1090 | Ga0209281_1000559 | |||
| 1091 | Ga0209281_1000768 | |||
| 1092 | Ga0209281_1001450 | |||
| 1093 | Ga0209281_1002003 | |||
| 1094 | Ga0209281_1002943 | |||
| 1095 | Ga0209281_1003785 | |||
| 1096 | Ga0209371_1000010 | |||
| 1097 | Ga0209371_1000013 | |||
| 1098 | Ga0209371_1000019 | |||
| 1099 | Ga0209371_1000126 | |||
| 1100 | Ga0209371_1000149 | |||
| 1101 | Ga0209371_1000254 | |||
| 1102 | Ga0209371_1000335 | |||
| 1103 | Ga0209371_1000718 | |||
| 1104 | Ga0209371_1000795 | |||
| 1105 | Ga0209371_1001352 | |||
| 1106 | Ga0209371_1001485 | |||
| 1107 | Ga0209371_1001753 | |||
| 1108 | Ga0209371_1002033 | |||
| 1109 | Ga0209371_1002452 | |||
| 1110 | Ga0209371_1003488 | |||
| 1111 | Ga0209371_1008461 | |||
| 1112 | Ga0209371_1008697 | |||
| 1113 | Ga0209371_1014225 | |||
| 1114 | Ga0209371_1016172 | |||
| 1115 | Ga0268266_10000041 | |||
| 1116 | Ga0268266_10035813 | |||
| 1117 | Ga0268266_10064513 | |||
| 1118 | Ga0268265_10253636 | |||
| 1119 | Ga0268264_10001710 | |||
| 1120 | Ga0265338_10223382 | |||
| 1121 | Ga0268256_1000014 | |||
| 1122 | Ga0268256_1000022 | |||
| 1123 | Ga0268256_1000024 | |||
| 1124 | Ga0268256_1000105 | |||
| 1125 | Ga0268256_1000110 | |||
| 1126 | Ga0268256_1000559 | |||
| 1127 | Ga0268256_1000635 | |||
| 1128 | Ga0268256_1000709 | |||
| 1129 | Ga0268256_1000767 | |||
| 1130 | Ga0268256_1001840 | |||
| 1131 | Ga0268256_1002442 | |||
| 1132 | Ga0268256_1003121 | |||
| 1133 | Ga0268256_1005368 | |||
| 1134 | Ga0268256_1008638 | |||
| 1135 | Ga0268256_1008694 | |||
| 1136 | Ga0268256_1009783 | |||
| 1137 | Ga0268256_1015768 | |||
| 1138 | Ga0268256_1016253 | |||
| 1139 | Ga0316183_1053585 | |||
| 1140 | Ga0307413_10298248 | |||
| 1141 | Ga0307416_100607667 | |||
| 1142 | Ga0307416_100706520 | |||
| 1143 | Ga0395899_0043099 | |||
| 1144 | Ga0395899_0149998 | |||
| 1145 | Ga0395901_0153598 | |||
| 1146 | Ga0436365_0471682 | |||
| 1147 | Ga0436361_0995447 | |||
| 1148 | Ga0439438_000059 | |||
| 1149 | Ga0439438_007349 | |||
| 1150 | Ga0439438_020412 | |||
| 1151 | Ga0439438_024994 | |||
| 1152 | Ga0439447_000863 | |||
| 1153 | Ga0439447_005242 | |||
| 1154 | Ga0439447_006174 | |||
| 1155 | Ga0439466_0000004 | |||
| 1156 | Ga0451853_2456147 | |||
| 1157 | Ga0439448_0006624 | |||
| 1158 | Ga0439432_003141 | |||
| 1159 | Ga0439432_004840 | |||
| 1160 | Ga0439449_0072347 | |||
| 1161 | Ga0439450_009891 | |||
| 1162 | Ga0439452_000006 | |||
| 1163 | Ga0439452_000009 | |||
| 1164 | Ga0439452_000011 | |||
| 1165 | Ga0439452_000272 | |||
| 1166 | Ga0439452_003757 | |||
| 1167 | Ga0439463_005230 | |||
| 1168 | Ga0450907_000024 | |||
