F482996

General Info

Members Datasets Scaffolds Average Seq Length
838 682 1676 264

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0011955|Ga0495610_0011955_728_1645
Length 305
Sequence MGKAVFGPPFLFCASVQRLQPCHISIFHDNSAVQILGSHTMFFRRTVLASLTAAMLSPLAAFAGSLPDLGGKTVVVVTENAYPPLQFVDPKSGQQIGWEYDAMNEIAKRLNFKVEYQNTSWDAMIQAVSDGQYNIGMTGITIKDDRKQKVDFSDPYMRSQQFMLVRGDEKRFTDAKSFGAFNDGLIGAQPGTSPFYTAVYEILDGNEQNPRIKLFETFGATVQALKTGDVDLVLTDSVAAKGYVDSSNGGLKVVGEPLGTEDFGFIFPKGSDLVAPVNAAIADLKADGTFDALNKKWFLDYKMGQ

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
36 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
39 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
40 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
41 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
42 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
43 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
78 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
86 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
141 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
144 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
152 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
153 2509276019 Ensifer aridi TW10 Isolate Nodule
154 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
155 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
156 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
157 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
158 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
159 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
160 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
161 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
162 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
163 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
164 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
165 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
166 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
167 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
168 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
169 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
170 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
171 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
172 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
173 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
174 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
175 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
176 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
177 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
178 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
179 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
180 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
181 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
182 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
183 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
184 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
185 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
186 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
187 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
188 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
189 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
190 2516143018 Ensifer sp. BR816 Isolate Nodule
191 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
192 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
193 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
194 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
195 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
196 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
197 2519899620 Rhizobium sp. Pop5 Isolate Nodule
198 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
199 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
200 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
201 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
202 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
203 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
204 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
205 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
206 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
207 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
208 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
209 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
210 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
211 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
212 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
213 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
214 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
215 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
216 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
217 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
218 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
219 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
220 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
221 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
222 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
223 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
224 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
225 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
226 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
227 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
228 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
229 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
230 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
231 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
232 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
233 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
234 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
235 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
236 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
237 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
238 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
239 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
240 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
241 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
242 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
243 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
244 2643221557 Ensifer sp. Root558 Isolate Unclassified
245 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
246 2643221580 Devosia sp. Root635 Isolate Unclassified
247 2643221599 Rhizobium sp. Root708 Isolate Unclassified
248 2643221607 Rhizobium sp. Root73 Isolate Unclassified
249 2643221610 Ensifer sp. Root74 Isolate Unclassified
250 2643221618 Ensifer sp. Root231 Isolate Unclassified
251 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
252 2643221626 Ensifer sp. Root31 Isolate Unclassified
253 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
254 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
255 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
256 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
257 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
258 2643221655 Ensifer sp. Root1252 Isolate Unclassified
259 2643221659 Ensifer sp. Root127 Isolate Unclassified
260 2643221668 Ensifer sp. Root423 Isolate Unclassified
261 2643221675 Ensifer sp. Root1298 Isolate Unclassified
262 2643221680 Ensifer sp. Root1312 Isolate Unclassified
263 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
264 2643221688 Rhizobium sp. Root482 Isolate Unclassified
265 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
266 2643221698 Ensifer sp. Root142 Isolate Unclassified
267 2643221712 Ensifer sp. Root258 Isolate Unclassified
268 2643221718 Rhizobium sp. Root268 Isolate Unclassified
269 2643221719 Rhizobium sp. Root274 Isolate Unclassified
270 2643221723 Ensifer sp. Root278 Isolate Unclassified
271 2643221726 Ensifer sp. Root954 Isolate Unclassified
272 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
273 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
274 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
275 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
276 2718217882 Rhizobium sp. N741 Isolate Nodule
277 2718217927 Rhizobium sp. N324 Isolate Nodule
278 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
279 2718218009 Rhizobium sp. N561 Isolate Nodule
280 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
281 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
282 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
283 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
284 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
285 2718218363 Rhizobium sp. N113 Isolate Nodule
286 2718218365 Rhizobium sp. N731 Isolate Nodule
287 2718218366 Rhizobium sp. N621 Isolate Nodule
288 2718218423 Rhizobium sp. N941 Isolate Nodule
289 2721755514 Rhizobium sp. N6212 Isolate Nodule
290 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
291 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
292 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
293 2721755809 Rhizobium sp. N541 Isolate Nodule
294 2721755810 Rhizobium sp. N871 Isolate Nodule
295 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
296 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
297 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
298 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
299 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
300 2728369365 Rhizobium sp. N1341 Isolate Nodule
301 2728369397 Rhizobium sp. N1314 Isolate Nodule
302 2738541293 Rhizobium sp. GV031 Isolate Unclassified
303 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
304 2738543024 Aminobacter sp. AP02 Isolate Unclassified
305 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
306 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
307 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
308 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
309 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
310 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
311 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
312 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
313 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
314 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
315 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
316 2791355256 Rhizobium sp. M10 Isolate Nodule
317 2791355260 Rhizobium sp. L9 Isolate Nodule
318 2791355261 Rhizobium sp. J15 Isolate Nodule
319 2791355262 Rhizobium sp. M1 Isolate Nodule
320 2791355264 Rhizobium sp. S9 Isolate Nodule
321 2791355265 Rhizobium sp. H4 Isolate Nodule
322 2791355266 Rhizobium sp. L43 Isolate Nodule
