F483015

General Info

Members Datasets Scaffolds Average Seq Length
839 318 1678 354

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10142433|Ga0207652_101424333
Length 377
Sequence VALRIWMERASGAPGVGRTLEKPMIVAHLDLDAFFAAVEELENPALRRVPLVVGGDPKGRGVVATANYVARGFGIHSAMSCAEAHRRCPQAVFVRPRHSLYKDYSREVWSTIREIVPTVEQAGIDEGYLDLGEVAPAFDDARALAEAVRAVVRARTKLSCSLGVASSKVVAKVASDRRKPGGLTVVRPGKEAEFLAPFPIRILPGIGPRAEERLVAVGIKTIGDIAALEDDDLRGGVLSGKVGRELRDRARGIDRRTLEVSTERISISQEETFERDIGDPERLHDELRRMAEKLADHLRGRGMVGRTVTTKVRYPDFAIRTRSTSLPVGTDDGERIGELACQLLDRALHDRPGPLRLVGVGVSGLEDHVQLSFPAVV

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
200 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 9.18
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10142433 3300025921 Bacteria 2144
2 JGI24751J29686_10007330 3300002459 Bacteria 2253
3 Ga0070658_10010114 3300005327 Bacteria 7571
4 Ga0070676_10124406 3300005328 Unclassified 1623
5 Ga0070683_100015830 3300005329 Bacteria 6632
6 Ga0070683_100015891 3300005329 Bacteria 6622
7 Ga0070683_100030281 3300005329 Bacteria 4910
8 Ga0070683_100036759 3300005329 Bacteria 4481
9 Ga0070683_100054672 3300005329 Bacteria 3702
10 Ga0070683_100056804 3300005329 Bacteria 3635
11 Ga0070683_100064594 3300005329 Bacteria 3407
12 Ga0070683_100084745 3300005329 Bacteria 2969
13 Ga0070683_100155406 3300005329 Bacteria 2169
14 Ga0070683_100224722 3300005329 Bacteria 1784
15 Ga0070683_100322751 3300005329 Bacteria 1470
16 Ga0070690_100118952 3300005330 Unclassified 1771
17 Ga0070670_100010859 3300005331 Bacteria 7779
18 Ga0068869_100010513 3300005334 Bacteria 6038
19 Ga0068869_100078836 3300005334 Unclassified 2454
20 Ga0070680_100005086 3300005336 Bacteria 9922
21 Ga0070680_100008703 3300005336 Bacteria 7780
22 Ga0070680_100023016 3300005336 Bacteria 4965
23 Ga0070680_100044147 3300005336 Bacteria 3621
24 Ga0070680_100155552 3300005336 Bacteria 1920
25 Ga0070682_100008580 3300005337 Bacteria 5768
26 Ga0070682_100009117 3300005337 Bacteria 5609
27 Ga0070682_100019435 3300005337 Bacteria 3984
28 Ga0070682_100128267 3300005337 Bacteria 1713
29 Ga0068868_100054441 3300005338 Unclassified 3153
30 Ga0070660_100003574 3300005339 Bacteria 10734
31 Ga0070660_100015515 3300005339 Bacteria 5504
32 Ga0070660_100020419 3300005339 Unclassified 4867
33 Ga0070660_100030252 3300005339 Bacteria 4062
34 Ga0070660_100036011 3300005339 Bacteria 3747
35 Ga0070660_100036981 3300005339 Bacteria 3700
36 Ga0070660_100089764 3300005339 Bacteria 2422
37 Ga0070660_100144054 3300005339 Bacteria 1913
38 Ga0070689_100008401 3300005340 Bacteria 7272
39 Ga0070689_100077028 3300005340 Bacteria 2613
40 Ga0070691_10003647 3300005341 Bacteria 6949
41 Ga0070691_10058157 3300005341 Bacteria 1856
42 Ga0070661_100006585 3300005344 Bacteria 8009
43 Ga0070661_100008439 3300005344 Bacteria 7122
44 Ga0070661_100015898 3300005344 Bacteria 5310
45 Ga0070661_100016782 3300005344 Bacteria 5184
46 Ga0070661_100051329 3300005344 Bacteria 3018
47 Ga0070661_100055728 3300005344 Bacteria 2894
48 Ga0070661_100064499 3300005344 Bacteria 2691
49 Ga0070692_10026747 3300005345 Unclassified 2854
50 Ga0070692_10046905 3300005345 Bacteria 2235
51 Ga0070675_100023009 3300005354 Bacteria 4979
52 Ga0070675_100046807 3300005354 Bacteria 3543
53 Ga0070671_100096596 3300005355 Bacteria 2478
54 Ga0070674_100001302 3300005356 Bacteria 13114
55 Ga0070674_100067398 3300005356 Unclassified 2517
56 Ga0070673_100030163 3300005364 Bacteria 4053
57 Ga0070688_100092772 3300005365 Bacteria 1976
58 Ga0070688_100124254 3300005365 Bacteria 1732
59 Ga0070659_100013626 3300005366 Bacteria 6058
60 Ga0070659_100016104 3300005366 Bacteria 5610
61 Ga0070659_100040076 3300005366 Bacteria 3659
62 Ga0070659_100045849 3300005366 Bacteria 3426
63 Ga0070659_100114484 3300005366 Bacteria 2179
64 Ga0070659_100140678 3300005366 Bacteria 1965
65 Ga0070709_10048057 3300005434 Bacteria 2661
66 Ga0070714_100013725 3300005435 Bacteria 6496
67 Ga0070714_100056459 3300005435 Bacteria 3358
68 Ga0070714_100106721 3300005435 Bacteria 2474
69 Ga0070714_100109946 3300005435 Bacteria 2439
70 Ga0070713_100112126 3300005436 Bacteria 2379
71 Ga0070710_10028029 3300005437 Bacteria 3009
72 Ga0070710_10062693 3300005437 Bacteria 2121
73 Ga0070701_10010620 3300005438 Bacteria 4080
74 Ga0070701_10066896 3300005438 Unclassified 1911
75 Ga0070711_100095013 3300005439 Bacteria 2156
76 Ga0070711_100261444 3300005439 Bacteria 1362
77 Ga0070700_100098109 3300005441 Bacteria 1926
78 Ga0070708_100079170 3300005445 Bacteria 2973
79 Ga0070708_100152619 3300005445 Bacteria 2149
80 Ga0070708_100337694 3300005445 Bacteria 1420
81 Ga0070663_100079549 3300005455 Bacteria 2406
82 Ga0070678_100080965 3300005456 Unclassified 2460
83 Ga0070662_100040166 3300005457 Unclassified 3330
84 Ga0070662_100048186 3300005457 Bacteria 3069
85 Ga0070681_10000749 3300005458 Bacteria 26980
86 Ga0070681_10006655 3300005458 Bacteria 11248
87 Ga0070681_10009487 3300005458 Bacteria 9578
88 Ga0070681_10093430 3300005458 Bacteria 2957
89 Ga0070681_10334230 3300005458 Bacteria 1424
90 Ga0068867_100034924 3300005459 Bacteria 3645
91 Ga0068867_100173014 3300005459 Bacteria 1712
92 Ga0068867_100305086 3300005459 Bacteria 1314
93 Ga0070685_10005978 3300005466 Bacteria 6197
94 Ga0070706_100388506 3300005467 Bacteria 1299
95 Ga0070707_100106168 3300005468 Bacteria 2724
96 Ga0070698_100019245 3300005471 Bacteria 7173
97 Ga0070698_100041887 3300005471 Bacteria 4700
98 Ga0070698_100179487 3300005471 Bacteria 2056
99 Ga0070698_100295449 3300005471 Bacteria 1551
100 Ga0070699_100089410 3300005518 Bacteria 2691
101 Ga0070699_100141498 3300005518 Bacteria 2125
102 Ga0070699_100184688 3300005518 Bacteria 1851
103 Ga0070679_100005464 3300005530 Bacteria 11782
104 Ga0070679_100032625 3300005530 Bacteria 5153
105 Ga0070679_100039537 3300005530 Bacteria 4687
106 Ga0070679_100049312 3300005530 Bacteria 4193
107 Ga0070679_100064508 3300005530 Bacteria 3650
108 Ga0070679_100095677 3300005530 Bacteria 2957
109 Ga0070679_100113839 3300005530 Bacteria 2690
110 Ga0070684_100005027 3300005535 Bacteria 10099
111 Ga0070684_100011603 3300005535 Bacteria 7022
112 Ga0070684_100014289 3300005535 Bacteria 6427
113 Ga0070684_100027664 3300005535 Bacteria 4788
114 Ga0070684_100030872 3300005535 Bacteria 4557
115 Ga0070684_100034227 3300005535 Bacteria 4343
116 Ga0070684_100040658 3300005535 Bacteria 4005
117 Ga0070684_100041144 3300005535 Bacteria 3983
118 Ga0070684_100055365 3300005535 Bacteria 3457
119 Ga0070684_100069774 3300005535 Bacteria 3091
120 Ga0070684_100084843 3300005535 Bacteria 2808
121 Ga0070684_100114531 3300005535 Bacteria 2420
122 Ga0070684_100124503 3300005535 Bacteria 2320
123 Ga0068853_100009467 3300005539 Bacteria 7849
124 Ga0070672_100003936 3300005543 Bacteria 9680
125 Ga0070672_100023768 3300005543 Bacteria 4521
126 Ga0070686_100014712 3300005544 Bacteria 4516
127 Ga0070695_100123706 3300005545 Bacteria 1773
128 Ga0070696_100124520 3300005546 Bacteria 1869
129 Ga0070696_100157078 3300005546 Bacteria 1673
130 Ga0070693_100019933 3300005547 Bacteria 3528
131 Ga0070693_100023607 3300005547 Bacteria 3289
132 Ga0070693_100046798 3300005547 Bacteria 2458
133 Ga0070665_100033445 3300005548 Bacteria 5173
134 Ga0070704_100029686 3300005549 Bacteria 3654
135 Ga0070704_100194221 3300005549 Bacteria 1634
136 Ga0070704_100313733 3300005549 Bacteria 1311
137 Ga0070704_100335741 3300005549 Bacteria 1271
138 Ga0068855_100032562 3300005563 Bacteria 6223
139 Ga0068855_100037090 3300005563 Bacteria 5799
140 Ga0068855_100045854 3300005563 Bacteria 5168
141 Ga0068855_100058740 3300005563 Bacteria 4502
142 Ga0068855_100061055 3300005563 Bacteria 4405
143 Ga0068855_100131207 3300005563 Unclassified 2861
144 Ga0070664_100014453 3300005564 Bacteria 6436
145 Ga0070664_100039824 3300005564 Bacteria 3961
146 Ga0070664_100324800 3300005564 Bacteria 1395
147 Ga0068857_100045121 3300005577 Bacteria 3910
148 Ga0068857_100049130 3300005577 Bacteria 3744
149 Ga0068857_100054005 3300005577 Bacteria 3564
150 Ga0068857_100137342 3300005577 Unclassified 2208
151 Ga0068857_100292668 3300005577 Bacteria 1500
152 Ga0068854_100026625 3300005578 Bacteria 3976
153 Ga0068854_100238932 3300005578 Bacteria 1446
154 Ga0068856_100028398 3300005614 Bacteria 5463
155 Ga0068856_100082748 3300005614 Bacteria 3186
156 Ga0068856_100122243 3300005614 Bacteria 2605
157 Ga0068856_100302831 3300005614 Bacteria 1616
158 Ga0068856_100401464 3300005614 Bacteria 1390
159 Ga0070702_100019096 3300005615 Bacteria 3567
160 Ga0070702_100022581 3300005615 Bacteria 3329
161 Ga0070702_100050663 3300005615 Bacteria 2373
162 Ga0068852_100008666 3300005616 Bacteria 7515
163 Ga0068852_100159231 3300005616 Bacteria 2106
164 Ga0068859_100370367 3300005617 Bacteria 1528