| 1169 | Ga0439464_0001001 | |||
| 1170 | Ga0439464_0053990 | |||
| 1171 | Ga0466981_0000001 | |||
| 1172 | Ga0466965_0007746 | |||
| 1173 | Ga0466966_0019529 | |||
| 1174 | Ga0466971_0051382 | |||
| 1175 | Ga0466959_0182467 | |||
| 1176 | Ga0451576_0030242 | |||
| 1177 | Ga0466958_0174061 | |||
| 1178 | Ga0466967_0513746 | |||
| 1179 | Ga0495617_000002 | |||
| 1180 | Ga0495617_000362 | |||
| 1181 | Ga0495617_069510 | |||
| 1182 | Ga0495627_000111 | |||
| 1183 | Ga0495627_000344 | |||
| 1184 | Ga0495627_022241 | |||
| 1185 | Ga0495603_0014885 | |||
| 1186 | Ga0495603_0136129 | |||
| 1187 | Ga0495590_0000007 | |||
| 1188 | Ga0495590_0042440 | |||
| 1189 | Ga0495590_0088393 | |||
| 1190 | Ga0495591_000045 | |||
| 1191 | Ga0495591_000062 | |||
| 1192 | Ga0495591_020797 | |||
| 1193 | Ga0495591_026163 | |||
| 1194 | Ga0495629_0019494 | |||
| 1195 | Ga0495629_0047544 | |||
| 1196 | Ga0495638_0004537 | |||
| 1197 | Ga0495653_0013262 | |||
| 1198 | Ga0495653_0141892 | |||
| 1199 | Ga0495650_0000008 | |||
| 1200 | Ga0495650_0000040 | |||
| 1201 | Ga0495650_0019534 | |||
| 1202 | Ga0495580_0069933 | |||
| 1203 | Ga0495582_0023795 | |||
| 1204 | Ga0495605_0000092 | |||
| 1205 | Ga0495605_0003289 | |||
| 1206 | Ga0495605_0013027 | |||
| 1207 | Ga0495605_0111993 | |||
| 1208 | Ga0495605_0112845 | |||
| 1209 | Ga0495584_0000007 | |||
| 1210 | Ga0495584_0000238 | |||
| 1211 | Ga0495584_0013955 | |||
| 1212 | Ga0495584_0020413 | |||
| 1213 | Ga0495584_0094690 | |||
| 1214 | Ga0495584_0102855 | |||
| 1215 | Ga0495584_0248369 | |||
| 1216 | Ga0495585_0000090 | |||
| 1217 | Ga0495585_0000812 | |||
| 1218 | Ga0495585_0003197 | |||
| 1219 | Ga0495585_0013108 | |||
| 1220 | Ga0495585_0019777 | |||
| 1221 | Ga0495585_0028690 | |||
| 1222 | Ga0495585_0030105 | |||
| 1223 | Ga0495585_0088314 | |||
| 1224 | Ga0495585_0095011 | |||
| 1225 | Ga0495585_0152042 | |||
| 1226 | Ga0495585_0170495 | |||
| 1227 | Ga0495594_0137780 | |||
| 1228 | Ga0495594_0138380 | |||
| 1229 | Ga0495596_0001144 | |||
| 1230 | Ga0495596_0003412 | |||
| 1231 | Ga0495596_0004492 | |||
| 1232 | Ga0495596_0004525 | |||
| 1233 | Ga0495596_0010126 | |||
| 1234 | Ga0495596_0011749 | |||
| 1235 | Ga0495596_0054090 | |||
| 1236 | Ga0495607_0000811 | |||
| 1237 | Ga0495607_0000887 | |||
| 1238 | Ga0495607_0002622 | |||
| 1239 | Ga0495607_0032797 | |||
| 1240 | Ga0495607_0049037 | |||
| 1241 | Ga0495607_0094901 | |||
| 1242 | Ga0495607_0210408 | |||
| 1243 | Ga0495583_0000075 | |||
| 1244 | Ga0495583_0000302 | |||
| 1245 | Ga0495583_0000462 | |||
| 1246 | Ga0495583_0000520 | |||
| 1247 | Ga0495583_0050584 | |||