323 2791355267 Rhizobium sp. L18 Isolate Nodule
324 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
325 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
326 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
327 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
328 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
329 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
330 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
331 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
332 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
333 2802429633 Rhizobium anhuiense J3 Isolate Nodule
334 2802429634 Rhizobium anhuiense S10 Isolate Nodule
335 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
336 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
337 2802429637 Rhizobium anhuiense C15 Isolate Nodule
338 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
339 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
340 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
341 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
342 2838048938 Rhizobium pisi 27/80 Isolate Nodule
343 2838061910 Rhizobium phaseoli L15 Isolate Nodule
344 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
345 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
346 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
347 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
348 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
349 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
350 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
351 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
352 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
353 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
354 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
355 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
356 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
357 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
358 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
359 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
360 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
361 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
362 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
363 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
364 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
365 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
366 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
367 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
368 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
369 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
370 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
371 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
372 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
373 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
374 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
375 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
376 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
377 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
378 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
379 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
380 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
381 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
382 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
383 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
384 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
385 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
386 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
387 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
388 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
389 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
390 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
391 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
392 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
393 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
394 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
395 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
396 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
397 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
398 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
399 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
400 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
401 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
402 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
403 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
404 2844163670 Ensifer sp. 1H6 Isolate Unclassified
405 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
406 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
407 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
408 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
409 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
410 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
411 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
412 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
413 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
414 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
415 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
416 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
417 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
418 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
419 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
420 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
421 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
422 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
423 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
424 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
425 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
426 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
427 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
428 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
429 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
430 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
431 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
432 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
433 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
434 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
435 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
436 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
437 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
438 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
439 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
440 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
441 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
442 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
443 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
444 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
445 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
446 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
447 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
448 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
449 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
450 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
451 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
452 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
453 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
454 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
455 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
456 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
457 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
458 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
459 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
460 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
461 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
462 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
463 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
464 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
465 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
466 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
467 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
468 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
469 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
470 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
471 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
472 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
473 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
474 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
475 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
476 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
477 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
478 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
479 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
480 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
481 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
482 2933599457 Rhizobium phaseoli M3 Isolate Nodule
483 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
484 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
485 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
486 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
487 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
488 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
489 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
490 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
491 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
492 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
493 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
494 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
495 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
496 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
497 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
498 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
499 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
500 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
501 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
502 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
503 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
504 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
505 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
506 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
507 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
508 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
509 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
