F482976

General Info

Members Datasets Scaffolds Average Seq Length
838 333 1676 99

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10295396|Ga0075364_102953962
Length 118
Sequence VVAESGAGEHSRYYRGVIFKRVGEGRPYPDHGLSSKAWAALPPRQVRLDELVTTKDTLQLAALLDEDSTFYGDLFAHVVEWQGEYYLEDGLHRALRAALQQRNVLHARVHTVAGRDST

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
294 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
295 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
301 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
302 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
325 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
326 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
327 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
333 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.36
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.72
Nodule 0
Rhizoplane 7.04
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10295396 3300006051 Bacteria 1103
2 LJQas_1008926 3300000549 Bacteria 1212
3 JGI24739J22299_10053906 3300001989 Bacteria 1290
4 JGI24750J21931_1026673 3300002070 Bacteria 833
5 JGI24738J21930_10003650 3300002075 Bacteria 3856
6 JGI24744J21845_10004360 3300002077 Bacteria 2923
7 rootH2_10059890 3300003320 Bacteria 1824
8 Ga0070683_100020382 3300005329 Bacteria 5901
9 Ga0070683_100195883 3300005329 Bacteria 1918
10 Ga0070683_100210626 3300005329 Bacteria 1846
11 Ga0070683_100217719 3300005329 Bacteria 1815
12 Ga0070690_100265450 3300005330 Bacteria 1219
13 Ga0070670_101454598 3300005331 Bacteria 629
14 Ga0068869_100460947 3300005334 Bacteria 1055
15 Ga0068868_100063614 3300005338 Bacteria 2926
16 Ga0068868_100150571 3300005338 Bacteria 1916
17 Ga0068868_100217876 3300005338 Bacteria 1597
18 Ga0070689_100694417 3300005340 Bacteria 888
19 Ga0070691_10075889 3300005341 Bacteria 1638
20 Ga0070687_100015708 3300005343 Bacteria 3431
21 Ga0070687_100214533 3300005343 Bacteria 1175
22 Ga0070687_100813559 3300005343 Bacteria 663
23 Ga0070661_100577554 3300005344 Bacteria 907
24 Ga0070675_100483022 3300005354 Bacteria 1114
25 Ga0070671_100243196 3300005355 Bacteria 1528
26 Ga0070671_100701861 3300005355 Bacteria 878
27 Ga0070674_100007060 3300005356 Bacteria 6605
28 Ga0070673_100958939 3300005364 Bacteria 795
29 Ga0070659_101058855 3300005366 Bacteria 714
30 Ga0070667_100219600 3300005367 Bacteria 1692
31 Ga0070709_10068908 3300005434 Bacteria 2277
32 Ga0070714_100365528 3300005435 Bacteria 1357
33 Ga0070710_10749147 3300005437 Bacteria 693
34 Ga0070701_10001310 3300005438 Bacteria 9156
35 Ga0070701_10077653 3300005438 Bacteria 1790
36 Ga0070700_100099375 3300005441 Bacteria 1914
37 Ga0070700_100122362 3300005441 Bacteria 1745
38 Ga0070694_100799774 3300005444 Bacteria 773
39 Ga0070708_100365861 3300005445 Bacteria 1359
40 Ga0070663_100366529 3300005455 Bacteria 1170
41 Ga0068867_100050398 3300005459 Bacteria 3068
42 Ga0070685_10051188 3300005466 Bacteria 2388
43 Ga0070685_10293132 3300005466 Bacteria 1094
44 Ga0070706_100129387 3300005467 Bacteria 2356
45 Ga0070707_100071242 3300005468 Bacteria 3349
46 Ga0070698_100000831 3300005471 Bacteria 33755
47 Ga0070684_100010870 3300005535 Bacteria 7232
48 Ga0070684_100063113 3300005535 Bacteria 3247
49 Ga0070684_100079397 3300005535 Bacteria 2901
50 Ga0070684_100939515 3300005535 Bacteria 811
51 Ga0070697_100145332 3300005536 Bacteria 1996
52 Ga0068853_100363066 3300005539 Bacteria 1349
53 Ga0068853_101014896 3300005539 Bacteria 799
54 Ga0070672_100048743 3300005543 Bacteria 3293
55 Ga0070672_100190479 3300005543 Bacteria 1712
56 Ga0070686_100008853 3300005544 Bacteria 5640
57 Ga0070693_100754060 3300005547 Bacteria 717
58 Ga0070693_100883158 3300005547 Bacteria 669
59 Ga0070665_100326810 3300005548 Bacteria 1538
60 Ga0070665_101428195 3300005548 Bacteria 701
61 Ga0070704_101376918 3300005549 Bacteria 647
62 Ga0070664_100061812 3300005564 Bacteria 3193
63 Ga0070664_101015800 3300005564 Bacteria 780
64 Ga0070664_101116571 3300005564 Bacteria 743
65 Ga0068857_100295022 3300005577 Bacteria 1494
66 Ga0068857_100473077 3300005577 Bacteria 1174
67 Ga0068857_100772859 3300005577 Bacteria 916
68 Ga0068854_100080876 3300005578 Bacteria 2398
69 Ga0068854_100975582 3300005578 Bacteria 749
70 Ga0068856_100151965 3300005614 Bacteria 2324
71 Ga0068856_100320206 3300005614 Bacteria 1568
72 Ga0068856_100411448 3300005614 Bacteria 1372
73 Ga0068856_101580149 3300005614 Bacteria 669
74 Ga0070702_100084042 3300005615 Bacteria 1913
75 Ga0070702_100126482 3300005615 Bacteria 1608
76 Ga0070702_100170319 3300005615 Bacteria 1416
77 Ga0070702_100286794 3300005615 Bacteria 1132
78 Ga0070702_100302653 3300005615 Bacteria 1107
79 Ga0068852_100004893 3300005616 Bacteria 9513
80 Ga0068852_101160828 3300005616 Bacteria 793
81 Ga0068852_101714683 3300005616 Bacteria 651
82 Ga0068852_101954807 3300005616 Bacteria 609
83 Ga0068864_100064263 3300005618 Bacteria 3182
84 Ga0068864_100336543 3300005618 Bacteria 1421
85 Ga0068866_10022186 3300005718 Bacteria 2935
86 Ga0068866_10171788 3300005718 Bacteria 1273
87 Ga0068861_100005041 3300005719 Bacteria 8905
88 Ga0068861_100071151 3300005719 Bacteria 2696
89 Ga0068861_101790171 3300005719 Bacteria 609
90 Ga0068870_10650711 3300005840 Bacteria 722
91 Ga0068870_11090085 3300005840 Bacteria 574
92 Ga0068870_11252515 3300005840 Bacteria 539
93 Ga0068860_100000544 3300005843 Bacteria 45936
94 Ga0068860_100655230 3300005843 Bacteria 1058
95 Ga0068860_100701123 3300005843 Bacteria 1022
96 Ga0081455_10017768 3300005937 Bacteria 6804
97 Ga0081539_10018562 3300005985 Bacteria 4820
98 Ga0081539_10037559 3300005985 Bacteria 2884
99 Ga0075365_10012365 3300006038 Bacteria 5067
100 Ga0075365_10024823 3300006038 Bacteria 3788
101 Ga0075365_10072896 3300006038 Bacteria 2313
102 Ga0075365_10087085 3300006038 Bacteria 2123
103 Ga0075365_10122994 3300006038 Bacteria 1791
104 Ga0075365_10133807 3300006038 Bacteria 1717
105 Ga0075365_10134070 3300006038 Bacteria 1715
106 Ga0075365_10156073 3300006038 Bacteria 1588
107 Ga0075365_10171491 3300006038 Bacteria 1514
108 Ga0075365_10174209 3300006038 Bacteria 1502
109 Ga0075365_10215856 3300006038 Bacteria 1345
110 Ga0075365_10240247 3300006038 Bacteria 1272
111 Ga0075365_10251976 3300006038 Bacteria 1241
112 Ga0075365_10299946 3300006038 Bacteria 1131
113 Ga0075365_10328759 3300006038 Bacteria 1077
114 Ga0075365_10624557 3300006038 Bacteria 762
115 Ga0075368_10002771 3300006042 Bacteria 5786
116 Ga0075368_10032868 3300006042 Bacteria 2016
117 Ga0075368_10124067 3300006042 Bacteria 1071
118 Ga0075363_100012002 3300006048 Bacteria 4166
119 Ga0075363_100029745 3300006048 Bacteria 2822
120 Ga0075363_100042435 3300006048 Bacteria 2404
121 Ga0075363_100059668 3300006048 Bacteria 2052
122 Ga0075363_100074224 3300006048 Bacteria 1851
123 Ga0075363_100248647 3300006048 Bacteria 1023
124 Ga0075363_100340633 3300006048 Bacteria 874
125 Ga0075364_10013632 3300006051 Bacteria 5004
126 Ga0075364_10033326 3300006051 Bacteria 3316
127 Ga0075364_10046248 3300006051 Bacteria 2833
128 Ga0075364_10079805 3300006051 Bacteria 2163
129 Ga0075364_10105714 3300006051 Bacteria 1875
130 Ga0075364_10368380 3300006051 Bacteria 979
131 Ga0075364_10626853 3300006051 Bacteria 735
132 Ga0070716_100068541 3300006173 Bacteria 2076
133 Ga0070712_100177684 3300006175 Bacteria 1656
134 Ga0075362_10013777 3300006177 Bacteria 3245
135 Ga0075362_10534151 3300006177 Bacteria 602
136 Ga0075362_10758315 3300006177 Bacteria 509
137 Ga0075367_10010586 3300006178 Bacteria 4850
138 Ga0075367_10013260 3300006178 Bacteria 4425
139 Ga0075367_10147994 3300006178 Bacteria 1457
140 Ga0075367_10308893 3300006178 Bacteria 996
141 Ga0075367_10384956 3300006178 Bacteria 886
142 Ga0075367_10576818 3300006178 Bacteria 715
143 Ga0075367_10809384 3300006178 Bacteria 597