| 1248 | Ga0495583_0114721 | |||
| 1249 | Ga0495606_0001700 | |||
| 1250 | Ga0495606_0022090 | |||
| 1251 | Ga0495606_0051953 | |||
| 1252 | Ga0495606_0073446 | |||
| 1253 | Ga0495610_0007411 | |||
| 1254 | Ga0495616_0000171 | |||
| 1255 | Ga0495616_0000241 | |||
| 1256 | Ga0495616_0001157 | |||
| 1257 | Ga0495616_0012785 | |||
| 1258 | Ga0495616_0021816 | |||
| 1259 | Ga0495616_0033345 | |||
| 1260 | Ga0495616_0051445 | |||
| 1261 | Ga0495616_0112099 | |||
| 1262 | Ga0495620_0013112 | |||
| 1263 | Ga0495620_0026872 | |||
| 1264 | Ga0495630_0183705 | |||
| 1265 | Ga0495631_0003035 | |||
| 1266 | Ga0495631_0010395 | |||
| 1267 | Ga0495631_0014348 | |||
| 1268 | Ga0495631_0081636 | |||
| 1269 | Ga0495631_0132559 | |||
| 1270 | Ga0495632_0000068 | |||
| 1271 | Ga0495632_0000768 | |||
| 1272 | Ga0495632_0001646 | |||
| 1273 | Ga0495632_0004545 | |||
| 1274 | Ga0495632_0007063 | |||
| 1275 | Ga0495632_0025534 | |||
| 1276 | Ga0495637_0000019 | |||
| 1277 | Ga0495637_0045269 | |||
| 1278 | Ga0495637_0101186 | |||
| 1279 | Ga0495643_0002408 | |||
| 1280 | Ga0495643_0005881 | |||
| 1281 | Ga0495643_0026600 | |||
| 1282 | Ga0495643_0072042 | |||
| 1283 | Ga0495643_0197885 | |||
| 1284 | Ga0495644_0000354 | |||
| 1285 | Ga0495644_0006372 | |||
| 1286 | Ga0495644_0047395 | |||
| 1287 | Ga0495644_0050621 | |||
| 1288 | Ga0495648_0000091 | |||
| 1289 | Ga0495648_0000193 | |||
| 1290 | Ga0495648_0000934 | |||
| 1291 | Ga0495648_0001612 | |||
| 1292 | Ga0495648_0029763 | |||
| 1293 | Ga0495648_0084608 | |||
| 1294 | Ga0495666_0000511 | |||
| 1295 | Ga0495666_0007365 | |||
| 1296 | Ga0495642_0000217 | |||
| 1297 | Ga0495642_0003097 | |||
| 1298 | Ga0495642_0007047 | |||
| 1299 | Ga0495642_0008426 | |||
| 1300 | Ga0495642_0014656 | |||
| 1301 | Ga0495654_0000073 | |||
| 1302 | Ga0495654_0000171 | |||
| 1303 | Ga0495654_0125259 | |||
| 1304 | Ga0495665_0008709 | |||
| 1305 | Ga0495665_0046155 | |||
| 1306 | Ga0495640_0034754 | |||
| 1307 | Ga0495640_0171574 | |||
| 1308 | Ga0495586_0015955 | |||
| 1309 | Ga0495587_0093649 | |||
| 1310 | Ga0495609_0000716 | |||
| 1311 | Ga0495609_0022169 | |||
| 1312 | Ga0495609_0085952 | |||
| 1313 | Ga0495609_0093881 | |||
| 1314 | Ga0495609_0126713 | |||
| 1315 | Ga0495597_0000738 | |||
| 1316 | Ga0495597_0001122 | |||
| 1317 | Ga0495597_0001580 | |||
| 1318 | Ga0495597_0009125 | |||
| 1319 | Ga0495622_0003617 | |||
| 1320 | Ga0495622_0175168 | |||
| 1321 | Ga0495633_0010347 | |||
| 1322 | Ga0495633_0020436 | |||
| 1323 | Ga0495633_0036783 | |||
| 1324 | Ga0495633_0094860 | |||
| 1325 | Ga0495656_0032664 | |||
| 1326 | Ga0495668_0000139 | |||