510 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
511 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
512 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
513 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
514 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
515 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
516 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
517 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
518 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
519 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
520 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
521 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
522 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
523 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
524 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
525 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
526 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
527 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
528 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
529 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
530 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
531 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
532 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
533 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
534 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
535 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
536 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
537 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
538 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
539 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
540 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
541 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
542 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
543 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
544 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
545 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
546 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
547 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
548 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
549 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
550 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
551 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
552 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
553 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
554 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
555 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
556 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
557 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
558 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
559 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
560 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
561 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
562 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
563 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
564 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
565 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
566 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
567 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
568 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
569 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
570 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
571 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
572 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
573 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
574 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
575 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
576 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
577 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
578 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
579 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
580 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
581 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
582 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
583 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
584 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
585 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
586 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
587 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
588 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
589 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
590 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
591 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
592 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
593 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
594 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
595 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
596 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
597 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
598 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
599 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
600 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
601 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
602 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
603 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
604 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
605 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
606 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
607 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
608 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
609 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
610 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
611 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
612 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
613 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
614 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
615 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
616 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
617 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
618 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
619 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
620 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
621 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
622 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
623 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
624 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
625 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
626 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
627 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
628 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
629 2996887358 Rhizobium sp. R711 Isolate Nodule
630 2996893221 Rhizobium sp. R635 Isolate Nodule
631 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
632 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
633 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
634 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
635 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
636 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
637 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
638 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
639 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
640 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
641 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
642 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
643 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
644 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
645 8005258706 Rhizobium sp. R693 Isolate Nodule
646 8005275841 Rhizobium sp. N4311 Isolate Nodule
647 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
648 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
649 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
650 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
651 8005321885 Rhizobium sp. R72 Isolate Nodule
652 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
653 8005382845 Rhizobium sp. R634 Isolate Nodule
654 8005395548 Rhizobium sp. R339 Isolate Nodule
655 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
656 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
657 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
658 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
659 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
660 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
661 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
662 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
663 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
664 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
665 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
666 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
667 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
668 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
669 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
670 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
671 8018176218 Rhizobium sp. N122 Isolate Nodule
672 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
673 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
674 8024501048 Rhizobium sp. H4 Isolate Nodule
675 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
676 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
677 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
678 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
679 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
680 8056382006 Rhizobium croatiense 13T Isolate Nodule
681 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
682 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.4
Metatranscriptomes 0
Isolates 63.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.26
Nodule 49.64
Rhizoplane 1.19
Rhizosphere 16.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0011955 3300046512 Bacteria 5263
2 JGI25158J39367_1000116 3300002739 Bacteria 18332
3 JGI25152J39213_1002074 3300002773 Bacteria 7887
4 JGI25152J39213_1002660 3300002773 Bacteria 6604
5 JGI25152J39213_1004780 3300002773 Bacteria 4157
6 JGI25152J39213_1005991 3300002773 Bacteria 3410
7 JGI25150J39212_1000037 3300002774 Bacteria 88885
8 JGI25150J39212_1006040 3300002774 Bacteria 2538
9 JGI25159J45721_1003134 3300002987 Bacteria 5952
10 JGI25151J46595_10000220 3300003187 Bacteria 67327
11 JGI25151J46595_10002488 3300003187 Bacteria 11010
12 JGI25151J46595_10006712 3300003187 Bacteria 5738
13 JGI25151J46595_10014115 3300003187 Bacteria 3573
14 JGI25151J46595_10016522 3300003187 Bacteria 3225