165 Ga0068864_100008532 3300005618 Bacteria 8455
166 Ga0068864_100064126 3300005618 Bacteria 3185
167 Ga0068864_100308730 3300005618 Bacteria 1483
168 Ga0068866_10144683 3300005718 Bacteria 1369
169 Ga0068851_10025677 3300005834 Bacteria 2891
170 Ga0068870_10004976 3300005840 Bacteria 5764
171 Ga0068870_10030426 3300005840 Bacteria 2728
172 Ga0068863_100020555 3300005841 Bacteria 6311
173 Ga0068858_100169147 3300005842 Bacteria 2060
174 Ga0068860_100233063 3300005843 Bacteria 1789
175 Ga0081455_10001959 3300005937 Bacteria 24720
176 Ga0081455_10029352 3300005937 Bacteria 5014
177 Ga0081455_10031718 3300005937 Bacteria 4774
178 Ga0081455_10063555 3300005937 Bacteria 3097
179 Ga0081455_10154165 3300005937 Bacteria 1768
180 Ga0081538_10001290 3300005981 Bacteria 26012
181 Ga0081538_10034537 3300005981 Unclassified 3341
182 Ga0070717_10014420 3300006028 Bacteria 6081
183 Ga0070717_10025725 3300006028 Bacteria 4686
184 Ga0070717_10152348 3300006028 Unclassified 2001
185 Ga0070717_10186398 3300006028 Bacteria 1811
186 Ga0075364_10008748 3300006051 Bacteria 6057
187 Ga0075364_10030740 3300006051 Bacteria 3448
188 Ga0075432_10036939 3300006058 Bacteria 1699
189 Ga0070715_10016206 3300006163 Bacteria 2795
190 Ga0070715_10080829 3300006163 Bacteria 1475
191 Ga0070716_100167805 3300006173 Bacteria 1429
192 Ga0070712_100009618 3300006175 Bacteria 6095
193 Ga0070712_100013144 3300006175 Bacteria 5281
194 Ga0070712_100062243 3300006175 Bacteria 2638
195 Ga0070712_100163318 3300006175 Bacteria 1722
196 Ga0075362_10002455 3300006177 Bacteria 6234
197 Ga0097621_100098314 3300006237 Unclassified 2458
198 Ga0075428_100058183 3300006844 Bacteria 4231
199 Ga0075428_100439815 3300006844 Bacteria 1397
200 Ga0075430_100018905 3300006846 Bacteria 5862
201 Ga0075433_10120348 3300006852 Bacteria 2331
202 Ga0075434_100057551 3300006871 Bacteria 3863
203 Ga0075434_100149161 3300006871 Bacteria 2358
204 Ga0075429_100110113 3300006880 Bacteria 2407
205 Ga0068865_100011508 3300006881 Bacteria 5544
206 Ga0068865_100058112 3300006881 Bacteria 2700
207 Ga0068865_100063414 3300006881 Bacteria 2597
208 Ga0075436_100055067 3300006914 Bacteria 2746
209 Ga0097620_100370371 3300006931 Bacteria 1528
210 Ga0075435_100025171 3300007076 Bacteria 4630
211 Ga0105240_10078090 3300009093 Bacteria 4077
212 Ga0105240_10210478 3300009093 Bacteria 2273
213 Ga0105240_10308024 3300009093 Bacteria 1809
214 Ga0105240_10512389 3300009093 Bacteria 1332
215 Ga0111539_10002753 3300009094 Bacteria 23327
216 Ga0111539_10027719 3300009094 Bacteria 6919
217 Ga0111539_10045112 3300009094 Bacteria 5278
218 Ga0111539_10108767 3300009094 Bacteria 3254
219 Ga0111539_10170250 3300009094 Unclassified 2545
220 Ga0111539_10298684 3300009094 Bacteria 1874
221 Ga0105245_10018522 3300009098 Bacteria 6090
222 Ga0105245_10027306 3300009098 Bacteria 5030
223 Ga0105245_10068145 3300009098 Bacteria 3224
224 Ga0105245_10131931 3300009098 Bacteria 2344
225 Ga0105245_10405334 3300009098 Bacteria 1364
226 Ga0114129_10044321 3300009147 Bacteria 6258
227 Ga0114129_10286351 3300009147 Bacteria 2200
228 Ga0105243_10007960 3300009148 Bacteria 8143
229 Ga0105243_10067568 3300009148 Bacteria 2878
230 Ga0105243_10146371 3300009148 Bacteria 2021
231 Ga0105243_10186840 3300009148 Bacteria 1807
232 Ga0105243_10216847 3300009148 Bacteria 1689
233 Ga0105243_10224610 3300009148 Bacteria 1662
234 Ga0105241_10435528 3300009174 Unclassified 1157
235 Ga0105242_10027625 3300009176 Bacteria 4509
236 Ga0105242_10067261 3300009176 Bacteria 2962
237 Ga0105242_10075192 3300009176 Unclassified 2811
238 Ga0105242_10081304 3300009176 Bacteria 2709
239 Ga0105242_10095615 3300009176 Bacteria 2508
240 Ga0105242_10126199 3300009176 Bacteria 2203
241 Ga0105248_10041322 3300009177 Bacteria 5169
242 Ga0105237_10065429 3300009545 Unclassified 3632
243 Ga0105237_10188522 3300009545 Unclassified 2063
244 Ga0105238_10010250 3300009551 Bacteria 9401
245 Ga0105238_10355194 3300009551 Bacteria 1455
246 Ga0105249_10044752 3300009553 Unclassified 4025
247 Ga0105249_10076206 3300009553 Bacteria 3108
248 Ga0105249_10187372 3300009553 Bacteria 2017
249 Ga0105239_10056070 3300010375 Bacteria 4322
250 Ga0105239_10175366 3300010375 Unclassified 2398
251 Ga0105246_10101897 3300011119 Bacteria 2092
252 Ga0157373_10103066 3300013100 Bacteria 2007
253 Ga0157371_10007020 3300013102 Bacteria 9163
254 Ga0157370_10006143 3300013104 Bacteria 13329
255 Ga0157370_10015065 3300013104 Bacteria 7878
256 Ga0157370_10197257 3300013104 Bacteria 1868
257 Ga0157370_10371623 3300013104 Unclassified 1317
258 Ga0157369_10003856 3300013105 Bacteria 17824
259 Ga0157369_10019412 3300013105 Bacteria 7604
260 Ga0157369_10032679 3300013105 Bacteria 5720
261 Ga0157369_10033145 3300013105 Bacteria 5678
262 Ga0157369_10033154 3300013105 Bacteria 5677
263 Ga0157369_10077696 3300013105 Bacteria 3558
264 Ga0157378_10101345 3300013297 Bacteria 2630
265 Ga0157378_10116958 3300013297 Bacteria 2452
266 Ga0157378_10194553 3300013297 Bacteria 1915
267 Ga0163162_10141206 3300013306 Bacteria 2522
268 Ga0163162_10177139 3300013306 Bacteria 2258
269 Ga0157372_10026859 3300013307 Bacteria 6267
270 Ga0157372_10039029 3300013307 Bacteria 5241
271 Ga0157372_10131467 3300013307 Bacteria 2880
272 Ga0157372_10184521 3300013307 Bacteria 2416
273 Ga0157372_10235230 3300013307 Bacteria 2125
274 Ga0157372_10457091 3300013307 Bacteria 1488
275 Ga0157375_10029202 3300013308 Bacteria 5183
276 Ga0157375_10087185 3300013308 Bacteria 3173
277 Ga0163163_10147669 3300014325 Bacteria 2395
278 Ga0157380_10009357 3300014326 Bacteria 7017
279 Ga0157380_10024897 3300014326 Bacteria 4534
280 Ga0157380_10127513 3300014326 Bacteria 2165
281 Ga0157377_10006038 3300014745 Bacteria 5745
282 Ga0157377_10012532 3300014745 Bacteria 4267
283 Ga0157377_10035908 3300014745 Unclassified 2723
284 Ga0157377_10050784 3300014745 Bacteria 2337
285 Ga0157379_10211108 3300014968 Bacteria 1757
286 Ga0157376_10011069 3300014969 Bacteria 6634
287 Ga0157376_10212840 3300014969 Bacteria 1785
288 Ga0197907_11224760 3300020069 Bacteria 4008
289 Ga0206354_11621597 3300020081 Bacteria 2280
290 Ga0206353_10906813 3300020082 Bacteria 16815
291 Ga0206353_11793764 3300020082 Bacteria 1514
292 Ga0213871_10013380 3300021441 Bacteria 1927
293 Ga0207653_10043062 3300025885 Unclassified 1486
294 Ga0207692_10003153 3300025898 Bacteria 6399
295 Ga0207688_10000822 3300025901 Bacteria 15528
296 Ga0207688_10015428 3300025901 Bacteria 4144
297 Ga0207688_10020581 3300025901 Bacteria 3602
298 Ga0207688_10025867 3300025901 Bacteria 3226
299 Ga0207688_10031096 3300025901 Bacteria 2946
300 Ga0207699_10199921 3300025906 Bacteria 1354
301 Ga0207645_10071477 3300025907 Unclassified 2221
302 Ga0207643_10005291 3300025908 Bacteria 6906
303 Ga0207643_10038895 3300025908 Bacteria 2674
304 Ga0207643_10043869 3300025908 Bacteria 2524
305 Ga0207643_10179603 3300025908 Bacteria 1280
306 Ga0207705_10083844 3300025909 Bacteria 2326
307 Ga0207705_10095709 3300025909 Bacteria 2179
308 Ga0207705_10173619 3300025909 Bacteria 1624
309 Ga0207705_10200156 3300025909 Bacteria 1513
310 Ga0207705_10239467 3300025909 Bacteria 1382
311 Ga0207684_10324584 3300025910 Bacteria 1327
312 Ga0207654_10117976 3300025911 Bacteria 1661
313 Ga0207707_10024128 3300025912 Bacteria 5320
314 Ga0207707_10037642 3300025912 Bacteria 4227
315 Ga0207707_10045018 3300025912 Bacteria 3846
316 Ga0207707_10146910 3300025912 Unclassified 2061
317 Ga0207695_10344922 3300025913 Bacteria 1377
318 Ga0207695_10375501 3300025913 Bacteria 1308
319 Ga0207671_10263029 3300025914 Bacteria 1358
320 Ga0207693_10002091 3300025915 Bacteria 17432
321 Ga0207693_10171163 3300025915 Bacteria 1710
322 Ga0207660_10005528 3300025917 Bacteria 8208
323 Ga0207660_10020652 3300025917 Bacteria 4424
324 Ga0207660_10025160 3300025917 Bacteria 4038
325 Ga0207662_10010917 3300025918 Bacteria 5023
326 Ga0207657_10000486 3300025919 Bacteria 41915
327 Ga0207657_10001651 3300025919 Bacteria 24065
328 Ga0207657_10010171 3300025919 Bacteria 9398
329 Ga0207657_10012673 3300025919 Bacteria 8310
330 Ga0207657_10015181 3300025919 Bacteria 7474
331 Ga0207657_10021999 3300025919 Bacteria 5987
332 Ga0207657_10047551 3300025919 Unclassified 3750
333 Ga0207657_10124977 3300025919 Bacteria 2113
334 Ga0207649_10024282 3300025920 Bacteria 3522
335 Ga0207649_10025612 3300025920 Bacteria 3441
336 Ga0207649_10110558 3300025920 Bacteria 1835
337 Ga0207652_10006427 3300025921 Bacteria 9475
338 Ga0207652_10030079 3300025921 Bacteria 4545
339 Ga0207652_10058584 3300025921 Bacteria 3319
340 Ga0207652_10069779 3300025921 Bacteria 3051
341 Ga0207652_10147477 3300025921 Bacteria 2106
342 Ga0207650_10060467 3300025925 Bacteria 2827
343 Ga0207659_10145356 3300025926 Bacteria 1846