144 Ga0097621_100095012 3300006237 Bacteria 2500
145 Ga0075370_10005096 3300006353 Bacteria 6476
146 Ga0075370_10016927 3300006353 Bacteria 3931
147 Ga0075370_10088068 3300006353 Bacteria 1789
148 Ga0075370_10092786 3300006353 Bacteria 1743
149 Ga0075370_10112111 3300006353 Bacteria 1584
150 Ga0075370_10236385 3300006353 Bacteria 1082
151 Ga0075370_10240136 3300006353 Bacteria 1073
152 Ga0075370_10483139 3300006353 Bacteria 747
153 Ga0075428_101306331 3300006844 Bacteria 763
154 Ga0075434_100448363 3300006871 Bacteria 1312
155 Ga0068865_100006410 3300006881 Bacteria 7173
156 Ga0068865_101240273 3300006881 Bacteria 661
157 Ga0099794_10688188 3300007265 Bacteria 544
158 Ga0111539_10022669 3300009094 Bacteria 7714
159 Ga0111539_10429045 3300009094 Bacteria 1539
160 Ga0111539_12215302 3300009094 Bacteria 638
161 Ga0105245_10006661 3300009098 Bacteria 10136
162 Ga0105245_10149184 3300009098 Bacteria 2209
163 Ga0105245_11176443 3300009098 Bacteria 814
164 Ga0105245_11416945 3300009098 Bacteria 745
165 Ga0105247_10785830 3300009101 Bacteria 725
166 Ga0105243_10008995 3300009148 Bacteria 7633
167 Ga0105243_10057122 3300009148 Bacteria 3106
168 Ga0105243_10117055 3300009148 Bacteria 2239
169 Ga0105243_10796968 3300009148 Bacteria 931
170 Ga0105243_13111820 3300009148 Bacteria 502
171 Ga0105241_11631902 3300009174 Bacteria 624
172 Ga0105241_11846221 3300009174 Bacteria 591
173 Ga0105242_10291878 3300009176 Bacteria 1485
174 Ga0105248_10176271 3300009177 Bacteria 2409
175 Ga0105248_10280123 3300009177 Bacteria 1877
176 Ga0105248_10927694 3300009177 Bacteria 983
177 Ga0105238_10116887 3300009551 Bacteria 2647
178 Ga0105238_10453376 3300009551 Bacteria 1280
179 Ga0105238_10457113 3300009551 Bacteria 1274
180 Ga0105249_10077828 3300009553 Bacteria 3076
181 Ga0105249_10503859 3300009553 Bacteria 1256
182 Ga0105249_10624042 3300009553 Bacteria 1134
183 Ga0105239_10205479 3300010375 Bacteria 2207
184 Ga0105239_10703861 3300010375 Bacteria 1155
185 Ga0105239_11508941 3300010375 Bacteria 777
186 Ga0105246_10135858 3300011119 Bacteria 1843
187 Ga0105246_10236894 3300011119 Bacteria 1440
188 Ga0105246_10834812 3300011119 Bacteria 821
189 Ga0105246_12545040 3300011119 Bacteria 504
190 Ga0157343_1040344 3300012488 Bacteria 506
191 Ga0157371_10132583 3300013102 Bacteria 1773
192 Ga0157371_10592231 3300013102 Bacteria 824
193 Ga0157370_10055840 3300013104 Bacteria 3760
194 Ga0157370_10394005 3300013104 Bacteria 1275
195 Ga0157369_10060483 3300013105 Bacteria 4085
196 Ga0157369_10450074 3300013105 Bacteria 1334
197 Ga0157369_10744089 3300013105 Bacteria 1009
198 Ga0157374_10088060 3300013296 Bacteria 2957
199 Ga0157378_10580410 3300013297 Bacteria 1130
200 Ga0157372_10017845 3300013307 Bacteria 7622
201 Ga0157372_10170547 3300013307 Bacteria 2518
202 Ga0157372_10334321 3300013307 Bacteria 1764
203 Ga0157375_10144122 3300013308 Bacteria 2511
204 Ga0157375_10381825 3300013308 Bacteria 1575
205 Ga0163163_10364447 3300014325 Bacteria 1502
206 Ga0163163_10900439 3300014325 Bacteria 948
207 Ga0157380_10012435 3300014326 Bacteria 6176
208 Ga0157380_10667217 3300014326 Bacteria 1040
209 Ga0157380_11664989 3300014326 Bacteria 695
210 Ga0157380_12593609 3300014326 Bacteria 573
211 Ga0182008_10016127 3300014497 Bacteria 3887
212 Ga0182008_10188801 3300014497 Bacteria 1045
213 Ga0182008_10504207 3300014497 Bacteria 666
214 Ga0157377_10012722 3300014745 Bacteria 4240
215 Ga0157377_11255582 3300014745 Bacteria 577
216 Ga0157379_10047972 3300014968 Bacteria 3812
217 Ga0157379_11849687 3300014968 Bacteria 594
218 Ga0157379_12462314 3300014968 Bacteria 520
219 Ga0157376_10030728 3300014969 Bacteria 4293
220 Ga0163161_10117847 3300017792 Bacteria 1992
221 Ga0206356_10923993 3300020070 Bacteria 1065
222 Ga0206353_10072911 3300020082 Bacteria 615
223 Ga0206353_10714204 3300020082 Bacteria 1245
224 Ga0213875_10111027 3300021388 Bacteria 1280
225 Ga0207697_10045134 3300025315 Bacteria 1814
226 Ga0207692_10159385 3300025898 Bacteria 1299
227 Ga0207642_10693639 3300025899 Bacteria 641
228 Ga0207688_10055281 3300025901 Bacteria 2228
229 Ga0207688_10077739 3300025901 Bacteria 1891
230 Ga0207688_10268578 3300025901 Bacteria 1037
231 Ga0207647_10277363 3300025904 Bacteria 957
232 Ga0207643_10686926 3300025908 Bacteria 661
233 Ga0207643_10703097 3300025908 Bacteria 653
234 Ga0207684_10028079 3300025910 Bacteria 4793
235 Ga0207662_10024764 3300025918 Bacteria 3454
236 Ga0207662_10064952 3300025918 Bacteria 2197
237 Ga0207662_10372230 3300025918 Bacteria 964
238 Ga0207662_10578308 3300025918 Bacteria 780
239 Ga0207652_10413283 3300025921 Bacteria 1217
240 Ga0207646_10361486 3300025922 Bacteria 1311
241 Ga0207694_10570502 3300025924 Bacteria 951
242 Ga0207694_10918753 3300025924 Bacteria 740
243 Ga0207659_10551450 3300025926 Bacteria 980
244 Ga0207659_10785281 3300025926 Bacteria 818
245 Ga0207687_10311155 3300025927 Bacteria 1272
246 Ga0207664_10014461 3300025929 Bacteria 5699
247 Ga0207706_10405461 3300025933 Bacteria 1182
248 Ga0207686_10118658 3300025934 Bacteria 1797
249 Ga0207709_10006110 3300025935 Bacteria 6785
250 Ga0207709_10275695 3300025935 Bacteria 1240
251 Ga0207709_10777810 3300025935 Bacteria 771
252 Ga0207670_10633133 3300025936 Bacteria 881
253 Ga0207669_10173011 3300025937 Bacteria 1539
254 Ga0207669_10184364 3300025937 Bacteria 1500
255 Ga0207704_10021454 3300025938 Bacteria 3441
256 Ga0207704_11775094 3300025938 Bacteria 530
257 Ga0207665_10020098 3300025939 Bacteria 4386
258 Ga0207691_10048458 3300025940 Bacteria 3895
259 Ga0207691_10555431 3300025940 Bacteria 973
260 Ga0207691_10632158 3300025940 Bacteria 905
261 Ga0207711_10232539 3300025941 Bacteria 1688
262 Ga0207711_10550716 3300025941 Bacteria 1076
263 Ga0207711_10581936 3300025941 Bacteria 1044
264 Ga0207711_11076889 3300025941 Bacteria 744
265 Ga0207689_11476696 3300025942 Bacteria 568
266 Ga0207661_10040040 3300025944 Bacteria 3682
267 Ga0207661_10235774 3300025944 Bacteria 1622
268 Ga0207661_10367564 3300025944 Bacteria 1300
269 Ga0207661_10694475 3300025944 Bacteria 936
270 Ga0207661_11895109 3300025944 Bacteria 542
271 Ga0207679_10796879 3300025945 Bacteria 861
272 Ga0207679_11376934 3300025945 Bacteria 647
273 Ga0207667_10346453 3300025949 Bacteria 1515
274 Ga0207712_10118587 3300025961 Bacteria 1998
275 Ga0207712_10934463 3300025961 Bacteria 768
276 Ga0207668_10110353 3300025972 Bacteria 2063
277 Ga0207668_11753543 3300025972 Bacteria 560
278 Ga0207640_10119996 3300025981 Bacteria 1882
279 Ga0207658_10201623 3300025986 Bacteria 1661
280 Ga0207658_10408660 3300025986 Bacteria 1195
281 Ga0207677_10122478 3300026023 Bacteria 1959
282 Ga0207677_10199237 3300026023 Bacteria 1590
283 Ga0207677_10264607 3300026023 Bacteria 1403
284 Ga0207639_10104399 3300026041 Bacteria 2298
285 Ga0207678_10222738 3300026067 Bacteria 1615
286 Ga0207708_10000511 3300026075 Bacteria 29928
287 Ga0207708_10266340 3300026075 Bacteria 1384
288 Ga0207702_10481123 3300026078 Bacteria 1208
289 Ga0207648_10003555 3300026089 Bacteria 16299
290 Ga0207676_10649977 3300026095 Bacteria 1018
291 Ga0207674_10194532 3300026116 Bacteria 1978
292 Ga0207675_100002095 3300026118 Bacteria 19806
293 Ga0207675_100069327 3300026118 Bacteria 3296
294 Ga0207675_101693191 3300026118 Bacteria 652
295 Ga0207683_10056701 3300026121 Bacteria 3437
296 Ga0207683_10733309 3300026121 Bacteria 916
297 Ga0207698_10021176 3300026142 Bacteria 4491
298 Ga0207698_10515121 3300026142 Bacteria 1166
299 Ga0207698_11409967 3300026142 Bacteria 712
300 Ga0207698_12534344 3300026142 Bacteria 523
301 Ga0209813_10022513 3300027866 Bacteria 1783
302 Ga0209813_10253597 3300027866 Bacteria 669
303 Ga0209813_10294508 3300027866 Bacteria 629
304 Ga0207428_10063586 3300027907 Bacteria 2915
305 Ga0268264_10000343 3300028381 Bacteria 71702
306 Ga0268264_10678611 3300028381 Bacteria 1022
307 Ga0316178_1065008 3300030735 Bacteria 520
