F483015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 318 | 1678 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10142433|Ga0207652_101424333 |
| Length | 377 |
| Sequence | VALRIWMERASGAPGVGRTLEKPMIVAHLDLDAFFAAVEELENPALRRVPLVVGGDPKGRGVVATANYVARGFGIHSAMSCAEAHRRCPQAVFVRPRHSLYKDYSREVWSTIREIVPTVEQAGIDEGYLDLGEVAPAFDDARALAEAVRAVVRARTKLSCSLGVASSKVVAKVASDRRKPGGLTVVRPGKEAEFLAPFPIRILPGIGPRAEERLVAVGIKTIGDIAALEDDDLRGGVLSGKVGRELRDRARGIDRRTLEVSTERISISQEETFERDIGDPERLHDELRRMAEKLADHLRGRGMVGRTVTTKVRYPDFAIRTRSTSLPVGTDDGERIGELACQLLDRALHDRPGPLRLVGVGVSGLEDHVQLSFPAVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 199 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 200 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 9.18 |
| Rhizosphere | 90.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207652_10142433 | 3300025921 | Bacteria | 2144 |
| 2 | JGI24751J29686_10007330 | 3300002459 | Bacteria | 2253 |
| 3 | Ga0070658_10010114 | 3300005327 | Bacteria | 7571 |
| 4 | Ga0070676_10124406 | 3300005328 | Unclassified | 1623 |
| 5 | Ga0070683_100015830 | 3300005329 | Bacteria | 6632 |
| 6 | Ga0070683_100015891 | 3300005329 | Bacteria | 6622 |
| 7 | Ga0070683_100030281 | 3300005329 | Bacteria | 4910 |
| 8 | Ga0070683_100036759 | 3300005329 | Bacteria | 4481 |
| 9 | Ga0070683_100054672 | 3300005329 | Bacteria | 3702 |
| 10 | Ga0070683_100056804 | 3300005329 | Bacteria | 3635 |
| 11 | Ga0070683_100064594 | 3300005329 | Bacteria | 3407 |
| 12 | Ga0070683_100084745 | 3300005329 | Bacteria | 2969 |
| 13 | Ga0070683_100155406 | 3300005329 | Bacteria | 2169 |
| 14 | Ga0070683_100224722 | 3300005329 | Bacteria | 1784 |
| 15 | Ga0070683_100322751 | 3300005329 | Bacteria | 1470 |
| 16 | Ga0070690_100118952 | 3300005330 | Unclassified | 1771 |
| 17 | Ga0070670_100010859 | 3300005331 | Bacteria | 7779 |
| 18 | Ga0068869_100010513 | 3300005334 | Bacteria | 6038 |
| 19 | Ga0068869_100078836 | 3300005334 | Unclassified | 2454 |
| 20 | Ga0070680_100005086 | 3300005336 | Bacteria | 9922 |
| 21 | Ga0070680_100008703 | 3300005336 | Bacteria | 7780 |
| 22 | Ga0070680_100023016 | 3300005336 | Bacteria | 4965 |
| 23 | Ga0070680_100044147 | 3300005336 | Bacteria | 3621 |
| 24 | Ga0070680_100155552 | 3300005336 | Bacteria | 1920 |
| 25 | Ga0070682_100008580 | 3300005337 | Bacteria | 5768 |
| 26 | Ga0070682_100009117 | 3300005337 | Bacteria | 5609 |
| 27 | Ga0070682_100019435 | 3300005337 | Bacteria | 3984 |
| 28 | Ga0070682_100128267 | 3300005337 | Bacteria | 1713 |
| 29 | Ga0068868_100054441 | 3300005338 | Unclassified | 3153 |
| 30 | Ga0070660_100003574 | 3300005339 | Bacteria | 10734 |
| 31 | Ga0070660_100015515 | 3300005339 | Bacteria | 5504 |
| 32 | Ga0070660_100020419 | 3300005339 | Unclassified | 4867 |
| 33 | Ga0070660_100030252 | 3300005339 | Bacteria | 4062 |
| 34 | Ga0070660_100036011 | 3300005339 | Bacteria | 3747 |
| 35 | Ga0070660_100036981 | 3300005339 | Bacteria | 3700 |
| 36 | Ga0070660_100089764 | 3300005339 | Bacteria | 2422 |
| 37 | Ga0070660_100144054 | 3300005339 | Bacteria | 1913 |
| 38 | Ga0070689_100008401 | 3300005340 | Bacteria | 7272 |
| 39 | Ga0070689_100077028 | 3300005340 | Bacteria | 2613 |
| 40 | Ga0070691_10003647 | 3300005341 | Bacteria | 6949 |
| 41 | Ga0070691_10058157 | 3300005341 | Bacteria | 1856 |
| 42 | Ga0070661_100006585 | 3300005344 | Bacteria | 8009 |
| 43 | Ga0070661_100008439 | 3300005344 | Bacteria | 7122 |
| 44 | Ga0070661_100015898 | 3300005344 | Bacteria | 5310 |
| 45 | Ga0070661_100016782 | 3300005344 | Bacteria | 5184 |
| 46 | Ga0070661_100051329 | 3300005344 | Bacteria | 3018 |
| 47 | Ga0070661_100055728 | 3300005344 | Bacteria | 2894 |
| 48 | Ga0070661_100064499 | 3300005344 | Bacteria | 2691 |
| 49 | Ga0070692_10026747 | 3300005345 | Unclassified | 2854 |
| 50 | Ga0070692_10046905 | 3300005345 | Bacteria | 2235 |
| 51 | Ga0070675_100023009 | 3300005354 | Bacteria | 4979 |
| 52 | Ga0070675_100046807 | 3300005354 | Bacteria | 3543 |
| 53 | Ga0070671_100096596 | 3300005355 | Bacteria | 2478 |
| 54 | Ga0070674_100001302 | 3300005356 | Bacteria | 13114 |
| 55 | Ga0070674_100067398 | 3300005356 | Unclassified | 2517 |
| 56 | Ga0070673_100030163 | 3300005364 | Bacteria | 4053 |
| 57 | Ga0070688_100092772 | 3300005365 | Bacteria | 1976 |
| 58 | Ga0070688_100124254 | 3300005365 | Bacteria | 1732 |
| 59 | Ga0070659_100013626 | 3300005366 | Bacteria | 6058 |
| 60 | Ga0070659_100016104 | 3300005366 | Bacteria | 5610 |
| 61 | Ga0070659_100040076 | 3300005366 | Bacteria | 3659 |
| 62 | Ga0070659_100045849 | 3300005366 | Bacteria | 3426 |
| 63 | Ga0070659_100114484 | 3300005366 | Bacteria | 2179 |
| 64 | Ga0070659_100140678 | 3300005366 | Bacteria | 1965 |
| 65 | Ga0070709_10048057 | 3300005434 | Bacteria | 2661 |
| 66 | Ga0070714_100013725 | 3300005435 | Bacteria | 6496 |
| 67 | Ga0070714_100056459 | 3300005435 | Bacteria | 3358 |
| 68 | Ga0070714_100106721 | 3300005435 | Bacteria | 2474 |
| 69 | Ga0070714_100109946 | 3300005435 | Bacteria | 2439 |
| 70 | Ga0070713_100112126 | 3300005436 | Bacteria | 2379 |
| 71 | Ga0070710_10028029 | 3300005437 | Bacteria | 3009 |
| 72 | Ga0070710_10062693 | 3300005437 | Bacteria | 2121 |
| 73 | Ga0070701_10010620 | 3300005438 | Bacteria | 4080 |
| 74 | Ga0070701_10066896 | 3300005438 | Unclassified | 1911 |
| 75 | Ga0070711_100095013 | 3300005439 | Bacteria | 2156 |
| 76 | Ga0070711_100261444 | 3300005439 | Bacteria | 1362 |
| 77 | Ga0070700_100098109 | 3300005441 | Bacteria | 1926 |
| 78 | Ga0070708_100079170 | 3300005445 | Bacteria | 2973 |
| 79 | Ga0070708_100152619 | 3300005445 | Bacteria | 2149 |
| 80 | Ga0070708_100337694 | 3300005445 | Bacteria | 1420 |
| 81 | Ga0070663_100079549 | 3300005455 | Bacteria | 2406 |
| 82 | Ga0070678_100080965 | 3300005456 | Unclassified | 2460 |
| 83 | Ga0070662_100040166 | 3300005457 | Unclassified | 3330 |
| 84 | Ga0070662_100048186 | 3300005457 | Bacteria | 3069 |
| 85 | Ga0070681_10000749 | 3300005458 | Bacteria | 26980 |
| 86 | Ga0070681_10006655 | 3300005458 | Bacteria | 11248 |
| 87 | Ga0070681_10009487 | 3300005458 | Bacteria | 9578 |
| 88 | Ga0070681_10093430 | 3300005458 | Bacteria | 2957 |
| 89 | Ga0070681_10334230 | 3300005458 | Bacteria | 1424 |
| 90 | Ga0068867_100034924 | 3300005459 | Bacteria | 3645 |
| 91 | Ga0068867_100173014 | 3300005459 | Bacteria | 1712 |
| 92 | Ga0068867_100305086 | 3300005459 | Bacteria | 1314 |
| 93 | Ga0070685_10005978 | 3300005466 | Bacteria | 6197 |
| 94 | Ga0070706_100388506 | 3300005467 | Bacteria | 1299 |
| 95 | Ga0070707_100106168 | 3300005468 | Bacteria | 2724 |
| 96 | Ga0070698_100019245 | 3300005471 | Bacteria | 7173 |
| 97 | Ga0070698_100041887 | 3300005471 | Bacteria | 4700 |
| 98 | Ga0070698_100179487 | 3300005471 | Bacteria | 2056 |
| 99 | Ga0070698_100295449 | 3300005471 | Bacteria | 1551 |
| 100 | Ga0070699_100089410 | 3300005518 | Bacteria | 2691 |
| 101 | Ga0070699_100141498 | 3300005518 | Bacteria | 2125 |
| 102 | Ga0070699_100184688 | 3300005518 | Bacteria | 1851 |
| 103 | Ga0070679_100005464 | 3300005530 | Bacteria | 11782 |
| 104 | Ga0070679_100032625 | 3300005530 | Bacteria | 5153 |
| 105 | Ga0070679_100039537 | 3300005530 | Bacteria | 4687 |
| 106 | Ga0070679_100049312 | 3300005530 | Bacteria | 4193 |
| 107 | Ga0070679_100064508 | 3300005530 | Bacteria | 3650 |
| 108 | Ga0070679_100095677 | 3300005530 | Bacteria | 2957 |
| 109 | Ga0070679_100113839 | 3300005530 | Bacteria | 2690 |
| 110 | Ga0070684_100005027 | 3300005535 | Bacteria | 10099 |
| 111 | Ga0070684_100011603 | 3300005535 | Bacteria | 7022 |
| 112 | Ga0070684_100014289 | 3300005535 | Bacteria | 6427 |
| 113 | Ga0070684_100027664 | 3300005535 | Bacteria | 4788 |
| 114 | Ga0070684_100030872 | 3300005535 | Bacteria | 4557 |
| 115 | Ga0070684_100034227 | 3300005535 | Bacteria | 4343 |
| 116 | Ga0070684_100040658 | 3300005535 | Bacteria | 4005 |
| 117 | Ga0070684_100041144 | 3300005535 | Bacteria | 3983 |
| 118 | Ga0070684_100055365 | 3300005535 | Bacteria | 3457 |
| 119 | Ga0070684_100069774 | 3300005535 | Bacteria | 3091 |
| 120 | Ga0070684_100084843 | 3300005535 | Bacteria | 2808 |
| 121 | Ga0070684_100114531 | 3300005535 | Bacteria | 2420 |
| 122 | Ga0070684_100124503 | 3300005535 | Bacteria | 2320 |
| 123 | Ga0068853_100009467 | 3300005539 | Bacteria | 7849 |
| 124 | Ga0070672_100003936 | 3300005543 | Bacteria | 9680 |
| 125 | Ga0070672_100023768 | 3300005543 | Bacteria | 4521 |
| 126 | Ga0070686_100014712 | 3300005544 | Bacteria | 4516 |
| 127 | Ga0070695_100123706 | 3300005545 | Bacteria | 1773 |
| 128 | Ga0070696_100124520 | 3300005546 | Bacteria | 1869 |
| 129 | Ga0070696_100157078 | 3300005546 | Bacteria | 1673 |
| 130 | Ga0070693_100019933 | 3300005547 | Bacteria | 3528 |
| 131 | Ga0070693_100023607 | 3300005547 | Bacteria | 3289 |
| 132 | Ga0070693_100046798 | 3300005547 | Bacteria | 2458 |
| 133 | Ga0070665_100033445 | 3300005548 | Bacteria | 5173 |
| 134 | Ga0070704_100029686 | 3300005549 | Bacteria | 3654 |
| 135 | Ga0070704_100194221 | 3300005549 | Bacteria | 1634 |
| 136 | Ga0070704_100313733 | 3300005549 | Bacteria | 1311 |
| 137 | Ga0070704_100335741 | 3300005549 | Bacteria | 1271 |
| 138 | Ga0068855_100032562 | 3300005563 | Bacteria | 6223 |
| 139 | Ga0068855_100037090 | 3300005563 | Bacteria | 5799 |
| 140 | Ga0068855_100045854 | 3300005563 | Bacteria | 5168 |
| 141 | Ga0068855_100058740 | 3300005563 | Bacteria | 4502 |
| 142 | Ga0068855_100061055 | 3300005563 | Bacteria | 4405 |
| 143 | Ga0068855_100131207 | 3300005563 | Unclassified | 2861 |
| 144 | Ga0070664_100014453 | 3300005564 | Bacteria | 6436 |
| 145 | Ga0070664_100039824 | 3300005564 | Bacteria | 3961 |
| 146 | Ga0070664_100324800 | 3300005564 | Bacteria | 1395 |
| 147 | Ga0068857_100045121 | 3300005577 | Bacteria | 3910 |
| 148 | Ga0068857_100049130 | 3300005577 | Bacteria | 3744 |
| 149 | Ga0068857_100054005 | 3300005577 | Bacteria | 3564 |
| 150 | Ga0068857_100137342 | 3300005577 | Unclassified | 2208 |
| 151 | Ga0068857_100292668 | 3300005577 | Bacteria | 1500 |
| 152 | Ga0068854_100026625 | 3300005578 | Bacteria | 3976 |
| 153 | Ga0068854_100238932 | 3300005578 | Bacteria | 1446 |
| 154 | Ga0068856_100028398 | 3300005614 | Bacteria | 5463 |