| 1327 | Ga0495668_0000975 | |||
| 1328 | Ga0495668_0138976 | |||
| 1329 | Ga0495611_0000295 | |||
| 1330 | Ga0495611_0018440 | |||
| 1331 | Ga0495611_0020696 | |||
| 1332 | Ga0495625_0003007 | |||
| 1333 | Ga0495625_0029671 | |||
| 1334 | Ga0495625_0037354 | |||
| 1335 | Ga0495625_0286500 | |||
| 1336 | Ga0495661_0000495 | |||
| 1337 | Ga0495661_0001229 | |||
| 1338 | Ga0495661_0007744 | |||
| 1339 | Ga0495661_0015501 | |||
| 1340 | Ga0495661_0020745 | |||
| 1341 | Ga0495661_0026067 | |||
| 1342 | Ga0495661_0092152 | |||
| 1343 | Ga0495661_0100969 | |||
| 1344 | Ga0495588_0004154 | |||
| 1345 | Ga0495588_0032101 | |||
| 1346 | Ga0495588_0073701 | |||
| 1347 | Ga0495588_0079904 | |||
| 1348 | Ga0495588_0110247 | |||
| 1349 | Ga0495588_0130522 | |||
| 1350 | Ga0495646_0133826 | |||
| 1351 | Ga0495669_0000423 | |||
| 1352 | Ga0495669_0000945 | |||
| 1353 | Ga0495669_0023680 | |||
| 1354 | Ga0495669_0024049 | |||
| 1355 | Ga0495669_0064568 | |||
| 1356 | Ga0495669_0083928 | |||
| 1357 | Ga0495613_0042447 | |||
| 1358 | Ga0495613_0236864 | |||
| 1359 | Ga0495670_0000504 | |||
| 1360 | Ga0495670_0003055 | |||
| 1361 | Ga0495670_0028623 | |||
| 1362 | Ga0495670_0050843 | |||
| 1363 | Ga0495670_0111209 | |||
| 1364 | Ga0495671_0000067 | |||
| 1365 | Ga0495671_0004592 | |||
| 1366 | Ga0495671_0027165 | |||
| 1367 | Ga0495671_0039870 | |||
| 1368 | Ga0495671_0084105 | |||
| 1369 | Ga0495671_0084450 | |||
| 1370 | Ga0495649_0000196 | |||
| 1371 | Ga0495649_0000862 | |||
| 1372 | Ga0495649_0001555 | |||
| 1373 | Ga0495649_0075753 | |||
| 1374 | Ga0495589_0000079 | |||
| 1375 | Ga0495589_0003250 | |||
| 1376 | Ga0495589_0007544 | |||
| 1377 | Ga0495589_0012110 | |||
| 1378 | Ga0495589_0020685 | |||
| 1379 | Ga0495589_0021565 | |||
| 1380 | Ga0495589_0064421 | |||
| 1381 | Ga0495589_0116676 | |||
| 1382 | Ga0495600_0029880 | |||
| 1383 | Ga0495660_0000019 | |||
| 1384 | Ga0495660_0008204 | |||
| 1385 | Ga0495660_0011483 | |||
| 1386 | Ga0495660_0077996 | |||
| 1387 | Ga0495581_0001697 | |||
| 1388 | Ga0495581_0211700 | |||
| 1389 | Ga0495604_0018117 | |||
| 1390 | Ga0495604_0068660 | |||
| 1391 | Ga0495604_0187737 | |||
| 1392 | Ga0495672_0000003 | |||
| 1393 | Ga0495672_0000025 | |||
| 1394 | Ga0495672_0000041 | |||
| 1395 | Ga0495672_0000362 | |||
| 1396 | Ga0495676_0000092 | |||
| 1397 | Ga0495676_0287904 | |||
| 1398 | Ga0495680_0001486 | |||
| 1399 | Ga0495683_0008503 | |||
| 1400 | Ga0495683_0015048 | |||
| 1401 | Ga0495683_0023499 | |||
| 1402 | Ga0495683_0118418 | |||
| 1403 | Ga0495687_000133 | |||
| 1404 | Ga0495687_000537 | |||
| 1405 | Ga0495687_054822 | |||