308 Ga0316181_1211841 3300030744 Bacteria 1099
309 Ga0316182_1091689 3300030745 Bacteria 531
310 Ga0307408_100268767 3300031548 Bacteria 1415
311 Ga0307408_101175305 3300031548 Bacteria 715
312 Ga0307408_102434733 3300031548 Bacteria 508
313 Ga0307405_10223790 3300031731 Bacteria 1382
314 Ga0307405_10413224 3300031731 Bacteria 1060
315 Ga0307405_10724272 3300031731 Bacteria 826
316 Ga0307413_10115143 3300031824 Bacteria 1809
317 Ga0307413_10309469 3300031824 Bacteria 1202
318 Ga0307413_10592244 3300031824 Bacteria 906
319 Ga0307413_10742384 3300031824 Bacteria 820
320 Ga0307410_10010912 3300031852 Bacteria 5173
321 Ga0307410_10403325 3300031852 Bacteria 1105
322 Ga0307410_10436705 3300031852 Bacteria 1065
323 Ga0307410_10532935 3300031852 Bacteria 971
324 Ga0307410_10540579 3300031852 Bacteria 964
325 Ga0307410_10744798 3300031852 Bacteria 829
326 Ga0307410_11090317 3300031852 Bacteria 692
327 Ga0307406_10163407 3300031901 Bacteria 1603
328 Ga0307406_10310705 3300031901 Bacteria 1215
329 Ga0307406_10671081 3300031901 Bacteria 862
330 Ga0307407_10014092 3300031903 Bacteria 3903
331 Ga0307407_10082480 3300031903 Bacteria 1949
332 Ga0307407_10093730 3300031903 Bacteria 1847
333 Ga0307407_10721240 3300031903 Bacteria 753
334 Ga0307412_10070640 3300031911 Bacteria 2381
335 Ga0307412_11138154 3300031911 Bacteria 696
336 Ga0307409_100002374 3300031995 Bacteria 9799
337 Ga0307409_100015538 3300031995 Bacteria 5000
338 Ga0307409_100037981 3300031995 Bacteria 3556
339 Ga0307409_100050275 3300031995 Bacteria 3183
340 Ga0307409_100129975 3300031995 Bacteria 2150
341 Ga0307409_100161435 3300031995 Bacteria 1960
342 Ga0307409_100168518 3300031995 Bacteria 1925
343 Ga0307409_100301011 3300031995 Bacteria 1492
344 Ga0307409_100436712 3300031995 Bacteria 1260
345 Ga0307409_101117504 3300031995 Bacteria 810
346 Ga0307409_101422933 3300031995 Bacteria 720
347 Ga0307409_101501509 3300031995 Bacteria 701
348 Ga0307409_101508050 3300031995 Bacteria 700
349 Ga0307409_101697988 3300031995 Bacteria 660
350 Ga0307416_100149323 3300032002 Bacteria 2140
351 Ga0307416_100342717 3300032002 Bacteria 1508
352 Ga0307416_100446637 3300032002 Bacteria 1344
353 Ga0307416_101505587 3300032002 Bacteria 778
354 Ga0307416_102020975 3300032002 Bacteria 679
355 Ga0307414_10165708 3300032004 Bacteria 1761
356 Ga0307414_10649613 3300032004 Bacteria 951
357 Ga0307411_10027450 3300032005 Bacteria 3445
358 Ga0307411_10320079 3300032005 Bacteria 1252
359 Ga0307411_10620784 3300032005 Bacteria 932
360 Ga0307411_10910347 3300032005 Bacteria 782
361 Ga0307411_11294901 3300032005 Bacteria 664
362 Ga0307415_100007929 3300032126 Bacteria 5845
363 Ga0307415_100008326 3300032126 Bacteria 5737
364 Ga0307415_100770096 3300032126 Bacteria 875
365 Ga0307415_101381706 3300032126 Bacteria 670
366 Ga0307415_101891864 3300032126 Bacteria 579
367 Ga0307415_101960576 3300032126 Bacteria 569
368 Ga0373959_0055085 3300034820 Bacteria 868
369 Ga0373938_0233092 3300034957 Bacteria 521
370 Ga0373926_0120709 3300035083 Bacteria 988
371 Ga0373934_0344868 3300035086 Bacteria 620
372 Ga0373944_0155796 3300035089 Bacteria 807
373 Ga0373923_0114884 3300035111 Bacteria 1198
374 Ga0373936_0019093 3300035113 Bacteria 2654
375 Ga0373941_0241531 3300035115 Bacteria 702
376 Ga0373953_0121992 3300035117 Bacteria 1107
377 Ga0373956_0007485 3300035119 Bacteria 4399
378 Ga0373957_0442472 3300035120 Bacteria 562
379 Ga0373943_0651341 3300035170 Bacteria 622
380 Ga0373955_0042790 3300035172 Bacteria 2433
381 Ga0373924_0150936 3300035410 Bacteria 1016
382 Ga0373935_0057208 3300035692 Bacteria 2487
383 Ga0373935_0473048 3300035692 Bacteria 907
384 Ga0373927_0243458 3300035695 Bacteria 1182
385 Ga0373933_1096635 3300035724 Bacteria 524
386 Ga0373947_0599707 3300035725 Bacteria 750
387 Ga0373937_0053592 3300036401 Bacteria 3699
388 Ga0373925_1349864 3300037068 Bacteria 584
389 Ga0395900_0927168 3300037418 Bacteria 793
390 Ga0395898_0561028 3300037466 Bacteria 1084
391 Ga0395898_0913252 3300037466 Bacteria 816
392 Ga0395898_1549922 3300037466 Bacteria 588
393 Ga0395905_0270556 3300037471 Bacteria 1585
394 Ga0436364_0377508 3300037853 Bacteria 1998
395 Ga0436364_0604960 3300037853 Bacteria 3280
396 Ga0436364_0677451 3300037853 Bacteria 3567
397 Ga0395901_0016125 3300038443 Bacteria 7611
398 Ga0395901_0074662 3300038443 Bacteria 3537
399 Ga0395901_0239719 3300038443 Bacteria 1892
400 Ga0395901_0346903 3300038443 Bacteria 1533
401 Ga0439465_0276293 3300041413 Bacteria 625
402 Ga0451789_0439321 3300041443 Bacteria 1284
403 Ga0451789_1093280 3300041443 Bacteria 589
404 Ga0451793_0216178 3300041452 Bacteria 520
405 Ga0451793_0300424 3300041452 Bacteria 579
406 Ga0451793_0819880 3300041452 Bacteria 704
407 Ga0451795_0722433 3300041456 Bacteria 512
408 Ga0451795_0900417 3300041456 Bacteria 559
409 Ga0451800_0070332 3300041459 Bacteria 747
410 Ga0451804_0584031 3300041463 Bacteria 688
411 Ga0451807_1458531 3300041486 Bacteria 1004
412 Ga0451833_0016686 3300041491 Bacteria 568
413 Ga0451833_1361652 3300041491 Bacteria 610
414 Ga0451835_0975322 3300041492 Bacteria 648
415 Ga0451839_0290448 3300041496 Bacteria 746
416 Ga0451839_0675532 3300041496 Bacteria 1087
417 Ga0451841_0694075 3300041498 Bacteria 517
418 Ga0451841_1330074 3300041498 Bacteria 788
419 Ga0451847_0681827 3300041503 Bacteria 834
420 Ga0451851_0594568 3300041507 Bacteria 683
421 Ga0451843_0265237 3300041509 Bacteria 625
422 Ga0451843_1275745 3300041509 Bacteria 1004
423 Ga0451853_1246941 3300041512 Bacteria 1221
424 Ga0451853_2182320 3300041512 Bacteria 889
425 Ga0466969_0484302 3300044656 Bacteria 564
426 Ga0466972_0045370 3300044658 Bacteria 2131
427 Ga0466965_0026893 3300044683 Bacteria 2790
428 Ga0466965_0037788 3300044683 Bacteria 2371
429 Ga0466965_0058162 3300044683 Bacteria 1928
430 Ga0466965_0135751 3300044683 Bacteria 1278
431 Ga0466965_0201825 3300044683 Bacteria 1055
432 Ga0466965_0902931 3300044683 Bacteria 515
433 Ga0466966_0010950 3300044684 Bacteria 6020
434 Ga0466966_0108423 3300044684 Bacteria 1713
435 Ga0466966_0150675 3300044684 Bacteria 1418
436 Ga0466966_0289186 3300044684 Bacteria 985
437 Ga0466966_0687306 3300044684 Bacteria 617
438 Ga0466961_0018326 3300044693 Bacteria 4502
439 Ga0466961_0022820 3300044693 Bacteria 4025
440 Ga0466961_0271242 3300044693 Bacteria 1039
441 Ga0466961_0291420 3300044693 Bacteria 998
442 Ga0466961_0579570 3300044693 Bacteria 675
443 Ga0466963_0016618 3300044694 Bacteria 4578
444 Ga0466963_0040016 3300044694 Bacteria 3072
445 Ga0466963_0370344 3300044694 Bacteria 1009
446 Ga0466964_0139265 3300044706 Bacteria 1113
447 Ga0466971_0139191 3300044719 Bacteria 1130
448 Ga0466971_0163224 3300044719 Bacteria 1043
449 Ga0466971_0176682 3300044719 Bacteria 1003
450 Ga0466968_0251155 3300044735 Bacteria 840
451 Ga0466968_0575442 3300044735 Bacteria 567
452 Ga0466970_0006592 3300044765 Bacteria 5807
453 Ga0466970_0089211 3300044765 Bacteria 1672
454 Ga0466970_0179851 3300044765 Bacteria 1173
455 Ga0466970_0222973 3300044765 Bacteria 1052
456 Ga0466970_0228239 3300044765 Bacteria 1040
457 Ga0466970_0230379 3300044765 Bacteria 1035
458 Ga0466970_0355712 3300044765 Bacteria 831
459 Ga0466970_0389494 3300044765 Bacteria 794
460 Ga0466970_0414055 3300044765 Bacteria 770
461 Ga0466970_0539631 3300044765 Bacteria 673
462 Ga0466957_0022078 3300044842 Bacteria 3753
463 Ga0466957_0169012 3300044842 Bacteria 1424
464 Ga0466957_0367828 3300044842 Bacteria 978
465 Ga0466957_0580316 3300044842 Bacteria 783
466 Ga0466960_0004028 3300044901 Bacteria 5711
467 Ga0466960_0014736 3300044901 Bacteria 3356
468 Ga0466960_0047544 3300044901 Bacteria 2058
469 Ga0466960_0134924 3300044901 Bacteria 1306
470 Ga0466960_0325997 3300044901 Bacteria 871
471 Ga0466960_0411134 3300044901 Bacteria 781
472 Ga0466960_0642132 3300044901 Bacteria 633