344 Ga0207659_10155216 3300025926 Unclassified 1791
345 Ga0207659_10159429 3300025926 Bacteria 1770
346 Ga0207687_10005316 3300025927 Bacteria 8525
347 Ga0207687_10031906 3300025927 Bacteria 3564
348 Ga0207664_10207692 3300025929 Bacteria 1693
349 Ga0207690_10007278 3300025932 Bacteria 6573
350 Ga0207690_10047190 3300025932 Bacteria 2856
351 Ga0207690_10056383 3300025932 Bacteria 2650
352 Ga0207690_10059503 3300025932 Unclassified 2588
353 Ga0207690_10307520 3300025932 Bacteria 1242
354 Ga0207706_10002051 3300025933 Bacteria 19764
355 Ga0207706_10052223 3300025933 Bacteria 3609
356 Ga0207706_10059081 3300025933 Bacteria 3377
357 Ga0207686_10025311 3300025934 Bacteria 3450
358 Ga0207686_10146804 3300025934 Bacteria 1637
359 Ga0207709_10042277 3300025935 Unclassified 2740
360 Ga0207670_10024035 3300025936 Bacteria 3803
361 Ga0207669_10011544 3300025937 Bacteria 4304
362 Ga0207691_10006749 3300025940 Bacteria 11072
363 Ga0207691_10060912 3300025940 Bacteria 3429
364 Ga0207691_10108267 3300025940 Bacteria 2473
365 Ga0207711_10296743 3300025941 Bacteria 1490
366 Ga0207689_10118178 3300025942 Unclassified 2180
367 Ga0207661_10000195 3300025944 Bacteria 39367
368 Ga0207661_10011506 3300025944 Bacteria 6414
369 Ga0207661_10086261 3300025944 Bacteria 2605
370 Ga0207661_10136475 3300025944 Bacteria 2107
371 Ga0207661_10154167 3300025944 Bacteria 1988
372 Ga0207661_10161014 3300025944 Bacteria 1947
373 Ga0207679_10019329 3300025945 Bacteria 4573
374 Ga0207679_10038699 3300025945 Bacteria 3400
375 Ga0207667_10168665 3300025949 Unclassified 2250
376 Ga0207667_10192681 3300025949 Bacteria 2091
377 Ga0207651_10032369 3300025960 Bacteria 3358
378 Ga0207651_10093539 3300025960 Bacteria 2208
379 Ga0207712_10255116 3300025961 Bacteria 1420
380 Ga0207668_10078192 3300025972 Bacteria 2388
381 Ga0207668_10279827 3300025972 Bacteria 1368
382 Ga0207640_10047495 3300025981 Unclassified 2769
383 Ga0207639_10034181 3300026041 Bacteria 3756
384 Ga0207639_10343403 3300026041 Bacteria 1331
385 Ga0207678_10039615 3300026067 Bacteria 4089
386 Ga0207678_10043583 3300026067 Bacteria 3882
387 Ga0207678_10070736 3300026067 Bacteria 2991
388 Ga0207678_10130033 3300026067 Bacteria 2148
389 Ga0207708_10017804 3300026075 Bacteria 5347
390 Ga0207708_10036713 3300026075 Bacteria 3732
391 Ga0207708_10038162 3300026075 Bacteria 3659
392 Ga0207702_10013308 3300026078 Bacteria 6843
393 Ga0207702_10031145 3300026078 Bacteria 4446
394 Ga0207702_10051095 3300026078 Bacteria 3492
395 Ga0207702_10086471 3300026078 Bacteria 2734
396 Ga0207702_10105480 3300026078 Bacteria 2496
397 Ga0207648_10176049 3300026089 Bacteria 1892
398 Ga0207648_10338623 3300026089 Bacteria 1354
399 Ga0207676_10026885 3300026095 Bacteria 4280
400 Ga0207674_10008631 3300026116 Bacteria 11742
401 Ga0207674_10008773 3300026116 Bacteria 11644
402 Ga0207674_10026630 3300026116 Bacteria 6135
403 Ga0207674_10030732 3300026116 Bacteria 5645
404 Ga0207674_10082538 3300026116 Bacteria 3215
405 Ga0207674_10139127 3300026116 Bacteria 2388
406 Ga0207675_100084473 3300026118 Bacteria 2979
407 Ga0207683_10032676 3300026121 Bacteria 4520
408 Ga0207683_10040427 3300026121 Bacteria 4069
409 Ga0207683_10166674 3300026121 Bacteria 1993
410 Ga0207683_10291673 3300026121 Unclassified 1492
411 Ga0207698_10014637 3300026142 Bacteria 5222
412 Ga0207698_10041458 3300026142 Bacteria 3430
413 Ga0207428_10002821 3300027907 Bacteria 17256
414 Ga0207428_10008067 3300027907 Bacteria 9552
415 Ga0207428_10009180 3300027907 Bacteria 8884
416 Ga0207428_10018875 3300027907 Bacteria 5883
417 Ga0268266_10046878 3300028379 Bacteria 3700
418 Ga0268266_10075604 3300028379 Bacteria 2926
419 Ga0268264_10043596 3300028381 Bacteria 3718
420 Ga0265319_1027097 3300028563 Unclassified 2036
421 Ga0265318_10009735 3300028577 Bacteria 4212
422 Ga0265318_10019457 3300028577 Unclassified 2753
423 Ga0265322_10011901 3300028654 Bacteria 2516
424 Ga0265322_10021932 3300028654 Bacteria 1829
425 Ga0265338_10014805 3300028800 Bacteria 8632
426 Ga0265338_10053965 3300028800 Bacteria 3589
427 Ga0265338_10213368 3300028800 Bacteria 1447
428 Ga0265324_10012363 3300029957 Bacteria 3220
429 Ga0265330_10031776 3300031235 Bacteria 2367
430 Ga0265330_10048606 3300031235 Bacteria 1865
431 Ga0265332_10084565 3300031238 Bacteria 1345
432 Ga0265325_10031136 3300031241 Bacteria 2857
433 Ga0265325_10110920 3300031241 Bacteria 1333
434 Ga0265339_10024102 3300031249 Bacteria 3511
435 Ga0265327_10045506 3300031251 Bacteria 2331
436 Ga0265316_10029926 3300031344 Bacteria 4470
437 Ga0307408_100031946 3300031548 Archaea 3669
438 Ga0265313_10004167 3300031595 Bacteria 11226
439 Ga0265313_10009381 3300031595 Bacteria 6357
440 Ga0265314_10010725 3300031711 Bacteria 7625
441 Ga0265342_10047624 3300031712 Bacteria 2572
442 Ga0307409_100168334 3300031995 Bacteria 1926
443 Ga0307409_100261270 3300031995 Bacteria 1589
444 Ga0307414_10076413 3300032004 Bacteria 2434
445 Ga0373951_0011845 3300035091 Bacteria 1961
446 Ga0373943_0004770 3300035170 Bacteria 6128
447 Ga0373946_0007039 3300035171 Bacteria 4102
448 Ga0373935_0028527 3300035692 Bacteria 3450
449 Ga0373935_0043479 3300035692 Bacteria 2827
450 Ga0373935_0287616 3300035692 Unclassified 1159
451 Ga0373927_0063107 3300035695 Bacteria 2396
452 Ga0373947_0000833 3300035725 Bacteria 18617
453 Ga0373947_0004241 3300035725 Bacteria 8409
454 Ga0373937_0041010 3300036401 Bacteria 4222
455 Ga0373937_0480453 3300036401 Bacteria 1180
456 Ga0373925_0011906 3300037068 Bacteria 6295
457 Ga0395899_0003567 3300037312 Bacteria 12317
458 Ga0395899_0017962 3300037312 Bacteria 5382
459 Ga0395899_0033726 3300037312 Bacteria 3845
460 Ga0395899_0163905 3300037312 Bacteria 1569
461 Ga0395900_0001819 3300037418 Bacteria 24397
462 Ga0395900_0014881 3300037418 Bacteria 7926
463 Ga0395900_0024327 3300037418 Bacteria 6201
464 Ga0395900_0096245 3300037418 Bacteria 3042
465 Ga0395900_0101216 3300037418 Bacteria 2959
466 Ga0395898_0002618 3300037466 Bacteria 20929
467 Ga0395898_0014564 3300037466 Bacteria 8077
468 Ga0395898_0180963 3300037466 Bacteria 2015
469 Ga0395898_0251229 3300037466 Bacteria 1686
470 Ga0395905_0009197 3300037471 Bacteria 9674
471 Ga0395905_0032649 3300037471 Bacteria 4895
472 Ga0395905_0066382 3300037471 Bacteria 3379
473 Ga0395905_0315152 3300037471 Unclassified 1453
474 Ga0395901_0001138 3300038443 Bacteria 28189
475 Ga0395901_0154410 3300038443 Bacteria 2411
476 Ga0395901_0186682 3300038443 Bacteria 2174
477 Ga0395901_0212577 3300038443 Bacteria 2024
478 Ga0436365_0434512 3300039437 Bacteria 1877
479 Ga0436360_0143933 3300039438 Bacteria 6708
480 Ga0436363_1187594 3300039450 Bacteria 2718
481 Ga0436362_0037531 3300039453 Bacteria 2084
482 Ga0439463_018308 3300042016 Bacteria 1743
483 Ga0450920_005795 3300042122 Bacteria 2206
484 Ga0439446_0022649 3300042156 Bacteria 1782
485 Ga0466969_0017142 3300044656 Bacteria 3786
486 Ga0466965_0066965 3300044683 Bacteria 1802
487 Ga0466965_0100011 3300044683 Bacteria 1482
488 Ga0466966_0007508 3300044684 Bacteria 7221
489 Ga0466966_0013272 3300044684 Bacteria 5455
490 Ga0466966_0128973 3300044684 Bacteria 1549
491 Ga0466961_0006627 3300044693 Bacteria 7364
492 Ga0466961_0010932 3300044693 Bacteria 5799
493 Ga0466961_0019336 3300044693 Bacteria 4382
494 Ga0466963_0005065 3300044694 Bacteria 7700
495 Ga0466963_0039337 3300044694 Archaea 3096
496 Ga0466963_0056514 3300044694 Bacteria 2611
497 Ga0466963_0072594 3300044694 Bacteria 2318
498 Ga0466963_0147588 3300044694 Unclassified 1632
499 Ga0466963_0171284 3300044694 Bacteria 1513
500 Ga0466963_0201582 3300044694 Bacteria 1392
501 Ga0466964_0016632 3300044706 Bacteria 2810
502 Ga0466971_0001805 3300044719 Bacteria 9086
503 Ga0466971_0003461 3300044719 Bacteria 6741
504 Ga0466971_0004010 3300044719 Bacteria 6331
505 Ga0466971_0010864 3300044719 Bacteria 3982
506 Ga0466968_0011166 3300044735 Bacteria 3498
507 Ga0466968_0021808 3300044735 Bacteria 2597
508 Ga0466970_0018788 3300044765 Bacteria 3581
509 Ga0466957_0012546 3300044842 Bacteria 4905
510 Ga0466957_0021598 3300044842 Bacteria 3794
511 Ga0466957_0033737 3300044842 Bacteria 3071
512 Ga0466957_0136216 3300044842 Bacteria 1578
513 Ga0466960_0051139 3300044901 Bacteria 1995
514 Ga0466959_0003619 3300045049 Bacteria 10192
515 Ga0466959_0008520 3300045049 Bacteria 7256
516 Ga0466959_0018649 3300045049 Bacteria 5095
517 Ga0466959_0023916 3300045049 Bacteria 4523
518 Ga0466959_0062769 3300045049 Bacteria 2699
519 Ga0466958_0005516 3300045836 Bacteria 6822
520 Ga0466958_0008945 3300045836 Bacteria 5565
521 Ga0466958_0009049 3300045836 Bacteria 5531
522 Ga0466958_0009210 3300045836 Bacteria 5493
523 Ga0466958_0023818 3300045836 Bacteria 3598
524 Ga0466958_0024983 3300045836 Bacteria 3518
525 Ga0466958_0059446 3300045836 Bacteria 2325