15 JGI25153J46596_10004090 3300003215 Bacteria 7933
16 JGI25153J46596_10007213 3300003215 Bacteria 5507
17 JGI25153J46596_10022145 3300003215 Bacteria 2351
18 JGI25153J46596_10036449 3300003215 Bacteria 1576
19 JGI25160J50197_1000027 3300003354 Bacteria 182809
20 JGI25160J50197_1000108 3300003354 Bacteria 77944
21 JGI25160J50197_1002336 3300003354 Bacteria 8877
22 JGI25160J50197_1004011 3300003354 Bacteria 6423
23 JGI25160J50197_1021541 3300003354 Bacteria 1913
24 JGI25161J50226_1000112 3300003374 Bacteria 63152
25 JGI25161J50226_1000327 3300003374 Bacteria 25949
26 JGI25161J50226_1000501 3300003374 Bacteria 17353
27 Ga0055526_1002678 3300003771 Bacteria 11896
28 Ga0055526_1011992 3300003771 Bacteria 3834
29 Ga0055526_1013569 3300003771 Bacteria 3432
30 Ga0055526_1018677 3300003771 Bacteria 2573
31 Ga0055526_1030183 3300003771 Bacteria 1588
32 Ga0055524_1004989 3300003775 Bacteria 6011
33 Ga0055524_1007541 3300003775 Bacteria 4602
34 Ga0055524_1017101 3300003775 Bacteria 2570
35 Ga0055524_1029614 3300003775 Bacteria 1614
36 Ga0055524_1035522 3300003775 Bacteria 1358
37 Ga0055536_1000999 3300003781 Bacteria 17954
38 Ga0055528_1000099 3300003790 Bacteria 68463
39 Ga0055528_1007426 3300003790 Bacteria 4849
40 Ga0055528_1016778 3300003790 Bacteria 2569
41 Ga0055528_1016941 3300003790 Bacteria 2549
42 Ga0055528_1025021 3300003790 Bacteria 1769
43 Ga0055540_1001518 3300003792 Bacteria 13685
44 Ga0055531_10006403 3300003794 Bacteria 6694
45 Ga0055543_1000030 3300004625 Bacteria 130849
46 Ga0055543_1000062 3300004625 Bacteria 98034
47 Ga0055543_1000080 3300004625 Bacteria 84865
48 Ga0055543_1000683 3300004625 Bacteria 17717
49 Ga0065165_1000122 3300005262 Bacteria 132524
50 Ga0065165_1002470 3300005262 Bacteria 15554
51 Ga0065165_1005804 3300005262 Bacteria 6736
52 Ga0065165_1021888 3300005262 Bacteria 2208
53 Ga0070682_100131782 3300005337 Bacteria 1693
54 Ga0070668_100213088 3300005347 Bacteria 1590
55 Ga0070669_100134573 3300005353 Bacteria 1900
56 Ga0070714_100610209 3300005435 Bacteria 1048
57 Ga0068853_100203017 3300005539 Bacteria 1804
58 Ga0070665_100036587 3300005548 Bacteria 4937
59 Ga0070665_100110964 3300005548 Bacteria 2745
60 Ga0081540_1096704 3300005983 Bacteria 1284
61 Ga0081539_10000437 3300005985 Bacteria 88848
62 Ga0075365_10014754 3300006038 Bacteria 4706
63 Ga0075365_10022020 3300006038 Bacteria 3985
64 Ga0075365_10036700 3300006038 Bacteria 3177
65 Ga0075365_10065525 3300006038 Bacteria 2435
66 Ga0075362_10031088 3300006177 Bacteria 2309
67 Ga0075367_10000317 3300006178 Bacteria 17069
68 Ga0075367_10028826 3300006178 Bacteria 3170
69 Ga0075369_10002260 3300006186 Bacteria 6838
70 Ga0075369_10003953 3300006186 Bacteria 5434
71 Ga0075369_10018325 3300006186 Bacteria 2849
72 Ga0075366_10007998 3300006195 Bacteria 5858
73 Ga0075366_10281865 3300006195 Bacteria 1016
74 Ga0075370_10008448 3300006353 Bacteria 5300
75 Ga0105238_10021951 3300009551 Bacteria 6503
76 Ga0123342_1005742 3300009766 Bacteria 17739
77 Ga0157369_10219682 3300013105 Bacteria 1989
78 Ga0171463_1004 3300013249 Bacteria 437207
79 Ga0183363_1019 3300015690 Bacteria 61083
80 Ga0163161_10641046 3300017792 Bacteria 879
81 Ga0214544_1000079 3300021320 Bacteria 121742
82 Ga0214542_1000064 3300021321 Bacteria 127681
83 Ga0214543_1000015 3300021327 Bacteria 305679
84 Ga0214543_1000063 3300021327 Bacteria 127694
85 Ga0228711_1000004 3300022739 Bacteria 250146
86 Ga0228710_1000002 3300022740 Bacteria 287279
87 Ga0209436_100018 3300025208 Bacteria 113499
88 Ga0209436_100540 3300025208 Bacteria 16420
89 Ga0207425_1000034 3300025245 Bacteria 227886
90 Ga0207425_1003134 3300025245 Bacteria 5429
91 Ga0207425_1006854 3300025245 Bacteria 3074
92 Ga0209129_1000118 3300025258 Bacteria 139972
93 Ga0209129_1000253 3300025258 Bacteria 55709
94 Ga0209129_1001394 3300025258 Bacteria 13509
95 Ga0209129_1004326 3300025258 Bacteria 5612
96 Ga0209129_1004708 3300025258 Bacteria 5183
97 Ga0209129_1005410 3300025258 Bacteria 4535
98 Ga0209233_1000118 3300025261 Bacteria 236172
99 Ga0209673_1000033 3300025273 Bacteria 335369
100 Ga0209673_1000050 3300025273 Bacteria 285287
101 Ga0209673_1000052 3300025273 Bacteria 279795
102 Ga0209673_1004592 3300025273 Bacteria 7322
103 Ga0209673_1012521 3300025273 Bacteria 3410
104 Ga0209130_1000009 3300025284 Bacteria 498952
105 Ga0209130_1000027 3300025284 Bacteria 327700
106 Ga0209130_1000108 3300025284 Bacteria 133733
107 Ga0209130_1009914 3300025284 Bacteria 2668
108 Ga0209675_1013892 3300025291 Bacteria 2485
109 Ga0209676_1000406 3300025292 Bacteria 77603
110 Ga0209676_1013267 3300025292 Bacteria 3180
111 Ga0209025_1000042 3300025294 Bacteria 370577
112 Ga0209025_1000241 3300025294 Bacteria 128329
113 Ga0209025_1000335 3300025294 Bacteria 103615
114 Ga0209025_1000533 3300025294 Bacteria 72404
115 Ga0209025_1002567 3300025294 Bacteria 18887
116 Ga0209025_1006540 3300025294 Bacteria 8995
117 Ga0209025_1013261 3300025294 Bacteria 5196
118 Ga0209025_1016446 3300025294 Bacteria 4362
119 Ga0209025_1034149 3300025294 Bacteria 2331
120 Ga0209025_1036512 3300025294 Bacteria 2199
121 Ga0209025_1049902 3300025294 Bacteria 1678
122 Ga0209564_1000111 3300025295 Bacteria 212210
123 Ga0209564_1001330 3300025295 Bacteria 26421
124 Ga0209564_1002296 3300025295 Bacteria 15576
125 Ga0209564_1006715 3300025295 Bacteria 6114
126 Ga0209564_1008393 3300025295 Bacteria 5102
127 Ga0209758_1000415 3300025297 Bacteria 72404
128 Ga0209758_1000896 3300025297 Bacteria 40464
129 Ga0209758_1001085 3300025297 Bacteria 35309
130 Ga0209758_1001086 3300025297 Bacteria 35300
131 Ga0209758_1001936 3300025297 Bacteria 22483
132 Ga0209758_1002583 3300025297 Bacteria 18175
133 Ga0209758_1028435 3300025297 Bacteria 2365
134 Ga0209050_1000572 3300025298 Bacteria 59716
135 Ga0209050_1012928 3300025298 Bacteria 3774
136 Ga0209256_1000773 3300025299 Bacteria 41485
137 Ga0209256_1001743 3300025299 Bacteria 20757
138 Ga0209256_1003248 3300025299 Bacteria 11690
139 Ga0209256_1003365 3300025299 Bacteria 11320
140 Ga0209256_1003400 3300025299 Bacteria 11219
141 Ga0209256_1018539 3300025299 Bacteria 2255
142 Ga0209256_1056246 3300025299 Bacteria 931
143 Ga0207426_1000041 3300025302 Bacteria 433536
144 Ga0207426_1000072 3300025302 Bacteria 327700
145 Ga0207426_1000082 3300025302 Bacteria 298939
146 Ga0207426_1000348 3300025302 Bacteria 85294
147 Ga0207426_1001232 3300025302 Bacteria 22539
148 Ga0209051_1000276 3300025303 Bacteria 84192
149 Ga0209051_1004620 3300025303 Bacteria 8387
150 Ga0209051_1005303 3300025303 Bacteria 7589
151 Ga0209051_1006579 3300025303 Bacteria 6520
152 Ga0209051_1009103 3300025303 Bacteria 5157
153 Ga0209051_1052278 3300025303 Bacteria 1351
154 Ga0209257_1002707 3300025304 Bacteria 16894
155 Ga0209257_1015856 3300025304 Bacteria 3095
156 Ga0209257_1038047 3300025304 Bacteria 1461
157 Ga0209257_1056454 3300025304 Bacteria 1084
158 Ga0207696_1050324 3300025711 Bacteria 1193
159 Ga0207671_10181999 3300025914 Bacteria 1636
160 Ga0207681_10170660 3300025923 Bacteria 1648
161 Ga0207711_10430652 3300025941 Bacteria 1227
162 Ga0207639_10032663 3300026041 Bacteria 3833
163 Ga0207674_10140735 3300026116 Bacteria 2372
164 Ga0209281_1000030 3300027111 Bacteria 425931
165 Ga0209281_1000144 3300027111 Bacteria 172471
166 Ga0209282_1000004 3300027666 Bacteria 425931
167 Ga0268266_10041961 3300028379 Bacteria 3906
168 Ga0307515_10004852 3300028794 Bacteria 27508
169 Ga0307515_10016477 3300028794 Bacteria 13524
170 Ga0307515_10046110 3300028794 Bacteria 6674
171 Ga0307513_10015506 3300031456 Bacteria 9237
172 Ga0307408_100300646 3300031548 Bacteria 1344
173 Ga0307405_10008039 3300031731 Bacteria 5320
174 Ga0307405_10427802 3300031731 Bacteria 1044
175 Ga0307405_10444833 3300031731 Bacteria 1026
176 Ga0307410_10634941 3300031852 Bacteria 894
177 Ga0307406_10083526 3300031901 Bacteria 2130
178 Ga0307406_10312496 3300031901 Bacteria 1212
179 Ga0307412_10005736 3300031911 Bacteria 6978
180 Ga0315914_1000001 3300031967 Bacteria 416633
181 Ga0307414_10020503 3300032004 Bacteria 4121
182 Ga0315913_1000004 3300033430 Bacteria 192741
183 Ga0315915_1000002 3300033464 Bacteria 425854
184 Ga0395899_0119551 3300037312 Bacteria 1889
185 Ga0395905_0043406 3300037471 Bacteria 4218
186 Ga0395905_0611702 3300037471 Bacteria 992
187 Ga0439436_0007896 3300041404 Bacteria 3269
188 Ga0439436_0011975 3300041404 Bacteria 2633
189 Ga0439465_0016957 3300041413 Bacteria 2273
190 Ga0439465_0026848 3300041413 Bacteria 1822
191 Ga0439465_0070100 3300041413 Bacteria 1174
192 Ga0451793_0969719 3300041452 Bacteria 1015
193 Ga0451798_0568173 3300041458 Bacteria 2888
194 Ga0451835_0384467 3300041492 Bacteria 1872
195 Ga0451837_1373485 3300041494 Bacteria 1840
196 Ga0451843_1206718 3300041509 Bacteria 2672
197 Ga0451855_0379872 3300041511 Bacteria 3237
198 Ga0451855_1098397 3300041511 Bacteria 5936
199 Ga0450920_004471 3300042122 Bacteria 2458
200 Ga0439434_0044592 3300042435 Bacteria 1367
201 Ga0453684_0010894 3300044712 Bacteria 15397
202 Ga0451576_0014874 3300045051 Bacteria 8646
203 Ga0495638_0006475 3300046460 Bacteria 8514
204 Ga0495638_0023906 3300046460 Bacteria 3991
205 Ga0495585_0073526 3300046492 Bacteria 1861
206 Ga0495607_0040411 3300046501 Bacteria 2777
207 Ga0495606_0113796 3300046507 Bacteria 1628
208 Ga0495610_0049789 3300046512 Bacteria 2049
209 Ga0495610_0056328 3300046512 Bacteria 1890
210 Ga0495620_0076939 3300046515 Bacteria 1355
211 Ga0495632_0006155 3300046519 Bacteria 7773
212 Ga0495643_0006495 3300046522 Bacteria 7693
213 Ga0495643_0079013 3300046522 Bacteria 1716
214 Ga0495668_0129856 3300046616 Bacteria 1379
215 Ga0495625_0066025 3300046660 Bacteria 2549
216 Ga0495670_0120460 3300046691 Bacteria 1362
217 Ga0495649_0063067 3300046694 Bacteria 1992
218 Ga0495660_0122995 3300046810 Bacteria 1310
219 Ga0495681_0119032 3300047470 Bacteria 1135
220 Ga0495686_0045926 3300047472 Bacteria 2762
221 Ga0495615_0006146 3300048090 Bacteria 2206
222 Ga0496106_0065953 3300048909 Bacteria 2756
223 Ga0496116_0005573 3300048919 Bacteria 11611
224 Ga0496116_0039438 3300048919 Bacteria 3266
225 Ga0496116_0055483 3300048919 Bacteria 2602
226 Ga0496116_0062249 3300048919 Bacteria 2410
227 Ga0496117_0005347 3300048920 Bacteria 13534
228 Ga0496117_0184377 3300048920 Bacteria 1196
229 Ga0496118_0062412 3300048921 Bacteria 2751
230 Ga0496121_0026756 3300048924 Bacteria 5420
231 Ga0496121_0037832 3300048924 Bacteria 4280
232 Ga0496121_0056879 3300048924 Bacteria 3245
233 Ga0496121_0073205 3300048924 Bacteria 2747
234 Ga0496121_0075319 3300048924 Bacteria 2696
235 Ga0496122_0000984 3300048925 Bacteria 50862
236 Ga0496122_0007522 3300048925 Bacteria 12072
237 Ga0496122_0051249 3300048925 Bacteria 3138
238 Ga0496122_0065256 3300048925 Bacteria 2641
239 Ga0496122_0095266 3300048925 Bacteria 2012
240 Ga0496123_0000290 3300048926 Bacteria 98053
241 Ga0496123_0029681 3300048926 Bacteria 4017