473 Ga0466959_0163483 3300045049 Bacteria 1564
474 Ga0466959_1056823 3300045049 Bacteria 540
475 Ga0466958_0066184 3300045836 Bacteria 2206
476 Ga0466958_0541177 3300045836 Bacteria 756
477 Ga0466967_0012575 3300045976 Bacteria 6485
478 Ga0466967_0016498 3300045976 Bacteria 5828
479 Ga0466967_0043530 3300045976 Bacteria 3888
480 Ga0466967_0056674 3300045976 Bacteria 3456
481 Ga0466967_0269733 3300045976 Bacteria 1630
482 Ga0466967_0274906 3300045976 Bacteria 1615
483 Ga0466967_0489334 3300045976 Bacteria 1206
484 Ga0466967_0499879 3300045976 Bacteria 1193
485 Ga0466967_0572989 3300045976 Bacteria 1112
486 Ga0466967_0668416 3300045976 Bacteria 1028
487 Ga0466967_1091297 3300045976 Bacteria 795
488 Ga0466967_2566444 3300045976 Bacteria 504
489 Ga0495592_0339825 3300046454 Bacteria 965
490 Ga0495603_0063945 3300046455 Bacteria 2170
491 Ga0495603_0645788 3300046455 Bacteria 606
492 Ga0495629_0066955 3300046459 Bacteria 2507
493 Ga0495629_1040533 3300046459 Bacteria 531
494 Ga0495651_0001003 3300046462 Bacteria 21922
495 Ga0495653_0083818 3300046463 Bacteria 2349
496 Ga0495582_0327596 3300046473 Bacteria 881
497 Ga0495582_0362371 3300046473 Bacteria 835
498 Ga0495639_0130276 3300046475 Bacteria 1204
499 Ga0495664_0060987 3300046477 Bacteria 2246
500 Ga0495664_0765698 3300046477 Bacteria 568
501 Ga0495608_0238952 3300046511 Bacteria 1135
502 Ga0495618_0019628 3300046514 Bacteria 4160
503 Ga0495628_0057116 3300046516 Bacteria 3070
504 Ga0495630_0176703 3300046517 Bacteria 1627
505 Ga0495630_1250215 3300046517 Bacteria 560
506 Ga0495666_0401297 3300046526 Bacteria 616
507 Ga0495652_0048027 3300046529 Bacteria 3659
508 Ga0495652_0342539 3300046529 Bacteria 1073
509 Ga0495652_1071243 3300046529 Bacteria 524
510 Ga0495665_0156969 3300046531 Bacteria 1187
511 Ga0495640_0006350 3300046533 Bacteria 9367
512 Ga0495587_0074489 3300046536 Bacteria 1971
513 Ga0495645_0037079 3300046543 Bacteria 3553
514 Ga0495667_0044499 3300046559 Bacteria 2940
515 Ga0495667_0824442 3300046559 Bacteria 571
516 Ga0495635_0012566 3300046663 Bacteria 5934
517 Ga0495588_0256816 3300046674 Bacteria 921
518 Ga0495657_0064215 3300046675 Bacteria 2419
519 Ga0495657_0146144 3300046675 Bacteria 1470
520 Ga0495599_0009218 3300046678 Bacteria 6022
521 Ga0495599_0431079 3300046678 Bacteria 782
522 Ga0495646_0004081 3300046680 Bacteria 9162
523 Ga0495646_0627699 3300046680 Bacteria 544
524 Ga0495658_0853705 3300046683 Bacteria 582
525 Ga0495613_1008858 3300046689 Bacteria 534
526 Ga0495600_0013591 3300046809 Bacteria 5119
527 Ga0495604_0000897 3300047317 Bacteria 24776
528 Ga0495674_0023005 3300047319 Bacteria 5741
529 Ga0495674_0289531 3300047319 Bacteria 1340
530 Ga0495676_0414311 3300047321 Bacteria 892
531 Ga0495680_0041485 3300047322 Bacteria 3659
532 Ga0495680_0392577 3300047322 Bacteria 959
533 Ga0495684_0988516 3300047471 Bacteria 535
534 Ga0495593_0209032 3300047673 Bacteria 980
535 Ga0495602_0109227 3300048088 Bacteria 2250
536 Ga0495614_0236439 3300048089 Bacteria 833
537 Ga0496100_0012418 3300048903 Bacteria 4883
538 Ga0496100_0185845 3300048903 Bacteria 1506
539 Ga0496100_0414602 3300048903 Bacteria 1028
540 Ga0496100_0915433 3300048903 Bacteria 689
541 Ga0496101_0078260 3300048904 Bacteria 2438
542 Ga0496101_0570935 3300048904 Bacteria 894
543 Ga0496102_0026810 3300048905 Bacteria 5143
544 Ga0496102_0829948 3300048905 Bacteria 847
545 Ga0496102_1864009 3300048905 Bacteria 518
546 Ga0496103_0036039 3300048906 Bacteria 3029
547 Ga0496103_0871742 3300048906 Bacteria 565
548 Ga0496104_0059494 3300048907 Bacteria 3617
549 Ga0496104_0584317 3300048907 Bacteria 1027
550 Ga0496104_0595156 3300048907 Bacteria 1016
551 Ga0496104_1501751 3300048907 Bacteria 577
552 Ga0496105_0020613 3300048908 Bacteria 5328
553 Ga0496105_0104813 3300048908 Bacteria 2335
554 Ga0496106_0003757 3300048909 Bacteria 11324
555 Ga0496106_0465293 3300048909 Bacteria 1016
556 Ga0496106_0603173 3300048909 Bacteria 879
557 Ga0496106_0991015 3300048909 Bacteria 661
558 Ga0496107_0426615 3300048910 Bacteria 986
559 Ga0496107_0472754 3300048910 Bacteria 930
560 Ga0496108_0016818 3300048911 Bacteria 5975
561 Ga0496108_0058493 3300048911 Bacteria 3240
562 Ga0496109_0009737 3300048912 Bacteria 8203
563 Ga0496109_0072342 3300048912 Bacteria 3167
564 Ga0496109_0094948 3300048912 Bacteria 2760
565 Ga0496109_0547155 3300048912 Bacteria 1092
566 Ga0496110_0010577 3300048913 Bacteria 7512
567 Ga0496110_0027745 3300048913 Bacteria 4856
568 Ga0496110_0115260 3300048913 Bacteria 2419
569 Ga0496110_0321290 3300048913 Bacteria 1410
570 Ga0496110_0533761 3300048913 Bacteria 1067
571 Ga0496110_0622305 3300048913 Bacteria 978
572 Ga0496111_0193544 3300048914 Bacteria 1512
573 Ga0496111_0404817 3300048914 Bacteria 1008
574 Ga0496112_0097857 3300048915 Bacteria 2904
575 Ga0496112_0106520 3300048915 Bacteria 2773
576 Ga0496113_0115637 3300048916 Bacteria 2093
577 Ga0496113_0151530 3300048916 Bacteria 1829
578 Ga0496113_1290220 3300048916 Bacteria 568
579 Ga0496114_0023731 3300048917 Bacteria 5006
580 Ga0496114_0064601 3300048917 Bacteria 3065
581 Ga0496114_0085920 3300048917 Bacteria 2665
582 Ga0496114_0763500 3300048917 Bacteria 844
583 Ga0496114_0904998 3300048917 Bacteria 764
584 Ga0496114_1242133 3300048917 Bacteria 631
585 Ga0496115_1349516 3300048918 Bacteria 529
586 Ga0496124_0069059 3300048927 Bacteria 2935
587 Ga0501291_048793 3300049514 Bacteria 765
588 Ga0501031_0002605 3300049568 Bacteria 11485
589 Ga0501031_0011951 3300049568 Bacteria 5660
590 Ga0501031_0034223 3300049568 Bacteria 3316
591 Ga0501031_0238198 3300049568 Bacteria 1183
592 Ga0501031_0284553 3300049568 Bacteria 1072
593 Ga0501031_0311367 3300049568 Bacteria 1020
594 Ga0501031_0398910 3300049568 Bacteria 890
595 Ga0501031_1056486 3300049568 Bacteria 518
596 Ga0501032_0015704 3300049569 Bacteria 5338
597 Ga0501032_0023365 3300049569 Bacteria 4273
598 Ga0501032_0142750 3300049569 Bacteria 1577
599 Ga0501033_0003058 3300049570 Bacteria 13906
600 Ga0501033_0351755 3300049570 Bacteria 1032
601 Ga0501033_0379466 3300049570 Bacteria 988
602 Ga0501033_0467121 3300049570 Bacteria 875
603 Ga0501034_0263117 3300049571 Bacteria 1667
604 Ga0501034_0943584 3300049571 Bacteria 749
605 Ga0501034_1010786 3300049571 Bacteria 715
606 Ga0501036_0024749 3300049572 Bacteria 5061
607 Ga0501036_0082940 3300049572 Bacteria 2710
608 Ga0501036_0299954 3300049572 Bacteria 1344
609 Ga0501036_0469874 3300049572 Bacteria 1047
610 Ga0501037_0040863 3300049573 Bacteria 3412
611 Ga0501037_0090116 3300049573 Bacteria 2219
612 Ga0501037_1062721 3300049573 Bacteria 525
613 Ga0501038_0002213 3300049574 Bacteria 18087
614 Ga0501038_0034325 3300049574 Bacteria 4461
615 Ga0501038_0924892 3300049574 Bacteria 643
616 Ga0501039_0017268 3300049575 Bacteria 5536
617 Ga0501039_0018411 3300049575 Bacteria 5361
618 Ga0501039_0043080 3300049575 Bacteria 3487
619 Ga0501039_0081598 3300049575 Bacteria 2517
620 Ga0501039_0280064 3300049575 Bacteria 1311
621 Ga0501039_0608518 3300049575 Bacteria 856
622 Ga0501040_0026139 3300049576 Bacteria 3926
623 Ga0501040_0152116 3300049576 Bacteria 1633
624 Ga0501040_0293044 3300049576 Bacteria 1163
625 Ga0501040_0495530 3300049576 Bacteria 881
626 Ga0501040_0698118 3300049576 Bacteria 734
627 Ga0501040_1056686 3300049576 Bacteria 589
628 Ga0501040_1185128 3300049576 Bacteria 554
629 Ga0501041_0036170 3300049577 Bacteria 2993
630 Ga0501041_0206102 3300049577 Bacteria 1233
631 Ga0501041_0250382 3300049577 Bacteria 1114
632 Ga0501041_0342159 3300049577 Bacteria 945
633 Ga0501041_0358965 3300049577 Bacteria 921
634 Ga0501042_0004813 3300049578 Bacteria 8630
635 Ga0501042_0018268 3300049578 Bacteria 4854
636 Ga0501042_0024356 3300049578 Bacteria 4245
637 Ga0501042_0135761 3300049578 Bacteria 1774
638 Ga0501042_0291655 3300049578 Bacteria 1178
639 Ga0501043_0048232 3300049579 Bacteria 3348