526 Ga0466967_0000602 3300045976 Bacteria 17865
527 Ga0466967_0004099 3300045976 Bacteria 9735
528 Ga0466967_0004937 3300045976 Bacteria 9121
529 Ga0466967_0009609 3300045976 Bacteria 7188
530 Ga0466967_0012582 3300045976 Bacteria 6484
531 Ga0466967_0018008 3300045976 Bacteria 5632
532 Ga0466967_0025019 3300045976 Bacteria 4916
533 Ga0466967_0035358 3300045976 Bacteria 4252
534 Ga0466967_0056609 3300045976 Bacteria 3458
535 Ga0466967_0138433 3300045976 Bacteria 2265
536 Ga0466967_0212181 3300045976 Bacteria 1836
537 Ga0466967_0249958 3300045976 Bacteria 1693
538 Ga0466967_0260988 3300045976 Bacteria 1657
539 Ga0495592_0094033 3300046454 Bacteria 2146
540 Ga0495629_0000983 3300046459 Bacteria 22888
541 Ga0495629_0026236 3300046459 Bacteria 4140
542 Ga0495629_0043301 3300046459 Bacteria 3161
543 Ga0495629_0050286 3300046459 Bacteria 2919
544 Ga0495641_0000513 3300046461 Bacteria 32468
545 Ga0495653_0027441 3300046463 Bacteria 4556
546 Ga0495653_0089323 3300046463 Bacteria 2258
547 Ga0495653_0130356 3300046463 Bacteria 1781
548 Ga0495582_0000553 3300046473 Bacteria 20635
549 Ga0495582_0061000 3300046473 Bacteria 2082
550 Ga0495662_0007890 3300046476 Bacteria 5240
551 Ga0495608_0004647 3300046511 Bacteria 9812
552 Ga0495608_0010647 3300046511 Bacteria 6416
553 Ga0495608_0049347 3300046511 Bacteria 2794
554 Ga0495618_0190545 3300046514 Bacteria 1300
555 Ga0495628_0049357 3300046516 Bacteria 3333
556 Ga0495628_0183967 3300046516 Bacteria 1579
557 Ga0495630_0011346 3300046517 Bacteria 6449
558 Ga0495630_0012886 3300046517 Bacteria 6074
559 Ga0495630_0039587 3300046517 Bacteria 3524
560 Ga0495631_0043159 3300046518 Bacteria 1990
561 Ga0495652_0045046 3300046529 Bacteria 3796
562 Ga0495652_0070467 3300046529 Unclassified 2922
563 Ga0495652_0097501 3300046529 Bacteria 2391
564 Ga0495652_0129180 3300046529 Bacteria 2003
565 Ga0495665_0005465 3300046531 Bacteria 6844
566 Ga0495640_0024123 3300046533 Bacteria 4425
567 Ga0495586_0020193 3300046535 Bacteria 3548
568 Ga0495586_0029424 3300046535 Bacteria 2939
569 Ga0495609_0048947 3300046538 Bacteria 1887
570 Ga0495645_0037023 3300046543 Bacteria 3556
571 Ga0495645_0162819 3300046543 Bacteria 1541
572 Ga0495667_0016085 3300046559 Bacteria 5057
573 Ga0495667_0028440 3300046559 Bacteria 3764
574 Ga0495656_0054762 3300046615 Bacteria 1717
575 Ga0495634_0032786 3300046642 Bacteria 3570
576 Ga0495634_0099103 3300046642 Bacteria 1884
577 Ga0495635_0035027 3300046663 Bacteria 3481
578 Ga0495635_0079802 3300046663 Bacteria 2240
579 Ga0495588_0093994 3300046674 Bacteria 1572
580 Ga0495657_0091790 3300046675 Bacteria 1947
581 Ga0495657_0091984 3300046675 Bacteria 1944
582 Ga0495657_0228486 3300046675 Bacteria 1126
583 Ga0495647_0006157 3300046681 Bacteria 3960
584 Ga0495658_0002075 3300046683 Bacteria 10156
585 Ga0495613_0010487 3300046689 Bacteria 6879
586 Ga0495613_0022025 3300046689 Bacteria 4750
587 Ga0495613_0152080 3300046689 Bacteria 1650
588 Ga0495624_0007147 3300046690 Bacteria 7857
589 Ga0495624_0046705 3300046690 Bacteria 2753
590 Ga0495671_0044900 3300046692 Bacteria 2214
591 Ga0495589_0068741 3300046794 Bacteria 1733
592 Ga0495581_0001833 3300047315 Bacteria 11890
593 Ga0495604_0027208 3300047317 Bacteria 4550
594 Ga0495604_0055205 3300047317 Bacteria 3062
595 Ga0495604_0082603 3300047317 Bacteria 2402
596 Ga0495674_0003155 3300047319 Bacteria 16010
597 Ga0495674_0157775 3300047319 Bacteria 1900
598 Ga0495676_0029645 3300047321 Bacteria 4658
599 Ga0495680_0004330 3300047322 Bacteria 13597
600 Ga0495680_0007287 3300047322 Bacteria 10179
601 Ga0495680_0019817 3300047322 Bacteria 5672
602 Ga0495680_0059904 3300047322 Bacteria 2937
603 Ga0495680_0080873 3300047322 Bacteria 2454
604 Ga0495677_0014430 3300047445 Bacteria 2876
605 Ga0495684_0282128 3300047471 Bacteria 1198
606 Ga0495593_0009203 3300047673 Bacteria 5726
607 Ga0495602_0103893 3300048088 Bacteria 2325
608 Ga0496100_0008112 3300048903 Bacteria 5843
609 Ga0496100_0061984 3300048903 Unclassified 2466
610 Ga0496100_0139811 3300048903 Bacteria 1715
611 Ga0496101_0000745 3300048904 Bacteria 19316
612 Ga0496101_0001389 3300048904 Bacteria 14495
613 Ga0496101_0033798 3300048904 Bacteria 3609
614 Ga0496101_0051101 3300048904 Unclassified 2977
615 Ga0496101_0104168 3300048904 Bacteria 2128
616 Ga0496101_0140746 3300048904 Bacteria 1839
617 Ga0496102_0006447 3300048905 Bacteria 10007
618 Ga0496102_0126388 3300048905 Bacteria 2390
619 Ga0496102_0249710 3300048905 Bacteria 1673
620 Ga0496102_0334852 3300048905 Bacteria 1425
621 Ga0496102_0345188 3300048905 Unclassified 1402
622 Ga0496103_0009315 3300048906 Bacteria 5819
623 Ga0496103_0036650 3300048906 Unclassified 3004
624 Ga0496103_0040444 3300048906 Bacteria 2865
625 Ga0496103_0154421 3300048906 Bacteria 1471
626 Ga0496104_0005726 3300048907 Bacteria 10872
627 Ga0496104_0008448 3300048907 Bacteria 9155
628 Ga0496104_0038427 3300048907 Bacteria 4479
629 Ga0496104_0089195 3300048907 Bacteria 2946
630 Ga0496104_0155582 3300048907 Unclassified 2194
631 Ga0496104_0351788 3300048907 Bacteria 1386
632 Ga0496105_0000092 3300048908 Bacteria 62726
633 Ga0496105_0008326 3300048908 Bacteria 8060
634 Ga0496105_0014858 3300048908 Bacteria 6199
635 Ga0496105_0039809 3300048908 Bacteria 3875
636 Ga0496105_0077680 3300048908 Bacteria 2741
637 Ga0496106_0011906 3300048909 Bacteria 6421
638 Ga0496106_0025492 3300048909 Bacteria 4401
639 Ga0496106_0027167 3300048909 Bacteria 4262
640 Ga0496106_0280221 3300048909 Bacteria 1336
641 Ga0496106_0283970 3300048909 Bacteria 1326
642 Ga0496107_0008186 3300048910 Bacteria 7229
643 Ga0496107_0042719 3300048910 Bacteria 3256
644 Ga0496107_0166711 3300048910 Bacteria 1633
645 Ga0496107_0222397 3300048910 Bacteria 1405
646 Ga0496107_0231900 3300048910 Bacteria 1374
647 Ga0496107_0306349 3300048910 Unclassified 1182
648 Ga0496108_0004497 3300048911 Bacteria 11232
649 Ga0496108_0020817 3300048911 Bacteria 5393
650 Ga0496108_0049082 3300048911 Bacteria 3530
651 Ga0496108_0236887 3300048911 Bacteria 1587
652 Ga0496109_0005332 3300048912 Bacteria 10749
653 Ga0496109_0015046 3300048912 Bacteria 6733
654 Ga0496109_0016884 3300048912 Bacteria 6387
655 Ga0496109_0058568 3300048912 Bacteria 3518
656 Ga0496109_0210599 3300048912 Bacteria 1828
657 Ga0496109_0423964 3300048912 Archaea 1257
658 Ga0496110_0001135 3300048913 Bacteria 18829
659 Ga0496110_0005043 3300048913 Bacteria 10320
660 Ga0496110_0026862 3300048913 Bacteria 4929
661 Ga0496110_0044456 3300048913 Bacteria 3878
662 Ga0496110_0208213 3300048913 Bacteria 1777
663 Ga0496111_0001391 3300048914 Bacteria 13734
664 Ga0496111_0005159 3300048914 Bacteria 8329
665 Ga0496111_0010119 3300048914 Bacteria 6313
666 Ga0496111_0024233 3300048914 Bacteria 4270
667 Ga0496111_0033950 3300048914 Bacteria 3640
668 Ga0496111_0144710 3300048914 Bacteria 1762
669 Ga0496111_0145106 3300048914 Unclassified 1759
670 Ga0496112_0038076 3300048915 Bacteria 4696
671 Ga0496112_0094502 3300048915 Bacteria 2960
672 Ga0496112_0493952 3300048915 Unclassified 1160
673 Ga0496113_0016441 3300048916 Bacteria 5112
674 Ga0496113_0143446 3300048916 Unclassified 1880
675 Ga0496113_0293747 3300048916 Bacteria 1300
676 Ga0496114_0000570 3300048917 Bacteria 27268
677 Ga0496114_0004918 3300048917 Bacteria 10410
678 Ga0496114_0061489 3300048917 Bacteria 3141
679 Ga0496114_0088448 3300048917 Bacteria 2627
680 Ga0496114_0166008 3300048917 Bacteria 1922
681 Ga0496114_0255410 3300048917 Unclassified 1542
682 Ga0496115_0002884 3300048918 Bacteria 12387
683 Ga0496115_0004959 3300048918 Bacteria 9670
684 Ga0496115_0208173 3300048918 Bacteria 1616
685 Ga0501031_0147083 3300049568 Bacteria 1539
686 Ga0501032_0012379 3300049569 Bacteria 6098
687 Ga0501033_0009406 3300049570 Bacteria 7524
688 Ga0501033_0190359 3300049570 Bacteria 1468
689 Ga0501034_0033688 3300049571 Bacteria 5193
690 Ga0501036_0010250 3300049572 Bacteria 7729
691 Ga0501036_0039015 3300049572 Bacteria 4021
692 Ga0501036_0312940 3300049572 Bacteria 1313
693 Ga0501037_0018228 3300049573 Bacteria 5172
694 Ga0501037_0024816 3300049573 Bacteria 4432
695 Ga0501038_0008602 3300049574 Bacteria 9368
696 Ga0501038_0017471 3300049574 Bacteria 6484
697 Ga0501038_0069629 3300049574 Bacteria 2988
698 Ga0501039_0021594 3300049575 Bacteria 4938
699 Ga0501039_0204264 3300049575 Bacteria 1553
700 Ga0501040_0002954 3300049576 Bacteria 10999
701 Ga0501040_0008892 3300049576 Bacteria 6530
702 Ga0501040_0022680 3300049576 Bacteria 4205
703 Ga0501040_0237465 3300049576 Bacteria 1299
704 Ga0501041_0000642 3300049577 Bacteria 18327
705 Ga0501041_0021858 3300049577 Bacteria 3832
706 Ga0501041_0067773 3300049577 Bacteria 2187
707 Ga0501041_0165727 3300049577 Bacteria 1382
708 Ga0501042_0006076 3300049578 Bacteria 7822
709 Ga0501042_0020099 3300049578 Bacteria 4644