| 155 | Ga0068856_100082748 | 3300005614 | Bacteria | 3186 |
| 156 | Ga0068856_100122243 | 3300005614 | Bacteria | 2605 |
| 157 | Ga0068856_100302831 | 3300005614 | Bacteria | 1616 |
| 158 | Ga0068856_100401464 | 3300005614 | Bacteria | 1390 |
| 159 | Ga0070702_100019096 | 3300005615 | Bacteria | 3567 |
| 160 | Ga0070702_100022581 | 3300005615 | Bacteria | 3329 |
| 161 | Ga0070702_100050663 | 3300005615 | Bacteria | 2373 |
| 162 | Ga0068852_100008666 | 3300005616 | Bacteria | 7515 |
| 163 | Ga0068852_100159231 | 3300005616 | Bacteria | 2106 |
| 164 | Ga0068859_100370367 | 3300005617 | Bacteria | 1528 |
| 165 | Ga0068864_100008532 | 3300005618 | Bacteria | 8455 |
| 166 | Ga0068864_100064126 | 3300005618 | Bacteria | 3185 |
| 167 | Ga0068864_100308730 | 3300005618 | Bacteria | 1483 |
| 168 | Ga0068866_10144683 | 3300005718 | Bacteria | 1369 |
| 169 | Ga0068851_10025677 | 3300005834 | Bacteria | 2891 |
| 170 | Ga0068870_10004976 | 3300005840 | Bacteria | 5764 |
| 171 | Ga0068870_10030426 | 3300005840 | Bacteria | 2728 |
| 172 | Ga0068863_100020555 | 3300005841 | Bacteria | 6311 |
| 173 | Ga0068858_100169147 | 3300005842 | Bacteria | 2060 |
| 174 | Ga0068860_100233063 | 3300005843 | Bacteria | 1789 |
| 175 | Ga0081455_10001959 | 3300005937 | Bacteria | 24720 |
| 176 | Ga0081455_10029352 | 3300005937 | Bacteria | 5014 |
| 177 | Ga0081455_10031718 | 3300005937 | Bacteria | 4774 |
| 178 | Ga0081455_10063555 | 3300005937 | Bacteria | 3097 |
| 179 | Ga0081455_10154165 | 3300005937 | Bacteria | 1768 |
| 180 | Ga0081538_10001290 | 3300005981 | Bacteria | 26012 |
| 181 | Ga0081538_10034537 | 3300005981 | Unclassified | 3341 |
| 182 | Ga0070717_10014420 | 3300006028 | Bacteria | 6081 |
| 183 | Ga0070717_10025725 | 3300006028 | Bacteria | 4686 |
| 184 | Ga0070717_10152348 | 3300006028 | Unclassified | 2001 |
| 185 | Ga0070717_10186398 | 3300006028 | Bacteria | 1811 |
| 186 | Ga0075364_10008748 | 3300006051 | Bacteria | 6057 |
| 187 | Ga0075364_10030740 | 3300006051 | Bacteria | 3448 |
| 188 | Ga0075432_10036939 | 3300006058 | Bacteria | 1699 |
| 189 | Ga0070715_10016206 | 3300006163 | Bacteria | 2795 |
| 190 | Ga0070715_10080829 | 3300006163 | Bacteria | 1475 |
| 191 | Ga0070716_100167805 | 3300006173 | Bacteria | 1429 |
| 192 | Ga0070712_100009618 | 3300006175 | Bacteria | 6095 |
| 193 | Ga0070712_100013144 | 3300006175 | Bacteria | 5281 |
| 194 | Ga0070712_100062243 | 3300006175 | Bacteria | 2638 |
| 195 | Ga0070712_100163318 | 3300006175 | Bacteria | 1722 |
| 196 | Ga0075362_10002455 | 3300006177 | Bacteria | 6234 |
| 197 | Ga0097621_100098314 | 3300006237 | Unclassified | 2458 |
| 198 | Ga0075428_100058183 | 3300006844 | Bacteria | 4231 |
| 199 | Ga0075428_100439815 | 3300006844 | Bacteria | 1397 |
| 200 | Ga0075430_100018905 | 3300006846 | Bacteria | 5862 |
| 201 | Ga0075433_10120348 | 3300006852 | Bacteria | 2331 |
| 202 | Ga0075434_100057551 | 3300006871 | Bacteria | 3863 |
| 203 | Ga0075434_100149161 | 3300006871 | Bacteria | 2358 |
| 204 | Ga0075429_100110113 | 3300006880 | Bacteria | 2407 |
| 205 | Ga0068865_100011508 | 3300006881 | Bacteria | 5544 |
| 206 | Ga0068865_100058112 | 3300006881 | Bacteria | 2700 |
| 207 | Ga0068865_100063414 | 3300006881 | Bacteria | 2597 |
| 208 | Ga0075436_100055067 | 3300006914 | Bacteria | 2746 |
| 209 | Ga0097620_100370371 | 3300006931 | Bacteria | 1528 |
| 210 | Ga0075435_100025171 | 3300007076 | Bacteria | 4630 |
| 211 | Ga0105240_10078090 | 3300009093 | Bacteria | 4077 |
| 212 | Ga0105240_10210478 | 3300009093 | Bacteria | 2273 |
| 213 | Ga0105240_10308024 | 3300009093 | Bacteria | 1809 |
| 214 | Ga0105240_10512389 | 3300009093 | Bacteria | 1332 |
| 215 | Ga0111539_10002753 | 3300009094 | Bacteria | 23327 |
| 216 | Ga0111539_10027719 | 3300009094 | Bacteria | 6919 |
| 217 | Ga0111539_10045112 | 3300009094 | Bacteria | 5278 |
| 218 | Ga0111539_10108767 | 3300009094 | Bacteria | 3254 |
| 219 | Ga0111539_10170250 | 3300009094 | Unclassified | 2545 |
| 220 | Ga0111539_10298684 | 3300009094 | Bacteria | 1874 |
| 221 | Ga0105245_10018522 | 3300009098 | Bacteria | 6090 |
| 222 | Ga0105245_10027306 | 3300009098 | Bacteria | 5030 |
| 223 | Ga0105245_10068145 | 3300009098 | Bacteria | 3224 |
| 224 | Ga0105245_10131931 | 3300009098 | Bacteria | 2344 |
| 225 | Ga0105245_10405334 | 3300009098 | Bacteria | 1364 |
| 226 | Ga0114129_10044321 | 3300009147 | Bacteria | 6258 |
| 227 | Ga0114129_10286351 | 3300009147 | Bacteria | 2200 |
| 228 | Ga0105243_10007960 | 3300009148 | Bacteria | 8143 |
| 229 | Ga0105243_10067568 | 3300009148 | Bacteria | 2878 |
| 230 | Ga0105243_10146371 | 3300009148 | Bacteria | 2021 |
| 231 | Ga0105243_10186840 | 3300009148 | Bacteria | 1807 |
| 232 | Ga0105243_10216847 | 3300009148 | Bacteria | 1689 |
| 233 | Ga0105243_10224610 | 3300009148 | Bacteria | 1662 |
| 234 | Ga0105241_10435528 | 3300009174 | Unclassified | 1157 |
| 235 | Ga0105242_10027625 | 3300009176 | Bacteria | 4509 |
| 236 | Ga0105242_10067261 | 3300009176 | Bacteria | 2962 |
| 237 | Ga0105242_10075192 | 3300009176 | Unclassified | 2811 |
| 238 | Ga0105242_10081304 | 3300009176 | Bacteria | 2709 |
| 239 | Ga0105242_10095615 | 3300009176 | Bacteria | 2508 |
| 240 | Ga0105242_10126199 | 3300009176 | Bacteria | 2203 |
| 241 | Ga0105248_10041322 | 3300009177 | Bacteria | 5169 |
| 242 | Ga0105237_10065429 | 3300009545 | Unclassified | 3632 |
| 243 | Ga0105237_10188522 | 3300009545 | Unclassified | 2063 |
| 244 | Ga0105238_10010250 | 3300009551 | Bacteria | 9401 |
| 245 | Ga0105238_10355194 | 3300009551 | Bacteria | 1455 |
| 246 | Ga0105249_10044752 | 3300009553 | Unclassified | 4025 |
| 247 | Ga0105249_10076206 | 3300009553 | Bacteria | 3108 |
| 248 | Ga0105249_10187372 | 3300009553 | Bacteria | 2017 |
| 249 | Ga0105239_10056070 | 3300010375 | Bacteria | 4322 |
| 250 | Ga0105239_10175366 | 3300010375 | Unclassified | 2398 |
| 251 | Ga0105246_10101897 | 3300011119 | Bacteria | 2092 |
| 252 | Ga0157373_10103066 | 3300013100 | Bacteria | 2007 |
| 253 | Ga0157371_10007020 | 3300013102 | Bacteria | 9163 |
| 254 | Ga0157370_10006143 | 3300013104 | Bacteria | 13329 |
| 255 | Ga0157370_10015065 | 3300013104 | Bacteria | 7878 |
| 256 | Ga0157370_10197257 | 3300013104 | Bacteria | 1868 |
| 257 | Ga0157370_10371623 | 3300013104 | Unclassified | 1317 |
| 258 | Ga0157369_10003856 | 3300013105 | Bacteria | 17824 |
| 259 | Ga0157369_10019412 | 3300013105 | Bacteria | 7604 |
| 260 | Ga0157369_10032679 | 3300013105 | Bacteria | 5720 |
| 261 | Ga0157369_10033145 | 3300013105 | Bacteria | 5678 |
| 262 | Ga0157369_10033154 | 3300013105 | Bacteria | 5677 |
| 263 | Ga0157369_10077696 | 3300013105 | Bacteria | 3558 |
| 264 | Ga0157378_10101345 | 3300013297 | Bacteria | 2630 |
| 265 | Ga0157378_10116958 | 3300013297 | Bacteria | 2452 |
| 266 | Ga0157378_10194553 | 3300013297 | Bacteria | 1915 |
| 267 | Ga0163162_10141206 | 3300013306 | Bacteria | 2522 |
| 268 | Ga0163162_10177139 | 3300013306 | Bacteria | 2258 |
| 269 | Ga0157372_10026859 | 3300013307 | Bacteria | 6267 |
| 270 | Ga0157372_10039029 | 3300013307 | Bacteria | 5241 |
| 271 | Ga0157372_10131467 | 3300013307 | Bacteria | 2880 |
| 272 | Ga0157372_10184521 | 3300013307 | Bacteria | 2416 |
| 273 | Ga0157372_10235230 | 3300013307 | Bacteria | 2125 |
| 274 | Ga0157372_10457091 | 3300013307 | Bacteria | 1488 |
| 275 | Ga0157375_10029202 | 3300013308 | Bacteria | 5183 |
| 276 | Ga0157375_10087185 | 3300013308 | Bacteria | 3173 |
| 277 | Ga0163163_10147669 | 3300014325 | Bacteria | 2395 |
| 278 | Ga0157380_10009357 | 3300014326 | Bacteria | 7017 |
| 279 | Ga0157380_10024897 | 3300014326 | Bacteria | 4534 |
| 280 | Ga0157380_10127513 | 3300014326 | Bacteria | 2165 |
| 281 | Ga0157377_10006038 | 3300014745 | Bacteria | 5745 |
| 282 | Ga0157377_10012532 | 3300014745 | Bacteria | 4267 |
| 283 | Ga0157377_10035908 | 3300014745 | Unclassified | 2723 |
| 284 | Ga0157377_10050784 | 3300014745 | Bacteria | 2337 |
| 285 | Ga0157379_10211108 | 3300014968 | Bacteria | 1757 |
| 286 | Ga0157376_10011069 | 3300014969 | Bacteria | 6634 |
| 287 | Ga0157376_10212840 | 3300014969 | Bacteria | 1785 |
| 288 | Ga0197907_11224760 | 3300020069 | Bacteria | 4008 |
| 289 | Ga0206354_11621597 | 3300020081 | Bacteria | 2280 |
| 290 | Ga0206353_10906813 | 3300020082 | Bacteria | 16815 |
| 291 | Ga0206353_11793764 | 3300020082 | Bacteria | 1514 |
| 292 | Ga0213871_10013380 | 3300021441 | Bacteria | 1927 |
| 293 | Ga0207653_10043062 | 3300025885 | Unclassified | 1486 |
| 294 | Ga0207692_10003153 | 3300025898 | Bacteria | 6399 |
| 295 | Ga0207688_10000822 | 3300025901 | Bacteria | 15528 |
| 296 | Ga0207688_10015428 | 3300025901 | Bacteria | 4144 |
| 297 | Ga0207688_10020581 | 3300025901 | Bacteria | 3602 |
| 298 | Ga0207688_10025867 | 3300025901 | Bacteria | 3226 |
| 299 | Ga0207688_10031096 | 3300025901 | Bacteria | 2946 |
| 300 | Ga0207699_10199921 | 3300025906 | Bacteria | 1354 |
| 301 | Ga0207645_10071477 | 3300025907 | Unclassified | 2221 |
| 302 | Ga0207643_10005291 | 3300025908 | Bacteria | 6906 |
| 303 | Ga0207643_10038895 | 3300025908 | Bacteria | 2674 |
| 304 | Ga0207643_10043869 | 3300025908 | Bacteria | 2524 |
| 305 | Ga0207643_10179603 | 3300025908 | Bacteria | 1280 |
| 306 | Ga0207705_10083844 | 3300025909 | Bacteria | 2326 |
| 307 | Ga0207705_10095709 | 3300025909 | Bacteria | 2179 |
| 308 | Ga0207705_10173619 | 3300025909 | Bacteria | 1624 |
| 309 | Ga0207705_10200156 | 3300025909 | Bacteria | 1513 |
| 310 | Ga0207705_10239467 | 3300025909 | Bacteria | 1382 |
| 311 | Ga0207684_10324584 | 3300025910 | Bacteria | 1327 |
| 312 | Ga0207654_10117976 | 3300025911 | Bacteria | 1661 |
| 313 | Ga0207707_10024128 | 3300025912 | Bacteria | 5320 |
| 314 | Ga0207707_10037642 | 3300025912 | Bacteria | 4227 |
| 315 | Ga0207707_10045018 | 3300025912 | Bacteria | 3846 |
| 316 | Ga0207707_10146910 | 3300025912 | Unclassified | 2061 |
| 317 | Ga0207695_10344922 | 3300025913 | Bacteria | 1377 |
| 318 | Ga0207695_10375501 | 3300025913 | Bacteria | 1308 |
| 319 | Ga0207671_10263029 | 3300025914 | Bacteria | 1358 |
| 320 | Ga0207693_10002091 | 3300025915 | Bacteria | 17432 |
| 321 | Ga0207693_10171163 | 3300025915 | Bacteria | 1710 |
| 322 | Ga0207660_10005528 | 3300025917 | Bacteria | 8208 |