640 Ga0501043_0118989 3300049579 Bacteria 2071
641 Ga0501043_0368615 3300049579 Bacteria 1089
642 Ga0501043_0976708 3300049579 Bacteria 604
643 Ga0501046_0000440 3300049580 Bacteria 41802
644 Ga0501046_0017835 3300049580 Bacteria 5920
645 Ga0501046_0076300 3300049580 Bacteria 2597
646 Ga0501046_0252521 3300049580 Bacteria 1298
647 Ga0501047_0013506 3300049581 Bacteria 7741
648 Ga0501048_0003644 3300049582 Bacteria 11731
649 Ga0501048_0020946 3300049582 Bacteria 4789
650 Ga0501048_0112450 3300049582 Bacteria 1923
651 Ga0501048_0175900 3300049582 Bacteria 1517
652 Ga0501048_0453888 3300049582 Bacteria 918
653 Ga0501048_0619744 3300049582 Bacteria 777
654 Ga0501048_1078101 3300049582 Bacteria 578
655 Ga0501067_0004432 3300049583 Bacteria 7739
656 Ga0501067_0015155 3300049583 Bacteria 4267
657 Ga0501067_0054294 3300049583 Bacteria 2220
658 Ga0501067_0084460 3300049583 Bacteria 1761
659 Ga0501067_0414688 3300049583 Bacteria 751
660 Ga0501067_0632573 3300049583 Bacteria 600
661 Ga0501068_0159541 3300049584 Bacteria 1421
662 Ga0501068_0182958 3300049584 Bacteria 1325
663 Ga0501069_0034741 3300049585 Bacteria 2776
664 Ga0501069_0043753 3300049585 Bacteria 2479
665 Ga0501069_0077428 3300049585 Bacteria 1870
666 Ga0501069_0419540 3300049585 Bacteria 793
667 Ga0501069_0432092 3300049585 Bacteria 781
668 Ga0501069_0692581 3300049585 Bacteria 614
669 Ga0501069_0766474 3300049585 Bacteria 584
670 Ga0501070_0031667 3300049586 Bacteria 4431
671 Ga0501070_0134154 3300049586 Bacteria 2044
672 Ga0501070_0331548 3300049586 Bacteria 1237
673 Ga0501070_0446191 3300049586 Bacteria 1043
674 Ga0501070_0474979 3300049586 Bacteria 1006
675 Ga0501070_0999081 3300049586 Bacteria 649
676 Ga0501070_1068518 3300049586 Bacteria 624
677 Ga0501070_1440098 3300049586 Bacteria 523
678 Ga0501071_0000962 3300049587 Bacteria 15704
679 Ga0501071_0117813 3300049587 Bacteria 1967
680 Ga0501071_0168808 3300049587 Bacteria 1638
681 Ga0501071_0194001 3300049587 Bacteria 1524
682 Ga0501071_0418609 3300049587 Bacteria 1024
683 Ga0501071_0477608 3300049587 Bacteria 955
684 Ga0501071_0863385 3300049587 Bacteria 698
685 Ga0501071_1236397 3300049587 Bacteria 577
686 Ga0501072_0127343 3300049588 Bacteria 2029
687 Ga0501072_0164069 3300049588 Bacteria 1772
688 Ga0501072_0180916 3300049588 Bacteria 1682
689 Ga0501072_0299880 3300049588 Bacteria 1277
690 Ga0501072_0441639 3300049588 Bacteria 1031
691 Ga0501072_1122711 3300049588 Bacteria 611
692 Ga0501073_0083180 3300049589 Bacteria 2227
693 Ga0501073_0389098 3300049589 Bacteria 963
694 Ga0501073_0921982 3300049589 Bacteria 601
695 Ga0501074_0087661 3300049590 Bacteria 2229
696 Ga0501074_0147455 3300049590 Bacteria 1683
697 Ga0501074_0193087 3300049590 Bacteria 1451
698 Ga0501074_0344547 3300049590 Bacteria 1058
699 Ga0501074_0627833 3300049590 Bacteria 759
700 Ga0501074_0668124 3300049590 Bacteria 734
701 Ga0501074_0986924 3300049590 Bacteria 592
702 Ga0501075_0058820 3300049591 Bacteria 2895
703 Ga0501075_0198656 3300049591 Bacteria 1529
704 Ga0501076_0011529 3300049592 Bacteria 6589
705 Ga0501076_0272453 3300049592 Bacteria 1386
706 Ga0501076_0414853 3300049592 Bacteria 1108
707 Ga0501076_0436717 3300049592 Bacteria 1078
708 Ga0501076_0607248 3300049592 Bacteria 902
709 Ga0501076_0813976 3300049592 Bacteria 771
710 Ga0501076_0942857 3300049592 Bacteria 711
711 Ga0501077_0057897 3300049593 Bacteria 2461
712 Ga0501077_0122307 3300049593 Bacteria 1650
713 Ga0501077_0540295 3300049593 Bacteria 748
714 Ga0501198_112306 3300049649 Bacteria 565
715 Ga0501206_084944 3300049653 Bacteria 555
716 Ga0501224_052743 3300049664 Bacteria 626
717 Ga0501079_0103301 3300049741 Bacteria 2211
718 Ga0501079_0189649 3300049741 Bacteria 1604
719 Ga0501079_0331752 3300049741 Bacteria 1191
720 Ga0501079_0607434 3300049741 Bacteria 861
721 Ga0501079_1206251 3300049741 Bacteria 596
722 Ga0501080_0390455 3300049742 Bacteria 1253
723 Ga0501080_0454768 3300049742 Bacteria 1148
724 Ga0501080_0464674 3300049742 Bacteria 1133
725 Ga0501080_0546220 3300049742 Bacteria 1032
726 Ga0501081_0025748 3300049743 Bacteria 3961
727 Ga0501081_0073777 3300049743 Bacteria 2380
728 Ga0501081_0399812 3300049743 Bacteria 1017
729 Ga0501081_0900908 3300049743 Bacteria 667
730 Ga0501083_0310242 3300049744 Bacteria 1026
731 Ga0501083_0482575 3300049744 Bacteria 807
732 Ga0501083_0548844 3300049744 Bacteria 752
733 Ga0501270_017970 3300049767 Bacteria 1042
734 Ga0501271_019271 3300049768 Bacteria 784
735 Ga0501275_069296 3300049772 Bacteria 552
736 Ga0501035_0033442 3300049822 Bacteria 4676
737 Ga0501035_0251034 3300049822 Bacteria 1502
738 Ga0501035_0302194 3300049822 Bacteria 1348
739 Ga0501035_0324995 3300049822 Bacteria 1292
740 Ga0501035_1000042 3300049822 Bacteria 658
741 Ga0501044_0127909 3300049823 Bacteria 2536
742 Ga0501044_0657324 3300049823 Bacteria 937
743 Ga0501044_0858405 3300049823 Bacteria 784
744 Ga0501045_0007514 3300049824 Bacteria 7573
745 Ga0501045_0346927 3300049824 Bacteria 1105
746 Ga0501045_0877128 3300049824 Bacteria 659
747 Ga0501212_080124 3300049851 Bacteria 590
748 nmdc:mga03683_150993_c1 3300050489 Bacteria 1048
749 nmdc:mga03683_20406_c1 3300050489 Bacteria 2542
750 nmdc:mga03683_284220_c1 3300050489 Bacteria 773
751 nmdc:mga03683_336546_c1 3300050489 Bacteria 712
752 nmdc:mga03n38_15922_c1 3300050490 Bacteria 2915
753 nmdc:mga03n38_261299_c1 3300050490 Bacteria 918
754 nmdc:mga03n38_337210_c1 3300050490 Bacteria 818
755 nmdc:mga03n38_38394_c1 3300050490 Bacteria 2071
756 nmdc:mga03n38_77748_c1 3300050490 Bacteria 1552
757 nmdc:mga00v17_11714_c1 3300050491 Bacteria 4824
758 nmdc:mga00v17_165049_c1 3300050491 Bacteria 1427
759 nmdc:mga00v17_221934_c1 3300050491 Bacteria 1224
760 nmdc:mga00v17_326655_c1 3300050491 Bacteria 997
761 nmdc:mga00v17_441711_c1 3300050491 Bacteria 845
762 nmdc:mga00v17_51413_c1 3300050491 Bacteria 2506
763 nmdc:mga00v17_706809_c1 3300050491 Bacteria 646
764 nmdc:mga0yw44_101334_c1 3300050492 Bacteria 1834
765 nmdc:mga0yw44_107963_c1 3300050492 Bacteria 1780
766 nmdc:mga0yw44_153600_c1 3300050492 Bacteria 1503
767 nmdc:mga0yw44_1748_c1 3300050492 Bacteria 8841
768 nmdc:mga0yw44_187435_c1 3300050492 Bacteria 1363
769 nmdc:mga0yw44_257716_c1 3300050492 Bacteria 1162
770 nmdc:mga0yw44_272582_c1 3300050492 Bacteria 1130
771 nmdc:mga0yw44_325444_c1 3300050492 Bacteria 1033
772 nmdc:mga0yw44_341443_c1 3300050492 Bacteria 1007
773 nmdc:mga0yw44_348442_c1 3300050492 Bacteria 997
774 nmdc:mga0yw44_39031_c1 3300050492 Bacteria 2813
775 nmdc:mga0yw44_39129_c2 3300050492 Bacteria 910
776 nmdc:mga0yw44_416819_c1 3300050492 Bacteria 909
777 nmdc:mga0yw44_4400_c1 3300050492 Bacteria 6452
778 nmdc:mga0yw44_445873_c1 3300050492 Bacteria 877
779 nmdc:mga0yw44_495569_c1 3300050492 Bacteria 829
780 nmdc:mga0yw44_60355_c1 3300050492 Bacteria 2323
781 nmdc:mga0yw44_820248_c1 3300050492 Bacteria 632
782 nmdc:mga0yw44_856630_c1 3300050492 Bacteria 617
783 nmdc:mga0yw44_871100_c1 3300050492 Bacteria 611
784 nmdc:mga06z11_143981_c1 3300050494 Bacteria 1349
785 nmdc:mga06z11_227438_c1 3300050494 Bacteria 1092
786 nmdc:mga06z11_49662_c1 3300050494 Bacteria 2141
787 nmdc:mga06z11_63576_c1 3300050494 Bacteria 1931
788 nmdc:mga04h51_16758_c1 3300050495 Bacteria 2132
789 nmdc:mga04h51_286860_c1 3300050495 Bacteria 668
790 nmdc:mga04h51_64004_c1 3300050495 Bacteria 1268
791 nmdc:mga07m45_114432_c1 3300050496 Bacteria 1555
792 nmdc:mga07m45_153902_c1 3300050496 Bacteria 1334
793 nmdc:mga07m45_168766_c1 3300050496 Bacteria 1271
794 nmdc:mga07m45_226379_c1 3300050496 Bacteria 1088
795 nmdc:mga07m45_22687_c1 3300050496 Bacteria 3429
796 nmdc:mga07m45_295424_c1 3300050496 Bacteria 942
797 nmdc:mga07m45_31455_c1 3300050496 Bacteria 2942
798 nmdc:mga07m45_372725_c1 3300050496 Bacteria 829
799 nmdc:mga07m45_438074_c1 3300050496 Bacteria 758
800 nmdc:mga08y16_104701_c1 3300050511 Bacteria 2945