710 Ga0501042_0042560 3300049578 Bacteria 3233
711 Ga0501042_0128224 3300049578 Bacteria 1827
712 Ga0501043_0025395 3300049579 Bacteria 4648
713 Ga0501043_0152451 3300049579 Bacteria 1808
714 Ga0501046_0048628 3300049580 Bacteria 3357
715 Ga0501046_0234275 3300049580 Bacteria 1355
716 Ga0501047_0029693 3300049581 Bacteria 5271
717 Ga0501047_0055501 3300049581 Bacteria 3830
718 Ga0501048_0001465 3300049582 Bacteria 17896
719 Ga0501048_0007213 3300049582 Bacteria 8438
720 Ga0501048_0047071 3300049582 Unclassified 3077
721 Ga0501048_0292016 3300049582 Bacteria 1159
722 Ga0501067_0027487 3300049583 Bacteria 3152
723 Ga0501067_0106012 3300049583 Bacteria 1562
724 Ga0501067_0107308 3300049583 Unclassified 1552
725 Ga0501067_0113783 3300049583 Bacteria 1505
726 Ga0501068_0056923 3300049584 Bacteria 2370
727 Ga0501069_0002590 3300049585 Bacteria 9222
728 Ga0501069_0005484 3300049585 Bacteria 6600
729 Ga0501069_0022568 3300049585 Bacteria 3426
730 Ga0501069_0051075 3300049585 Bacteria 2300
731 Ga0501069_0099359 3300049585 Bacteria 1651
732 Ga0501069_0133021 3300049585 Bacteria 1425
733 Ga0501070_0000932 3300049586 Bacteria 26359
734 Ga0501070_0108300 3300049586 Bacteria 2296
735 Ga0501070_0148975 3300049586 Bacteria 1931
736 Ga0501070_0186256 3300049586 Bacteria 1707
737 Ga0501071_0000997 3300049587 Bacteria 15530
738 Ga0501071_0019993 3300049587 Bacteria 4651
739 Ga0501071_0039942 3300049587 Bacteria 3357
740 Ga0501071_0099787 3300049587 Bacteria 2140
741 Ga0501072_0003712 3300049588 Bacteria 11511
742 Ga0501072_0048785 3300049588 Bacteria 3333
743 Ga0501072_0069786 3300049588 Bacteria 2774
744 Ga0501072_0087033 3300049588 Bacteria 2479
745 Ga0501072_0210920 3300049588 Bacteria 1548
746 Ga0501073_0010424 3300049589 Bacteria 6815
747 Ga0501073_0145596 3300049589 Bacteria 1642
748 Ga0501074_0036015 3300049590 Bacteria 3585
749 Ga0501074_0088730 3300049590 Bacteria 2215
750 Ga0501074_0146768 3300049590 Bacteria 1687
751 Ga0501074_0163469 3300049590 Bacteria 1589
752 Ga0501074_0227578 3300049590 Bacteria 1327
753 Ga0501075_0017454 3300049591 Bacteria 5185
754 Ga0501075_0053219 3300049591 Unclassified 3044
755 Ga0501075_0246245 3300049591 Bacteria 1362
756 Ga0501076_0001003 3300049592 Bacteria 18496
757 Ga0501076_0004726 3300049592 Bacteria 9717
758 Ga0501076_0025881 3300049592 Bacteria 4542
759 Ga0501076_0201667 3300049592 Bacteria 1624
760 Ga0501076_0216028 3300049592 Unclassified 1567
761 Ga0501076_0335511 3300049592 Bacteria 1241
762 Ga0501077_0001414 3300049593 Bacteria 14418
763 Ga0501077_0034601 3300049593 Bacteria 3215
764 Ga0501077_0037976 3300049593 Bacteria 3066
765 Ga0501077_0094328 3300049593 Bacteria 1897
766 Ga0501079_0000515 3300049741 Bacteria 25161
767 Ga0501079_0011954 3300049741 Bacteria 6626
768 Ga0501079_0021415 3300049741 Bacteria 4945
769 Ga0501079_0056607 3300049741 Bacteria 3026
770 Ga0501079_0075187 3300049741 Bacteria 2612
771 Ga0501079_0097710 3300049741 Bacteria 2276
772 Ga0501079_0142814 3300049741 Bacteria 1865
773 Ga0501079_0150137 3300049741 Bacteria 1816
774 Ga0501080_0064210 3300049742 Bacteria 3415
775 Ga0501080_0130413 3300049742 Bacteria 2327
776 Ga0501080_0280372 3300049742 Bacteria 1515
777 Ga0501081_0004921 3300049743 Bacteria 8588
778 Ga0501081_0009112 3300049743 Bacteria 6457
779 Ga0501081_0025254 3300049743 Bacteria 3995
780 Ga0501081_0072488 3300049743 Bacteria 2402
781 Ga0501081_0115061 3300049743 Bacteria 1912
782 Ga0501081_0140695 3300049743 Unclassified 1729
783 Ga0501081_0178233 3300049743 Bacteria 1536
784 Ga0501083_0031724 3300049744 Bacteria 3626
785 Ga0501083_0044564 3300049744 Unclassified 3002
786 Ga0501035_0060975 3300049822 Bacteria 3357
787 Ga0501035_0123850 3300049822 Bacteria 2258
788 Ga0501035_0177045 3300049822 Bacteria 1839
789 Ga0501044_0005405 3300049823 Bacteria 14189
790 Ga0501044_0223057 3300049823 Archaea 1835
791 Ga0501045_0006880 3300049824 Bacteria 7882
792 Ga0501045_0010910 3300049824 Bacteria 6363
793 Ga0501045_0044426 3300049824 Unclassified 3237
794 Ga0501045_0064086 3300049824 Bacteria 2697
795 Ga0501045_0066109 3300049824 Bacteria 2655
796 Ga0501045_0068604 3300049824 Bacteria 2605
797 Ga0501045_0101923 3300049824 Bacteria 2125
798 Ga0501045_0135880 3300049824 Bacteria 1828
799 nmdc:mga00v17_6506_c1 3300050491 Bacteria 6202
800 nmdc:mga05p37_129809_c1 3300050507 Bacteria 3092
801 nmdc:mga05p37_20055_c1 3300050507 Bacteria 8090
802 nmdc:mga05p37_259958_c1 3300050507 Bacteria 2078
803 nmdc:mga05p37_60110_c1 3300050507 Bacteria 4679
804 nmdc:mga09592_282492_c1 3300050508 Bacteria 1440
805 nmdc:mga09592_8847_c1 3300050508 Bacteria 8190
806 nmdc:mga0qj67_6754_c1 3300050509 Bacteria 8434
807 nmdc:mga06r32_4545_c1 3300050510 Bacteria 12431
808 nmdc:mga08y16_43344_c1 3300050511 Bacteria 4716
809 nmdc:mga08y16_4467_c1 3300050511 Bacteria 14616
810 nmdc:mga08y16_77133_c1 3300050511 Bacteria 3474
811 nmdc:mga0n895_3110_c1 3300050512 Bacteria 13221
812 nmdc:mga0n895_60199_c1 3300050512 Bacteria 3747
813 nmdc:mga0rr50_254865_c1 3300050513 Bacteria 1458
814 nmdc:mga0rr50_27411_c1 3300050513 Bacteria 3989
815 nmdc:mga0rr50_47732_c1 3300050513 Bacteria 3161
816 nmdc:mga0a205_377077_c1 3300050515 Bacteria 1284
817 Ga0495612_0007703 3300053078 Bacteria 4396
818 Ga0495612_0050201 3300053078 Unclassified 1713
819 Ga0495655_0002212 3300053083 Bacteria 3072
820 Ga0495619_0010604 3300053085 Bacteria 5797
821 Ga0495619_0134604 3300053085 Bacteria 1699
822 Ga0501084_0001865 3300054114 Bacteria 16783
823 Ga0501084_0021635 3300054114 Bacteria 5362
824 Ga0501084_0028358 3300054114 Bacteria 4679
825 Ga0501084_0111285 3300054114 Bacteria 2301
826 Ga0501084_0129986 3300054114 Bacteria 2120
827 Ga0501082_0000729 3300060353 Bacteria 28974
828 Ga0501082_0044683 3300060353 Bacteria 3821
829 Ga0501082_0083710 3300060353 Bacteria 2752
830 Ga0501082_0110525 3300060353 Bacteria 2379
831 Ga0501082_0274139 3300060353 Bacteria 1468
832 Ga0466962_0000661 3300061719 Bacteria 15283
833 Ga0466962_0009711 3300061719 Bacteria 4618
834 Ga0466962_0011442 3300061719 Bacteria 4271
835 Ga0530510_0004851 3300061734 Bacteria 9309
836 Ga0530510_0013682 3300061734 Bacteria 5711
837 Ga0530510_0023096 3300061734 Bacteria 4429
838 Ga0530510_0065130 3300061734 Bacteria 2640
839 Ga0530510_0164074 3300061734 Bacteria 1644
840 Ga0207652_10142433
841 JGI24751J29686_10007330
842 Ga0070658_10010114
843 Ga0070676_10124406
844 Ga0070683_100015830
845 Ga0070683_100015891
846 Ga0070683_100030281
847 Ga0070683_100036759
848 Ga0070683_100054672
849 Ga0070683_100056804
850 Ga0070683_100064594
851 Ga0070683_100084745
852 Ga0070683_100155406
853 Ga0070683_100224722
854 Ga0070683_100322751
855 Ga0070690_100118952
856 Ga0070670_100010859
857 Ga0068869_100010513
858 Ga0068869_100078836
859 Ga0070680_100005086
860 Ga0070680_100008703
861 Ga0070680_100023016
862 Ga0070680_100044147
863 Ga0070680_100155552
864 Ga0070682_100008580
865 Ga0070682_100009117
866 Ga0070682_100019435
867 Ga0070682_100128267
868 Ga0068868_100054441
869 Ga0070660_100003574
870 Ga0070660_100015515
871 Ga0070660_100020419
872 Ga0070660_100030252
873 Ga0070660_100036011
874 Ga0070660_100036981
875 Ga0070660_100089764
876 Ga0070660_100144054
877 Ga0070689_100008401
878 Ga0070689_100077028
879 Ga0070691_10003647
880 Ga0070691_10058157
881 Ga0070661_100006585
882 Ga0070661_100008439
883 Ga0070661_100015898
884 Ga0070661_100016782
885 Ga0070661_100051329
886 Ga0070661_100055728
887 Ga0070661_100064499
888 Ga0070692_10026747
889 Ga0070692_10046905
890 Ga0070675_100023009
891 Ga0070675_100046807
892 Ga0070671_100096596
893 Ga0070674_100001302
894 Ga0070674_100067398
895 Ga0070673_100030163
896 Ga0070688_100092772
897 Ga0070688_100124254
898 Ga0070659_100013626
899 Ga0070659_100016104
900 Ga0070659_100040076
901 Ga0070659_100045849
902 Ga0070659_100114484
903 Ga0070659_100140678
904 Ga0070709_10048057
905 Ga0070714_100013725
906 Ga0070714_100056459
907 Ga0070714_100106721
908 Ga0070714_100109946
909 Ga0070713_100112126
910 Ga0070710_10028029
911 Ga0070710_10062693
912 Ga0070701_10010620
913 Ga0070701_10066896
914 Ga0070711_100095013
915 Ga0070711_100261444
916 Ga0070700_100098109
917 Ga0070708_100079170
918 Ga0070708_100152619
919 Ga0070708_100337694
920 Ga0070663_100079549
921 Ga0070678_100080965
922 Ga0070662_100040166
923 Ga0070662_100048186
924 Ga0070681_10000749
925 Ga0070681_10006655
926 Ga0070681_10009487
927 Ga0070681_10093430
928 Ga0070681_10334230
929 Ga0068867_100034924
930 Ga0068867_100173014
931 Ga0068867_100305086
932 Ga0070685_10005978
933 Ga0070706_100388506
934 Ga0070707_100106168
935 Ga0070698_100019245
936 Ga0070698_100041887
937 Ga0070698_100179487
938 Ga0070698_100295449
939 Ga0070699_100089410
940 Ga0070699_100141498
941 Ga0070699_100184688