| 323 | Ga0207660_10020652 | 3300025917 | Bacteria | 4424 |
| 324 | Ga0207660_10025160 | 3300025917 | Bacteria | 4038 |
| 325 | Ga0207662_10010917 | 3300025918 | Bacteria | 5023 |
| 326 | Ga0207657_10000486 | 3300025919 | Bacteria | 41915 |
| 327 | Ga0207657_10001651 | 3300025919 | Bacteria | 24065 |
| 328 | Ga0207657_10010171 | 3300025919 | Bacteria | 9398 |
| 329 | Ga0207657_10012673 | 3300025919 | Bacteria | 8310 |
| 330 | Ga0207657_10015181 | 3300025919 | Bacteria | 7474 |
| 331 | Ga0207657_10021999 | 3300025919 | Bacteria | 5987 |
| 332 | Ga0207657_10047551 | 3300025919 | Unclassified | 3750 |
| 333 | Ga0207657_10124977 | 3300025919 | Bacteria | 2113 |
| 334 | Ga0207649_10024282 | 3300025920 | Bacteria | 3522 |
| 335 | Ga0207649_10025612 | 3300025920 | Bacteria | 3441 |
| 336 | Ga0207649_10110558 | 3300025920 | Bacteria | 1835 |
| 337 | Ga0207652_10006427 | 3300025921 | Bacteria | 9475 |
| 338 | Ga0207652_10030079 | 3300025921 | Bacteria | 4545 |
| 339 | Ga0207652_10058584 | 3300025921 | Bacteria | 3319 |
| 340 | Ga0207652_10069779 | 3300025921 | Bacteria | 3051 |
| 341 | Ga0207652_10147477 | 3300025921 | Bacteria | 2106 |
| 342 | Ga0207650_10060467 | 3300025925 | Bacteria | 2827 |
| 343 | Ga0207659_10145356 | 3300025926 | Bacteria | 1846 |
| 344 | Ga0207659_10155216 | 3300025926 | Unclassified | 1791 |
| 345 | Ga0207659_10159429 | 3300025926 | Bacteria | 1770 |
| 346 | Ga0207687_10005316 | 3300025927 | Bacteria | 8525 |
| 347 | Ga0207687_10031906 | 3300025927 | Bacteria | 3564 |
| 348 | Ga0207664_10207692 | 3300025929 | Bacteria | 1693 |
| 349 | Ga0207690_10007278 | 3300025932 | Bacteria | 6573 |
| 350 | Ga0207690_10047190 | 3300025932 | Bacteria | 2856 |
| 351 | Ga0207690_10056383 | 3300025932 | Bacteria | 2650 |
| 352 | Ga0207690_10059503 | 3300025932 | Unclassified | 2588 |
| 353 | Ga0207690_10307520 | 3300025932 | Bacteria | 1242 |
| 354 | Ga0207706_10002051 | 3300025933 | Bacteria | 19764 |
| 355 | Ga0207706_10052223 | 3300025933 | Bacteria | 3609 |
| 356 | Ga0207706_10059081 | 3300025933 | Bacteria | 3377 |
| 357 | Ga0207686_10025311 | 3300025934 | Bacteria | 3450 |
| 358 | Ga0207686_10146804 | 3300025934 | Bacteria | 1637 |
| 359 | Ga0207709_10042277 | 3300025935 | Unclassified | 2740 |
| 360 | Ga0207670_10024035 | 3300025936 | Bacteria | 3803 |
| 361 | Ga0207669_10011544 | 3300025937 | Bacteria | 4304 |
| 362 | Ga0207691_10006749 | 3300025940 | Bacteria | 11072 |
| 363 | Ga0207691_10060912 | 3300025940 | Bacteria | 3429 |
| 364 | Ga0207691_10108267 | 3300025940 | Bacteria | 2473 |
| 365 | Ga0207711_10296743 | 3300025941 | Bacteria | 1490 |
| 366 | Ga0207689_10118178 | 3300025942 | Unclassified | 2180 |
| 367 | Ga0207661_10000195 | 3300025944 | Bacteria | 39367 |
| 368 | Ga0207661_10011506 | 3300025944 | Bacteria | 6414 |
| 369 | Ga0207661_10086261 | 3300025944 | Bacteria | 2605 |
| 370 | Ga0207661_10136475 | 3300025944 | Bacteria | 2107 |
| 371 | Ga0207661_10154167 | 3300025944 | Bacteria | 1988 |
| 372 | Ga0207661_10161014 | 3300025944 | Bacteria | 1947 |
| 373 | Ga0207679_10019329 | 3300025945 | Bacteria | 4573 |
| 374 | Ga0207679_10038699 | 3300025945 | Bacteria | 3400 |
| 375 | Ga0207667_10168665 | 3300025949 | Unclassified | 2250 |
| 376 | Ga0207667_10192681 | 3300025949 | Bacteria | 2091 |
| 377 | Ga0207651_10032369 | 3300025960 | Bacteria | 3358 |
| 378 | Ga0207651_10093539 | 3300025960 | Bacteria | 2208 |
| 379 | Ga0207712_10255116 | 3300025961 | Bacteria | 1420 |
| 380 | Ga0207668_10078192 | 3300025972 | Bacteria | 2388 |
| 381 | Ga0207668_10279827 | 3300025972 | Bacteria | 1368 |
| 382 | Ga0207640_10047495 | 3300025981 | Unclassified | 2769 |
| 383 | Ga0207639_10034181 | 3300026041 | Bacteria | 3756 |
| 384 | Ga0207639_10343403 | 3300026041 | Bacteria | 1331 |
| 385 | Ga0207678_10039615 | 3300026067 | Bacteria | 4089 |
| 386 | Ga0207678_10043583 | 3300026067 | Bacteria | 3882 |
| 387 | Ga0207678_10070736 | 3300026067 | Bacteria | 2991 |
| 388 | Ga0207678_10130033 | 3300026067 | Bacteria | 2148 |
| 389 | Ga0207708_10017804 | 3300026075 | Bacteria | 5347 |
| 390 | Ga0207708_10036713 | 3300026075 | Bacteria | 3732 |
| 391 | Ga0207708_10038162 | 3300026075 | Bacteria | 3659 |
| 392 | Ga0207702_10013308 | 3300026078 | Bacteria | 6843 |
| 393 | Ga0207702_10031145 | 3300026078 | Bacteria | 4446 |
| 394 | Ga0207702_10051095 | 3300026078 | Bacteria | 3492 |
| 395 | Ga0207702_10086471 | 3300026078 | Bacteria | 2734 |
| 396 | Ga0207702_10105480 | 3300026078 | Bacteria | 2496 |
| 397 | Ga0207648_10176049 | 3300026089 | Bacteria | 1892 |
| 398 | Ga0207648_10338623 | 3300026089 | Bacteria | 1354 |
| 399 | Ga0207676_10026885 | 3300026095 | Bacteria | 4280 |
| 400 | Ga0207674_10008631 | 3300026116 | Bacteria | 11742 |
| 401 | Ga0207674_10008773 | 3300026116 | Bacteria | 11644 |
| 402 | Ga0207674_10026630 | 3300026116 | Bacteria | 6135 |
| 403 | Ga0207674_10030732 | 3300026116 | Bacteria | 5645 |
| 404 | Ga0207674_10082538 | 3300026116 | Bacteria | 3215 |
| 405 | Ga0207674_10139127 | 3300026116 | Bacteria | 2388 |
| 406 | Ga0207675_100084473 | 3300026118 | Bacteria | 2979 |
| 407 | Ga0207683_10032676 | 3300026121 | Bacteria | 4520 |
| 408 | Ga0207683_10040427 | 3300026121 | Bacteria | 4069 |
| 409 | Ga0207683_10166674 | 3300026121 | Bacteria | 1993 |
| 410 | Ga0207683_10291673 | 3300026121 | Unclassified | 1492 |
| 411 | Ga0207698_10014637 | 3300026142 | Bacteria | 5222 |
| 412 | Ga0207698_10041458 | 3300026142 | Bacteria | 3430 |
| 413 | Ga0207428_10002821 | 3300027907 | Bacteria | 17256 |
| 414 | Ga0207428_10008067 | 3300027907 | Bacteria | 9552 |
| 415 | Ga0207428_10009180 | 3300027907 | Bacteria | 8884 |
| 416 | Ga0207428_10018875 | 3300027907 | Bacteria | 5883 |
| 417 | Ga0268266_10046878 | 3300028379 | Bacteria | 3700 |
| 418 | Ga0268266_10075604 | 3300028379 | Bacteria | 2926 |
| 419 | Ga0268264_10043596 | 3300028381 | Bacteria | 3718 |
| 420 | Ga0265319_1027097 | 3300028563 | Unclassified | 2036 |
| 421 | Ga0265318_10009735 | 3300028577 | Bacteria | 4212 |
| 422 | Ga0265318_10019457 | 3300028577 | Unclassified | 2753 |
| 423 | Ga0265322_10011901 | 3300028654 | Bacteria | 2516 |
| 424 | Ga0265322_10021932 | 3300028654 | Bacteria | 1829 |
| 425 | Ga0265338_10014805 | 3300028800 | Bacteria | 8632 |
| 426 | Ga0265338_10053965 | 3300028800 | Bacteria | 3589 |
| 427 | Ga0265338_10213368 | 3300028800 | Bacteria | 1447 |
| 428 | Ga0265324_10012363 | 3300029957 | Bacteria | 3220 |
| 429 | Ga0265330_10031776 | 3300031235 | Bacteria | 2367 |
| 430 | Ga0265330_10048606 | 3300031235 | Bacteria | 1865 |
| 431 | Ga0265332_10084565 | 3300031238 | Bacteria | 1345 |
| 432 | Ga0265325_10031136 | 3300031241 | Bacteria | 2857 |
| 433 | Ga0265325_10110920 | 3300031241 | Bacteria | 1333 |
| 434 | Ga0265339_10024102 | 3300031249 | Bacteria | 3511 |
| 435 | Ga0265327_10045506 | 3300031251 | Bacteria | 2331 |
| 436 | Ga0265316_10029926 | 3300031344 | Bacteria | 4470 |
| 437 | Ga0307408_100031946 | 3300031548 | Archaea | 3669 |
| 438 | Ga0265313_10004167 | 3300031595 | Bacteria | 11226 |
| 439 | Ga0265313_10009381 | 3300031595 | Bacteria | 6357 |
| 440 | Ga0265314_10010725 | 3300031711 | Bacteria | 7625 |
| 441 | Ga0265342_10047624 | 3300031712 | Bacteria | 2572 |
| 442 | Ga0307409_100168334 | 3300031995 | Bacteria | 1926 |
| 443 | Ga0307409_100261270 | 3300031995 | Bacteria | 1589 |
| 444 | Ga0307414_10076413 | 3300032004 | Bacteria | 2434 |
| 445 | Ga0373951_0011845 | 3300035091 | Bacteria | 1961 |
| 446 | Ga0373943_0004770 | 3300035170 | Bacteria | 6128 |
| 447 | Ga0373946_0007039 | 3300035171 | Bacteria | 4102 |
| 448 | Ga0373935_0028527 | 3300035692 | Bacteria | 3450 |
| 449 | Ga0373935_0043479 | 3300035692 | Bacteria | 2827 |
| 450 | Ga0373935_0287616 | 3300035692 | Unclassified | 1159 |
| 451 | Ga0373927_0063107 | 3300035695 | Bacteria | 2396 |
| 452 | Ga0373947_0000833 | 3300035725 | Bacteria | 18617 |
| 453 | Ga0373947_0004241 | 3300035725 | Bacteria | 8409 |
| 454 | Ga0373937_0041010 | 3300036401 | Bacteria | 4222 |
| 455 | Ga0373937_0480453 | 3300036401 | Bacteria | 1180 |
| 456 | Ga0373925_0011906 | 3300037068 | Bacteria | 6295 |
| 457 | Ga0395899_0003567 | 3300037312 | Bacteria | 12317 |
| 458 | Ga0395899_0017962 | 3300037312 | Bacteria | 5382 |
| 459 | Ga0395899_0033726 | 3300037312 | Bacteria | 3845 |
| 460 | Ga0395899_0163905 | 3300037312 | Bacteria | 1569 |
| 461 | Ga0395900_0001819 | 3300037418 | Bacteria | 24397 |
| 462 | Ga0395900_0014881 | 3300037418 | Bacteria | 7926 |
| 463 | Ga0395900_0024327 | 3300037418 | Bacteria | 6201 |
| 464 | Ga0395900_0096245 | 3300037418 | Bacteria | 3042 |
| 465 | Ga0395900_0101216 | 3300037418 | Bacteria | 2959 |
| 466 | Ga0395898_0002618 | 3300037466 | Bacteria | 20929 |
| 467 | Ga0395898_0014564 | 3300037466 | Bacteria | 8077 |
| 468 | Ga0395898_0180963 | 3300037466 | Bacteria | 2015 |
| 469 | Ga0395898_0251229 | 3300037466 | Bacteria | 1686 |
| 470 | Ga0395905_0009197 | 3300037471 | Bacteria | 9674 |
| 471 | Ga0395905_0032649 | 3300037471 | Bacteria | 4895 |
| 472 | Ga0395905_0066382 | 3300037471 | Bacteria | 3379 |
| 473 | Ga0395905_0315152 | 3300037471 | Unclassified | 1453 |
| 474 | Ga0395901_0001138 | 3300038443 | Bacteria | 28189 |
| 475 | Ga0395901_0154410 | 3300038443 | Bacteria | 2411 |
| 476 | Ga0395901_0186682 | 3300038443 | Bacteria | 2174 |
| 477 | Ga0395901_0212577 | 3300038443 | Bacteria | 2024 |
| 478 | Ga0436365_0434512 | 3300039437 | Bacteria | 1877 |
| 479 | Ga0436360_0143933 | 3300039438 | Bacteria | 6708 |
| 480 | Ga0436363_1187594 | 3300039450 | Bacteria | 2718 |
| 481 | Ga0436362_0037531 | 3300039453 | Bacteria | 2084 |
| 482 | Ga0439463_018308 | 3300042016 | Bacteria | 1743 |
| 483 | Ga0450920_005795 | 3300042122 | Bacteria | 2206 |
| 484 | Ga0439446_0022649 | 3300042156 | Bacteria | 1782 |
| 485 | Ga0466969_0017142 | 3300044656 | Bacteria | 3786 |
| 486 | Ga0466965_0066965 | 3300044683 | Bacteria | 1802 |
| 487 | Ga0466965_0100011 | 3300044683 | Bacteria | 1482 |
| 488 | Ga0466966_0007508 | 3300044684 | Bacteria | 7221 |
| 489 | Ga0466966_0013272 | 3300044684 | Bacteria | 5455 |
| 490 | Ga0466966_0128973 | 3300044684 | Bacteria | 1549 |
| 491 | Ga0466961_0006627 | 3300044693 | Bacteria | 7364 |