801 nmdc:mga08y16_2163668_c1 3300050511 Bacteria 503
802 nmdc:mga08y16_398698_c1 3300050511 Bacteria 1408
803 nmdc:mga08y16_44369_c1 3300050511 Bacteria 4658
804 nmdc:mga0n895_587280_c1 3300050512 Bacteria 1117
805 nmdc:mga0rr50_1298473_c1 3300050513 Bacteria 617
806 nmdc:mga08x19_1342382_c1 3300050514 Bacteria 506
807 nmdc:mga08x19_957101_c1 3300050514 Bacteria 608
808 nmdc:mga0sz30_510235_c1 3300050516 Bacteria 541
809 Ga0495601_0244170 3300053077 Bacteria 1172
810 Ga0495601_0467109 3300053077 Bacteria 815
811 Ga0495612_0013052 3300053078 Bacteria 3346
812 Ga0495619_0927349 3300053085 Bacteria 585
813 Ga0500644_0000164 3300053088 Bacteria 41953
814 Ga0500641_0045908 3300053096 Bacteria 1781
815 Ga0500554_085860 3300053102 Bacteria 1041
816 Ga0500556_0002474 3300053104 Bacteria 5906
817 Ga0500593_000231 3300053117 Bacteria 22993
818 Ga0500655_055370 3300053133 Bacteria 794
819 Ga0500568_0240596 3300053139 Bacteria 660
820 Ga0501084_0045884 3300054114 Bacteria 3658
821 Ga0501084_0166726 3300054114 Bacteria 1859
822 Ga0501084_0206650 3300054114 Bacteria 1657
823 Ga0501084_0322345 3300054114 Bacteria 1305
824 Ga0501084_0372338 3300054114 Bacteria 1207
825 Ga0501084_0510153 3300054114 Bacteria 1016
826 Ga0501084_1334613 3300054114 Bacteria 601
827 Ga0501082_0021790 3300060353 Bacteria 5525
828 Ga0501082_0137999 3300060353 Bacteria 2116
829 Ga0501082_0793631 3300060353 Bacteria 828
830 Ga0501082_1633615 3300060353 Bacteria 563
831 Ga0466962_0065010 3300061719 Bacteria 1741
832 Ga0466962_0566771 3300061719 Bacteria 577
833 Ga0530510_0026300 3300061734 Bacteria 4165
834 Ga0530510_0050574 3300061734 Bacteria 3002
835 Ga0530510_0081094 3300061734 Bacteria 2362
836 Ga0530510_0168669 3300061734 Bacteria 1621
837 Ga0530510_0757123 3300061734 Bacteria 741
838 2740168588 2739367898 Bacteria 4367674
839 Ga0075364_10295396
840 LJQas_1008926
841 JGI24739J22299_10053906
842 JGI24750J21931_1026673
843 JGI24738J21930_10003650
844 JGI24744J21845_10004360
845 rootH2_10059890
846 Ga0070683_100020382
847 Ga0070683_100195883
848 Ga0070683_100210626
849 Ga0070683_100217719
850 Ga0070690_100265450
851 Ga0070670_101454598
852 Ga0068869_100460947
853 Ga0068868_100063614
854 Ga0068868_100150571
855 Ga0068868_100217876
856 Ga0070689_100694417
857 Ga0070691_10075889
858 Ga0070687_100015708
859 Ga0070687_100214533
860 Ga0070687_100813559
861 Ga0070661_100577554
862 Ga0070675_100483022
863 Ga0070671_100243196
864 Ga0070671_100701861
865 Ga0070674_100007060
866 Ga0070673_100958939
867 Ga0070659_101058855
868 Ga0070667_100219600
869 Ga0070709_10068908
870 Ga0070714_100365528
871 Ga0070710_10749147
872 Ga0070701_10001310
873 Ga0070701_10077653
874 Ga0070700_100099375
875 Ga0070700_100122362
876 Ga0070694_100799774
877 Ga0070708_100365861
878 Ga0070663_100366529
879 Ga0068867_100050398
880 Ga0070685_10051188
881 Ga0070685_10293132
882 Ga0070706_100129387
883 Ga0070707_100071242
884 Ga0070698_100000831
885 Ga0070684_100010870
886 Ga0070684_100063113
887 Ga0070684_100079397
888 Ga0070684_100939515
889 Ga0070697_100145332
890 Ga0068853_100363066
891 Ga0068853_101014896
892 Ga0070672_100048743
893 Ga0070672_100190479
894 Ga0070686_100008853
895 Ga0070693_100754060
896 Ga0070693_100883158
897 Ga0070665_100326810
898 Ga0070665_101428195
899 Ga0070704_101376918
900 Ga0070664_100061812
901 Ga0070664_101015800
902 Ga0070664_101116571
903 Ga0068857_100295022
904 Ga0068857_100473077
905 Ga0068857_100772859
906 Ga0068854_100080876
907 Ga0068854_100975582
908 Ga0068856_100151965
909 Ga0068856_100320206
910 Ga0068856_100411448
911 Ga0068856_101580149
912 Ga0070702_100084042
913 Ga0070702_100126482
914 Ga0070702_100170319
915 Ga0070702_100286794
916 Ga0070702_100302653
917 Ga0068852_100004893
918 Ga0068852_101160828
919 Ga0068852_101714683
920 Ga0068852_101954807
921 Ga0068864_100064263
922 Ga0068864_100336543
923 Ga0068866_10022186
924 Ga0068866_10171788
925 Ga0068861_100005041
926 Ga0068861_100071151
927 Ga0068861_101790171
928 Ga0068870_10650711
929 Ga0068870_11090085
930 Ga0068870_11252515
931 Ga0068860_100000544
932 Ga0068860_100655230
933 Ga0068860_100701123
934 Ga0081455_10017768
935 Ga0081539_10018562
936 Ga0081539_10037559
937 Ga0075365_10012365
938 Ga0075365_10024823
939 Ga0075365_10072896
940 Ga0075365_10087085
941 Ga0075365_10122994
942 Ga0075365_10133807
943 Ga0075365_10134070
944 Ga0075365_10156073
945 Ga0075365_10171491
946 Ga0075365_10174209
947 Ga0075365_10215856
948 Ga0075365_10240247
949 Ga0075365_10251976
950 Ga0075365_10299946
951 Ga0075365_10328759
952 Ga0075365_10624557
953 Ga0075368_10002771
954 Ga0075368_10032868
955 Ga0075368_10124067
956 Ga0075363_100012002
957 Ga0075363_100029745
958 Ga0075363_100042435
959 Ga0075363_100059668
960 Ga0075363_100074224
961 Ga0075363_100248647
962 Ga0075363_100340633
963 Ga0075364_10013632
964 Ga0075364_10033326
965 Ga0075364_10046248
966 Ga0075364_10079805
967 Ga0075364_10105714
968 Ga0075364_10368380
969 Ga0075364_10626853
970 Ga0070716_100068541
971 Ga0070712_100177684
972 Ga0075362_10013777
973 Ga0075362_10534151
974 Ga0075362_10758315
975 Ga0075367_10010586
976 Ga0075367_10013260
977 Ga0075367_10147994
978 Ga0075367_10308893
979 Ga0075367_10384956
980 Ga0075367_10576818
981 Ga0075367_10809384
982 Ga0097621_100095012
983 Ga0075370_10005096
984 Ga0075370_10016927
985 Ga0075370_10088068
986 Ga0075370_10092786
987 Ga0075370_10112111
988 Ga0075370_10236385
989 Ga0075370_10240136
990 Ga0075370_10483139
991 Ga0075428_101306331
992 Ga0075434_100448363
993 Ga0068865_100006410
994 Ga0068865_101240273
995 Ga0099794_10688188
996 Ga0111539_10022669
997 Ga0111539_10429045
998 Ga0111539_12215302
999 Ga0105245_10006661
1000 Ga0105245_10149184
1001 Ga0105245_11176443
1002 Ga0105245_11416945
1003 Ga0105247_10785830
1004 Ga0105243_10008995
1005 Ga0105243_10057122
1006 Ga0105243_10117055
1007 Ga0105243_10796968
1008 Ga0105243_13111820
1009 Ga0105241_11631902
1010 Ga0105241_11846221
1011 Ga0105242_10291878
1012 Ga0105248_10176271
1013 Ga0105248_10280123
1014 Ga0105248_10927694
1015 Ga0105238_10116887
1016 Ga0105238_10453376
1017 Ga0105238_10457113
1018 Ga0105249_10077828
1019 Ga0105249_10503859
1020 Ga0105249_10624042
1021 Ga0105239_10205479
1022 Ga0105239_10703861
1023 Ga0105239_11508941
1024 Ga0105246_10135858
1025 Ga0105246_10236894
1026 Ga0105246_10834812
1027 Ga0105246_12545040
1028 Ga0157343_1040344
1029 Ga0157371_10132583
1030 Ga0157371_10592231
1031 Ga0157370_10055840
1032 Ga0157370_10394005
1033 Ga0157369_10060483
1034 Ga0157369_10450074
1035 Ga0157369_10744089
1036 Ga0157374_10088060
1037 Ga0157378_10580410
1038 Ga0157372_10017845
1039 Ga0157372_10170547
1040 Ga0157372_10334321
1041 Ga0157375_10144122
1042 Ga0157375_10381825
1043 Ga0163163_10364447
1044 Ga0163163_10900439
1045 Ga0157380_10012435
1046 Ga0157380_10667217
1047 Ga0157380_11664989
1048 Ga0157380_12593609
1049 Ga0182008_10016127
1050 Ga0182008_10188801
1051 Ga0182008_10504207
1052 Ga0157377_10012722
1053 Ga0157377_11255582
1054 Ga0157379_10047972
1055 Ga0157379_11849687
1056 Ga0157379_12462314
1057 Ga0157376_10030728
1058 Ga0163161_10117847
1059 Ga0206356_10923993
1060 Ga0206353_10072911
1061 Ga0206353_10714204
1062 Ga0213875_10111027
1063 Ga0207697_10045134
1064 Ga0207692_10159385
1065 Ga0207642_10693639
1066 Ga0207688_10055281
1067 Ga0207688_10077739
1068 Ga0207688_10268578
1069 Ga0207647_10277363
1070 Ga0207643_10686926
1071 Ga0207643_10703097
1072 Ga0207684_10028079
1073 Ga0207662_10024764
1074 Ga0207662_10064952
1075 Ga0207662_10372230
1076 Ga0207662_10578308
1077 Ga0207652_10413283
1078 Ga0207646_10361486
1079 Ga0207694_10570502
1080 Ga0207694_10918753
1081 Ga0207659_10551450
1082 Ga0207659_10785281
1083 Ga0207687_10311155
1084 Ga0207664_10014461
1085 Ga0207706_10405461
1086 Ga0207686_10118658
1087 Ga0207709_10006110
1088 Ga0207709_10275695
1089 Ga0207709_10777810