242 Ga0496123_0060665 3300048926 Bacteria 2437
243 Ga0496123_0102445 3300048926 Bacteria 1661
244 Ga0496124_0014171 3300048927 Bacteria 7724
245 Ga0496124_0036175 3300048927 Bacteria 4310
246 Ga0496124_0069034 3300048927 Bacteria 2935
247 Ga0496124_0087958 3300048927 Bacteria 2540
248 Ga0496124_0252478 3300048927 Bacteria 1303
249 Ga0496125_0007081 3300048928 Bacteria 11973
250 Ga0496125_0043126 3300048928 Bacteria 3834
251 Ga0496126_0001347 3300048929 Bacteria 38995
252 Ga0501031_0000022 3300049568 Bacteria 92471
253 Ga0501031_0056657 3300049568 Bacteria 2553
254 Ga0501032_0000063 3300049569 Bacteria 92497
255 Ga0501033_0000073 3300049570 Bacteria 94880
256 Ga0501033_0015770 3300049570 Bacteria 5728
257 Ga0501034_0000276 3300049571 Bacteria 92497
258 Ga0501034_0013832 3300049571 Bacteria 8306
259 Ga0501034_0021121 3300049571 Bacteria 6642
260 Ga0501034_0118266 3300049571 Bacteria 2637
261 Ga0501034_0293216 3300049571 Bacteria 1564
262 Ga0501036_0000030 3300049572 Bacteria 92497
263 Ga0501036_0378099 3300049572 Bacteria 1182
264 Ga0501037_0000075 3300049573 Bacteria 92499
265 Ga0501037_0014494 3300049573 Bacteria 5800
266 Ga0501037_0046195 3300049573 Bacteria 3194
267 Ga0501038_0000058 3300049574 Bacteria 92497
268 Ga0501038_0190092 3300049574 Bacteria 1652
269 Ga0501039_0000054 3300049575 Bacteria 92497
270 Ga0501040_0017164 3300049576 Bacteria 4804
271 Ga0501040_0075093 3300049576 Bacteria 2336
272 Ga0501042_0026607 3300049578 Bacteria 4064
273 Ga0501043_0001296 3300049579 Bacteria 21934
274 Ga0501043_0100843 3300049579 Bacteria 2269
275 Ga0501047_0001489 3300049581 Bacteria 22827
276 Ga0501047_0073759 3300049581 Bacteria 3285
277 Ga0501047_0158719 3300049581 Bacteria 2134
278 Ga0501047_0183270 3300049581 Bacteria 1960
279 Ga0501069_0127753 3300049585 Bacteria 1455
280 Ga0501071_0437265 3300049587 Bacteria 1001
281 Ga0501073_0136355 3300049589 Bacteria 1701
282 Ga0501083_0206329 3300049744 Bacteria 1281
283 Ga0501035_0000126 3300049822 Bacteria 92497
284 Ga0501044_0000131 3300049823 Bacteria 92497
285 Ga0501044_0015879 3300049823 Bacteria 8104
286 Ga0501044_0090842 3300049823 Bacteria 3080
287 nmdc:mga03683_15806_c1 3300050489 Bacteria 2824
288 nmdc:mga0yw44_40693_c1 3300050492 Bacteria 2763
289 nmdc:mga0k408_270063_c1 3300050493 Bacteria 1015
290 nmdc:mga0k408_54773_c1 3300050493 Bacteria 2312
291 nmdc:mga07m45_18041_c1 3300050496 Bacteria 3801
292 nmdc:mga0sz30_26139_c1 3300050516 Bacteria 2391
293 Ga0500578_0125816 3300053086 Bacteria 1609
294 Ga0500643_003112 3300053087 Bacteria 8145
295 Ga0500569_030273 3300053109 Bacteria 1513
296 Ga0500607_133288 3300053121 Bacteria 1181
297 Ga0500658_0000735 3300053134 Bacteria 13496
298 Ga0500616_0004669 3300053153 Bacteria 9655
299 Ga0500616_0014226 3300053153 Bacteria 4579
300 Ga0500616_0015830 3300053153 Bacteria 4305
301 Ga0500616_0139567 3300053153 Bacteria 1134
302 Ga0500622_0008199 3300053156 Bacteria 5866
303 Ga0500627_0087185 3300053158 Bacteria 1395
304 Ga0500634_0004706 3300053161 Bacteria 6366
305 Ga0501082_0240195 3300060353 Bacteria 1576
306 2509109599 2508501122 Bacteria 6292184
307 2509143193 2508501127 Bacteria 7037543
308 2509378077 2509276019 Bacteria 6802256
309 2510135246 2510065019 Bacteria 6903379
310 2510306733 2510065057 Bacteria 6649661
311 2510840479 2510461069 Bacteria 5505000
312 2510896701 2510461076 Bacteria 8618824
313 2511133885 2510917022 Bacteria 6504556
314 2511172964 2510917026 Bacteria 7046020
315 2511184000 2510917028 Bacteria 6185411
316 2511194602 2510917030 Bacteria 7460662
317 2511391807 2511231027 Bacteria 5013807
318 2511498502 2511231052 Bacteria 6974333
319 2512534644 2512047086 Bacteria 6850303
320 2512973548 2512875026 Bacteria 6861065
321 2513571630 2513237084 Bacteria 7231967
322 2513578664 2513237085 Bacteria 7695351
323 2513583664 2513237086 Bacteria 7265287
324 2513596830 2513237088 Bacteria 6927906
325 2513601933 2513237089 Bacteria 6553624
326 2513614174 2513237090 Bacteria 7096802
327 2513615737 2513237091 Bacteria 6900273
328 2513630151 2513237093 Bacteria 7545552
329 2513711350 2513237103 Bacteria 7647401
330 2513867482 2513237138 Bacteria 7368160
331 2513884966 2513237140 Bacteria 7076289
332 2513905176 2513237143 Bacteria 6664116
333 2513912379 2513237144 Bacteria 7530820
334 2513928434 2513237146 Bacteria 7166346
335 2513998492 2513237159 Bacteria 6810126
336 2514003467 2513237160 Bacteria 6650282
337 2514019401 2513237162 Bacteria 7468464
338 2514586660 2513237351 Bacteria 6968952
339 2515114404 2515075009 Bacteria 7288508
340 2515611077 2515154107 Bacteria 6795637
341 2515635408 2515154113 Bacteria 7807172
342 2515643184 2515154114 Bacteria 7848616
343 2515657648 2515154116 Bacteria 7552979
344 2515741589 2515154134 Bacteria 7220242
345 2516205544 2516143018 Bacteria 6951533
346 2516894783 2516653046 Bacteria 6989037
347 2517038055 2516653077 Bacteria 7555578
348 2517078319 2516653085 Bacteria 7346596
349 2517097078 2517093000 Bacteria 7412387
350 2517408538 2517287029 Bacteria 6905599
351 2517571448 2517487022 Bacteria 7227575
352 2520379693 2519899620 Bacteria 6499161
353 2524450406 2524023207 Bacteria 6813453
354 2530647350 2529292951 Bacteria 6916614
355 2535519025 2534681796 Bacteria 7146037
356 2551676637 2551306084 Bacteria 8942552
357 2551680261 2551306084 Bacteria 8942552
358 2551685091 2551306085 Bacteria 7347181
359 2551694493 2551306086 Bacteria 6843938
360 2551697716 2551306087 Bacteria 7351905
361 2551708371 2551306089 Bacteria 7162724
362 2551717621 2551306090 Bacteria 7953713
363 2551731622 2551306091 Bacteria 7086830
364 2551736206 2551306092 Bacteria 6992595
365 2551746067 2551306093 Bacteria 7064773
366 2558867423 2558860100 Bacteria 8458965
367 2561467110 2558860983 Bacteria 4133860
368 2585166728 2582581283 Bacteria 6030556
369 2585201736 2582581294 Bacteria 6626667
370 2585223924 2582581298 Bacteria 7315509
371 2585228736 2582581299 Bacteria 6518058
372 2585257586 2582581304 Bacteria 5831370
373 2585266935 2582581306 Bacteria 6450535
374 2585271675 2582581307 Bacteria 6597605
375 2585387976 2582581865 Bacteria 6644329
376 2585396067 2582581866 Bacteria 6859583
377 2585399751 2582581867 Bacteria 7184437
378 2585526043 2585427526 Bacteria 7258840
379 2585540779 2585427528 Bacteria 6842387
380 2585549147 2585427529 Bacteria 7395659
381 2585563085 2585427531 Bacteria 6992870
382 2585820838 2585427590 Bacteria 6824633
383 2585839049 2585427593 Bacteria 7141551
384 2585844882 2585427594 Bacteria 6180594
385 2585902861 2585427608 Bacteria 6544331
386 2585907302 2585427609 Bacteria 6667127
387 2585997788 2585427633 Bacteria 6413184
388 2586002373 2585427634 Bacteria 6455027
389 2587982704 2585428125 Bacteria 6662905
390 2597811926 2597489875 Bacteria 7010078
391 2599335096 2599185156 Bacteria 5403036
392 2599420144 2599185170 Bacteria 7295545
393 2599936988 2599185301 Bacteria 6161860
394 2600193376 2599185352 Bacteria 7228948
395 2600373233 2600254933 Bacteria 4750527
396 2616296314 2615840624 Bacteria 6557588
397 2643771528 2643221550 Bacteria 4619371
398 2643777247 2643221551 Bacteria 3750538
399 2643795695 2643221555 Bacteria 3749717
400 2643808074 2643221557 Bacteria 7184309
401 2643836728 2643221564 Bacteria 4193379
402 2643911132 2643221580 Bacteria 3816678
403 2644002474 2643221599 Bacteria 6292121
404 2644052042 2643221607 Bacteria 6314006
405 2644068737 2643221610 Bacteria 7480339
406 2644110143 2643221618 Bacteria 7717186
407 2644131583 2643221623 Bacteria 5239945
408 2644150419 2643221626 Bacteria 8069654
409 2644194819 2643221634 Bacteria 6705461
410 2644201401 2643221636 Bacteria 6583769
411 2644209458 2643221637 Bacteria 5345260
412 2644240501 2643221643 Bacteria 5749658
413 2644299793 2643221653 Bacteria 4569637
414 2644313023 2643221655 Bacteria 7722067
415 2644336571 2643221659 Bacteria 7890716
416 2644379508 2643221668 Bacteria 7306521
417 2644419807 2643221675 Bacteria 7473456
418 2644453164 2643221680 Bacteria 7473610
419 2644484494 2643221686 Bacteria 6310811
420 2644493086 2643221688 Bacteria 5260751
421 2644499284 2643221689 Bacteria 6042950
422 2644546218 2643221698 Bacteria 7756764
423 2644618753 2643221712 Bacteria 7729434
424 2644652986 2643221718 Bacteria 5345506
425 2644658020 2643221719 Bacteria 4568197
426 2644677102 2643221723 Bacteria 7095460
427 2644688808 2643221726 Bacteria 7455827
428 2657682384 2657244999 Bacteria 5946535
429 2692319968 2690316117 Bacteria 6800650
430 2694631597 2693429783 Bacteria 7019804
431 2694638349 2693429784 Bacteria 7241525
432 2719182964 2718217882 Bacteria 6556348
433 2719387677 2718217927 Bacteria 6972593
434 2719667309 2718217997 Bacteria 6740740
435 2719733681 2718218009 Bacteria 6478651
436 2720493729 2718218199 Bacteria 6740745
437 2720615182 2718218232 Bacteria 6720332
438 2720621977 2718218233 Bacteria 6662049
439 2720633327 2718218235 Bacteria 6630699
440 2720777025 2718218269 Bacteria 6906114
441 2721149076 2718218363 Bacteria 6524337
442 2721160474 2718218365 Bacteria 6274507
443 2721165889 2718218366 Bacteria 6425255
444 2721401311 2718218423 Bacteria 6438183
445 2722842059 2721755514 Bacteria 6424414
446 2723028623 2721755556 Bacteria 6745503
447 2723562227 2721755684 Bacteria 6859907
448 2723568930 2721755685 Bacteria 6704835
449 2724040125 2721755809 Bacteria 6438790
450 2724046437 2721755810 Bacteria 6479005
451 2724091632 2721755819 Bacteria 6906405
452 2724106195 2721755822 Bacteria 6726041
453 2724112001 2721755823 Bacteria 6752556
454 2725947538 2724679232 Bacteria 7646494
455 2730109559 2728369352 Bacteria 6745171
456 2730166199 2728369365 Bacteria 6555560
457 2730300106 2728369397 Bacteria 6274511
458 2738805940 2738541293 Bacteria 7065685
459 2739037276 2738541333 Bacteria 7106503
460 2739306062 2738543024 Bacteria 5603683
461 2753462471 2751185821 Bacteria 6189929
462 2765465700 2765235802 Bacteria 5618596
463 2766064267 2765235942 Bacteria 7445910
464 2770198347 2767802442 Bacteria 5747986
465 2776269597 2775506902 Bacteria 6208009
466 2776282528 2775506904 Bacteria 5954060
467 2776915590 2775507049 Bacteria 6284736
468 2792582266 2791355082 Bacteria 5973319
469 2792621929 2791355091 Bacteria 6135441
470 2792628814 2791355092 Bacteria 6248105
471 2792640000 2791355094 Bacteria 7011481
472 2793295627 2791355256 Bacteria 6798008
473 2793320721 2791355260 Bacteria 6598818
474 2793327284 2791355261 Bacteria 6661293
475 2793332238 2791355262 Bacteria 6774204
476 2793346601 2791355264 Bacteria 6429314
477 2793353860 2791355265 Bacteria 6539969
478 2793359395 2791355266 Bacteria 7116587
479 2793365905 2791355267 Bacteria 7222458
480 2802717184 2802428858 Bacteria 6636079
481 2802724827 2802428859 Bacteria 6667919
482 2802729578 2802428860 Bacteria 6525526
483 2802736924 2802428861 Bacteria 6534206
484 2802743329 2802428862 Bacteria 6633353
485 2802749545 2802428863 Bacteria 6410669