| 492 | Ga0466961_0010932 | 3300044693 | Bacteria | 5799 |
| 493 | Ga0466961_0019336 | 3300044693 | Bacteria | 4382 |
| 494 | Ga0466963_0005065 | 3300044694 | Bacteria | 7700 |
| 495 | Ga0466963_0039337 | 3300044694 | Archaea | 3096 |
| 496 | Ga0466963_0056514 | 3300044694 | Bacteria | 2611 |
| 497 | Ga0466963_0072594 | 3300044694 | Bacteria | 2318 |
| 498 | Ga0466963_0147588 | 3300044694 | Unclassified | 1632 |
| 499 | Ga0466963_0171284 | 3300044694 | Bacteria | 1513 |
| 500 | Ga0466963_0201582 | 3300044694 | Bacteria | 1392 |
| 501 | Ga0466964_0016632 | 3300044706 | Bacteria | 2810 |
| 502 | Ga0466971_0001805 | 3300044719 | Bacteria | 9086 |
| 503 | Ga0466971_0003461 | 3300044719 | Bacteria | 6741 |
| 504 | Ga0466971_0004010 | 3300044719 | Bacteria | 6331 |
| 505 | Ga0466971_0010864 | 3300044719 | Bacteria | 3982 |
| 506 | Ga0466968_0011166 | 3300044735 | Bacteria | 3498 |
| 507 | Ga0466968_0021808 | 3300044735 | Bacteria | 2597 |
| 508 | Ga0466970_0018788 | 3300044765 | Bacteria | 3581 |
| 509 | Ga0466957_0012546 | 3300044842 | Bacteria | 4905 |
| 510 | Ga0466957_0021598 | 3300044842 | Bacteria | 3794 |
| 511 | Ga0466957_0033737 | 3300044842 | Bacteria | 3071 |
| 512 | Ga0466957_0136216 | 3300044842 | Bacteria | 1578 |
| 513 | Ga0466960_0051139 | 3300044901 | Bacteria | 1995 |
| 514 | Ga0466959_0003619 | 3300045049 | Bacteria | 10192 |
| 515 | Ga0466959_0008520 | 3300045049 | Bacteria | 7256 |
| 516 | Ga0466959_0018649 | 3300045049 | Bacteria | 5095 |
| 517 | Ga0466959_0023916 | 3300045049 | Bacteria | 4523 |
| 518 | Ga0466959_0062769 | 3300045049 | Bacteria | 2699 |
| 519 | Ga0466958_0005516 | 3300045836 | Bacteria | 6822 |
| 520 | Ga0466958_0008945 | 3300045836 | Bacteria | 5565 |
| 521 | Ga0466958_0009049 | 3300045836 | Bacteria | 5531 |
| 522 | Ga0466958_0009210 | 3300045836 | Bacteria | 5493 |
| 523 | Ga0466958_0023818 | 3300045836 | Bacteria | 3598 |
| 524 | Ga0466958_0024983 | 3300045836 | Bacteria | 3518 |
| 525 | Ga0466958_0059446 | 3300045836 | Bacteria | 2325 |
| 526 | Ga0466967_0000602 | 3300045976 | Bacteria | 17865 |
| 527 | Ga0466967_0004099 | 3300045976 | Bacteria | 9735 |
| 528 | Ga0466967_0004937 | 3300045976 | Bacteria | 9121 |
| 529 | Ga0466967_0009609 | 3300045976 | Bacteria | 7188 |
| 530 | Ga0466967_0012582 | 3300045976 | Bacteria | 6484 |
| 531 | Ga0466967_0018008 | 3300045976 | Bacteria | 5632 |
| 532 | Ga0466967_0025019 | 3300045976 | Bacteria | 4916 |
| 533 | Ga0466967_0035358 | 3300045976 | Bacteria | 4252 |
| 534 | Ga0466967_0056609 | 3300045976 | Bacteria | 3458 |
| 535 | Ga0466967_0138433 | 3300045976 | Bacteria | 2265 |
| 536 | Ga0466967_0212181 | 3300045976 | Bacteria | 1836 |
| 537 | Ga0466967_0249958 | 3300045976 | Bacteria | 1693 |
| 538 | Ga0466967_0260988 | 3300045976 | Bacteria | 1657 |
| 539 | Ga0495592_0094033 | 3300046454 | Bacteria | 2146 |
| 540 | Ga0495629_0000983 | 3300046459 | Bacteria | 22888 |
| 541 | Ga0495629_0026236 | 3300046459 | Bacteria | 4140 |
| 542 | Ga0495629_0043301 | 3300046459 | Bacteria | 3161 |
| 543 | Ga0495629_0050286 | 3300046459 | Bacteria | 2919 |
| 544 | Ga0495641_0000513 | 3300046461 | Bacteria | 32468 |
| 545 | Ga0495653_0027441 | 3300046463 | Bacteria | 4556 |
| 546 | Ga0495653_0089323 | 3300046463 | Bacteria | 2258 |
| 547 | Ga0495653_0130356 | 3300046463 | Bacteria | 1781 |
| 548 | Ga0495582_0000553 | 3300046473 | Bacteria | 20635 |
| 549 | Ga0495582_0061000 | 3300046473 | Bacteria | 2082 |
| 550 | Ga0495662_0007890 | 3300046476 | Bacteria | 5240 |
| 551 | Ga0495608_0004647 | 3300046511 | Bacteria | 9812 |
| 552 | Ga0495608_0010647 | 3300046511 | Bacteria | 6416 |
| 553 | Ga0495608_0049347 | 3300046511 | Bacteria | 2794 |
| 554 | Ga0495618_0190545 | 3300046514 | Bacteria | 1300 |
| 555 | Ga0495628_0049357 | 3300046516 | Bacteria | 3333 |
| 556 | Ga0495628_0183967 | 3300046516 | Bacteria | 1579 |
| 557 | Ga0495630_0011346 | 3300046517 | Bacteria | 6449 |
| 558 | Ga0495630_0012886 | 3300046517 | Bacteria | 6074 |
| 559 | Ga0495630_0039587 | 3300046517 | Bacteria | 3524 |
| 560 | Ga0495631_0043159 | 3300046518 | Bacteria | 1990 |
| 561 | Ga0495652_0045046 | 3300046529 | Bacteria | 3796 |
| 562 | Ga0495652_0070467 | 3300046529 | Unclassified | 2922 |
| 563 | Ga0495652_0097501 | 3300046529 | Bacteria | 2391 |
| 564 | Ga0495652_0129180 | 3300046529 | Bacteria | 2003 |
| 565 | Ga0495665_0005465 | 3300046531 | Bacteria | 6844 |
| 566 | Ga0495640_0024123 | 3300046533 | Bacteria | 4425 |
| 567 | Ga0495586_0020193 | 3300046535 | Bacteria | 3548 |
| 568 | Ga0495586_0029424 | 3300046535 | Bacteria | 2939 |
| 569 | Ga0495609_0048947 | 3300046538 | Bacteria | 1887 |
| 570 | Ga0495645_0037023 | 3300046543 | Bacteria | 3556 |
| 571 | Ga0495645_0162819 | 3300046543 | Bacteria | 1541 |
| 572 | Ga0495667_0016085 | 3300046559 | Bacteria | 5057 |
| 573 | Ga0495667_0028440 | 3300046559 | Bacteria | 3764 |
| 574 | Ga0495656_0054762 | 3300046615 | Bacteria | 1717 |
| 575 | Ga0495634_0032786 | 3300046642 | Bacteria | 3570 |
| 576 | Ga0495634_0099103 | 3300046642 | Bacteria | 1884 |
| 577 | Ga0495635_0035027 | 3300046663 | Bacteria | 3481 |
| 578 | Ga0495635_0079802 | 3300046663 | Bacteria | 2240 |
| 579 | Ga0495588_0093994 | 3300046674 | Bacteria | 1572 |
| 580 | Ga0495657_0091790 | 3300046675 | Bacteria | 1947 |
| 581 | Ga0495657_0091984 | 3300046675 | Bacteria | 1944 |
| 582 | Ga0495657_0228486 | 3300046675 | Bacteria | 1126 |
| 583 | Ga0495647_0006157 | 3300046681 | Bacteria | 3960 |
| 584 | Ga0495658_0002075 | 3300046683 | Bacteria | 10156 |
| 585 | Ga0495613_0010487 | 3300046689 | Bacteria | 6879 |
| 586 | Ga0495613_0022025 | 3300046689 | Bacteria | 4750 |
| 587 | Ga0495613_0152080 | 3300046689 | Bacteria | 1650 |
| 588 | Ga0495624_0007147 | 3300046690 | Bacteria | 7857 |
| 589 | Ga0495624_0046705 | 3300046690 | Bacteria | 2753 |
| 590 | Ga0495671_0044900 | 3300046692 | Bacteria | 2214 |
| 591 | Ga0495589_0068741 | 3300046794 | Bacteria | 1733 |
| 592 | Ga0495581_0001833 | 3300047315 | Bacteria | 11890 |
| 593 | Ga0495604_0027208 | 3300047317 | Bacteria | 4550 |
| 594 | Ga0495604_0055205 | 3300047317 | Bacteria | 3062 |
| 595 | Ga0495604_0082603 | 3300047317 | Bacteria | 2402 |
| 596 | Ga0495674_0003155 | 3300047319 | Bacteria | 16010 |
| 597 | Ga0495674_0157775 | 3300047319 | Bacteria | 1900 |
| 598 | Ga0495676_0029645 | 3300047321 | Bacteria | 4658 |
| 599 | Ga0495680_0004330 | 3300047322 | Bacteria | 13597 |
| 600 | Ga0495680_0007287 | 3300047322 | Bacteria | 10179 |
| 601 | Ga0495680_0019817 | 3300047322 | Bacteria | 5672 |
| 602 | Ga0495680_0059904 | 3300047322 | Bacteria | 2937 |
| 603 | Ga0495680_0080873 | 3300047322 | Bacteria | 2454 |
| 604 | Ga0495677_0014430 | 3300047445 | Bacteria | 2876 |
| 605 | Ga0495684_0282128 | 3300047471 | Bacteria | 1198 |
| 606 | Ga0495593_0009203 | 3300047673 | Bacteria | 5726 |
| 607 | Ga0495602_0103893 | 3300048088 | Bacteria | 2325 |
| 608 | Ga0496100_0008112 | 3300048903 | Bacteria | 5843 |
| 609 | Ga0496100_0061984 | 3300048903 | Unclassified | 2466 |
| 610 | Ga0496100_0139811 | 3300048903 | Bacteria | 1715 |
| 611 | Ga0496101_0000745 | 3300048904 | Bacteria | 19316 |
| 612 | Ga0496101_0001389 | 3300048904 | Bacteria | 14495 |
| 613 | Ga0496101_0033798 | 3300048904 | Bacteria | 3609 |
| 614 | Ga0496101_0051101 | 3300048904 | Unclassified | 2977 |
| 615 | Ga0496101_0104168 | 3300048904 | Bacteria | 2128 |
| 616 | Ga0496101_0140746 | 3300048904 | Bacteria | 1839 |
| 617 | Ga0496102_0006447 | 3300048905 | Bacteria | 10007 |
| 618 | Ga0496102_0126388 | 3300048905 | Bacteria | 2390 |
| 619 | Ga0496102_0249710 | 3300048905 | Bacteria | 1673 |
| 620 | Ga0496102_0334852 | 3300048905 | Bacteria | 1425 |
| 621 | Ga0496102_0345188 | 3300048905 | Unclassified | 1402 |
| 622 | Ga0496103_0009315 | 3300048906 | Bacteria | 5819 |
| 623 | Ga0496103_0036650 | 3300048906 | Unclassified | 3004 |
| 624 | Ga0496103_0040444 | 3300048906 | Bacteria | 2865 |
| 625 | Ga0496103_0154421 | 3300048906 | Bacteria | 1471 |
| 626 | Ga0496104_0005726 | 3300048907 | Bacteria | 10872 |
| 627 | Ga0496104_0008448 | 3300048907 | Bacteria | 9155 |
| 628 | Ga0496104_0038427 | 3300048907 | Bacteria | 4479 |
| 629 | Ga0496104_0089195 | 3300048907 | Bacteria | 2946 |
| 630 | Ga0496104_0155582 | 3300048907 | Unclassified | 2194 |
| 631 | Ga0496104_0351788 | 3300048907 | Bacteria | 1386 |
| 632 | Ga0496105_0000092 | 3300048908 | Bacteria | 62726 |
| 633 | Ga0496105_0008326 | 3300048908 | Bacteria | 8060 |
| 634 | Ga0496105_0014858 | 3300048908 | Bacteria | 6199 |
| 635 | Ga0496105_0039809 | 3300048908 | Bacteria | 3875 |
| 636 | Ga0496105_0077680 | 3300048908 | Bacteria | 2741 |
| 637 | Ga0496106_0011906 | 3300048909 | Bacteria | 6421 |
| 638 | Ga0496106_0025492 | 3300048909 | Bacteria | 4401 |
| 639 | Ga0496106_0027167 | 3300048909 | Bacteria | 4262 |
| 640 | Ga0496106_0280221 | 3300048909 | Bacteria | 1336 |
| 641 | Ga0496106_0283970 | 3300048909 | Bacteria | 1326 |
| 642 | Ga0496107_0008186 | 3300048910 | Bacteria | 7229 |
| 643 | Ga0496107_0042719 | 3300048910 | Bacteria | 3256 |
| 644 | Ga0496107_0166711 | 3300048910 | Bacteria | 1633 |
| 645 | Ga0496107_0222397 | 3300048910 | Bacteria | 1405 |
| 646 | Ga0496107_0231900 | 3300048910 | Bacteria | 1374 |
| 647 | Ga0496107_0306349 | 3300048910 | Unclassified | 1182 |
| 648 | Ga0496108_0004497 | 3300048911 | Bacteria | 11232 |
| 649 | Ga0496108_0020817 | 3300048911 | Bacteria | 5393 |
| 650 | Ga0496108_0049082 | 3300048911 | Bacteria | 3530 |
| 651 | Ga0496108_0236887 | 3300048911 | Bacteria | 1587 |
| 652 | Ga0496109_0005332 | 3300048912 | Bacteria | 10749 |
| 653 | Ga0496109_0015046 | 3300048912 | Bacteria | 6733 |
| 654 | Ga0496109_0016884 | 3300048912 | Bacteria | 6387 |
| 655 | Ga0496109_0058568 | 3300048912 | Bacteria | 3518 |
| 656 | Ga0496109_0210599 | 3300048912 | Bacteria | 1828 |
| 657 | Ga0496109_0423964 | 3300048912 | Archaea | 1257 |
| 658 | Ga0496110_0001135 | 3300048913 | Bacteria | 18829 |
| 659 | Ga0496110_0005043 | 3300048913 | Bacteria | 10320 |
| 660 | Ga0496110_0026862 | 3300048913 | Bacteria | 4929 |
| 661 | Ga0496110_0044456 | 3300048913 | Bacteria | 3878 |
| 662 | Ga0496110_0208213 | 3300048913 | Bacteria | 1777 |