| 1406 | Ga0495675_0159493 | |||
| 1407 | Ga0495677_0000304 | |||
| 1408 | Ga0495677_0003623 | |||
| 1409 | Ga0495677_0022004 | |||
| 1410 | Ga0495679_000125 | |||
| 1411 | Ga0495679_000813 | |||
| 1412 | Ga0495679_014746 | |||
| 1413 | Ga0495679_026229 | |||
| 1414 | Ga0495679_033633 | |||
| 1415 | Ga0495679_035330 | |||
| 1416 | Ga0495685_004310 | |||
| 1417 | Ga0495673_0000011 | |||
| 1418 | Ga0495673_0000055 | |||
| 1419 | Ga0495681_0000057 | |||
| 1420 | Ga0495681_0001196 | |||
| 1421 | Ga0495681_0001604 | |||
| 1422 | Ga0495681_0029171 | |||
| 1423 | Ga0495681_0077306 | |||
| 1424 | Ga0495686_0000479 | |||
| 1425 | Ga0495686_0098527 | |||
| 1426 | Ga0495686_0123956 | |||
| 1427 | Ga0495593_0006097 | |||
| 1428 | Ga0495602_0092282 | |||
| 1429 | Ga0495602_0201934 | |||
| 1430 | Ga0495614_0001353 | |||
| 1431 | Ga0495626_0001302 | |||
| 1432 | Ga0495626_0005515 | |||
| 1433 | Ga0495626_0005730 | |||
| 1434 | Ga0495626_0007600 | |||
| 1435 | Ga0495626_0019271 | |||
| 1436 | Ga0495626_0036348 | |||
| 1437 | Ga0495626_0066993 | |||
| 1438 | Ga0495626_0069900 | |||
| 1439 | Ga0495626_0096875 | |||
| 1440 | Ga0495626_0106988 | |||
| 1441 | Ga0495626_0117264 | |||
| 1442 | Ga0496100_0062139 | |||
| 1443 | Ga0496101_0000070 | |||
| 1444 | Ga0496102_0011022 | |||
| 1445 | Ga0496102_0024889 | |||
| 1446 | Ga0496102_0214727 | |||
| 1447 | Ga0496102_0303943 | |||
| 1448 | Ga0496102_0493895 | |||
| 1449 | Ga0496103_0111351 | |||
| 1450 | Ga0496104_0000784 | |||
| 1451 | Ga0496104_0533861 | |||
| 1452 | Ga0496105_0001684 | |||
| 1453 | Ga0496105_0002815 | |||
| 1454 | Ga0496105_0078383 | |||
| 1455 | Ga0496105_0146738 | |||
| 1456 | Ga0496106_0137080 | |||
| 1457 | Ga0496106_0378060 | |||
| 1458 | Ga0496107_0367535 | |||
| 1459 | Ga0496108_0127944 | |||
| 1460 | Ga0496108_0288670 | |||
| 1461 | Ga0496110_0000041 | |||
| 1462 | Ga0496110_0085270 | |||
| 1463 | Ga0496110_0396101 | |||
| 1464 | Ga0496111_0124406 | |||
| 1465 | Ga0496113_0003151 | |||
| 1466 | Ga0496116_0000015 | |||
| 1467 | Ga0496116_0000308 | |||
| 1468 | Ga0496116_0001206 | |||
| 1469 | Ga0496116_0008765 | |||
| 1470 | Ga0496116_0012638 | |||
| 1471 | Ga0496116_0071530 | |||
| 1472 | Ga0496116_0098690 | |||
| 1473 | Ga0496116_0117880 | |||
| 1474 | Ga0496116_0141374 | |||
| 1475 | Ga0496117_0000043 | |||
| 1476 | Ga0496117_0000680 | |||
| 1477 | Ga0496117_0005315 | |||
| 1478 | Ga0496117_0006484 | |||
| 1479 | Ga0496117_0012853 | |||
| 1480 | Ga0496117_0026290 | |||
| 1481 | Ga0496117_0034334 | |||
| 1482 | Ga0496117_0036218 | |||
| 1483 | Ga0496117_0041200 | |||
| 1484 | Ga0496117_0043194 | |||