1090 Ga0207670_10633133
1091 Ga0207669_10173011
1092 Ga0207669_10184364
1093 Ga0207704_10021454
1094 Ga0207704_11775094
1095 Ga0207665_10020098
1096 Ga0207691_10048458
1097 Ga0207691_10555431
1098 Ga0207691_10632158
1099 Ga0207711_10232539
1100 Ga0207711_10550716
1101 Ga0207711_10581936
1102 Ga0207711_11076889
1103 Ga0207689_11476696
1104 Ga0207661_10040040
1105 Ga0207661_10235774
1106 Ga0207661_10367564
1107 Ga0207661_10694475
1108 Ga0207661_11895109
1109 Ga0207679_10796879
1110 Ga0207679_11376934
1111 Ga0207667_10346453
1112 Ga0207712_10118587
1113 Ga0207712_10934463
1114 Ga0207668_10110353
1115 Ga0207668_11753543
1116 Ga0207640_10119996
1117 Ga0207658_10201623
1118 Ga0207658_10408660
1119 Ga0207677_10122478
1120 Ga0207677_10199237
1121 Ga0207677_10264607
1122 Ga0207639_10104399
1123 Ga0207678_10222738
1124 Ga0207708_10000511
1125 Ga0207708_10266340
1126 Ga0207702_10481123
1127 Ga0207648_10003555
1128 Ga0207676_10649977
1129 Ga0207674_10194532
1130 Ga0207675_100002095
1131 Ga0207675_100069327
1132 Ga0207675_101693191
1133 Ga0207683_10056701
1134 Ga0207683_10733309
1135 Ga0207698_10021176
1136 Ga0207698_10515121
1137 Ga0207698_11409967
1138 Ga0207698_12534344
1139 Ga0209813_10022513
1140 Ga0209813_10253597
1141 Ga0209813_10294508
1142 Ga0207428_10063586
1143 Ga0268264_10000343
1144 Ga0268264_10678611
1145 Ga0316178_1065008
1146 Ga0316181_1211841
1147 Ga0316182_1091689
1148 Ga0307408_100268767
1149 Ga0307408_101175305
1150 Ga0307408_102434733
1151 Ga0307405_10223790
1152 Ga0307405_10413224
1153 Ga0307405_10724272
1154 Ga0307413_10115143
1155 Ga0307413_10309469
1156 Ga0307413_10592244
1157 Ga0307413_10742384
1158 Ga0307410_10010912
1159 Ga0307410_10403325
1160 Ga0307410_10436705
1161 Ga0307410_10532935
1162 Ga0307410_10540579
1163 Ga0307410_10744798
1164 Ga0307410_11090317
1165 Ga0307406_10163407
1166 Ga0307406_10310705
1167 Ga0307406_10671081
1168 Ga0307407_10014092
1169 Ga0307407_10082480
1170 Ga0307407_10093730
1171 Ga0307407_10721240
1172 Ga0307412_10070640
1173 Ga0307412_11138154
1174 Ga0307409_100002374
1175 Ga0307409_100015538
1176 Ga0307409_100037981
1177 Ga0307409_100050275
1178 Ga0307409_100129975
1179 Ga0307409_100161435
1180 Ga0307409_100168518
1181 Ga0307409_100301011
1182 Ga0307409_100436712
1183 Ga0307409_101117504
1184 Ga0307409_101422933
1185 Ga0307409_101501509
1186 Ga0307409_101508050
1187 Ga0307409_101697988
1188 Ga0307416_100149323
1189 Ga0307416_100342717
1190 Ga0307416_100446637
1191 Ga0307416_101505587
1192 Ga0307416_102020975
1193 Ga0307414_10165708
1194 Ga0307414_10649613
1195 Ga0307411_10027450
1196 Ga0307411_10320079
1197 Ga0307411_10620784
1198 Ga0307411_10910347
1199 Ga0307411_11294901
1200 Ga0307415_100007929
1201 Ga0307415_100008326
1202 Ga0307415_100770096
1203 Ga0307415_101381706
1204 Ga0307415_101891864
1205 Ga0307415_101960576
1206 Ga0373959_0055085
1207 Ga0373938_0233092
1208 Ga0373926_0120709
1209 Ga0373934_0344868
1210 Ga0373944_0155796
1211 Ga0373923_0114884
1212 Ga0373936_0019093
1213 Ga0373941_0241531
1214 Ga0373953_0121992
1215 Ga0373956_0007485
1216 Ga0373957_0442472
1217 Ga0373943_0651341
1218 Ga0373955_0042790
1219 Ga0373924_0150936
1220 Ga0373935_0057208
1221 Ga0373935_0473048
1222 Ga0373927_0243458
1223 Ga0373933_1096635
1224 Ga0373947_0599707
1225 Ga0373937_0053592
1226 Ga0373925_1349864
1227 Ga0395900_0927168
1228 Ga0395898_0561028
1229 Ga0395898_0913252
1230 Ga0395898_1549922
1231 Ga0395905_0270556
1232 Ga0436364_0377508
1233 Ga0436364_0604960
1234 Ga0436364_0677451
1235 Ga0395901_0016125
1236 Ga0395901_0074662
1237 Ga0395901_0239719
1238 Ga0395901_0346903
1239 Ga0439465_0276293
1240 Ga0451789_0439321
1241 Ga0451789_1093280
1242 Ga0451793_0216178
1243 Ga0451793_0300424
1244 Ga0451793_0819880
1245 Ga0451795_0722433
1246 Ga0451795_0900417
1247 Ga0451800_0070332
1248 Ga0451804_0584031
1249 Ga0451807_1458531
1250 Ga0451833_0016686
1251 Ga0451833_1361652
1252 Ga0451835_0975322
1253 Ga0451839_0290448
1254 Ga0451839_0675532
1255 Ga0451841_0694075
1256 Ga0451841_1330074
1257 Ga0451847_0681827
1258 Ga0451851_0594568
1259 Ga0451843_0265237
1260 Ga0451843_1275745
1261 Ga0451853_1246941
1262 Ga0451853_2182320
1263 Ga0466969_0484302
1264 Ga0466972_0045370
1265 Ga0466965_0026893
1266 Ga0466965_0037788
1267 Ga0466965_0058162
1268 Ga0466965_0135751
1269 Ga0466965_0201825
1270 Ga0466965_0902931
1271 Ga0466966_0010950
1272 Ga0466966_0108423
1273 Ga0466966_0150675
1274 Ga0466966_0289186
1275 Ga0466966_0687306
1276 Ga0466961_0018326
1277 Ga0466961_0022820
1278 Ga0466961_0271242
1279 Ga0466961_0291420
1280 Ga0466961_0579570
1281 Ga0466963_0016618
1282 Ga0466963_0040016
1283 Ga0466963_0370344
1284 Ga0466964_0139265
1285 Ga0466971_0139191
1286 Ga0466971_0163224
1287 Ga0466971_0176682
1288 Ga0466968_0251155
1289 Ga0466968_0575442
1290 Ga0466970_0006592
1291 Ga0466970_0089211
1292 Ga0466970_0179851
1293 Ga0466970_0222973
1294 Ga0466970_0228239
1295 Ga0466970_0230379
1296 Ga0466970_0355712
1297 Ga0466970_0389494
1298 Ga0466970_0414055
1299 Ga0466970_0539631
1300 Ga0466957_0022078
1301 Ga0466957_0169012
1302 Ga0466957_0367828
1303 Ga0466957_0580316
1304 Ga0466960_0004028
1305 Ga0466960_0014736
1306 Ga0466960_0047544
1307 Ga0466960_0134924
1308 Ga0466960_0325997
1309 Ga0466960_0411134
1310 Ga0466960_0642132
1311 Ga0466959_0163483
1312 Ga0466959_1056823
1313 Ga0466958_0066184
1314 Ga0466958_0541177
1315 Ga0466967_0012575
1316 Ga0466967_0016498
1317 Ga0466967_0043530
1318 Ga0466967_0056674
1319 Ga0466967_0269733
1320 Ga0466967_0274906
1321 Ga0466967_0489334
1322 Ga0466967_0499879
1323 Ga0466967_0572989
1324 Ga0466967_0668416
1325 Ga0466967_1091297
1326 Ga0466967_2566444
1327 Ga0495592_0339825
1328 Ga0495603_0063945
1329 Ga0495603_0645788
1330 Ga0495629_0066955
1331 Ga0495629_1040533
1332 Ga0495651_0001003
1333 Ga0495653_0083818
1334 Ga0495582_0327596
1335 Ga0495582_0362371
1336 Ga0495639_0130276
1337 Ga0495664_0060987
1338 Ga0495664_0765698
1339 Ga0495608_0238952
1340 Ga0495618_0019628
1341 Ga0495628_0057116
1342 Ga0495630_0176703
1343 Ga0495630_1250215
1344 Ga0495666_0401297
1345 Ga0495652_0048027
1346 Ga0495652_0342539
1347 Ga0495652_1071243
1348 Ga0495665_0156969
1349 Ga0495640_0006350
1350 Ga0495587_0074489
1351 Ga0495645_0037079
1352 Ga0495667_0044499
1353 Ga0495667_0824442
1354 Ga0495635_0012566
1355 Ga0495588_0256816
1356 Ga0495657_0064215
1357 Ga0495657_0146144
1358 Ga0495599_0009218
1359 Ga0495599_0431079
1360 Ga0495646_0004081
1361 Ga0495646_0627699
1362 Ga0495658_0853705
1363 Ga0495613_1008858
1364 Ga0495600_0013591
1365 Ga0495604_0000897
1366 Ga0495674_0023005
1367 Ga0495674_0289531
1368 Ga0495676_0414311
1369 Ga0495680_0041485
1370 Ga0495680_0392577
1371 Ga0495684_0988516
1372 Ga0495593_0209032
1373 Ga0495602_0109227
1374 Ga0495614_0236439
1375 Ga0496100_0012418
1376 Ga0496100_0185845
1377 Ga0496100_0414602
1378 Ga0496100_0915433
1379 Ga0496101_0078260
1380 Ga0496101_0570935
1381 Ga0496102_0026810
1382 Ga0496102_0829948
1383 Ga0496102_1864009
1384 Ga0496103_0036039
1385 Ga0496103_0871742
1386 Ga0496104_0059494
1387 Ga0496104_0584317
1388 Ga0496104_0595156
1389 Ga0496104_1501751
1390 Ga0496105_0020613
1391 Ga0496105_0104813
1392 Ga0496106_0003757
1393 Ga0496106_0465293
1394 Ga0496106_0603173
1395 Ga0496106_0991015
1396 Ga0496107_0426615
1397 Ga0496107_0472754
1398 Ga0496108_0016818
1399 Ga0496108_0058493
1400 Ga0496109_0009737
1401 Ga0496109_0072342
1402 Ga0496109_0094948
1403 Ga0496109_0547155
1404 Ga0496110_0010577
1405 Ga0496110_0027745
1406 Ga0496110_0115260
1407 Ga0496110_0321290
1408 Ga0496110_0533761
1409 Ga0496110_0622305
1410 Ga0496111_0193544
1411 Ga0496111_0404817
1412 Ga0496112_0097857
1413 Ga0496112_0106520
1414 Ga0496113_0115637
1415 Ga0496113_0151530
1416 Ga0496113_1290220
1417 Ga0496114_0023731
1418 Ga0496114_0064601
1419 Ga0496114_0085920
1420 Ga0496114_0763500
1421 Ga0496114_0904998