| 663 | Ga0496111_0001391 | 3300048914 | Bacteria | 13734 |
| 664 | Ga0496111_0005159 | 3300048914 | Bacteria | 8329 |
| 665 | Ga0496111_0010119 | 3300048914 | Bacteria | 6313 |
| 666 | Ga0496111_0024233 | 3300048914 | Bacteria | 4270 |
| 667 | Ga0496111_0033950 | 3300048914 | Bacteria | 3640 |
| 668 | Ga0496111_0144710 | 3300048914 | Bacteria | 1762 |
| 669 | Ga0496111_0145106 | 3300048914 | Unclassified | 1759 |
| 670 | Ga0496112_0038076 | 3300048915 | Bacteria | 4696 |
| 671 | Ga0496112_0094502 | 3300048915 | Bacteria | 2960 |
| 672 | Ga0496112_0493952 | 3300048915 | Unclassified | 1160 |
| 673 | Ga0496113_0016441 | 3300048916 | Bacteria | 5112 |
| 674 | Ga0496113_0143446 | 3300048916 | Unclassified | 1880 |
| 675 | Ga0496113_0293747 | 3300048916 | Bacteria | 1300 |
| 676 | Ga0496114_0000570 | 3300048917 | Bacteria | 27268 |
| 677 | Ga0496114_0004918 | 3300048917 | Bacteria | 10410 |
| 678 | Ga0496114_0061489 | 3300048917 | Bacteria | 3141 |
| 679 | Ga0496114_0088448 | 3300048917 | Bacteria | 2627 |
| 680 | Ga0496114_0166008 | 3300048917 | Bacteria | 1922 |
| 681 | Ga0496114_0255410 | 3300048917 | Unclassified | 1542 |
| 682 | Ga0496115_0002884 | 3300048918 | Bacteria | 12387 |
| 683 | Ga0496115_0004959 | 3300048918 | Bacteria | 9670 |
| 684 | Ga0496115_0208173 | 3300048918 | Bacteria | 1616 |
| 685 | Ga0501031_0147083 | 3300049568 | Bacteria | 1539 |
| 686 | Ga0501032_0012379 | 3300049569 | Bacteria | 6098 |
| 687 | Ga0501033_0009406 | 3300049570 | Bacteria | 7524 |
| 688 | Ga0501033_0190359 | 3300049570 | Bacteria | 1468 |
| 689 | Ga0501034_0033688 | 3300049571 | Bacteria | 5193 |
| 690 | Ga0501036_0010250 | 3300049572 | Bacteria | 7729 |
| 691 | Ga0501036_0039015 | 3300049572 | Bacteria | 4021 |
| 692 | Ga0501036_0312940 | 3300049572 | Bacteria | 1313 |
| 693 | Ga0501037_0018228 | 3300049573 | Bacteria | 5172 |
| 694 | Ga0501037_0024816 | 3300049573 | Bacteria | 4432 |
| 695 | Ga0501038_0008602 | 3300049574 | Bacteria | 9368 |
| 696 | Ga0501038_0017471 | 3300049574 | Bacteria | 6484 |
| 697 | Ga0501038_0069629 | 3300049574 | Bacteria | 2988 |
| 698 | Ga0501039_0021594 | 3300049575 | Bacteria | 4938 |
| 699 | Ga0501039_0204264 | 3300049575 | Bacteria | 1553 |
| 700 | Ga0501040_0002954 | 3300049576 | Bacteria | 10999 |
| 701 | Ga0501040_0008892 | 3300049576 | Bacteria | 6530 |
| 702 | Ga0501040_0022680 | 3300049576 | Bacteria | 4205 |
| 703 | Ga0501040_0237465 | 3300049576 | Bacteria | 1299 |
| 704 | Ga0501041_0000642 | 3300049577 | Bacteria | 18327 |
| 705 | Ga0501041_0021858 | 3300049577 | Bacteria | 3832 |
| 706 | Ga0501041_0067773 | 3300049577 | Bacteria | 2187 |
| 707 | Ga0501041_0165727 | 3300049577 | Bacteria | 1382 |
| 708 | Ga0501042_0006076 | 3300049578 | Bacteria | 7822 |
| 709 | Ga0501042_0020099 | 3300049578 | Bacteria | 4644 |
| 710 | Ga0501042_0042560 | 3300049578 | Bacteria | 3233 |
| 711 | Ga0501042_0128224 | 3300049578 | Bacteria | 1827 |
| 712 | Ga0501043_0025395 | 3300049579 | Bacteria | 4648 |
| 713 | Ga0501043_0152451 | 3300049579 | Bacteria | 1808 |
| 714 | Ga0501046_0048628 | 3300049580 | Bacteria | 3357 |
| 715 | Ga0501046_0234275 | 3300049580 | Bacteria | 1355 |
| 716 | Ga0501047_0029693 | 3300049581 | Bacteria | 5271 |
| 717 | Ga0501047_0055501 | 3300049581 | Bacteria | 3830 |
| 718 | Ga0501048_0001465 | 3300049582 | Bacteria | 17896 |
| 719 | Ga0501048_0007213 | 3300049582 | Bacteria | 8438 |
| 720 | Ga0501048_0047071 | 3300049582 | Unclassified | 3077 |
| 721 | Ga0501048_0292016 | 3300049582 | Bacteria | 1159 |
| 722 | Ga0501067_0027487 | 3300049583 | Bacteria | 3152 |
| 723 | Ga0501067_0106012 | 3300049583 | Bacteria | 1562 |
| 724 | Ga0501067_0107308 | 3300049583 | Unclassified | 1552 |
| 725 | Ga0501067_0113783 | 3300049583 | Bacteria | 1505 |
| 726 | Ga0501068_0056923 | 3300049584 | Bacteria | 2370 |
| 727 | Ga0501069_0002590 | 3300049585 | Bacteria | 9222 |
| 728 | Ga0501069_0005484 | 3300049585 | Bacteria | 6600 |
| 729 | Ga0501069_0022568 | 3300049585 | Bacteria | 3426 |
| 730 | Ga0501069_0051075 | 3300049585 | Bacteria | 2300 |
| 731 | Ga0501069_0099359 | 3300049585 | Bacteria | 1651 |
| 732 | Ga0501069_0133021 | 3300049585 | Bacteria | 1425 |
| 733 | Ga0501070_0000932 | 3300049586 | Bacteria | 26359 |
| 734 | Ga0501070_0108300 | 3300049586 | Bacteria | 2296 |
| 735 | Ga0501070_0148975 | 3300049586 | Bacteria | 1931 |
| 736 | Ga0501070_0186256 | 3300049586 | Bacteria | 1707 |
| 737 | Ga0501071_0000997 | 3300049587 | Bacteria | 15530 |
| 738 | Ga0501071_0019993 | 3300049587 | Bacteria | 4651 |
| 739 | Ga0501071_0039942 | 3300049587 | Bacteria | 3357 |
| 740 | Ga0501071_0099787 | 3300049587 | Bacteria | 2140 |
| 741 | Ga0501072_0003712 | 3300049588 | Bacteria | 11511 |
| 742 | Ga0501072_0048785 | 3300049588 | Bacteria | 3333 |
| 743 | Ga0501072_0069786 | 3300049588 | Bacteria | 2774 |
| 744 | Ga0501072_0087033 | 3300049588 | Bacteria | 2479 |
| 745 | Ga0501072_0210920 | 3300049588 | Bacteria | 1548 |
| 746 | Ga0501073_0010424 | 3300049589 | Bacteria | 6815 |
| 747 | Ga0501073_0145596 | 3300049589 | Bacteria | 1642 |
| 748 | Ga0501074_0036015 | 3300049590 | Bacteria | 3585 |
| 749 | Ga0501074_0088730 | 3300049590 | Bacteria | 2215 |
| 750 | Ga0501074_0146768 | 3300049590 | Bacteria | 1687 |
| 751 | Ga0501074_0163469 | 3300049590 | Bacteria | 1589 |
| 752 | Ga0501074_0227578 | 3300049590 | Bacteria | 1327 |
| 753 | Ga0501075_0017454 | 3300049591 | Bacteria | 5185 |
| 754 | Ga0501075_0053219 | 3300049591 | Unclassified | 3044 |
| 755 | Ga0501075_0246245 | 3300049591 | Bacteria | 1362 |
| 756 | Ga0501076_0001003 | 3300049592 | Bacteria | 18496 |
| 757 | Ga0501076_0004726 | 3300049592 | Bacteria | 9717 |
| 758 | Ga0501076_0025881 | 3300049592 | Bacteria | 4542 |
| 759 | Ga0501076_0201667 | 3300049592 | Bacteria | 1624 |
| 760 | Ga0501076_0216028 | 3300049592 | Unclassified | 1567 |
| 761 | Ga0501076_0335511 | 3300049592 | Bacteria | 1241 |
| 762 | Ga0501077_0001414 | 3300049593 | Bacteria | 14418 |
| 763 | Ga0501077_0034601 | 3300049593 | Bacteria | 3215 |
| 764 | Ga0501077_0037976 | 3300049593 | Bacteria | 3066 |
| 765 | Ga0501077_0094328 | 3300049593 | Bacteria | 1897 |
| 766 | Ga0501079_0000515 | 3300049741 | Bacteria | 25161 |
| 767 | Ga0501079_0011954 | 3300049741 | Bacteria | 6626 |
| 768 | Ga0501079_0021415 | 3300049741 | Bacteria | 4945 |
| 769 | Ga0501079_0056607 | 3300049741 | Bacteria | 3026 |
| 770 | Ga0501079_0075187 | 3300049741 | Bacteria | 2612 |
| 771 | Ga0501079_0097710 | 3300049741 | Bacteria | 2276 |
| 772 | Ga0501079_0142814 | 3300049741 | Bacteria | 1865 |
| 773 | Ga0501079_0150137 | 3300049741 | Bacteria | 1816 |
| 774 | Ga0501080_0064210 | 3300049742 | Bacteria | 3415 |
| 775 | Ga0501080_0130413 | 3300049742 | Bacteria | 2327 |
| 776 | Ga0501080_0280372 | 3300049742 | Bacteria | 1515 |
| 777 | Ga0501081_0004921 | 3300049743 | Bacteria | 8588 |
| 778 | Ga0501081_0009112 | 3300049743 | Bacteria | 6457 |
| 779 | Ga0501081_0025254 | 3300049743 | Bacteria | 3995 |
| 780 | Ga0501081_0072488 | 3300049743 | Bacteria | 2402 |
| 781 | Ga0501081_0115061 | 3300049743 | Bacteria | 1912 |
| 782 | Ga0501081_0140695 | 3300049743 | Unclassified | 1729 |
| 783 | Ga0501081_0178233 | 3300049743 | Bacteria | 1536 |
| 784 | Ga0501083_0031724 | 3300049744 | Bacteria | 3626 |
| 785 | Ga0501083_0044564 | 3300049744 | Unclassified | 3002 |
| 786 | Ga0501035_0060975 | 3300049822 | Bacteria | 3357 |
| 787 | Ga0501035_0123850 | 3300049822 | Bacteria | 2258 |
| 788 | Ga0501035_0177045 | 3300049822 | Bacteria | 1839 |
| 789 | Ga0501044_0005405 | 3300049823 | Bacteria | 14189 |
| 790 | Ga0501044_0223057 | 3300049823 | Archaea | 1835 |
| 791 | Ga0501045_0006880 | 3300049824 | Bacteria | 7882 |
| 792 | Ga0501045_0010910 | 3300049824 | Bacteria | 6363 |
| 793 | Ga0501045_0044426 | 3300049824 | Unclassified | 3237 |
| 794 | Ga0501045_0064086 | 3300049824 | Bacteria | 2697 |
| 795 | Ga0501045_0066109 | 3300049824 | Bacteria | 2655 |
| 796 | Ga0501045_0068604 | 3300049824 | Bacteria | 2605 |
| 797 | Ga0501045_0101923 | 3300049824 | Bacteria | 2125 |
| 798 | Ga0501045_0135880 | 3300049824 | Bacteria | 1828 |
| 799 | nmdc:mga00v17_6506_c1 | 3300050491 | Bacteria | 6202 |
| 800 | nmdc:mga05p37_129809_c1 | 3300050507 | Bacteria | 3092 |
| 801 | nmdc:mga05p37_20055_c1 | 3300050507 | Bacteria | 8090 |
| 802 | nmdc:mga05p37_259958_c1 | 3300050507 | Bacteria | 2078 |
| 803 | nmdc:mga05p37_60110_c1 | 3300050507 | Bacteria | 4679 |
| 804 | nmdc:mga09592_282492_c1 | 3300050508 | Bacteria | 1440 |
| 805 | nmdc:mga09592_8847_c1 | 3300050508 | Bacteria | 8190 |
| 806 | nmdc:mga0qj67_6754_c1 | 3300050509 | Bacteria | 8434 |
| 807 | nmdc:mga06r32_4545_c1 | 3300050510 | Bacteria | 12431 |
| 808 | nmdc:mga08y16_43344_c1 | 3300050511 | Bacteria | 4716 |
| 809 | nmdc:mga08y16_4467_c1 | 3300050511 | Bacteria | 14616 |
| 810 | nmdc:mga08y16_77133_c1 | 3300050511 | Bacteria | 3474 |
| 811 | nmdc:mga0n895_3110_c1 | 3300050512 | Bacteria | 13221 |
| 812 | nmdc:mga0n895_60199_c1 | 3300050512 | Bacteria | 3747 |
| 813 | nmdc:mga0rr50_254865_c1 | 3300050513 | Bacteria | 1458 |
| 814 | nmdc:mga0rr50_27411_c1 | 3300050513 | Bacteria | 3989 |
| 815 | nmdc:mga0rr50_47732_c1 | 3300050513 | Bacteria | 3161 |
| 816 | nmdc:mga0a205_377077_c1 | 3300050515 | Bacteria | 1284 |
| 817 | Ga0495612_0007703 | 3300053078 | Bacteria | 4396 |
| 818 | Ga0495612_0050201 | 3300053078 | Unclassified | 1713 |
| 819 | Ga0495655_0002212 | 3300053083 | Bacteria | 3072 |
| 820 | Ga0495619_0010604 | 3300053085 | Bacteria | 5797 |
| 821 | Ga0495619_0134604 | 3300053085 | Bacteria | 1699 |
| 822 | Ga0501084_0001865 | 3300054114 | Bacteria | 16783 |
| 823 | Ga0501084_0021635 | 3300054114 | Bacteria | 5362 |
| 824 | Ga0501084_0028358 | 3300054114 | Bacteria | 4679 |
| 825 | Ga0501084_0111285 | 3300054114 | Bacteria | 2301 |
| 826 | Ga0501084_0129986 | 3300054114 | Bacteria | 2120 |
| 827 | Ga0501082_0000729 | 3300060353 | Bacteria | 28974 |
| 828 | Ga0501082_0044683 | 3300060353 | Bacteria | 3821 |
| 829 | Ga0501082_0083710 | 3300060353 | Bacteria | 2752 |
| 830 | Ga0501082_0110525 | 3300060353 | Bacteria | 2379 |
| 831 | Ga0501082_0274139 | 3300060353 | Bacteria | 1468 |