| 1485 | Ga0496117_0141147 | |||
| 1486 | Ga0496117_0157617 | |||
| 1487 | Ga0496118_0000075 | |||
| 1488 | Ga0496118_0002357 | |||
| 1489 | Ga0496118_0003898 | |||
| 1490 | Ga0496118_0005445 | |||
| 1491 | Ga0496118_0046672 | |||
| 1492 | Ga0496118_0129377 | |||
| 1493 | Ga0496118_0153428 | |||
| 1494 | Ga0496119_0000096 | |||
| 1495 | Ga0496119_0000324 | |||
| 1496 | Ga0496119_0001622 | |||
| 1497 | Ga0496119_0002543 | |||
| 1498 | Ga0496119_0002626 | |||
| 1499 | Ga0496119_0003023 | |||
| 1500 | Ga0496119_0008155 | |||
| 1501 | Ga0496119_0023352 | |||
| 1502 | Ga0496119_0032034 | |||
| 1503 | Ga0496119_0044583 | |||
| 1504 | Ga0496119_0047715 | |||
| 1505 | Ga0496120_0000414 | |||
| 1506 | Ga0496120_0000805 | |||
| 1507 | Ga0496120_0001565 | |||
| 1508 | Ga0496120_0002290 | |||
| 1509 | Ga0496120_0007007 | |||
| 1510 | Ga0496120_0022121 | |||
| 1511 | Ga0496120_0026009 | |||
| 1512 | Ga0496120_0041470 | |||
| 1513 | Ga0496120_0042161 | |||
| 1514 | Ga0496120_0122365 | |||
| 1515 | Ga0496121_0000057 | |||
| 1516 | Ga0496121_0001878 | |||
| 1517 | Ga0496121_0002032 | |||
| 1518 | Ga0496121_0004592 | |||
| 1519 | Ga0496121_0006182 | |||
| 1520 | Ga0496121_0007418 | |||
| 1521 | Ga0496121_0008060 | |||
| 1522 | Ga0496121_0011195 | |||
| 1523 | Ga0496122_0000016 | |||
| 1524 | Ga0496122_0000988 | |||
| 1525 | Ga0496122_0003346 | |||
| 1526 | Ga0496122_0008283 | |||
| 1527 | Ga0496122_0011751 | |||
| 1528 | Ga0496122_0011840 | |||
| 1529 | Ga0496122_0019814 | |||
| 1530 | Ga0496122_0032610 | |||
| 1531 | Ga0496122_0040471 | |||
| 1532 | Ga0496122_0047847 | |||
| 1533 | Ga0496122_0054640 | |||
| 1534 | Ga0496122_0197731 | |||
| 1535 | Ga0496123_0000017 | |||
| 1536 | Ga0496123_0000195 | |||
| 1537 | Ga0496123_0000198 | |||
| 1538 | Ga0496123_0001702 | |||
| 1539 | Ga0496123_0002965 | |||
| 1540 | Ga0496123_0006820 | |||
| 1541 | Ga0496123_0009791 | |||
| 1542 | Ga0496123_0010368 | |||
| 1543 | Ga0496123_0036775 | |||
| 1544 | Ga0496123_0050150 | |||
| 1545 | Ga0496123_0057697 | |||
| 1546 | Ga0496123_0080604 | |||
| 1547 | Ga0496124_0000246 | |||
| 1548 | Ga0496124_0000342 | |||
| 1549 | Ga0496124_0001425 | |||
| 1550 | Ga0496124_0002044 | |||
| 1551 | Ga0496124_0011023 | |||
| 1552 | Ga0496124_0015844 | |||
| 1553 | Ga0496124_0024609 | |||
| 1554 | Ga0496124_0032630 | |||
| 1555 | Ga0496124_0142628 | |||
| 1556 | Ga0496124_0167696 | |||
| 1557 | Ga0496124_0175516 | |||
| 1558 | Ga0496125_0000257 | |||
| 1559 | Ga0496125_0002401 | |||
| 1560 | Ga0496125_0002508 | |||
| 1561 | Ga0496125_0004530 | |||
| 1562 | Ga0496125_0008673 | |||
| 1563 | Ga0496125_0030552 | |||