486 2804753723 2802429268 Bacteria 6094027
487 2805926216 2802429605 Bacteria 6875453
488 2805933942 2802429606 Bacteria 6346811
489 2806047367 2802429633 Bacteria 7341974
490 2806054222 2802429634 Bacteria 7083200
491 2806060194 2802429635 Bacteria 7650140
492 2806068805 2802429636 Bacteria 7597525
493 2806076411 2802429637 Bacteria 7067217
494 2819244578 2818991272 Bacteria 4622173
495 2838018331 2838016132 Bacteria 6577831
496 2838024014 2838022645 Bacteria 6494267
497 2838040351 2838035591 Bacteria 7166484
498 2838050807 2838048938 Bacteria 6044578
499 2838062573 2838061910 Bacteria 6794874
500 2838072124 2838068647 Bacteria 6208656
501 2838078192 2838074704 Bacteria 6785777
502 2838667766 2838661181 Bacteria 7385261
503 2838672165 2838668709 Bacteria 6671819
504 2838683878 2838680041 Bacteria 6545511
505 2838690282 2838686498 Bacteria 7807632
506 2838698406 2838694306 Bacteria 6853137
507 2838704965 2838701080 Bacteria 6669771
508 2838711521 2838707686 Bacteria 6619912
509 2838732057 2838729681 Bacteria 7400765
510 2838744953 2838742623 Bacteria 7396178
511 2839993343 2839993093 Bacteria 5512535
512 2840766344 2840764183 Bacteria 6358399
513 2841736712 2841734538 Bacteria 6784580
514 2841856011 2841851746 Bacteria 7532261
515 2841867759 2841864319 Bacteria 6742987
516 2842081322 2842077413 Bacteria 6508645
517 2842116854 2842110456 Bacteria 7656360
518 2842121901 2842118031 Bacteria 7033875
519 2842148799 2842146304 Bacteria 5957337
520 2842161181 2842156927 Bacteria 6894975
521 2842166693 2842163707 Bacteria 6916235
522 2842184797 2842180545 Bacteria 6888678
523 2842194881 2842192696 Bacteria 6147454
524 2842201607 2842198810 Bacteria 6608673
525 2842207420 2842205361 Bacteria 6340321
526 2842221780 2842217011 Bacteria 7497767
527 2842232379 2842229732 Bacteria 7475766
528 2842240915 2842237096 Bacteria 6620661
529 2842246795 2842243621 Bacteria 7421798
530 2842254646 2842250916 Bacteria 6579627
531 2842261104 2842257432 Bacteria 7401195
532 2842269639 2842264693 Bacteria 6472963
533 2842274302 2842271015 Bacteria 7807131
534 2842280869 2842278818 Bacteria 6340002
535 2842288519 2842285085 Bacteria 6011953
536 2842294979 2842291075 Bacteria 7076806
537 2842305855 2842304105 Bacteria 7023636
538 2842311411 2842311132 Bacteria 6616990
539 2842321112 2842317721 Bacteria 6793725
540 2842366272 2842363717 Bacteria 6844742
541 2842375003 2842370503 Bacteria 7038661
542 2842381378 2842377471 Bacteria 7140707
543 2842388448 2842384541 Bacteria 7057858
544 2842395944 2842395702 Bacteria 6780583
545 2842406135 2842402390 Bacteria 6681310
546 2842412720 2842409023 Bacteria 6687331
547 2842419401 2842415677 Bacteria 6596907
548 2842425756 2842422224 Bacteria 6239196
549 2842433599 2842428310 Bacteria 6767288
550 2842439927 2842434925 Bacteria 6502746
551 2842446556 2842441272 Bacteria 6769273
552 2842448780 2842447887 Bacteria 6754142
553 2842467935 2842462802 Bacteria 6588055
554 2842474536 2842469257 Bacteria 6752936
555 2842491165 2842489311 Bacteria 6620893
556 2842498502 2842495871 Bacteria 6820686
557 2842511704 2842509118 Bacteria 6850950
558 2842524479 2842521101 Bacteria 6569494
559 2842873960 2842871566 Bacteria 4827117
560 2844166231 2844163670 Bacteria 7266046
561 2844457019 2844454524 Bacteria 7952546
562 2847420809 2847417321 Bacteria 6913799
563 2848995634 2848992105 Bacteria 6810864
564 2850082662 2850079185 Bacteria 6848280
565 2854901715 2854896431 Bacteria 5869725
566 2854919487 2854916844 Bacteria 5725939
567 2855827413 2855825444 Bacteria 6785811
568 2855842789 2855839649 Bacteria 7135830
569 2855878172 2855872281 Bacteria 6964271
570 2856342589 2856342000 Bacteria 7176905
571 2857519574 2857516855 Bacteria 7787325
572 2858802127 2858800743 Bacteria 6603254
573 2871479461 2871474448 Bacteria 6806570
574 2876383026 2876377896 Bacteria 6565995
575 2876399234 2876392853 Bacteria 6660880
576 2878742100 2878738818 Bacteria 7136951
577 2881165333 2881161766 Bacteria 7127907
578 2885307189 2885305155 Bacteria 7348390
579 2885332456 2885326080 Bacteria 7134805
580 2885339500 2885334103 Bacteria 7216818
581 2888344699 2888343758 Bacteria 6611049
582 2889791502 2889790730 Bacteria 5689708
583 2889917247 2889914905 Bacteria 5702301
584 2891373893 2891373044 Bacteria 5202277
585 2894653786 2894652903 Bacteria 4587256
586 2896390221 2896384573 Bacteria 7700774
587 2904580008 2904578770 Bacteria 5302906
588 2904665761 2904659560 Bacteria 6685615
589 2913300265 2913295892 Bacteria 6333755
590 2915982397 2915980308 Bacteria 6624279
591 2915988808 2915986958 Bacteria 6739310
592 2915999350 2915993759 Bacteria 7016183
593 2916003799 2916000859 Bacteria 6865702
594 2916010617 2916007675 Bacteria 6898660
595 2916018169 2916014648 Bacteria 6946486
596 2916023845 2916021584 Bacteria 6854472
597 2916031048 2916028427 Bacteria 6748433
598 2916040412 2916035215 Bacteria 6755766
599 2916045392 2916041962 Bacteria 6820487
600 2916050728 2916048683 Bacteria 6543552
601 2916056775 2916055098 Bacteria 6758838
602 2916064983 2916061851 Bacteria 6737736
603 2916070887 2916068649 Bacteria 6943657
604 2916080591 2916076590 Bacteria 6596108
605 2919105387 2919100787 Bacteria 7710546
606 2919120321 2919119836 Bacteria 5208557
607 2920760347 2920760137 Bacteria 7427611
608 2920825923 2920822456 Bacteria 6897201
609 2921207981 2921201388 Bacteria 6926299
610 2921209891 2921208531 Bacteria 6745326
611 2921239794 2921237296 Bacteria 6876710
612 2921249053 2921244191 Bacteria 6568419
613 2921252907 2921250672 Bacteria 6677771
614 2921260215 2921257292 Bacteria 6808382
615 2921266324 2921263974 Bacteria 6864552
616 2921286979 2921282425 Bacteria 6826397
617 2921295951 2921289301 Bacteria 7316391
618 2923559488 2923556063 Bacteria 6793593
619 2924149524 2924144063 Bacteria 6883928
620 2924157575 2924150972 Bacteria 7169444
621 2924163215 2924158325 Bacteria 7188855
622 2924167750 2924165586 Bacteria 7260590
623 2924174222 2924172951 Bacteria 6749356
624 2924181871 2924179722 Bacteria 6843264
625 2924187828 2924186466 Bacteria 6876637
626 2924193570 2924193448 Bacteria 6955718
627 2924201754 2924200457 Bacteria 6757188
628 2924207705 2924207177 Bacteria 6917007
629 2924219351 2924214083 Bacteria 7080103
630 2924223455 2924221636 Bacteria 7113495
631 2924234121 2924228884 Bacteria 6633132
632 2924758891 2924754689 Bacteria 6774424
633 2924768560 2924762789 Bacteria 6561353
634 2924779784 2924776078 Bacteria 7492003
635 2933017667 2933016740 Bacteria 6355406
636 2933572360 2933570622 Bacteria 7023390
637 2933593141 2933586486 Bacteria 7667493
638 2933603023 2933599457 Bacteria 5858799
639 2935897943 2935894831 Bacteria 6620579
640 2935903635 2935901341 Bacteria 7341747
641 2936369889 2936367885 Bacteria 7324495
642 2936379074 2936375103 Bacteria 6652732
643 2936998937 2936996657 Bacteria 6298727
644 2937006639 2937002841 Bacteria 6934057
645 2937015547 2937009748 Bacteria 6746052
646 2937017806 2937016420 Bacteria 6782579
647 2937023262 2937023124 Bacteria 6815156
648 2937031827 2937029754 Bacteria 6424026
649 2937036242 2937036028 Bacteria 6846469
650 2937048413 2937042894 Bacteria 6741576
651 2937053424 2937049772 Bacteria 6757901
652 2937059809 2937056579 Bacteria 7107896
653 2937068192 2937063883 Bacteria 7199456
654 2937077377 2937071275 Bacteria 6984483
655 2937082078 2937078374 Bacteria 6610289
656 2937090016 2937084907 Bacteria 6618516
657 2937098066 2937091812 Bacteria 6979387
658 2937101294 2937098957 Bacteria 7249374
659 2937109109 2937106411 Bacteria 6947143
660 2937114159 2937113482 Bacteria 6505872
661 2937120159 2937119839 Bacteria 6597547
662 2937128625 2937126314 Bacteria 6771275
663 2937839238 2937836603 Bacteria 6811263
664 2937843832 2937843397 Bacteria 5256375
665 2938020378 2938014810 Bacteria 6700592
666 2941501343 2941499720 Bacteria 7599444
667 2954013829 2954011201 Bacteria 4762601
668 2957381797 2957375807 Bacteria 6425588
669 2957384574 2957382221 Bacteria 6737050
670 2957395280 2957388812 Bacteria 6778072
671 2957396080 2957395598 Bacteria 6822399
672 2957405148 2957402308 Bacteria 6741770
673 2957411797 2957408893 Bacteria 6558585
674 2957417554 2957415311 Bacteria 6991633
675 2957423312 2957422303 Bacteria 7172205
676 2957432000 2957430029 Bacteria 7022557
677 2957443063 2957437181 Bacteria 6568994
678 2957450320 2957443900 Bacteria 6869977
679 2957454544 2957450854 Bacteria 6765715
680 2957460915 2957457609 Bacteria 6967680
681 2957470947 2957464669 Bacteria 6568877
682 2957474141 2957471148 Bacteria 6797643
683 2957479383 2957478035 Bacteria 6756658
684 2957489713 2957484790 Bacteria 6703082
685 2957494520 2957491536 Bacteria 6695180
686 2957504952 2957498199 Bacteria 7126688
687 2957512236 2957505466 Bacteria 7253085
688 2958074307 2958071322 Bacteria 6815895
689 2960586253 2960584000 Bacteria 6864594
690 2960592266 2960591022 Bacteria 6622873
691 2960597982 2960597568 Bacteria 6550735
692 2960605037 2960603979 Bacteria 6898737
693 2960613331 2960610863 Bacteria 6691244
694 2960618331 2960617483 Bacteria 6727748
695 2960629390 2960624210 Bacteria 6875384
696 2960633782 2960631154 Bacteria 6732508
697 2960643766 2960637947 Bacteria 7296468
698 2960647544 2960645483 Bacteria 7211087
699 2960654628 2960652885 Bacteria 7083688
700 2960666858 2960660292 Bacteria 7041660
701 2960673205 2960667422 Bacteria 6763020
702 2960674593 2960674078 Bacteria 6609048
703 2960682373 2960680706 Bacteria 6624464
704 2960693291 2960687367 Bacteria 6535474
705 2960698201 2960693952 Bacteria 6749742
706 2961121104 2961114664 Bacteria 6680456
707 2964610588 2964607997 Bacteria 7101408
708 2964617052 2964615318 Bacteria 6809089
709 2964627120 2964621998 Bacteria 6834995
710 2964633260 2964628898 Bacteria 7083044
711 2964641583 2964636051 Bacteria 7091832
712 2964648825 2964643177 Bacteria 6820887
713 2964655296 2964649959 Bacteria 6675118
714 2964659616 2964656573 Bacteria 7100150
715 2964669316 2964663802 Bacteria 7019362
716 2964675384 2964670856 Bacteria 6851364
717 2964680163 2964678106 Bacteria 6792020
718 2964691750 2964685014 Bacteria 6839111
719 2964695058 2964691889 Bacteria 6802758
720 2964702458 2964698721 Bacteria 6765331
721 2964705941 2964705432 Bacteria 7114648
722 2964712745 2964712639 Bacteria 6695970
723 2964719495 2964719344 Bacteria 7286602
724 2967666804 2967664464 Bacteria 6948836
725 2967678298 2967671571 Bacteria 7021409
726 2967681739 2967678726 Bacteria 7264382
727 2967690217 2967686174 Bacteria 6678622
728 2967699315 2967693043 Bacteria 6804451
729 2967705993 2967699805 Bacteria 6854538
730 2967713279 2967706974 Bacteria 7186053
731 2967719004 2967714385 Bacteria 7000047
732 2967723877 2967721400 Bacteria 7073753
733 2967730856 2967728569 Bacteria 6641507
734 2967738379 2967735183 Bacteria 6827012
735 2967748294 2967742019 Bacteria 6794534
736 2967753974 2967748971 Bacteria 6733771