| 832 | Ga0466962_0000661 | 3300061719 | Bacteria | 15283 |
| 833 | Ga0466962_0009711 | 3300061719 | Bacteria | 4618 |
| 834 | Ga0466962_0011442 | 3300061719 | Bacteria | 4271 |
| 835 | Ga0530510_0004851 | 3300061734 | Bacteria | 9309 |
| 836 | Ga0530510_0013682 | 3300061734 | Bacteria | 5711 |
| 837 | Ga0530510_0023096 | 3300061734 | Bacteria | 4429 |
| 838 | Ga0530510_0065130 | 3300061734 | Bacteria | 2640 |
| 839 | Ga0530510_0164074 | 3300061734 | Bacteria | 1644 |
| 840 | Ga0207652_10142433 | |||
| 841 | JGI24751J29686_10007330 | |||
| 842 | Ga0070658_10010114 | |||
| 843 | Ga0070676_10124406 | |||
| 844 | Ga0070683_100015830 | |||
| 845 | Ga0070683_100015891 | |||
| 846 | Ga0070683_100030281 | |||
| 847 | Ga0070683_100036759 | |||
| 848 | Ga0070683_100054672 | |||
| 849 | Ga0070683_100056804 | |||
| 850 | Ga0070683_100064594 | |||
| 851 | Ga0070683_100084745 | |||
| 852 | Ga0070683_100155406 | |||
| 853 | Ga0070683_100224722 | |||
| 854 | Ga0070683_100322751 | |||
| 855 | Ga0070690_100118952 | |||
| 856 | Ga0070670_100010859 | |||
| 857 | Ga0068869_100010513 | |||
| 858 | Ga0068869_100078836 | |||
| 859 | Ga0070680_100005086 | |||
| 860 | Ga0070680_100008703 | |||
| 861 | Ga0070680_100023016 | |||
| 862 | Ga0070680_100044147 | |||
| 863 | Ga0070680_100155552 | |||
| 864 | Ga0070682_100008580 | |||
| 865 | Ga0070682_100009117 | |||
| 866 | Ga0070682_100019435 | |||
| 867 | Ga0070682_100128267 | |||
| 868 | Ga0068868_100054441 | |||
| 869 | Ga0070660_100003574 | |||
| 870 | Ga0070660_100015515 | |||
| 871 | Ga0070660_100020419 | |||
| 872 | Ga0070660_100030252 | |||
| 873 | Ga0070660_100036011 | |||
| 874 | Ga0070660_100036981 | |||
| 875 | Ga0070660_100089764 | |||
| 876 | Ga0070660_100144054 | |||
| 877 | Ga0070689_100008401 | |||
| 878 | Ga0070689_100077028 | |||
| 879 | Ga0070691_10003647 | |||
| 880 | Ga0070691_10058157 | |||
| 881 | Ga0070661_100006585 | |||
| 882 | Ga0070661_100008439 | |||
| 883 | Ga0070661_100015898 | |||
| 884 | Ga0070661_100016782 | |||
| 885 | Ga0070661_100051329 | |||
| 886 | Ga0070661_100055728 | |||
| 887 | Ga0070661_100064499 | |||
| 888 | Ga0070692_10026747 | |||
| 889 | Ga0070692_10046905 | |||
| 890 | Ga0070675_100023009 | |||
| 891 | Ga0070675_100046807 | |||
| 892 | Ga0070671_100096596 | |||
| 893 | Ga0070674_100001302 | |||
| 894 | Ga0070674_100067398 | |||
| 895 | Ga0070673_100030163 | |||
| 896 | Ga0070688_100092772 | |||
| 897 | Ga0070688_100124254 | |||
| 898 | Ga0070659_100013626 | |||
| 899 | Ga0070659_100016104 | |||
| 900 | Ga0070659_100040076 | |||
| 901 | Ga0070659_100045849 | |||
| 902 | Ga0070659_100114484 | |||
| 903 | Ga0070659_100140678 | |||
| 904 | Ga0070709_10048057 | |||
| 905 | Ga0070714_100013725 | |||
| 906 | Ga0070714_100056459 | |||
| 907 | Ga0070714_100106721 | |||
| 908 | Ga0070714_100109946 | |||
| 909 | Ga0070713_100112126 | |||
| 910 | Ga0070710_10028029 | |||
| 911 | Ga0070710_10062693 | |||
| 912 | Ga0070701_10010620 | |||
| 913 | Ga0070701_10066896 | |||
| 914 | Ga0070711_100095013 | |||
| 915 | Ga0070711_100261444 | |||
| 916 | Ga0070700_100098109 | |||
| 917 | Ga0070708_100079170 | |||
| 918 | Ga0070708_100152619 | |||
| 919 | Ga0070708_100337694 | |||
| 920 | Ga0070663_100079549 | |||
| 921 | Ga0070678_100080965 | |||
| 922 | Ga0070662_100040166 | |||
| 923 | Ga0070662_100048186 | |||
| 924 | Ga0070681_10000749 | |||
| 925 | Ga0070681_10006655 | |||
| 926 | Ga0070681_10009487 | |||
| 927 | Ga0070681_10093430 | |||
| 928 | Ga0070681_10334230 | |||
| 929 | Ga0068867_100034924 | |||
| 930 | Ga0068867_100173014 | |||
| 931 | Ga0068867_100305086 | |||
| 932 | Ga0070685_10005978 | |||
| 933 | Ga0070706_100388506 | |||
| 934 | Ga0070707_100106168 | |||
| 935 | Ga0070698_100019245 | |||
| 936 | Ga0070698_100041887 | |||
| 937 | Ga0070698_100179487 | |||
| 938 | Ga0070698_100295449 | |||
| 939 | Ga0070699_100089410 | |||
| 940 | Ga0070699_100141498 | |||
| 941 | Ga0070699_100184688 | |||
| 942 | Ga0070679_100005464 | |||
| 943 | Ga0070679_100032625 | |||
| 944 | Ga0070679_100039537 | |||
| 945 | Ga0070679_100049312 | |||
| 946 | Ga0070679_100064508 | |||
| 947 | Ga0070679_100095677 | |||
| 948 | Ga0070679_100113839 | |||
| 949 | Ga0070684_100005027 | |||
| 950 | Ga0070684_100011603 | |||
| 951 | Ga0070684_100014289 | |||
| 952 | Ga0070684_100027664 | |||
| 953 | Ga0070684_100030872 | |||
| 954 | Ga0070684_100034227 | |||
| 955 | Ga0070684_100040658 | |||
| 956 | Ga0070684_100041144 | |||
| 957 | Ga0070684_100055365 | |||
| 958 | Ga0070684_100069774 | |||
| 959 | Ga0070684_100084843 | |||
| 960 | Ga0070684_100114531 | |||
| 961 | Ga0070684_100124503 | |||
| 962 | Ga0068853_100009467 | |||
| 963 | Ga0070672_100003936 | |||
| 964 | Ga0070672_100023768 | |||
| 965 | Ga0070686_100014712 | |||
| 966 | Ga0070695_100123706 | |||
| 967 | Ga0070696_100124520 | |||
| 968 | Ga0070696_100157078 | |||
| 969 | Ga0070693_100019933 | |||
| 970 | Ga0070693_100023607 | |||
| 971 | Ga0070693_100046798 | |||
| 972 | Ga0070665_100033445 | |||
| 973 | Ga0070704_100029686 | |||
| 974 | Ga0070704_100194221 | |||
| 975 | Ga0070704_100313733 | |||
| 976 | Ga0070704_100335741 | |||
| 977 | Ga0068855_100032562 | |||
| 978 | Ga0068855_100037090 | |||
| 979 | Ga0068855_100045854 | |||
| 980 | Ga0068855_100058740 | |||
| 981 | Ga0068855_100061055 | |||
| 982 | Ga0068855_100131207 | |||
| 983 | Ga0070664_100014453 | |||
| 984 | Ga0070664_100039824 | |||
| 985 | Ga0070664_100324800 | |||
| 986 | Ga0068857_100045121 | |||
| 987 | Ga0068857_100049130 | |||
| 988 | Ga0068857_100054005 | |||
| 989 | Ga0068857_100137342 | |||
| 990 | Ga0068857_100292668 | |||
| 991 | Ga0068854_100026625 | |||
| 992 | Ga0068854_100238932 | |||
| 993 | Ga0068856_100028398 | |||
| 994 | Ga0068856_100082748 | |||
| 995 | Ga0068856_100122243 | |||
| 996 | Ga0068856_100302831 | |||
| 997 | Ga0068856_100401464 | |||
| 998 | Ga0070702_100019096 | |||
| 999 | Ga0070702_100022581 | |||
| 1000 | Ga0070702_100050663 | |||
| 1001 | Ga0068852_100008666 | |||
| 1002 | Ga0068852_100159231 | |||
| 1003 | Ga0068859_100370367 | |||
| 1004 | Ga0068864_100008532 | |||
| 1005 | Ga0068864_100064126 | |||
| 1006 | Ga0068864_100308730 | |||
| 1007 | Ga0068866_10144683 | |||
| 1008 | Ga0068851_10025677 | |||
| 1009 | Ga0068870_10004976 | |||
| 1010 | Ga0068870_10030426 | |||
| 1011 | Ga0068863_100020555 | |||
| 1012 | Ga0068858_100169147 | |||
| 1013 | Ga0068860_100233063 | |||
| 1014 | Ga0081455_10001959 | |||
| 1015 | Ga0081455_10029352 | |||
| 1016 | Ga0081455_10031718 | |||
| 1017 | Ga0081455_10063555 | |||
| 1018 | Ga0081455_10154165 | |||
| 1019 | Ga0081538_10001290 | |||
| 1020 | Ga0081538_10034537 | |||
| 1021 | Ga0070717_10014420 | |||
| 1022 | Ga0070717_10025725 | |||
| 1023 | Ga0070717_10152348 | |||
| 1024 | Ga0070717_10186398 | |||
| 1025 | Ga0075364_10008748 | |||
| 1026 | Ga0075364_10030740 | |||
| 1027 | Ga0075432_10036939 | |||
| 1028 | Ga0070715_10016206 | |||
| 1029 | Ga0070715_10080829 | |||
| 1030 | Ga0070716_100167805 | |||
| 1031 | Ga0070712_100009618 | |||
| 1032 | Ga0070712_100013144 | |||
| 1033 | Ga0070712_100062243 | |||
| 1034 | Ga0070712_100163318 | |||
| 1035 | Ga0075362_10002455 | |||
| 1036 | Ga0097621_100098314 | |||
| 1037 | Ga0075428_100058183 | |||
| 1038 | Ga0075428_100439815 | |||
| 1039 | Ga0075430_100018905 | |||
| 1040 | Ga0075433_10120348 | |||
| 1041 | Ga0075434_100057551 | |||
| 1042 | Ga0075434_100149161 | |||
| 1043 | Ga0075429_100110113 | |||
| 1044 | Ga0068865_100011508 | |||
| 1045 | Ga0068865_100058112 | |||
| 1046 | Ga0068865_100063414 | |||
| 1047 | Ga0075436_100055067 | |||
| 1048 | Ga0097620_100370371 | |||
| 1049 | Ga0075435_100025171 | |||
| 1050 | Ga0105240_10078090 | |||
| 1051 | Ga0105240_10210478 | |||
| 1052 | Ga0105240_10308024 | |||
| 1053 | Ga0105240_10512389 | |||
| 1054 | Ga0111539_10002753 | |||
| 1055 | Ga0111539_10027719 | |||
| 1056 | Ga0111539_10045112 | |||
| 1057 | Ga0111539_10108767 | |||
| 1058 | Ga0111539_10170250 | |||
| 1059 | Ga0111539_10298684 | |||
| 1060 | Ga0105245_10018522 | |||
| 1061 | Ga0105245_10027306 | |||
| 1062 | Ga0105245_10068145 | |||
| 1063 | Ga0105245_10131931 | |||
| 1064 | Ga0105245_10405334 | |||
| 1065 | Ga0114129_10044321 | |||
| 1066 | Ga0114129_10286351 | |||
| 1067 | Ga0105243_10007960 | |||
| 1068 | Ga0105243_10067568 | |||
| 1069 | Ga0105243_10146371 | |||
| 1070 | Ga0105243_10186840 | |||
| 1071 | Ga0105243_10216847 | |||
| 1072 | Ga0105243_10224610 | |||
| 1073 | Ga0105241_10435528 | |||
| 1074 | Ga0105242_10027625 | |||
| 1075 | Ga0105242_10067261 | |||
| 1076 | Ga0105242_10075192 | |||
| 1077 | Ga0105242_10081304 | |||
| 1078 | Ga0105242_10095615 | |||
| 1079 | Ga0105242_10126199 | |||
| 1080 | Ga0105248_10041322 | |||
| 1081 | Ga0105237_10065429 | |||
| 1082 | Ga0105237_10188522 | |||
| 1083 | Ga0105238_10010250 | |||
| 1084 | Ga0105238_10355194 | |||
| 1085 | Ga0105249_10044752 | |||
| 1086 | Ga0105249_10076206 | |||
| 1087 | Ga0105249_10187372 | |||
| 1088 | Ga0105239_10056070 | |||
| 1089 | Ga0105239_10175366 | |||
| 1090 | Ga0105246_10101897 | |||
| 1091 | Ga0157373_10103066 | |||
| 1092 | Ga0157371_10007020 | |||
| 1093 | Ga0157370_10006143 | |||
| 1094 | Ga0157370_10015065 | |||
| 1095 | Ga0157370_10197257 | |||
| 1096 | Ga0157370_10371623 | |||
| 1097 | Ga0157369_10003856 | |||
| 1098 | Ga0157369_10019412 | |||
| 1099 | Ga0157369_10032679 | |||
| 1100 | Ga0157369_10033145 | |||
| 1101 | Ga0157369_10033154 | |||
| 1102 | Ga0157369_10077696 | |||
| 1103 | Ga0157378_10101345 | |||
| 1104 | Ga0157378_10116958 | |||
| 1105 | Ga0157378_10194553 | |||
| 1106 | Ga0163162_10141206 | |||
| 1107 | Ga0163162_10177139 | |||
| 1108 | Ga0157372_10026859 | |||
| 1109 | Ga0157372_10039029 | |||
| 1110 | Ga0157372_10131467 | |||
| 1111 | Ga0157372_10184521 | |||
| 1112 | Ga0157372_10235230 | |||
| 1113 | Ga0157372_10457091 | |||
| 1114 | Ga0157375_10029202 | |||
| 1115 | Ga0157375_10087185 | |||
| 1116 | Ga0163163_10147669 | |||
| 1117 | Ga0157380_10009357 | |||
| 1118 | Ga0157380_10024897 | |||
| 1119 | Ga0157380_10127513 | |||
| 1120 | Ga0157377_10006038 | |||
| 1121 | Ga0157377_10012532 | |||
| 1122 | Ga0157377_10035908 | |||
| 1123 | Ga0157377_10050784 | |||
| 1124 | Ga0157379_10211108 | |||