| 1564 | Ga0496125_0036882 | |||
| 1565 | Ga0496125_0043350 | |||
| 1566 | Ga0496125_0076493 | |||
| 1567 | Ga0496125_0157828 | |||
| 1568 | Ga0496126_0001485 | |||
| 1569 | Ga0496126_0003691 | |||
| 1570 | Ga0496126_0021288 | |||
| 1571 | Ga0496126_0143279 | |||
| 1572 | Ga0496126_0169557 | |||
| 1573 | Ga0496126_0276688 | |||
| 1574 | Ga0496126_0401492 | |||
| 1575 | Ga0495678_000070 | |||
| 1576 | Ga0495678_000105 | |||
| 1577 | Ga0495678_000486 | |||
| 1578 | Ga0495678_030330 | |||
| 1579 | Ga0495682_0000017 | |||
| 1580 | Ga0495682_0000362 | |||
| 1581 | nmdc:mga00v17_182327_c1 | |||
| 1582 | nmdc:mga0k408_10650_c1 | |||
| 1583 | nmdc:mga0k408_73277_c1 | |||
| 1584 | nmdc:mga0n895_225416_c1 | |||
| 1585 | Ga0500618_000081 | |||
| 1586 | Ga0500621_000004 | |||
| 1587 | Ga0500559_0001601 | |||
| 1588 | Ga0500622_0032842 | |||
| 1589 | Ga0500639_007555 | |||
| 1590 | Ga0500576_097623 | |||
| 1591 | Ga0500596_011788 | |||
| 1592 | Ga0466962_0076173 | |||
| 1593 | 2511378171 | |||
| 1594 | 2511436696 | |||
| 1595 | 2538427663 | |||
| 1596 | 2547696048 | |||
| 1597 | 2548649987 | |||
| 1598 | 2555258842 | |||
| 1599 | 2562464571 | |||
| 1600 | 2599928827 | |||
| 1601 | 2601534376 | |||
| 1602 | 2601538845 | |||
| 1603 | 2601757194 | |||
| 1604 | 2601762205 | |||
| 1605 | 2603639543 | |||
| 1606 | 2603644277 | |||
| 1607 | 2603701201 | |||
| 1608 | 2603704880 | |||
| 1609 | 2608670967 | |||
| 1610 | 2609911455 | |||
| 1611 | 2650897577 | |||
| 1612 | 2656278013 | |||
| 1613 | 2671104600 | |||
| 1614 | 2681998051 | |||
| 1615 | 2682008158 | |||
| 1616 | 2686354953 | |||
| 1617 | 2689443145 | |||
| 1618 | 2707098108 | |||
| 1619 | 2712471249 | |||
| 1620 | 2753857683 | |||
| 1621 | 2765590785 | |||
| 1622 | 2775540343 | |||
| 1623 | 2791925249 | |||
| 1624 | 2792312633 | |||
| 1625 | 2793403925 | |||
| 1626 | 2809126338 | |||
| 1627 | 2813726829 | |||
| 1628 | 2814694202 | |||
| 1629 | 2821120671 | |||
| 1630 | 2823376546 | |||
| 1631 | 2844429172 | |||
| 1632 | 2844530328 | |||
| 1633 | 2847798498 | |||
| 1634 | 2854605640 | |||
| 1635 | 2855199116 | |||
| 1636 | 2858467204 | |||
| 1637 | 2865016316 | |||
| 1638 | 2869552553 | |||
| 1639 | 2871273043 | |||
| 1640 | 2871283101 | |||
| 1641 | 2876601537 | |||
| 1642 | 2881613890 | |||
| 1643 | 2884087088 | |||
| 1644 | 2888374961 | |||
| 1645 | 2891671616 | |||
| 1646 | 2900053443 | |||
| 1647 | 2904506924 | |||
| 1648 | 2919113409 | |||
| 1649 | 2923636676 | |||
| 1650 | 2927836851 | |||
| 1651 | 2932406683 | |||
| 1652 | 2935629449 | |||
| 1653 | 2937544058 | |||
| 1654 | 2939572359 | |||