1422 Ga0496114_1242133
1423 Ga0496115_1349516
1424 Ga0496124_0069059
1425 Ga0501291_048793
1426 Ga0501031_0002605
1427 Ga0501031_0011951
1428 Ga0501031_0034223
1429 Ga0501031_0238198
1430 Ga0501031_0284553
1431 Ga0501031_0311367
1432 Ga0501031_0398910
1433 Ga0501031_1056486
1434 Ga0501032_0015704
1435 Ga0501032_0023365
1436 Ga0501032_0142750
1437 Ga0501033_0003058
1438 Ga0501033_0351755
1439 Ga0501033_0379466
1440 Ga0501033_0467121
1441 Ga0501034_0263117
1442 Ga0501034_0943584
1443 Ga0501034_1010786
1444 Ga0501036_0024749
1445 Ga0501036_0082940
1446 Ga0501036_0299954
1447 Ga0501036_0469874
1448 Ga0501037_0040863
1449 Ga0501037_0090116
1450 Ga0501037_1062721
1451 Ga0501038_0002213
1452 Ga0501038_0034325
1453 Ga0501038_0924892
1454 Ga0501039_0017268
1455 Ga0501039_0018411
1456 Ga0501039_0043080
1457 Ga0501039_0081598
1458 Ga0501039_0280064
1459 Ga0501039_0608518
1460 Ga0501040_0026139
1461 Ga0501040_0152116
1462 Ga0501040_0293044
1463 Ga0501040_0495530
1464 Ga0501040_0698118
1465 Ga0501040_1056686
1466 Ga0501040_1185128
1467 Ga0501041_0036170
1468 Ga0501041_0206102
1469 Ga0501041_0250382
1470 Ga0501041_0342159
1471 Ga0501041_0358965
1472 Ga0501042_0004813
1473 Ga0501042_0018268
1474 Ga0501042_0024356
1475 Ga0501042_0135761
1476 Ga0501042_0291655
1477 Ga0501043_0048232
1478 Ga0501043_0118989
1479 Ga0501043_0368615
1480 Ga0501043_0976708
1481 Ga0501046_0000440
1482 Ga0501046_0017835
1483 Ga0501046_0076300
1484 Ga0501046_0252521
1485 Ga0501047_0013506
1486 Ga0501048_0003644
1487 Ga0501048_0020946
1488 Ga0501048_0112450
1489 Ga0501048_0175900
1490 Ga0501048_0453888
1491 Ga0501048_0619744
1492 Ga0501048_1078101
1493 Ga0501067_0004432
1494 Ga0501067_0015155
1495 Ga0501067_0054294
1496 Ga0501067_0084460
1497 Ga0501067_0414688
1498 Ga0501067_0632573
1499 Ga0501068_0159541
1500 Ga0501068_0182958
1501 Ga0501069_0034741
1502 Ga0501069_0043753
1503 Ga0501069_0077428
1504 Ga0501069_0419540
1505 Ga0501069_0432092
1506 Ga0501069_0692581
1507 Ga0501069_0766474
1508 Ga0501070_0031667
1509 Ga0501070_0134154
1510 Ga0501070_0331548
1511 Ga0501070_0446191
1512 Ga0501070_0474979
1513 Ga0501070_0999081
1514 Ga0501070_1068518
1515 Ga0501070_1440098
1516 Ga0501071_0000962
1517 Ga0501071_0117813
1518 Ga0501071_0168808
1519 Ga0501071_0194001
1520 Ga0501071_0418609
1521 Ga0501071_0477608
1522 Ga0501071_0863385
1523 Ga0501071_1236397
1524 Ga0501072_0127343
1525 Ga0501072_0164069
1526 Ga0501072_0180916
1527 Ga0501072_0299880
1528 Ga0501072_0441639
1529 Ga0501072_1122711
1530 Ga0501073_0083180
1531 Ga0501073_0389098
1532 Ga0501073_0921982
1533 Ga0501074_0087661
1534 Ga0501074_0147455
1535 Ga0501074_0193087
1536 Ga0501074_0344547
1537 Ga0501074_0627833
1538 Ga0501074_0668124
1539 Ga0501074_0986924
1540 Ga0501075_0058820
1541 Ga0501075_0198656
1542 Ga0501076_0011529
1543 Ga0501076_0272453
1544 Ga0501076_0414853
1545 Ga0501076_0436717
1546 Ga0501076_0607248
1547 Ga0501076_0813976
1548 Ga0501076_0942857
1549 Ga0501077_0057897
1550 Ga0501077_0122307
1551 Ga0501077_0540295
1552 Ga0501198_112306
1553 Ga0501206_084944
1554 Ga0501224_052743
1555 Ga0501079_0103301
1556 Ga0501079_0189649
1557 Ga0501079_0331752
1558 Ga0501079_0607434
1559 Ga0501079_1206251
1560 Ga0501080_0390455
1561 Ga0501080_0454768
1562 Ga0501080_0464674
1563 Ga0501080_0546220
1564 Ga0501081_0025748
1565 Ga0501081_0073777
1566 Ga0501081_0399812
1567 Ga0501081_0900908
1568 Ga0501083_0310242
1569 Ga0501083_0482575
1570 Ga0501083_0548844
1571 Ga0501270_017970
1572 Ga0501271_019271
1573 Ga0501275_069296
1574 Ga0501035_0033442
1575 Ga0501035_0251034
1576 Ga0501035_0302194
1577 Ga0501035_0324995
1578 Ga0501035_1000042
1579 Ga0501044_0127909
1580 Ga0501044_0657324
1581 Ga0501044_0858405
1582 Ga0501045_0007514
1583 Ga0501045_0346927
1584 Ga0501045_0877128
1585 Ga0501212_080124
1586 nmdc:mga03683_150993_c1
1587 nmdc:mga03683_20406_c1
1588 nmdc:mga03683_284220_c1
1589 nmdc:mga03683_336546_c1
1590 nmdc:mga03n38_15922_c1
1591 nmdc:mga03n38_261299_c1
1592 nmdc:mga03n38_337210_c1
1593 nmdc:mga03n38_38394_c1
1594 nmdc:mga03n38_77748_c1
1595 nmdc:mga00v17_11714_c1
1596 nmdc:mga00v17_165049_c1
1597 nmdc:mga00v17_221934_c1
1598 nmdc:mga00v17_326655_c1
1599 nmdc:mga00v17_441711_c1
1600 nmdc:mga00v17_51413_c1
1601 nmdc:mga00v17_706809_c1
1602 nmdc:mga0yw44_101334_c1
1603 nmdc:mga0yw44_107963_c1
1604 nmdc:mga0yw44_153600_c1
1605 nmdc:mga0yw44_1748_c1
1606 nmdc:mga0yw44_187435_c1
1607 nmdc:mga0yw44_257716_c1
1608 nmdc:mga0yw44_272582_c1
1609 nmdc:mga0yw44_325444_c1
1610 nmdc:mga0yw44_341443_c1
1611 nmdc:mga0yw44_348442_c1
1612 nmdc:mga0yw44_39031_c1
1613 nmdc:mga0yw44_39129_c2
1614 nmdc:mga0yw44_416819_c1
1615 nmdc:mga0yw44_4400_c1
1616 nmdc:mga0yw44_445873_c1
1617 nmdc:mga0yw44_495569_c1
1618 nmdc:mga0yw44_60355_c1
1619 nmdc:mga0yw44_820248_c1
1620 nmdc:mga0yw44_856630_c1
1621 nmdc:mga0yw44_871100_c1
1622 nmdc:mga06z11_143981_c1
1623 nmdc:mga06z11_227438_c1
1624 nmdc:mga06z11_49662_c1
1625 nmdc:mga06z11_63576_c1
1626 nmdc:mga04h51_16758_c1
1627 nmdc:mga04h51_286860_c1
1628 nmdc:mga04h51_64004_c1
1629 nmdc:mga07m45_114432_c1
1630 nmdc:mga07m45_153902_c1
1631 nmdc:mga07m45_168766_c1
1632 nmdc:mga07m45_226379_c1
1633 nmdc:mga07m45_22687_c1
1634 nmdc:mga07m45_295424_c1
1635 nmdc:mga07m45_31455_c1
1636 nmdc:mga07m45_372725_c1
1637 nmdc:mga07m45_438074_c1
1638 nmdc:mga08y16_104701_c1
1639 nmdc:mga08y16_2163668_c1
1640 nmdc:mga08y16_398698_c1
1641 nmdc:mga08y16_44369_c1
1642 nmdc:mga0n895_587280_c1
1643 nmdc:mga0rr50_1298473_c1
1644 nmdc:mga08x19_1342382_c1
1645 nmdc:mga08x19_957101_c1
1646 nmdc:mga0sz30_510235_c1
1647 Ga0495601_0244170
1648 Ga0495601_0467109
1649 Ga0495612_0013052
1650 Ga0495619_0927349
1651 Ga0500644_0000164
1652 Ga0500641_0045908
1653 Ga0500554_085860
1654 Ga0500556_0002474
1655 Ga0500593_000231
1656 Ga0500655_055370
1657 Ga0500568_0240596
1658 Ga0501084_0045884
1659 Ga0501084_0166726
1660 Ga0501084_0206650
1661 Ga0501084_0322345
1662 Ga0501084_0372338
1663 Ga0501084_0510153
1664 Ga0501084_1334613
1665 Ga0501082_0021790
1666 Ga0501082_0137999
1667 Ga0501082_0793631
1668 Ga0501082_1633615
1669 Ga0466962_0065010
1670 Ga0466962_0566771
1671 Ga0530510_0026300
1672 Ga0530510_0050574
1673 Ga0530510_0081094
1674 Ga0530510_0168669
1675 Ga0530510_0757123
1676 2740168588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23719

17

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uje-assembly1.cif.gz_A sbni with c-terminal truncation from staphylococcus aureus 0.6574 27 94
6sdk-assembly1.cif.gz_B crystal structure of bacterial parb dimer bound to cdp 0.6541 25 97
7bnr-assembly1.cif.gz_A crystal structure of a parb q52a mutant from myxococcus xanthus bound to ctpys 0.6532 26 97
7bnk-assembly1.cif.gz_B crystal structure of parb from myxococcus xanthus bound to cdp and monothiophosphate 0.6503 26 97
7o0n-assembly1.cif.gz_B crystal structure of a parb e93a mutant from myxococcus xanthus bound to cdp and monothiophosphate 0.6372 28 97
ID Description Score Start End Superfamily
af_C6T717_7_90_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8428 59 71 3.10.20.90
af_O05823_27_95_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8306 28 94 3.40.140.10
af_O05823_27_95_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7984 28 94 3.40.140.10
af_I1NDB8_41_127_3.90.1530.10 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain 0.6821 26 96 3.90.1530.10
af_Q4DA92_9_104_3.90.1530.10 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain 0.6367 26 97 3.90.1530.10
ID Description Score Start End GO Terms
AF-A0A7M0CR42-F1-model_v4 deleted 0.9364 9 96
AF-A0A1H3GZH8-F1-model_v4 Transcription regulator of the Arc/MetJ class 0.8961 9 95
AF-A0A7I7SYT4-F1-model_v4 Antitoxin VapB 0.8914 1 96
AF-A0A1P8YN44-F1-model_v4 Transcription regulator of the Arc/MetJ class 0.8909 8 95
AF-H6RM84-F1-model_v4 Transcription regulator Arc/MetJ class 0.8881 8 95

Map