| 1125 | Ga0157376_10011069 | |||
| 1126 | Ga0157376_10212840 | |||
| 1127 | Ga0197907_11224760 | |||
| 1128 | Ga0206354_11621597 | |||
| 1129 | Ga0206353_10906813 | |||
| 1130 | Ga0206353_11793764 | |||
| 1131 | Ga0213871_10013380 | |||
| 1132 | Ga0207653_10043062 | |||
| 1133 | Ga0207692_10003153 | |||
| 1134 | Ga0207688_10000822 | |||
| 1135 | Ga0207688_10015428 | |||
| 1136 | Ga0207688_10020581 | |||
| 1137 | Ga0207688_10025867 | |||
| 1138 | Ga0207688_10031096 | |||
| 1139 | Ga0207699_10199921 | |||
| 1140 | Ga0207645_10071477 | |||
| 1141 | Ga0207643_10005291 | |||
| 1142 | Ga0207643_10038895 | |||
| 1143 | Ga0207643_10043869 | |||
| 1144 | Ga0207643_10179603 | |||
| 1145 | Ga0207705_10083844 | |||
| 1146 | Ga0207705_10095709 | |||
| 1147 | Ga0207705_10173619 | |||
| 1148 | Ga0207705_10200156 | |||
| 1149 | Ga0207705_10239467 | |||
| 1150 | Ga0207684_10324584 | |||
| 1151 | Ga0207654_10117976 | |||
| 1152 | Ga0207707_10024128 | |||
| 1153 | Ga0207707_10037642 | |||
| 1154 | Ga0207707_10045018 | |||
| 1155 | Ga0207707_10146910 | |||
| 1156 | Ga0207695_10344922 | |||
| 1157 | Ga0207695_10375501 | |||
| 1158 | Ga0207671_10263029 | |||
| 1159 | Ga0207693_10002091 | |||
| 1160 | Ga0207693_10171163 | |||
| 1161 | Ga0207660_10005528 | |||
| 1162 | Ga0207660_10020652 | |||
| 1163 | Ga0207660_10025160 | |||
| 1164 | Ga0207662_10010917 | |||
| 1165 | Ga0207657_10000486 | |||
| 1166 | Ga0207657_10001651 | |||
| 1167 | Ga0207657_10010171 | |||
| 1168 | Ga0207657_10012673 | |||
| 1169 | Ga0207657_10015181 | |||
| 1170 | Ga0207657_10021999 | |||
| 1171 | Ga0207657_10047551 | |||
| 1172 | Ga0207657_10124977 | |||
| 1173 | Ga0207649_10024282 | |||
| 1174 | Ga0207649_10025612 | |||
| 1175 | Ga0207649_10110558 | |||
| 1176 | Ga0207652_10006427 | |||
| 1177 | Ga0207652_10030079 | |||
| 1178 | Ga0207652_10058584 | |||
| 1179 | Ga0207652_10069779 | |||
| 1180 | Ga0207652_10147477 | |||
| 1181 | Ga0207650_10060467 | |||
| 1182 | Ga0207659_10145356 | |||
| 1183 | Ga0207659_10155216 | |||
| 1184 | Ga0207659_10159429 | |||
| 1185 | Ga0207687_10005316 | |||
| 1186 | Ga0207687_10031906 | |||
| 1187 | Ga0207664_10207692 | |||
| 1188 | Ga0207690_10007278 | |||
| 1189 | Ga0207690_10047190 | |||
| 1190 | Ga0207690_10056383 | |||
| 1191 | Ga0207690_10059503 | |||
| 1192 | Ga0207690_10307520 | |||
| 1193 | Ga0207706_10002051 | |||
| 1194 | Ga0207706_10052223 | |||
| 1195 | Ga0207706_10059081 | |||
| 1196 | Ga0207686_10025311 | |||
| 1197 | Ga0207686_10146804 | |||
| 1198 | Ga0207709_10042277 | |||
| 1199 | Ga0207670_10024035 | |||
| 1200 | Ga0207669_10011544 | |||
| 1201 | Ga0207691_10006749 | |||
| 1202 | Ga0207691_10060912 | |||
| 1203 | Ga0207691_10108267 | |||
| 1204 | Ga0207711_10296743 | |||
| 1205 | Ga0207689_10118178 | |||
| 1206 | Ga0207661_10000195 | |||
| 1207 | Ga0207661_10011506 | |||
| 1208 | Ga0207661_10086261 | |||
| 1209 | Ga0207661_10136475 | |||
| 1210 | Ga0207661_10154167 | |||
| 1211 | Ga0207661_10161014 | |||
| 1212 | Ga0207679_10019329 | |||
| 1213 | Ga0207679_10038699 | |||
| 1214 | Ga0207667_10168665 | |||
| 1215 | Ga0207667_10192681 | |||
| 1216 | Ga0207651_10032369 | |||
| 1217 | Ga0207651_10093539 | |||
| 1218 | Ga0207712_10255116 | |||
| 1219 | Ga0207668_10078192 | |||
| 1220 | Ga0207668_10279827 | |||
| 1221 | Ga0207640_10047495 | |||
| 1222 | Ga0207639_10034181 | |||
| 1223 | Ga0207639_10343403 | |||
| 1224 | Ga0207678_10039615 | |||
| 1225 | Ga0207678_10043583 | |||
| 1226 | Ga0207678_10070736 | |||
| 1227 | Ga0207678_10130033 | |||
| 1228 | Ga0207708_10017804 | |||
| 1229 | Ga0207708_10036713 | |||
| 1230 | Ga0207708_10038162 | |||
| 1231 | Ga0207702_10013308 | |||
| 1232 | Ga0207702_10031145 | |||
| 1233 | Ga0207702_10051095 | |||
| 1234 | Ga0207702_10086471 | |||
| 1235 | Ga0207702_10105480 | |||
| 1236 | Ga0207648_10176049 | |||
| 1237 | Ga0207648_10338623 | |||
| 1238 | Ga0207676_10026885 | |||
| 1239 | Ga0207674_10008631 | |||
| 1240 | Ga0207674_10008773 | |||
| 1241 | Ga0207674_10026630 | |||
| 1242 | Ga0207674_10030732 | |||
| 1243 | Ga0207674_10082538 | |||
| 1244 | Ga0207674_10139127 | |||
| 1245 | Ga0207675_100084473 | |||
| 1246 | Ga0207683_10032676 | |||
| 1247 | Ga0207683_10040427 | |||
| 1248 | Ga0207683_10166674 | |||
| 1249 | Ga0207683_10291673 | |||
| 1250 | Ga0207698_10014637 | |||
| 1251 | Ga0207698_10041458 | |||
| 1252 | Ga0207428_10002821 | |||
| 1253 | Ga0207428_10008067 | |||
| 1254 | Ga0207428_10009180 | |||
| 1255 | Ga0207428_10018875 | |||
| 1256 | Ga0268266_10046878 | |||
| 1257 | Ga0268266_10075604 | |||
| 1258 | Ga0268264_10043596 | |||
| 1259 | Ga0265319_1027097 | |||
| 1260 | Ga0265318_10009735 | |||
| 1261 | Ga0265318_10019457 | |||
| 1262 | Ga0265322_10011901 | |||
| 1263 | Ga0265322_10021932 | |||
| 1264 | Ga0265338_10014805 | |||
| 1265 | Ga0265338_10053965 | |||
| 1266 | Ga0265338_10213368 | |||
| 1267 | Ga0265324_10012363 | |||
| 1268 | Ga0265330_10031776 | |||
| 1269 | Ga0265330_10048606 | |||
| 1270 | Ga0265332_10084565 | |||
| 1271 | Ga0265325_10031136 | |||
| 1272 | Ga0265325_10110920 | |||
| 1273 | Ga0265339_10024102 | |||
| 1274 | Ga0265327_10045506 | |||
| 1275 | Ga0265316_10029926 | |||
| 1276 | Ga0307408_100031946 | |||
| 1277 | Ga0265313_10004167 | |||
| 1278 | Ga0265313_10009381 | |||
| 1279 | Ga0265314_10010725 | |||
| 1280 | Ga0265342_10047624 | |||
| 1281 | Ga0307409_100168334 | |||
| 1282 | Ga0307409_100261270 | |||
| 1283 | Ga0307414_10076413 | |||
| 1284 | Ga0373951_0011845 | |||
| 1285 | Ga0373943_0004770 | |||
| 1286 | Ga0373946_0007039 | |||
| 1287 | Ga0373935_0028527 | |||
| 1288 | Ga0373935_0043479 | |||
| 1289 | Ga0373935_0287616 | |||
| 1290 | Ga0373927_0063107 | |||
| 1291 | Ga0373947_0000833 | |||
| 1292 | Ga0373947_0004241 | |||
| 1293 | Ga0373937_0041010 | |||
| 1294 | Ga0373937_0480453 | |||
| 1295 | Ga0373925_0011906 | |||
| 1296 | Ga0395899_0003567 | |||
| 1297 | Ga0395899_0017962 | |||
| 1298 | Ga0395899_0033726 | |||
| 1299 | Ga0395899_0163905 | |||
| 1300 | Ga0395900_0001819 | |||
| 1301 | Ga0395900_0014881 | |||
| 1302 | Ga0395900_0024327 | |||
| 1303 | Ga0395900_0096245 | |||
| 1304 | Ga0395900_0101216 | |||
| 1305 | Ga0395898_0002618 | |||
| 1306 | Ga0395898_0014564 | |||
| 1307 | Ga0395898_0180963 | |||
| 1308 | Ga0395898_0251229 | |||
| 1309 | Ga0395905_0009197 | |||
| 1310 | Ga0395905_0032649 | |||
| 1311 | Ga0395905_0066382 | |||
| 1312 | Ga0395905_0315152 | |||
| 1313 | Ga0395901_0001138 | |||
| 1314 | Ga0395901_0154410 | |||
| 1315 | Ga0395901_0186682 | |||
| 1316 | Ga0395901_0212577 | |||
| 1317 | Ga0436365_0434512 | |||
| 1318 | Ga0436360_0143933 | |||
| 1319 | Ga0436363_1187594 | |||
| 1320 | Ga0436362_0037531 | |||
| 1321 | Ga0439463_018308 | |||
| 1322 | Ga0450920_005795 | |||
| 1323 | Ga0439446_0022649 | |||
| 1324 | Ga0466969_0017142 | |||
| 1325 | Ga0466965_0066965 | |||
| 1326 | Ga0466965_0100011 | |||
| 1327 | Ga0466966_0007508 | |||
| 1328 | Ga0466966_0013272 | |||
| 1329 | Ga0466966_0128973 | |||
| 1330 | Ga0466961_0006627 | |||
| 1331 | Ga0466961_0010932 | |||
| 1332 | Ga0466961_0019336 | |||
| 1333 | Ga0466963_0005065 | |||
| 1334 | Ga0466963_0039337 | |||
| 1335 | Ga0466963_0056514 | |||
| 1336 | Ga0466963_0072594 | |||
| 1337 | Ga0466963_0147588 | |||
| 1338 | Ga0466963_0171284 | |||
| 1339 | Ga0466963_0201582 | |||
| 1340 | Ga0466964_0016632 | |||
| 1341 | Ga0466971_0001805 | |||
| 1342 | Ga0466971_0003461 | |||
| 1343 | Ga0466971_0004010 | |||
| 1344 | Ga0466971_0010864 | |||
| 1345 | Ga0466968_0011166 | |||
| 1346 | Ga0466968_0021808 | |||
| 1347 | Ga0466970_0018788 | |||
| 1348 | Ga0466957_0012546 | |||
| 1349 | Ga0466957_0021598 | |||
| 1350 | Ga0466957_0033737 | |||
| 1351 | Ga0466957_0136216 | |||
| 1352 | Ga0466960_0051139 | |||
| 1353 | Ga0466959_0003619 | |||
| 1354 | Ga0466959_0008520 | |||
| 1355 | Ga0466959_0018649 | |||
| 1356 | Ga0466959_0023916 | |||
| 1357 | Ga0466959_0062769 | |||
| 1358 | Ga0466958_0005516 | |||
| 1359 | Ga0466958_0008945 | |||
| 1360 | Ga0466958_0009049 | |||
| 1361 | Ga0466958_0009210 | |||
| 1362 | Ga0466958_0023818 | |||
| 1363 | Ga0466958_0024983 | |||
| 1364 | Ga0466958_0059446 | |||
| 1365 | Ga0466967_0000602 | |||
| 1366 | Ga0466967_0004099 | |||
| 1367 | Ga0466967_0004937 | |||
| 1368 | Ga0466967_0009609 | |||
| 1369 | Ga0466967_0012582 | |||
| 1370 | Ga0466967_0018008 | |||
| 1371 | Ga0466967_0025019 | |||
| 1372 | Ga0466967_0035358 | |||
| 1373 | Ga0466967_0056609 | |||
| 1374 | Ga0466967_0138433 | |||
| 1375 | Ga0466967_0212181 | |||
| 1376 | Ga0466967_0249958 | |||
| 1377 | Ga0466967_0260988 | |||
| 1378 | Ga0495592_0094033 | |||
| 1379 | Ga0495629_0000983 | |||
| 1380 | Ga0495629_0026236 | |||
| 1381 | Ga0495629_0043301 | |||
| 1382 | Ga0495629_0050286 | |||
| 1383 | Ga0495641_0000513 | |||
| 1384 | Ga0495653_0027441 | |||
| 1385 | Ga0495653_0089323 | |||
| 1386 | Ga0495653_0130356 | |||
| 1387 | Ga0495582_0000553 | |||
| 1388 | Ga0495582_0061000 | |||
| 1389 | Ga0495662_0007890 | |||
| 1390 | Ga0495608_0004647 | |||
| 1391 | Ga0495608_0010647 | |||
| 1392 | Ga0495608_0049347 | |||
| 1393 | Ga0495618_0190545 | |||
| 1394 | Ga0495628_0049357 | |||
| 1395 | Ga0495628_0183967 | |||
| 1396 | Ga0495630_0011346 | |||
| 1397 | Ga0495630_0012886 | |||
| 1398 | Ga0495630_0039587 | |||
| 1399 | Ga0495631_0043159 | |||
| 1400 | Ga0495652_0045046 | |||
| 1401 | Ga0495652_0070467 | |||
| 1402 | Ga0495652_0097501 | |||
| 1403 | Ga0495652_0129180 | |||
| 1404 | Ga0495665_0005465 | |||
| 1405 | Ga0495640_0024123 | |||
| 1406 | Ga0495586_0020193 | |||
| 1407 | Ga0495586_0029424 | |||
| 1408 | Ga0495609_0048947 | |||
| 1409 | Ga0495645_0037023 | |||
| 1410 | Ga0495645_0162819 | |||
| 1411 | Ga0495667_0016085 | |||
| 1412 | Ga0495667_0028440 | |||
| 1413 | Ga0495656_0054762 | |||
| 1414 | Ga0495634_0032786 | |||
| 1415 | Ga0495634_0099103 | |||
| 1416 | Ga0495635_0035027 | |||
| 1417 | Ga0495635_0079802 | |||
| 1418 | Ga0495588_0093994 | |||
| 1419 | Ga0495657_0091790 | |||
| 1420 | Ga0495657_0091984 | |||
| 1421 | Ga0495657_0228486 | |||
| 1422 | Ga0495647_0006157 | |||
| 1423 | Ga0495658_0002075 | |||
| 1424 | Ga0495613_0010487 | |||
| 1425 | Ga0495613_0022025 | |||
| 1426 | Ga0495613_0152080 | |||