| 1655 | 2939576533 | |||
| 1656 | 2939577895 | |||
| 1657 | 2939604549 | |||
| 1658 | 2939610506 | |||
| 1659 | 2939620512 | |||
| 1660 | 2939645564 | |||
| 1661 | 2945875886 | |||
| 1662 | 2945951753 | |||
| 1663 | 2971821597 | |||
| 1664 | 2974440244 | |||
| 1665 | 2978978290 | |||
| 1666 | 2984495316 | |||
| 1667 | 2990265027 | |||
| 1668 | 3000380642 | |||
| 1669 | 8016734682 | |||
| 1670 | 8018225656 | |||
| 1671 | 8018407023 | |||
| 1672 | 8019503854 | |||
| 1673 | 8019507531 | |||
| 1674 | 8054848244 | |||
| 1675 | 8054853666 | |||
| 1676 | 8055089588 | |||
| 1677 | 8055095926 | |||
| 1678 | 8055101676 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dxe-assembly1.cif.gz_A | 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli | 0.9772 | 4 | 256 |
| 1dxe-assembly1.cif.gz_A | 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli | 0.9734 | 4 | 256 |
| 4b5w-assembly1.cif.gz_C | crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate | 0.9729 | 8 | 256 |
| 7v8t-assembly1.cif.gz_F | crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. | 0.9708 | 8 | 254 |
| 2v5j-assembly1.cif.gz_B | apo class ii aldolase hpch | 0.9642 | 8 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9746 | 4 | 256 | 3.20.20.60 |
| af_P76469_1_267_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9711 | 3 | 254 | 3.20.20.60 |
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9708 | 4 | 256 | 3.20.20.60 |
| 4mf4F00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9561 | 8 | 256 | 3.20.20.60 |
| af_P76469_1_267_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9525 | 3 | 254 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A242MTS3-F1-model_v4 | 2-dehydro-3-deoxyglucarate aldolase | 0.981 | 6 | 256 |
GO:0005737
GO:0008672 GO:0019394 |
| AF-A0A4R2YX13-F1-model_v4 | 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) | 0.9806 | 5 | 256 |
GO:0000287
GO:0005737 GO:0008672 GO:0042838 GO:0046392 |
| AF-A0A7W6KNN9-F1-model_v4 | 2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20) | 0.9806 | 6 | 255 |
GO:0005737
GO:0008672 GO:0019394 |
| AF-A0A5B9AQ54-F1-model_v4 | 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) | 0.9804 | 10 | 256 |
GO:0000287
GO:0005737 GO:0005886 GO:0008672 GO:0022857 GO:0042838 GO:0046392 |
| AF-D4DX30-F1-model_v4 | 5-keto-4-deoxy-D-glucarate aldolase (KDGluc aldolase) (KDGlucA) (EC 4.1.2.20) (2-dehydro-3-deoxy-D-glucarate aldolase) (2-keto-3-deoxy-D-glucarate aldolase) (5-dehydro-4-deoxy-D-glucarate aldolase) (Alpha-keto-beta-deoxy-D-glucarate aldolase) | 0.9799 | 8 | 256 |
GO:0000287
GO:0005737 GO:0008672 GO:0042838 GO:0046392 |