737 2967757452 2967755722 Bacteria 6814706
738 2967767889 2967762386 Bacteria 6923502
739 2967775132 2967769361 Bacteria 6587838
740 2967776577 2967775926 Bacteria 6738189
741 2968117254 2968110612 Bacteria 6814636
742 2970023609 2970019648 Bacteria 7072033
743 2970029568 2970026789 Bacteria 6785236
744 2970040546 2970033650 Bacteria 7118744
745 2970044934 2970040964 Bacteria 6731123
746 2970048753 2970047711 Bacteria 7088379
747 2970058921 2970054988 Bacteria 6611507
748 2970062060 2970061556 Bacteria 7099761
749 2970070275 2970068827 Bacteria 7123112
750 2970076804 2970076120 Bacteria 6697332
751 2970084058 2970082768 Bacteria 6183754
752 2970092828 2970088815 Bacteria 6933825
753 2970099921 2970095765 Bacteria 6936963
754 2970107003 2970102677 Bacteria 6812532
755 2970113000 2970109326 Bacteria 6863976
756 2970116854 2970116247 Bacteria 6501857
757 2970124607 2970122695 Bacteria 6625855
758 2970133606 2970129317 Bacteria 6806560
759 2970142282 2970136068 Bacteria 7207982
760 2970143571 2970143518 Bacteria 6446480
761 2970152943 2970149975 Bacteria 6779706
762 2970163147 2970156795 Bacteria 7168044
763 2970170839 2970164137 Bacteria 6861252
764 2970176078 2970170962 Bacteria 6876229
765 2970181252 2970177841 Bacteria 6768001
766 2970185480 2970184632 Bacteria 7054431
767 2970197999 2970191845 Bacteria 7032787
768 2970541979 2970540015 Bacteria 6977556
769 2977519740 2977516862 Bacteria 6940108
770 2977525187 2977523885 Bacteria 6960446
771 2977535051 2977530762 Bacteria 6951399
772 2977544555 2977537788 Bacteria 6929320
773 2977550596 2977544691 Bacteria 6875412
774 2977553173 2977551784 Bacteria 7125765
775 2977565779 2977558990 Bacteria 6863948
776 2977571226 2977565890 Bacteria 6901543
777 2977573749 2977572785 Bacteria 6763888
778 2977582950 2977579622 Bacteria 6772100
779 2987673289 2987666974 Bacteria 6509233
780 2989354942 2989349275 Bacteria 6349068
781 2989771551 2989771324 Bacteria 5605128
782 2989780165 2989776772 Bacteria 4843317
783 2995395270 2995392953 Bacteria 4539380
784 2996315241 2996310559 Bacteria 6357320
785 2996890243 2996887358 Bacteria 5795980
786 2996895281 2996893221 Bacteria 5823108
787 3002141664 3002141150 Bacteria 5254435
788 3003930983 3003930520 Bacteria 5667563
789 3005415799 3005409236 Bacteria 7188837
790 3005449660 3005445848 Bacteria 6906074
791 3005455948 3005452660 Bacteria 5889319
792 639650430 639633055 Bacteria 7751309
793 643827405 643692032 Bacteria 6891900
794 648737226 648276728 Bacteria 6968865
795 8002291826 8002285264 Bacteria 6717907
796 8003995369 8003992118 Bacteria 7266902
797 8004003111 8003999396 Bacteria 7063185
798 8004397068 8004395343 Bacteria 6620908
799 8004634540 8004633249 Bacteria 6723080
800 8005249308 8005246636 Bacteria 4933972
801 8005262426 8005258706 Bacteria 6184835
802 8005282432 8005275841 Bacteria 6929066
803 8005286749 8005282627 Bacteria 6675747
804 8005295083 8005289223 Bacteria 6634003
805 8005305962 8005301065 Bacteria 6614431
806 8005313698 8005307578 Bacteria 7395396
807 8005324770 8005321885 Bacteria 5795980
808 8005381568 8005376324 Bacteria 6590079
809 8005387772 8005382845 Bacteria 6732062
810 8005400808 8005395548 Bacteria 6806915
811 8005431105 8005430974 Bacteria 6689030
812 8005465096 8005460587 Bacteria 7157962
813 8005497673 8005497431 Bacteria 6477605
814 8005546674 8005542996 Bacteria 7077758
815 8005561171 8005556819 Bacteria 6908598
816 8005565796 8005563573 Bacteria 7153261
817 8005571843 8005570704 Bacteria 6957481
818 8005623407 8005619151 Bacteria 7030230
819 8005631013 8005626139 Bacteria 6534237
820 8005660816 8005658619 Bacteria 4500593
821 8005669078 8005668836 Bacteria 6953162
822 8005694339 8005688590 Bacteria 6610080
823 8005695734 8005695170 Bacteria 6912330
824 8018128910 8018127388 Bacteria 7351159
825 8018153363 8018150411 Bacteria 5549903
826 8018165090 8018163183 Bacteria 7277977
827 8018177150 8018176218 Bacteria 6896178
828 8023686538 8023680758 Bacteria 7729763
829 8024484370 8024479707 Bacteria 6954785
830 8024502010 8024501048 Bacteria 6427847
831 8046767234 8046767195 Bacteria 7547379
832 8049296321 8049293176 Bacteria 6128433
833 8054561754 8054558443 Bacteria 5204801
834 8055618248 8055617313 Bacteria 7548464
835 8056380414 8056375014 Bacteria 7006639
836 8056385245 8056382006 Bacteria 6408074
837 8057581620 8057575449 Bacteria 7367519
838 8057879287 8057874678 Bacteria 7494653
839 Ga0495610_0011955
840 JGI25158J39367_1000116
841 JGI25152J39213_1002074
842 JGI25152J39213_1002660
843 JGI25152J39213_1004780
844 JGI25152J39213_1005991
845 JGI25150J39212_1000037
846 JGI25150J39212_1006040
847 JGI25159J45721_1003134
848 JGI25151J46595_10000220
849 JGI25151J46595_10002488
850 JGI25151J46595_10006712
851 JGI25151J46595_10014115
852 JGI25151J46595_10016522
853 JGI25153J46596_10004090
854 JGI25153J46596_10007213
855 JGI25153J46596_10022145
856 JGI25153J46596_10036449
857 JGI25160J50197_1000027
858 JGI25160J50197_1000108
859 JGI25160J50197_1002336
860 JGI25160J50197_1004011
861 JGI25160J50197_1021541
862 JGI25161J50226_1000112
863 JGI25161J50226_1000327
864 JGI25161J50226_1000501
865 Ga0055526_1002678
866 Ga0055526_1011992
867 Ga0055526_1013569
868 Ga0055526_1018677
869 Ga0055526_1030183
870 Ga0055524_1004989
871 Ga0055524_1007541
872 Ga0055524_1017101
873 Ga0055524_1029614
874 Ga0055524_1035522
875 Ga0055536_1000999
876 Ga0055528_1000099
877 Ga0055528_1007426
878 Ga0055528_1016778
879 Ga0055528_1016941
880 Ga0055528_1025021
881 Ga0055540_1001518
882 Ga0055531_10006403
883 Ga0055543_1000030
884 Ga0055543_1000062
885 Ga0055543_1000080
886 Ga0055543_1000683
887 Ga0065165_1000122
888 Ga0065165_1002470
889 Ga0065165_1005804
890 Ga0065165_1021888
891 Ga0070682_100131782
892 Ga0070668_100213088
893 Ga0070669_100134573
894 Ga0070714_100610209
895 Ga0068853_100203017
896 Ga0070665_100036587
897 Ga0070665_100110964
898 Ga0081540_1096704
899 Ga0081539_10000437
900 Ga0075365_10014754
901 Ga0075365_10022020
902 Ga0075365_10036700
903 Ga0075365_10065525
904 Ga0075362_10031088
905 Ga0075367_10000317
906 Ga0075367_10028826
907 Ga0075369_10002260
908 Ga0075369_10003953
909 Ga0075369_10018325
910 Ga0075366_10007998
911 Ga0075366_10281865
912 Ga0075370_10008448
913 Ga0105238_10021951
914 Ga0123342_1005742
915 Ga0157369_10219682
916 Ga0171463_1004
917 Ga0183363_1019
918 Ga0163161_10641046
919 Ga0214544_1000079
920 Ga0214542_1000064
921 Ga0214543_1000015
922 Ga0214543_1000063
923 Ga0228711_1000004
924 Ga0228710_1000002
925 Ga0209436_100018
926 Ga0209436_100540
927 Ga0207425_1000034
928 Ga0207425_1003134
929 Ga0207425_1006854
930 Ga0209129_1000118
931 Ga0209129_1000253
932 Ga0209129_1001394
933 Ga0209129_1004326
934 Ga0209129_1004708
935 Ga0209129_1005410
936 Ga0209233_1000118
937 Ga0209673_1000033
938 Ga0209673_1000050
939 Ga0209673_1000052
940 Ga0209673_1004592
941 Ga0209673_1012521
942 Ga0209130_1000009
943 Ga0209130_1000027
944 Ga0209130_1000108
945 Ga0209130_1009914
946 Ga0209675_1013892
947 Ga0209676_1000406
948 Ga0209676_1013267
949 Ga0209025_1000042
950 Ga0209025_1000241
951 Ga0209025_1000335
952 Ga0209025_1000533
953 Ga0209025_1002567
954 Ga0209025_1006540
955 Ga0209025_1013261
956 Ga0209025_1016446
957 Ga0209025_1034149
958 Ga0209025_1036512
959 Ga0209025_1049902
960 Ga0209564_1000111
961 Ga0209564_1001330
962 Ga0209564_1002296
963 Ga0209564_1006715
964 Ga0209564_1008393
965 Ga0209758_1000415
966 Ga0209758_1000896
967 Ga0209758_1001085
968 Ga0209758_1001086
969 Ga0209758_1001936
970 Ga0209758_1002583
971 Ga0209758_1028435
972 Ga0209050_1000572
973 Ga0209050_1012928
974 Ga0209256_1000773
975 Ga0209256_1001743
976 Ga0209256_1003248
977 Ga0209256_1003365
978 Ga0209256_1003400
979 Ga0209256_1018539
980 Ga0209256_1056246
981 Ga0207426_1000041
982 Ga0207426_1000072
983 Ga0207426_1000082
984 Ga0207426_1000348
985 Ga0207426_1001232
986 Ga0209051_1000276
987 Ga0209051_1004620
988 Ga0209051_1005303
989 Ga0209051_1006579
990 Ga0209051_1009103
991 Ga0209051_1052278
992 Ga0209257_1002707
993 Ga0209257_1015856
994 Ga0209257_1038047
995 Ga0209257_1056454
996 Ga0207696_1050324
997 Ga0207671_10181999
998 Ga0207681_10170660
999 Ga0207711_10430652
1000 Ga0207639_10032663
1001 Ga0207674_10140735
1002 Ga0209281_1000030
1003 Ga0209281_1000144
1004 Ga0209282_1000004
1005 Ga0268266_10041961
1006 Ga0307515_10004852
1007 Ga0307515_10016477
1008 Ga0307515_10046110
1009 Ga0307513_10015506
1010 Ga0307408_100300646
1011 Ga0307405_10008039
1012 Ga0307405_10427802
1013 Ga0307405_10444833
1014 Ga0307410_10634941
1015 Ga0307406_10083526
1016 Ga0307406_10312496
1017 Ga0307412_10005736
1018 Ga0315914_1000001
1019 Ga0307414_10020503
1020 Ga0315913_1000004
1021 Ga0315915_1000002
1022 Ga0395899_0119551
1023 Ga0395905_0043406
1024 Ga0395905_0611702
1025 Ga0439436_0007896
1026 Ga0439436_0011975
1027 Ga0439465_0016957
1028 Ga0439465_0026848
1029 Ga0439465_0070100
1030 Ga0451793_0969719
1031 Ga0451798_0568173
1032 Ga0451835_0384467
1033 Ga0451837_1373485
1034 Ga0451843_1206718
1035 Ga0451855_0379872
1036 Ga0451855_1098397
1037 Ga0450920_004471
1038 Ga0439434_0044592
1039 Ga0453684_0010894
1040 Ga0451576_0014874
1041 Ga0495638_0006475
1042 Ga0495638_0023906
1043 Ga0495585_0073526
1044 Ga0495607_0040411
1045 Ga0495606_0113796
1046 Ga0495610_0049789
1047 Ga0495610_0056328
1048 Ga0495620_0076939
1049 Ga0495632_0006155
1050 Ga0495643_0006495
1051 Ga0495643_0079013
1052 Ga0495668_0129856
1053 Ga0495625_0066025
1054 Ga0495670_0120460
1055 Ga0495649_0063067
1056 Ga0495660_0122995
1057 Ga0495681_0119032
1058 Ga0495686_0045926
1059 Ga0495615_0006146
1060 Ga0496106_0065953
1061 Ga0496116_0005573
1062 Ga0496116_0039438
1063 Ga0496116_0055483
1064 Ga0496116_0062249
1065 Ga0496117_0005347
1066 Ga0496117_0184377
1067 Ga0496118_0062412
1068 Ga0496121_0026756
1069 Ga0496121_0037832
1070 Ga0496121_0056879
1071 Ga0496121_0073205
1072 Ga0496121_0075319
1073 Ga0496122_0000984
1074 Ga0496122_0007522
1075 Ga0496122_0051249
1076 Ga0496122_0065256
1077 Ga0496122_0095266
1078 Ga0496123_0000290
1079 Ga0496123_0029681
1080 Ga0496123_0060665
1081 Ga0496123_0102445
1082 Ga0496124_0014171
1083 Ga0496124_0036175
1084 Ga0496124_0069034
1085 Ga0496124_0087958
1086 Ga0496124_0252478
1087 Ga0496125_0007081
1088 Ga0496125_0043126
1089 Ga0496126_0001347
1090 Ga0501031_0000022
1091 Ga0501031_0056657
1092 Ga0501032_0000063
1093 Ga0501033_0000073
1094 Ga0501033_0015770
1095 Ga0501034_0000276
1096 Ga0501034_0013832
1097 Ga0501034_0021121
1098 Ga0501034_0118266
1099 Ga0501034_0293216
1100 Ga0501036_0000030
1101 Ga0501036_0378099
1102 Ga0501037_0000075
1103 Ga0501037_0014494
1104 Ga0501037_0046195
1105 Ga0501038_0000058
1106 Ga0501038_0190092
1107 Ga0501039_0000054
1108 Ga0501040_0017164
1109 Ga0501040_0075093
1110 Ga0501042_0026607
1111 Ga0501043_0001296
1112 Ga0501043_0100843
1113 Ga0501047_0001489
1114 Ga0501047_0073759
1115 Ga0501047_0158719
1116 Ga0501047_0183270
1117 Ga0501069_0127753