942 Ga0070679_100005464
943 Ga0070679_100032625
944 Ga0070679_100039537
945 Ga0070679_100049312
946 Ga0070679_100064508
947 Ga0070679_100095677
948 Ga0070679_100113839
949 Ga0070684_100005027
950 Ga0070684_100011603
951 Ga0070684_100014289
952 Ga0070684_100027664
953 Ga0070684_100030872
954 Ga0070684_100034227
955 Ga0070684_100040658
956 Ga0070684_100041144
957 Ga0070684_100055365
958 Ga0070684_100069774
959 Ga0070684_100084843
960 Ga0070684_100114531
961 Ga0070684_100124503
962 Ga0068853_100009467
963 Ga0070672_100003936
964 Ga0070672_100023768
965 Ga0070686_100014712
966 Ga0070695_100123706
967 Ga0070696_100124520
968 Ga0070696_100157078
969 Ga0070693_100019933
970 Ga0070693_100023607
971 Ga0070693_100046798
972 Ga0070665_100033445
973 Ga0070704_100029686
974 Ga0070704_100194221
975 Ga0070704_100313733
976 Ga0070704_100335741
977 Ga0068855_100032562
978 Ga0068855_100037090
979 Ga0068855_100045854
980 Ga0068855_100058740
981 Ga0068855_100061055
982 Ga0068855_100131207
983 Ga0070664_100014453
984 Ga0070664_100039824
985 Ga0070664_100324800
986 Ga0068857_100045121
987 Ga0068857_100049130
988 Ga0068857_100054005
989 Ga0068857_100137342
990 Ga0068857_100292668
991 Ga0068854_100026625
992 Ga0068854_100238932
993 Ga0068856_100028398
994 Ga0068856_100082748
995 Ga0068856_100122243
996 Ga0068856_100302831
997 Ga0068856_100401464
998 Ga0070702_100019096
999 Ga0070702_100022581
1000 Ga0070702_100050663
1001 Ga0068852_100008666
1002 Ga0068852_100159231
1003 Ga0068859_100370367
1004 Ga0068864_100008532
1005 Ga0068864_100064126
1006 Ga0068864_100308730
1007 Ga0068866_10144683
1008 Ga0068851_10025677
1009 Ga0068870_10004976
1010 Ga0068870_10030426
1011 Ga0068863_100020555
1012 Ga0068858_100169147
1013 Ga0068860_100233063
1014 Ga0081455_10001959
1015 Ga0081455_10029352
1016 Ga0081455_10031718
1017 Ga0081455_10063555
1018 Ga0081455_10154165
1019 Ga0081538_10001290
1020 Ga0081538_10034537
1021 Ga0070717_10014420
1022 Ga0070717_10025725
1023 Ga0070717_10152348
1024 Ga0070717_10186398
1025 Ga0075364_10008748
1026 Ga0075364_10030740
1027 Ga0075432_10036939
1028 Ga0070715_10016206
1029 Ga0070715_10080829
1030 Ga0070716_100167805
1031 Ga0070712_100009618
1032 Ga0070712_100013144
1033 Ga0070712_100062243
1034 Ga0070712_100163318
1035 Ga0075362_10002455
1036 Ga0097621_100098314
1037 Ga0075428_100058183
1038 Ga0075428_100439815
1039 Ga0075430_100018905
1040 Ga0075433_10120348
1041 Ga0075434_100057551
1042 Ga0075434_100149161
1043 Ga0075429_100110113
1044 Ga0068865_100011508
1045 Ga0068865_100058112
1046 Ga0068865_100063414
1047 Ga0075436_100055067
1048 Ga0097620_100370371
1049 Ga0075435_100025171
1050 Ga0105240_10078090
1051 Ga0105240_10210478
1052 Ga0105240_10308024
1053 Ga0105240_10512389
1054 Ga0111539_10002753
1055 Ga0111539_10027719
1056 Ga0111539_10045112
1057 Ga0111539_10108767
1058 Ga0111539_10170250
1059 Ga0111539_10298684
1060 Ga0105245_10018522
1061 Ga0105245_10027306
1062 Ga0105245_10068145
1063 Ga0105245_10131931
1064 Ga0105245_10405334
1065 Ga0114129_10044321
1066 Ga0114129_10286351
1067 Ga0105243_10007960
1068 Ga0105243_10067568
1069 Ga0105243_10146371
1070 Ga0105243_10186840
1071 Ga0105243_10216847
1072 Ga0105243_10224610
1073 Ga0105241_10435528
1074 Ga0105242_10027625
1075 Ga0105242_10067261
1076 Ga0105242_10075192
1077 Ga0105242_10081304
1078 Ga0105242_10095615
1079 Ga0105242_10126199
1080 Ga0105248_10041322
1081 Ga0105237_10065429
1082 Ga0105237_10188522
1083 Ga0105238_10010250
1084 Ga0105238_10355194
1085 Ga0105249_10044752
1086 Ga0105249_10076206
1087 Ga0105249_10187372
1088 Ga0105239_10056070
1089 Ga0105239_10175366
1090 Ga0105246_10101897
1091 Ga0157373_10103066
1092 Ga0157371_10007020
1093 Ga0157370_10006143
1094 Ga0157370_10015065
1095 Ga0157370_10197257
1096 Ga0157370_10371623
1097 Ga0157369_10003856
1098 Ga0157369_10019412
1099 Ga0157369_10032679
1100 Ga0157369_10033145
1101 Ga0157369_10033154
1102 Ga0157369_10077696
1103 Ga0157378_10101345
1104 Ga0157378_10116958
1105 Ga0157378_10194553
1106 Ga0163162_10141206
1107 Ga0163162_10177139
1108 Ga0157372_10026859
1109 Ga0157372_10039029
1110 Ga0157372_10131467
1111 Ga0157372_10184521
1112 Ga0157372_10235230
1113 Ga0157372_10457091
1114 Ga0157375_10029202
1115 Ga0157375_10087185
1116 Ga0163163_10147669
1117 Ga0157380_10009357
1118 Ga0157380_10024897
1119 Ga0157380_10127513
1120 Ga0157377_10006038
1121 Ga0157377_10012532
1122 Ga0157377_10035908
1123 Ga0157377_10050784
1124 Ga0157379_10211108
1125 Ga0157376_10011069
1126 Ga0157376_10212840
1127 Ga0197907_11224760
1128 Ga0206354_11621597
1129 Ga0206353_10906813
1130 Ga0206353_11793764
1131 Ga0213871_10013380
1132 Ga0207653_10043062
1133 Ga0207692_10003153
1134 Ga0207688_10000822
1135 Ga0207688_10015428
1136 Ga0207688_10020581
1137 Ga0207688_10025867
1138 Ga0207688_10031096
1139 Ga0207699_10199921
1140 Ga0207645_10071477
1141 Ga0207643_10005291
1142 Ga0207643_10038895
1143 Ga0207643_10043869
1144 Ga0207643_10179603
1145 Ga0207705_10083844
1146 Ga0207705_10095709
1147 Ga0207705_10173619
1148 Ga0207705_10200156
1149 Ga0207705_10239467
1150 Ga0207684_10324584
1151 Ga0207654_10117976
1152 Ga0207707_10024128
1153 Ga0207707_10037642
1154 Ga0207707_10045018
1155 Ga0207707_10146910
1156 Ga0207695_10344922
1157 Ga0207695_10375501
1158 Ga0207671_10263029
1159 Ga0207693_10002091
1160 Ga0207693_10171163
1161 Ga0207660_10005528
1162 Ga0207660_10020652
1163 Ga0207660_10025160
1164 Ga0207662_10010917
1165 Ga0207657_10000486
1166 Ga0207657_10001651
1167 Ga0207657_10010171
1168 Ga0207657_10012673
1169 Ga0207657_10015181
1170 Ga0207657_10021999
1171 Ga0207657_10047551
1172 Ga0207657_10124977
1173 Ga0207649_10024282
1174 Ga0207649_10025612
1175 Ga0207649_10110558
1176 Ga0207652_10006427
1177 Ga0207652_10030079
1178 Ga0207652_10058584
1179 Ga0207652_10069779
1180 Ga0207652_10147477
1181 Ga0207650_10060467
1182 Ga0207659_10145356
1183 Ga0207659_10155216
1184 Ga0207659_10159429
1185 Ga0207687_10005316
1186 Ga0207687_10031906
1187 Ga0207664_10207692
1188 Ga0207690_10007278
1189 Ga0207690_10047190
1190 Ga0207690_10056383
1191 Ga0207690_10059503
1192 Ga0207690_10307520
1193 Ga0207706_10002051
1194 Ga0207706_10052223
1195 Ga0207706_10059081
1196 Ga0207686_10025311
1197 Ga0207686_10146804
1198 Ga0207709_10042277
1199 Ga0207670_10024035
1200 Ga0207669_10011544
1201 Ga0207691_10006749
1202 Ga0207691_10060912
1203 Ga0207691_10108267
1204 Ga0207711_10296743
1205 Ga0207689_10118178
1206 Ga0207661_10000195
1207 Ga0207661_10011506
1208 Ga0207661_10086261
1209 Ga0207661_10136475
1210 Ga0207661_10154167
1211 Ga0207661_10161014
1212 Ga0207679_10019329
1213 Ga0207679_10038699
1214 Ga0207667_10168665
1215 Ga0207667_10192681
1216 Ga0207651_10032369
1217 Ga0207651_10093539
1218 Ga0207712_10255116
1219 Ga0207668_10078192
1220 Ga0207668_10279827
1221 Ga0207640_10047495
1222 Ga0207639_10034181
1223 Ga0207639_10343403
1224 Ga0207678_10039615
1225 Ga0207678_10043583
1226 Ga0207678_10070736
1227 Ga0207678_10130033
1228 Ga0207708_10017804
1229 Ga0207708_10036713
1230 Ga0207708_10038162
1231 Ga0207702_10013308
1232 Ga0207702_10031145
1233 Ga0207702_10051095
1234 Ga0207702_10086471
1235 Ga0207702_10105480
1236 Ga0207648_10176049
1237 Ga0207648_10338623
1238 Ga0207676_10026885
1239 Ga0207674_10008631
1240 Ga0207674_10008773
1241 Ga0207674_10026630
1242 Ga0207674_10030732
1243 Ga0207674_10082538
1244 Ga0207674_10139127
1245 Ga0207675_100084473
1246 Ga0207683_10032676
1247 Ga0207683_10040427
1248 Ga0207683_10166674
1249 Ga0207683_10291673
1250 Ga0207698_10014637
1251 Ga0207698_10041458
1252 Ga0207428_10002821
1253 Ga0207428_10008067
1254 Ga0207428_10009180
1255 Ga0207428_10018875
1256 Ga0268266_10046878
1257 Ga0268266_10075604
1258 Ga0268264_10043596
1259 Ga0265319_1027097
1260 Ga0265318_10009735
1261 Ga0265318_10019457
1262 Ga0265322_10011901
1263 Ga0265322_10021932
1264 Ga0265338_10014805
1265 Ga0265338_10053965
1266 Ga0265338_10213368
1267 Ga0265324_10012363
1268 Ga0265330_10031776
1269 Ga0265330_10048606
1270 Ga0265332_10084565
1271 Ga0265325_10031136
1272 Ga0265325_10110920
1273 Ga0265339_10024102
1274 Ga0265327_10045506
1275 Ga0265316_10029926
1276 Ga0307408_100031946
1277 Ga0265313_10004167
1278 Ga0265313_10009381
1279 Ga0265314_10010725
1280 Ga0265342_10047624
1281 Ga0307409_100168334
1282 Ga0307409_100261270
1283 Ga0307414_10076413
1284 Ga0373951_0011845
1285 Ga0373943_0004770
1286 Ga0373946_0007039
1287 Ga0373935_0028527
1288 Ga0373935_0043479
1289 Ga0373935_0287616
1290 Ga0373927_0063107
1291 Ga0373947_0000833
1292 Ga0373947_0004241
1293 Ga0373937_0041010
1294 Ga0373937_0480453
1295 Ga0373925_0011906
1296 Ga0395899_0003567
1297 Ga0395899_0017962
1298 Ga0395899_0033726
1299 Ga0395899_0163905
1300 Ga0395900_0001819
1301 Ga0395900_0014881
1302 Ga0395900_0024327
1303 Ga0395900_0096245
1304 Ga0395900_0101216