| 1427 | Ga0495624_0007147 | |||
| 1428 | Ga0495624_0046705 | |||
| 1429 | Ga0495671_0044900 | |||
| 1430 | Ga0495589_0068741 | |||
| 1431 | Ga0495581_0001833 | |||
| 1432 | Ga0495604_0027208 | |||
| 1433 | Ga0495604_0055205 | |||
| 1434 | Ga0495604_0082603 | |||
| 1435 | Ga0495674_0003155 | |||
| 1436 | Ga0495674_0157775 | |||
| 1437 | Ga0495676_0029645 | |||
| 1438 | Ga0495680_0004330 | |||
| 1439 | Ga0495680_0007287 | |||
| 1440 | Ga0495680_0019817 | |||
| 1441 | Ga0495680_0059904 | |||
| 1442 | Ga0495680_0080873 | |||
| 1443 | Ga0495677_0014430 | |||
| 1444 | Ga0495684_0282128 | |||
| 1445 | Ga0495593_0009203 | |||
| 1446 | Ga0495602_0103893 | |||
| 1447 | Ga0496100_0008112 | |||
| 1448 | Ga0496100_0061984 | |||
| 1449 | Ga0496100_0139811 | |||
| 1450 | Ga0496101_0000745 | |||
| 1451 | Ga0496101_0001389 | |||
| 1452 | Ga0496101_0033798 | |||
| 1453 | Ga0496101_0051101 | |||
| 1454 | Ga0496101_0104168 | |||
| 1455 | Ga0496101_0140746 | |||
| 1456 | Ga0496102_0006447 | |||
| 1457 | Ga0496102_0126388 | |||
| 1458 | Ga0496102_0249710 | |||
| 1459 | Ga0496102_0334852 | |||
| 1460 | Ga0496102_0345188 | |||
| 1461 | Ga0496103_0009315 | |||
| 1462 | Ga0496103_0036650 | |||
| 1463 | Ga0496103_0040444 | |||
| 1464 | Ga0496103_0154421 | |||
| 1465 | Ga0496104_0005726 | |||
| 1466 | Ga0496104_0008448 | |||
| 1467 | Ga0496104_0038427 | |||
| 1468 | Ga0496104_0089195 | |||
| 1469 | Ga0496104_0155582 | |||
| 1470 | Ga0496104_0351788 | |||
| 1471 | Ga0496105_0000092 | |||
| 1472 | Ga0496105_0008326 | |||
| 1473 | Ga0496105_0014858 | |||
| 1474 | Ga0496105_0039809 | |||
| 1475 | Ga0496105_0077680 | |||
| 1476 | Ga0496106_0011906 | |||
| 1477 | Ga0496106_0025492 | |||
| 1478 | Ga0496106_0027167 | |||
| 1479 | Ga0496106_0280221 | |||
| 1480 | Ga0496106_0283970 | |||
| 1481 | Ga0496107_0008186 | |||
| 1482 | Ga0496107_0042719 | |||
| 1483 | Ga0496107_0166711 | |||
| 1484 | Ga0496107_0222397 | |||
| 1485 | Ga0496107_0231900 | |||
| 1486 | Ga0496107_0306349 | |||
| 1487 | Ga0496108_0004497 | |||
| 1488 | Ga0496108_0020817 | |||
| 1489 | Ga0496108_0049082 | |||
| 1490 | Ga0496108_0236887 | |||
| 1491 | Ga0496109_0005332 | |||
| 1492 | Ga0496109_0015046 | |||
| 1493 | Ga0496109_0016884 | |||
| 1494 | Ga0496109_0058568 | |||
| 1495 | Ga0496109_0210599 | |||
| 1496 | Ga0496109_0423964 | |||
| 1497 | Ga0496110_0001135 | |||
| 1498 | Ga0496110_0005043 | |||
| 1499 | Ga0496110_0026862 | |||
| 1500 | Ga0496110_0044456 | |||
| 1501 | Ga0496110_0208213 | |||
| 1502 | Ga0496111_0001391 | |||
| 1503 | Ga0496111_0005159 | |||
| 1504 | Ga0496111_0010119 | |||
| 1505 | Ga0496111_0024233 | |||
| 1506 | Ga0496111_0033950 | |||
| 1507 | Ga0496111_0144710 | |||
| 1508 | Ga0496111_0145106 | |||
| 1509 | Ga0496112_0038076 | |||
| 1510 | Ga0496112_0094502 | |||
| 1511 | Ga0496112_0493952 | |||
| 1512 | Ga0496113_0016441 | |||
| 1513 | Ga0496113_0143446 | |||
| 1514 | Ga0496113_0293747 | |||
| 1515 | Ga0496114_0000570 | |||
| 1516 | Ga0496114_0004918 | |||
| 1517 | Ga0496114_0061489 | |||
| 1518 | Ga0496114_0088448 | |||
| 1519 | Ga0496114_0166008 | |||
| 1520 | Ga0496114_0255410 | |||
| 1521 | Ga0496115_0002884 | |||
| 1522 | Ga0496115_0004959 | |||
| 1523 | Ga0496115_0208173 | |||
| 1524 | Ga0501031_0147083 | |||
| 1525 | Ga0501032_0012379 | |||
| 1526 | Ga0501033_0009406 | |||
| 1527 | Ga0501033_0190359 | |||
| 1528 | Ga0501034_0033688 | |||
| 1529 | Ga0501036_0010250 | |||
| 1530 | Ga0501036_0039015 | |||
| 1531 | Ga0501036_0312940 | |||
| 1532 | Ga0501037_0018228 | |||
| 1533 | Ga0501037_0024816 | |||
| 1534 | Ga0501038_0008602 | |||
| 1535 | Ga0501038_0017471 | |||
| 1536 | Ga0501038_0069629 | |||
| 1537 | Ga0501039_0021594 | |||
| 1538 | Ga0501039_0204264 | |||
| 1539 | Ga0501040_0002954 | |||
| 1540 | Ga0501040_0008892 | |||
| 1541 | Ga0501040_0022680 | |||
| 1542 | Ga0501040_0237465 | |||
| 1543 | Ga0501041_0000642 | |||
| 1544 | Ga0501041_0021858 | |||
| 1545 | Ga0501041_0067773 | |||
| 1546 | Ga0501041_0165727 | |||
| 1547 | Ga0501042_0006076 | |||
| 1548 | Ga0501042_0020099 | |||
| 1549 | Ga0501042_0042560 | |||
| 1550 | Ga0501042_0128224 | |||
| 1551 | Ga0501043_0025395 | |||
| 1552 | Ga0501043_0152451 | |||
| 1553 | Ga0501046_0048628 | |||
| 1554 | Ga0501046_0234275 | |||
| 1555 | Ga0501047_0029693 | |||
| 1556 | Ga0501047_0055501 | |||
| 1557 | Ga0501048_0001465 | |||
| 1558 | Ga0501048_0007213 | |||
| 1559 | Ga0501048_0047071 | |||
| 1560 | Ga0501048_0292016 | |||
| 1561 | Ga0501067_0027487 | |||
| 1562 | Ga0501067_0106012 | |||
| 1563 | Ga0501067_0107308 | |||
| 1564 | Ga0501067_0113783 | |||
| 1565 | Ga0501068_0056923 | |||
| 1566 | Ga0501069_0002590 | |||
| 1567 | Ga0501069_0005484 | |||
| 1568 | Ga0501069_0022568 | |||
| 1569 | Ga0501069_0051075 | |||
| 1570 | Ga0501069_0099359 | |||
| 1571 | Ga0501069_0133021 | |||
| 1572 | Ga0501070_0000932 | |||
| 1573 | Ga0501070_0108300 | |||
| 1574 | Ga0501070_0148975 | |||
| 1575 | Ga0501070_0186256 | |||
| 1576 | Ga0501071_0000997 | |||
| 1577 | Ga0501071_0019993 | |||
| 1578 | Ga0501071_0039942 | |||
| 1579 | Ga0501071_0099787 | |||
| 1580 | Ga0501072_0003712 | |||
| 1581 | Ga0501072_0048785 | |||
| 1582 | Ga0501072_0069786 | |||
| 1583 | Ga0501072_0087033 | |||
| 1584 | Ga0501072_0210920 | |||
| 1585 | Ga0501073_0010424 | |||
| 1586 | Ga0501073_0145596 | |||
| 1587 | Ga0501074_0036015 | |||
| 1588 | Ga0501074_0088730 | |||
| 1589 | Ga0501074_0146768 | |||
| 1590 | Ga0501074_0163469 | |||
| 1591 | Ga0501074_0227578 | |||
| 1592 | Ga0501075_0017454 | |||
| 1593 | Ga0501075_0053219 | |||
| 1594 | Ga0501075_0246245 | |||
| 1595 | Ga0501076_0001003 | |||
| 1596 | Ga0501076_0004726 | |||
| 1597 | Ga0501076_0025881 | |||
| 1598 | Ga0501076_0201667 | |||
| 1599 | Ga0501076_0216028 | |||
| 1600 | Ga0501076_0335511 | |||
| 1601 | Ga0501077_0001414 | |||
| 1602 | Ga0501077_0034601 | |||
| 1603 | Ga0501077_0037976 | |||
| 1604 | Ga0501077_0094328 | |||
| 1605 | Ga0501079_0000515 | |||
| 1606 | Ga0501079_0011954 | |||
| 1607 | Ga0501079_0021415 | |||
| 1608 | Ga0501079_0056607 | |||
| 1609 | Ga0501079_0075187 | |||
| 1610 | Ga0501079_0097710 | |||
| 1611 | Ga0501079_0142814 | |||
| 1612 | Ga0501079_0150137 | |||
| 1613 | Ga0501080_0064210 | |||
| 1614 | Ga0501080_0130413 | |||
| 1615 | Ga0501080_0280372 | |||
| 1616 | Ga0501081_0004921 | |||
| 1617 | Ga0501081_0009112 | |||
| 1618 | Ga0501081_0025254 | |||
| 1619 | Ga0501081_0072488 | |||
| 1620 | Ga0501081_0115061 | |||
| 1621 | Ga0501081_0140695 | |||
| 1622 | Ga0501081_0178233 | |||
| 1623 | Ga0501083_0031724 | |||
| 1624 | Ga0501083_0044564 | |||
| 1625 | Ga0501035_0060975 | |||
| 1626 | Ga0501035_0123850 | |||
| 1627 | Ga0501035_0177045 | |||
| 1628 | Ga0501044_0005405 | |||
| 1629 | Ga0501044_0223057 | |||
| 1630 | Ga0501045_0006880 | |||
| 1631 | Ga0501045_0010910 | |||
| 1632 | Ga0501045_0044426 | |||
| 1633 | Ga0501045_0064086 | |||
| 1634 | Ga0501045_0066109 | |||
| 1635 | Ga0501045_0068604 | |||
| 1636 | Ga0501045_0101923 | |||
| 1637 | Ga0501045_0135880 | |||
| 1638 | nmdc:mga00v17_6506_c1 | |||
| 1639 | nmdc:mga05p37_129809_c1 | |||
| 1640 | nmdc:mga05p37_20055_c1 | |||
| 1641 | nmdc:mga05p37_259958_c1 | |||
| 1642 | nmdc:mga05p37_60110_c1 | |||
| 1643 | nmdc:mga09592_282492_c1 | |||
| 1644 | nmdc:mga09592_8847_c1 | |||
| 1645 | nmdc:mga0qj67_6754_c1 | |||
| 1646 | nmdc:mga06r32_4545_c1 | |||
| 1647 | nmdc:mga08y16_43344_c1 | |||
| 1648 | nmdc:mga08y16_4467_c1 | |||
| 1649 | nmdc:mga08y16_77133_c1 | |||
| 1650 | nmdc:mga0n895_3110_c1 | |||
| 1651 | nmdc:mga0n895_60199_c1 | |||
| 1652 | nmdc:mga0rr50_254865_c1 | |||
| 1653 | nmdc:mga0rr50_27411_c1 | |||
| 1654 | nmdc:mga0rr50_47732_c1 | |||
| 1655 | nmdc:mga0a205_377077_c1 | |||
| 1656 | Ga0495612_0007703 | |||
| 1657 | Ga0495612_0050201 | |||
| 1658 | Ga0495655_0002212 | |||
| 1659 | Ga0495619_0010604 | |||
| 1660 | Ga0495619_0134604 | |||
| 1661 | Ga0501084_0001865 | |||
| 1662 | Ga0501084_0021635 | |||
| 1663 | Ga0501084_0028358 | |||
| 1664 | Ga0501084_0111285 | |||
| 1665 | Ga0501084_0129986 | |||
| 1666 | Ga0501082_0000729 | |||
| 1667 | Ga0501082_0044683 | |||
| 1668 | Ga0501082_0083710 | |||
| 1669 | Ga0501082_0110525 | |||
| 1670 | Ga0501082_0274139 | |||
| 1671 | Ga0466962_0000661 | |||
| 1672 | Ga0466962_0009711 | |||
| 1673 | Ga0466962_0011442 | |||
| 1674 | Ga0530510_0004851 | |||
| 1675 | Ga0530510_0013682 | |||
| 1676 | Ga0530510_0023096 | |||
| 1677 | Ga0530510_0065130 | |||
| 1678 | Ga0530510_0164074 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ig1-assembly1.cif.gz_F | dna polymerase iv - dna ternary complex 10 | 0.9176 | 2 | 344 |
| 4r8u-assembly2.cif.gz_B | s-sad structure of dinb-dna complex | 0.9158 | 2 | 340 |
| 4q45-assembly1.cif.gz_F | dna polymerase- damaged dna complex | 0.9149 | 2 | 344 |
| 6ig1-assembly1.cif.gz_F | dna polymerase iv - dna ternary complex 10 | 0.9099 | 2 | 344 |
| 1im4-assembly1.cif.gz_A | crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus | 0.9094 | 2 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jx4A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.9641 | 78 | 164 | 3.30.70.270 |
| af_Q2FWZ5_4_63_3.40.1170.60 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.9626 | 13 | 71 | 3.40.1170.60 |
| 4ir1A02 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.9605 | 21 | 72 | 3.40.1170.60 |
| af_P34409_94_147_3.40.1170.60 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.9563 | 13 | 70 | 3.40.1170.60 |
| af_O74944_370_477_3.30.1490.100 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain | 0.9538 | 238 | 343 | 3.30.1490.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1E2E0-F1-model_v4 | UmuC domain-containing protein | 0.9862 | 8 | 84 |
GO:0003887
GO:0005829 GO:0009432 GO:0042276 |
| AF-A0A497EBQ7-F1-model_v4 | UmuC domain-containing protein | 0.9856 | 2 | 91 |
GO:0003887
GO:0005829 GO:0009432 GO:0042276 |
| AF-A0A2D5VMH9-F1-model_v4 | UmuC domain-containing protein | 0.981 | 2 | 108 |
GO:0003887
GO:0005829 GO:0009432 GO:0042276 |
| AF-A0A7C5IWZ1-F1-model_v4 | DNA polymerase IV | 0.9752 | 2 | 163 |
GO:0003887
GO:0042276 |
| AF-A3WZ00-F1-model_v4 | DNA-directed DNA polymerase (EC 2.7.7.7) | 0.973 | 238 | 343 |
GO:0003684
GO:0003887 GO:0005829 GO:0009432 GO:0042276 |