1118 Ga0501071_0437265
1119 Ga0501073_0136355
1120 Ga0501083_0206329
1121 Ga0501035_0000126
1122 Ga0501044_0000131
1123 Ga0501044_0015879
1124 Ga0501044_0090842
1125 nmdc:mga03683_15806_c1
1126 nmdc:mga0yw44_40693_c1
1127 nmdc:mga0k408_270063_c1
1128 nmdc:mga0k408_54773_c1
1129 nmdc:mga07m45_18041_c1
1130 nmdc:mga0sz30_26139_c1
1131 Ga0500578_0125816
1132 Ga0500643_003112
1133 Ga0500569_030273
1134 Ga0500607_133288
1135 Ga0500658_0000735
1136 Ga0500616_0004669
1137 Ga0500616_0014226
1138 Ga0500616_0015830
1139 Ga0500616_0139567
1140 Ga0500622_0008199
1141 Ga0500627_0087185
1142 Ga0500634_0004706
1143 Ga0501082_0240195
1144 2509109599
1145 2509143193
1146 2509378077
1147 2510135246
1148 2510306733
1149 2510840479
1150 2510896701
1151 2511133885
1152 2511172964
1153 2511184000
1154 2511194602
1155 2511391807
1156 2511498502
1157 2512534644
1158 2512973548
1159 2513571630
1160 2513578664
1161 2513583664
1162 2513596830
1163 2513601933
1164 2513614174
1165 2513615737
1166 2513630151
1167 2513711350
1168 2513867482
1169 2513884966
1170 2513905176
1171 2513912379
1172 2513928434
1173 2513998492
1174 2514003467
1175 2514019401
1176 2514586660
1177 2515114404
1178 2515611077
1179 2515635408
1180 2515643184
1181 2515657648
1182 2515741589
1183 2516205544
1184 2516894783
1185 2517038055
1186 2517078319
1187 2517097078
1188 2517408538
1189 2517571448
1190 2520379693
1191 2524450406
1192 2530647350
1193 2535519025
1194 2551676637
1195 2551680261
1196 2551685091
1197 2551694493
1198 2551697716
1199 2551708371
1200 2551717621
1201 2551731622
1202 2551736206
1203 2551746067
1204 2558867423
1205 2561467110
1206 2585166728
1207 2585201736
1208 2585223924
1209 2585228736
1210 2585257586
1211 2585266935
1212 2585271675
1213 2585387976
1214 2585396067
1215 2585399751
1216 2585526043
1217 2585540779
1218 2585549147
1219 2585563085
1220 2585820838
1221 2585839049
1222 2585844882
1223 2585902861
1224 2585907302
1225 2585997788
1226 2586002373
1227 2587982704
1228 2597811926
1229 2599335096
1230 2599420144
1231 2599936988
1232 2600193376
1233 2600373233
1234 2616296314
1235 2643771528
1236 2643777247
1237 2643795695
1238 2643808074
1239 2643836728
1240 2643911132
1241 2644002474
1242 2644052042
1243 2644068737
1244 2644110143
1245 2644131583
1246 2644150419
1247 2644194819
1248 2644201401
1249 2644209458
1250 2644240501
1251 2644299793
1252 2644313023
1253 2644336571
1254 2644379508
1255 2644419807
1256 2644453164
1257 2644484494
1258 2644493086
1259 2644499284
1260 2644546218
1261 2644618753
1262 2644652986
1263 2644658020
1264 2644677102
1265 2644688808
1266 2657682384
1267 2692319968
1268 2694631597
1269 2694638349
1270 2719182964
1271 2719387677
1272 2719667309
1273 2719733681
1274 2720493729
1275 2720615182
1276 2720621977
1277 2720633327
1278 2720777025
1279 2721149076
1280 2721160474
1281 2721165889
1282 2721401311
1283 2722842059
1284 2723028623
1285 2723562227
1286 2723568930
1287 2724040125
1288 2724046437
1289 2724091632
1290 2724106195
1291 2724112001
1292 2725947538
1293 2730109559
1294 2730166199
1295 2730300106
1296 2738805940
1297 2739037276
1298 2739306062
1299 2753462471
1300 2765465700
1301 2766064267
1302 2770198347
1303 2776269597
1304 2776282528
1305 2776915590
1306 2792582266
1307 2792621929
1308 2792628814
1309 2792640000
1310 2793295627
1311 2793320721
1312 2793327284
1313 2793332238
1314 2793346601
1315 2793353860
1316 2793359395
1317 2793365905
1318 2802717184
1319 2802724827
1320 2802729578
1321 2802736924
1322 2802743329
1323 2802749545
1324 2804753723
1325 2805926216
1326 2805933942
1327 2806047367
1328 2806054222
1329 2806060194
1330 2806068805
1331 2806076411
1332 2819244578
1333 2838018331
1334 2838024014
1335 2838040351
1336 2838050807
1337 2838062573
1338 2838072124
1339 2838078192
1340 2838667766
1341 2838672165
1342 2838683878
1343 2838690282
1344 2838698406
1345 2838704965
1346 2838711521
1347 2838732057
1348 2838744953
1349 2839993343
1350 2840766344
1351 2841736712
1352 2841856011
1353 2841867759
1354 2842081322
1355 2842116854
1356 2842121901
1357 2842148799
1358 2842161181
1359 2842166693
1360 2842184797
1361 2842194881
1362 2842201607
1363 2842207420
1364 2842221780
1365 2842232379
1366 2842240915
1367 2842246795
1368 2842254646
1369 2842261104
1370 2842269639
1371 2842274302
1372 2842280869
1373 2842288519
1374 2842294979
1375 2842305855
1376 2842311411
1377 2842321112
1378 2842366272
1379 2842375003
1380 2842381378
1381 2842388448
1382 2842395944
1383 2842406135
1384 2842412720
1385 2842419401
1386 2842425756
1387 2842433599
1388 2842439927
1389 2842446556
1390 2842448780
1391 2842467935
1392 2842474536
1393 2842491165
1394 2842498502
1395 2842511704
1396 2842524479
1397 2842873960
1398 2844166231
1399 2844457019
1400 2847420809
1401 2848995634
1402 2850082662
1403 2854901715
1404 2854919487
1405 2855827413
1406 2855842789
1407 2855878172
1408 2856342589
1409 2857519574
1410 2858802127
1411 2871479461
1412 2876383026
1413 2876399234
1414 2878742100
1415 2881165333
1416 2885307189
1417 2885332456
1418 2885339500
1419 2888344699
1420 2889791502
1421 2889917247
1422 2891373893
1423 2894653786
1424 2896390221
1425 2904580008
1426 2904665761
1427 2913300265
1428 2915982397
1429 2915988808
1430 2915999350
1431 2916003799
1432 2916010617
1433 2916018169
1434 2916023845
1435 2916031048
1436 2916040412
1437 2916045392
1438 2916050728
1439 2916056775
1440 2916064983
1441 2916070887
1442 2916080591
1443 2919105387
1444 2919120321
1445 2920760347
1446 2920825923
1447 2921207981
1448 2921209891
1449 2921239794
1450 2921249053
1451 2921252907
1452 2921260215
1453 2921266324
1454 2921286979
1455 2921295951
1456 2923559488
1457 2924149524
1458 2924157575
1459 2924163215
1460 2924167750
1461 2924174222
1462 2924181871
1463 2924187828
1464 2924193570
1465 2924201754
1466 2924207705
1467 2924219351
1468 2924223455
1469 2924234121
1470 2924758891
1471 2924768560
1472 2924779784
1473 2933017667
1474 2933572360
1475 2933593141
1476 2933603023
1477 2935897943
1478 2935903635
1479 2936369889
1480 2936379074
1481 2936998937
1482 2937006639
1483 2937015547
1484 2937017806
1485 2937023262
1486 2937031827
1487 2937036242
1488 2937048413
1489 2937053424
1490 2937059809
1491 2937068192
1492 2937077377
1493 2937082078
1494 2937090016
1495 2937098066
1496 2937101294
1497 2937109109
1498 2937114159
1499 2937120159
1500 2937128625
1501 2937839238
1502 2937843832
1503 2938020378
1504 2941501343
1505 2954013829
1506 2957381797
1507 2957384574
1508 2957395280
1509 2957396080
1510 2957405148
1511 2957411797
1512 2957417554
1513 2957423312
1514 2957432000
1515 2957443063
1516 2957450320
1517 2957454544
1518 2957460915
1519 2957470947
1520 2957474141
1521 2957479383
1522 2957489713
1523 2957494520
1524 2957504952
1525 2957512236
1526 2958074307
1527 2960586253
1528 2960592266
1529 2960597982
1530 2960605037
1531 2960613331
1532 2960618331
1533 2960629390
1534 2960633782
1535 2960643766
1536 2960647544
1537 2960654628
1538 2960666858
1539 2960673205
1540 2960674593
1541 2960682373
1542 2960693291
1543 2960698201
1544 2961121104
1545 2964610588
1546 2964617052
1547 2964627120
1548 2964633260
1549 2964641583
1550 2964648825
1551 2964655296
1552 2964659616
1553 2964669316
1554 2964675384
1555 2964680163
1556 2964691750
1557 2964695058
1558 2964702458
1559 2964705941
1560 2964712745
1561 2964719495
1562 2967666804
1563 2967678298
1564 2967681739
1565 2967690217
1566 2967699315
1567 2967705993
1568 2967713279
1569 2967719004
1570 2967723877
1571 2967730856
1572 2967738379
1573 2967748294
1574 2967753974
1575 2967757452
1576 2967767889
1577 2967775132
1578 2967776577
1579 2968117254
1580 2970023609
1581 2970029568
1582 2970040546
1583 2970044934
1584 2970048753
1585 2970058921
1586 2970062060
1587 2970070275
1588 2970076804
1589 2970084058
1590 2970092828
1591 2970099921
1592 2970107003
1593 2970113000
1594 2970116854
1595 2970124607
1596 2970133606
1597 2970142282
1598 2970143571
1599 2970152943
1600 2970163147
1601 2970170839
1602 2970176078
1603 2970181252
1604 2970185480
1605 2970197999
1606 2970541979
1607 2977519740
1608 2977525187
1609 2977535051
1610 2977544555
1611 2977550596
1612 2977553173
1613 2977565779
1614 2977571226
1615 2977573749
1616 2977582950
1617 2987673289
1618 2989354942
1619 2989771551
1620 2989780165
1621 2995395270
1622 2996315241
1623 2996890243
1624 2996895281
1625 3002141664
1626 3003930983
1627 3005415799
1628 3005449660
1629 3005455948
1630 639650430
1631 643827405
1632 648737226
1633 8002291826
1634 8003995369
1635 8004003111
1636 8004397068
1637 8004634540
1638 8005249308
1639 8005262426
1640 8005282432
1641 8005286749
1642 8005295083
1643 8005305962
1644 8005313698
1645 8005324770
1646 8005381568
1647 8005387772
1648 8005400808
1649 8005431105
1650 8005465096
1651 8005497673
1652 8005546674
1653 8005561171
1654 8005565796
1655 8005571843
1656 8005623407
1657 8005631013
1658 8005660816
1659 8005669078
1660 8005694339
1661 8005695734
1662 8018128910
1663 8018153363
1664 8018165090
1665 8018177150
1666 8023686538
1667 8024484370
1668 8024502010
1669 8046767234
1670 8049296321
1671 8054561754
1672 8055618248
1673 8056380414
1674 8056385245
1675 8057581620
1676 8057879287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

74

300

0.97

PF10613

Lig_chan-Glu_bd

Ligated ion channel L-glutamate- and glycine-binding site

72

169

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnj-assembly2.cif.gz_B domain-stabilized glutamine-binding protein 0.931 34 258
2q2c-assembly3.cif.gz_C crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus 0.9216 32 258
8hnj-assembly2.cif.gz_B domain-stabilized glutamine-binding protein 0.9188 34 258
5t0w-assembly2.cif.gz_B crystal structure of the ancestral amino acid-binding protein anccdt-1, a precursor of cyclohexadienyl dehydratase 0.9135 33 258
8eyz-assembly3.cif.gz_C engineered glutamine binding protein bound to gln and a cobaloxime ligand 0.9114 34 258
ID Description Score Start End Superfamily
3vvfB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9299 31 258 3.40.190.10
2q2aA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9299 34 258 3.40.190.10
af_P0AEQ3_22_243_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9234 30 258 3.40.1190.20
3zsfB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9195 30 258 3.40.190.10
af_P0AEU0_25_107_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9158 32 114 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S0Z178-F1-model_v4 deleted 0.9583 129 253
AF-A0A4S0Z178-F1-model_v4 deleted 0.9437 129 253
AF-A0A1R4HUV9-F1-model_v4 Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2) 0.9297 32 258 GO:0015276
GO:0016020
GO:0030313
AF-A0A7C4N9G4-F1-model_v4 Basic amino acid ABC transporter substrate-binding protein 0.916 57 260 GO:0015276
GO:0016020
GO:0030313
AF-A0A843J618-F1-model_v4 deleted 0.9115 33 257

Map