1305 Ga0395898_0002618
1306 Ga0395898_0014564
1307 Ga0395898_0180963
1308 Ga0395898_0251229
1309 Ga0395905_0009197
1310 Ga0395905_0032649
1311 Ga0395905_0066382
1312 Ga0395905_0315152
1313 Ga0395901_0001138
1314 Ga0395901_0154410
1315 Ga0395901_0186682
1316 Ga0395901_0212577
1317 Ga0436365_0434512
1318 Ga0436360_0143933
1319 Ga0436363_1187594
1320 Ga0436362_0037531
1321 Ga0439463_018308
1322 Ga0450920_005795
1323 Ga0439446_0022649
1324 Ga0466969_0017142
1325 Ga0466965_0066965
1326 Ga0466965_0100011
1327 Ga0466966_0007508
1328 Ga0466966_0013272
1329 Ga0466966_0128973
1330 Ga0466961_0006627
1331 Ga0466961_0010932
1332 Ga0466961_0019336
1333 Ga0466963_0005065
1334 Ga0466963_0039337
1335 Ga0466963_0056514
1336 Ga0466963_0072594
1337 Ga0466963_0147588
1338 Ga0466963_0171284
1339 Ga0466963_0201582
1340 Ga0466964_0016632
1341 Ga0466971_0001805
1342 Ga0466971_0003461
1343 Ga0466971_0004010
1344 Ga0466971_0010864
1345 Ga0466968_0011166
1346 Ga0466968_0021808
1347 Ga0466970_0018788
1348 Ga0466957_0012546
1349 Ga0466957_0021598
1350 Ga0466957_0033737
1351 Ga0466957_0136216
1352 Ga0466960_0051139
1353 Ga0466959_0003619
1354 Ga0466959_0008520
1355 Ga0466959_0018649
1356 Ga0466959_0023916
1357 Ga0466959_0062769
1358 Ga0466958_0005516
1359 Ga0466958_0008945
1360 Ga0466958_0009049
1361 Ga0466958_0009210
1362 Ga0466958_0023818
1363 Ga0466958_0024983
1364 Ga0466958_0059446
1365 Ga0466967_0000602
1366 Ga0466967_0004099
1367 Ga0466967_0004937
1368 Ga0466967_0009609
1369 Ga0466967_0012582
1370 Ga0466967_0018008
1371 Ga0466967_0025019
1372 Ga0466967_0035358
1373 Ga0466967_0056609
1374 Ga0466967_0138433
1375 Ga0466967_0212181
1376 Ga0466967_0249958
1377 Ga0466967_0260988
1378 Ga0495592_0094033
1379 Ga0495629_0000983
1380 Ga0495629_0026236
1381 Ga0495629_0043301
1382 Ga0495629_0050286
1383 Ga0495641_0000513
1384 Ga0495653_0027441
1385 Ga0495653_0089323
1386 Ga0495653_0130356
1387 Ga0495582_0000553
1388 Ga0495582_0061000
1389 Ga0495662_0007890
1390 Ga0495608_0004647
1391 Ga0495608_0010647
1392 Ga0495608_0049347
1393 Ga0495618_0190545
1394 Ga0495628_0049357
1395 Ga0495628_0183967
1396 Ga0495630_0011346
1397 Ga0495630_0012886
1398 Ga0495630_0039587
1399 Ga0495631_0043159
1400 Ga0495652_0045046
1401 Ga0495652_0070467
1402 Ga0495652_0097501
1403 Ga0495652_0129180
1404 Ga0495665_0005465
1405 Ga0495640_0024123
1406 Ga0495586_0020193
1407 Ga0495586_0029424
1408 Ga0495609_0048947
1409 Ga0495645_0037023
1410 Ga0495645_0162819
1411 Ga0495667_0016085
1412 Ga0495667_0028440
1413 Ga0495656_0054762
1414 Ga0495634_0032786
1415 Ga0495634_0099103
1416 Ga0495635_0035027
1417 Ga0495635_0079802
1418 Ga0495588_0093994
1419 Ga0495657_0091790
1420 Ga0495657_0091984
1421 Ga0495657_0228486
1422 Ga0495647_0006157
1423 Ga0495658_0002075
1424 Ga0495613_0010487
1425 Ga0495613_0022025
1426 Ga0495613_0152080
1427 Ga0495624_0007147
1428 Ga0495624_0046705
1429 Ga0495671_0044900
1430 Ga0495589_0068741
1431 Ga0495581_0001833
1432 Ga0495604_0027208
1433 Ga0495604_0055205
1434 Ga0495604_0082603
1435 Ga0495674_0003155
1436 Ga0495674_0157775
1437 Ga0495676_0029645
1438 Ga0495680_0004330
1439 Ga0495680_0007287
1440 Ga0495680_0019817
1441 Ga0495680_0059904
1442 Ga0495680_0080873
1443 Ga0495677_0014430
1444 Ga0495684_0282128
1445 Ga0495593_0009203
1446 Ga0495602_0103893
1447 Ga0496100_0008112
1448 Ga0496100_0061984
1449 Ga0496100_0139811
1450 Ga0496101_0000745
1451 Ga0496101_0001389
1452 Ga0496101_0033798
1453 Ga0496101_0051101
1454 Ga0496101_0104168
1455 Ga0496101_0140746
1456 Ga0496102_0006447
1457 Ga0496102_0126388
1458 Ga0496102_0249710
1459 Ga0496102_0334852
1460 Ga0496102_0345188
1461 Ga0496103_0009315
1462 Ga0496103_0036650
1463 Ga0496103_0040444
1464 Ga0496103_0154421
1465 Ga0496104_0005726
1466 Ga0496104_0008448
1467 Ga0496104_0038427
1468 Ga0496104_0089195
1469 Ga0496104_0155582
1470 Ga0496104_0351788
1471 Ga0496105_0000092
1472 Ga0496105_0008326
1473 Ga0496105_0014858
1474 Ga0496105_0039809
1475 Ga0496105_0077680
1476 Ga0496106_0011906
1477 Ga0496106_0025492
1478 Ga0496106_0027167
1479 Ga0496106_0280221
1480 Ga0496106_0283970
1481 Ga0496107_0008186
1482 Ga0496107_0042719
1483 Ga0496107_0166711
1484 Ga0496107_0222397
1485 Ga0496107_0231900
1486 Ga0496107_0306349
1487 Ga0496108_0004497
1488 Ga0496108_0020817
1489 Ga0496108_0049082
1490 Ga0496108_0236887
1491 Ga0496109_0005332
1492 Ga0496109_0015046
1493 Ga0496109_0016884
1494 Ga0496109_0058568
1495 Ga0496109_0210599
1496 Ga0496109_0423964
1497 Ga0496110_0001135
1498 Ga0496110_0005043
1499 Ga0496110_0026862
1500 Ga0496110_0044456
1501 Ga0496110_0208213
1502 Ga0496111_0001391
1503 Ga0496111_0005159
1504 Ga0496111_0010119
1505 Ga0496111_0024233
1506 Ga0496111_0033950
1507 Ga0496111_0144710
1508 Ga0496111_0145106
1509 Ga0496112_0038076
1510 Ga0496112_0094502
1511 Ga0496112_0493952
1512 Ga0496113_0016441
1513 Ga0496113_0143446
1514 Ga0496113_0293747
1515 Ga0496114_0000570
1516 Ga0496114_0004918
1517 Ga0496114_0061489
1518 Ga0496114_0088448
1519 Ga0496114_0166008
1520 Ga0496114_0255410
1521 Ga0496115_0002884
1522 Ga0496115_0004959
1523 Ga0496115_0208173
1524 Ga0501031_0147083
1525 Ga0501032_0012379
1526 Ga0501033_0009406
1527 Ga0501033_0190359
1528 Ga0501034_0033688
1529 Ga0501036_0010250
1530 Ga0501036_0039015
1531 Ga0501036_0312940
1532 Ga0501037_0018228
1533 Ga0501037_0024816
1534 Ga0501038_0008602
1535 Ga0501038_0017471
1536 Ga0501038_0069629
1537 Ga0501039_0021594
1538 Ga0501039_0204264
1539 Ga0501040_0002954
1540 Ga0501040_0008892
1541 Ga0501040_0022680
1542 Ga0501040_0237465
1543 Ga0501041_0000642
1544 Ga0501041_0021858
1545 Ga0501041_0067773
1546 Ga0501041_0165727
1547 Ga0501042_0006076
1548 Ga0501042_0020099
1549 Ga0501042_0042560
1550 Ga0501042_0128224
1551 Ga0501043_0025395
1552 Ga0501043_0152451
1553 Ga0501046_0048628
1554 Ga0501046_0234275
1555 Ga0501047_0029693
1556 Ga0501047_0055501
1557 Ga0501048_0001465
1558 Ga0501048_0007213
1559 Ga0501048_0047071
1560 Ga0501048_0292016
1561 Ga0501067_0027487
1562 Ga0501067_0106012
1563 Ga0501067_0107308
1564 Ga0501067_0113783
1565 Ga0501068_0056923
1566 Ga0501069_0002590
1567 Ga0501069_0005484
1568 Ga0501069_0022568
1569 Ga0501069_0051075
1570 Ga0501069_0099359
1571 Ga0501069_0133021
1572 Ga0501070_0000932
1573 Ga0501070_0108300
1574 Ga0501070_0148975
1575 Ga0501070_0186256
1576 Ga0501071_0000997
1577 Ga0501071_0019993
1578 Ga0501071_0039942
1579 Ga0501071_0099787
1580 Ga0501072_0003712
1581 Ga0501072_0048785
1582 Ga0501072_0069786
1583 Ga0501072_0087033
1584 Ga0501072_0210920
1585 Ga0501073_0010424
1586 Ga0501073_0145596
1587 Ga0501074_0036015
1588 Ga0501074_0088730
1589 Ga0501074_0146768
1590 Ga0501074_0163469
1591 Ga0501074_0227578
1592 Ga0501075_0017454
1593 Ga0501075_0053219
1594 Ga0501075_0246245
1595 Ga0501076_0001003
1596 Ga0501076_0004726
1597 Ga0501076_0025881
1598 Ga0501076_0201667
1599 Ga0501076_0216028
1600 Ga0501076_0335511
1601 Ga0501077_0001414
1602 Ga0501077_0034601
1603 Ga0501077_0037976
1604 Ga0501077_0094328
1605 Ga0501079_0000515
1606 Ga0501079_0011954
1607 Ga0501079_0021415
1608 Ga0501079_0056607
1609 Ga0501079_0075187
1610 Ga0501079_0097710
1611 Ga0501079_0142814
1612 Ga0501079_0150137
1613 Ga0501080_0064210
1614 Ga0501080_0130413
1615 Ga0501080_0280372
1616 Ga0501081_0004921
1617 Ga0501081_0009112
1618 Ga0501081_0025254
1619 Ga0501081_0072488
1620 Ga0501081_0115061
1621 Ga0501081_0140695
1622 Ga0501081_0178233
1623 Ga0501083_0031724
1624 Ga0501083_0044564
1625 Ga0501035_0060975
1626 Ga0501035_0123850
1627 Ga0501035_0177045
1628 Ga0501044_0005405
1629 Ga0501044_0223057
1630 Ga0501045_0006880
1631 Ga0501045_0010910
1632 Ga0501045_0044426
1633 Ga0501045_0064086
1634 Ga0501045_0066109
1635 Ga0501045_0068604
1636 Ga0501045_0101923
1637 Ga0501045_0135880
1638 nmdc:mga00v17_6506_c1
1639 nmdc:mga05p37_129809_c1
1640 nmdc:mga05p37_20055_c1
1641 nmdc:mga05p37_259958_c1
1642 nmdc:mga05p37_60110_c1
1643 nmdc:mga09592_282492_c1
1644 nmdc:mga09592_8847_c1
1645 nmdc:mga0qj67_6754_c1
1646 nmdc:mga06r32_4545_c1
1647 nmdc:mga08y16_43344_c1
1648 nmdc:mga08y16_4467_c1
1649 nmdc:mga08y16_77133_c1
1650 nmdc:mga0n895_3110_c1
1651 nmdc:mga0n895_60199_c1
1652 nmdc:mga0rr50_254865_c1
1653 nmdc:mga0rr50_27411_c1
1654 nmdc:mga0rr50_47732_c1
1655 nmdc:mga0a205_377077_c1
1656 Ga0495612_0007703
1657 Ga0495612_0050201
1658 Ga0495655_0002212
1659 Ga0495619_0010604
1660 Ga0495619_0134604
1661 Ga0501084_0001865
1662 Ga0501084_0021635
1663 Ga0501084_0028358
1664 Ga0501084_0111285
1665 Ga0501084_0129986
1666 Ga0501082_0000729
1667 Ga0501082_0044683
1668 Ga0501082_0083710
1669 Ga0501082_0110525
1670 Ga0501082_0274139
1671 Ga0466962_0000661
1672 Ga0466962_0009711
1673 Ga0466962_0011442
1674 Ga0530510_0004851
1675 Ga0530510_0013682
1676 Ga0530510_0023096
1677 Ga0530510_0065130
1678 Ga0530510_0164074

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00817

IMS

impB/mucB/samB family

29

176

0.98

PF11799

IMS_C

impB/mucB/samB family C-terminal domain

264

373

0.94

PF11798

IMS_HHH

IMS family HHH motif

188

219

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ig1-assembly1.cif.gz_F dna polymerase iv - dna ternary complex 10 0.9176 2 344
4r8u-assembly2.cif.gz_B s-sad structure of dinb-dna complex 0.9158 2 340
4q45-assembly1.cif.gz_F dna polymerase- damaged dna complex 0.9149 2 344
6ig1-assembly1.cif.gz_F dna polymerase iv - dna ternary complex 10 0.9099 2 344
1im4-assembly1.cif.gz_A crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus 0.9094 2 199
ID Description Score Start End Superfamily
1jx4A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9641 78 164 3.30.70.270
af_Q2FWZ5_4_63_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9626 13 71 3.40.1170.60
4ir1A02 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9605 21 72 3.40.1170.60
af_P34409_94_147_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9563 13 70 3.40.1170.60
af_O74944_370_477_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.9538 238 343 3.30.1490.100
ID Description Score Start End GO Terms
AF-X1E2E0-F1-model_v4 UmuC domain-containing protein 0.9862 8 84 GO:0003887
GO:0005829
GO:0009432
GO:0042276
AF-A0A497EBQ7-F1-model_v4 UmuC domain-containing protein 0.9856 2 91 GO:0003887
GO:0005829
GO:0009432
GO:0042276
AF-A0A2D5VMH9-F1-model_v4 UmuC domain-containing protein 0.981 2 108 GO:0003887
GO:0005829
GO:0009432
GO:0042276
AF-A0A7C5IWZ1-F1-model_v4 DNA polymerase IV 0.9752 2 163 GO:0003887
GO:0042276
AF-A3WZ00-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.973 238 343 GO:0003684
GO:0003887
GO:0005829
GO:0009432
GO:0042276

Map