F482876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 327 | 1672 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10885447|Ga0105240_108854472 |
| Length | 151 |
| Sequence | MKPRSKFLLGGALVVGVAGYLMASSIRETGQYYLTPTELSTKLKDPRFTDVGVKVGARVVPGTIQKAPSGKEYAFKVTDGAYTFPVVYRGIAPDTFADSVDVVIGGRMGQDGTFHATELLAKCASRYENAPDANKYNKYKQTPGYKAGSRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 223 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 283 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 294 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 301 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 308 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 310 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 312 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 317 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 1.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.84 |
| Rhizosphere | 98.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10885447 | 3300009093 | Archaea | 961 |
| 2 | LJQas_1022040 | 3300000549 | Bacteria | 741 |
| 3 | JGI25406J46586_10035716 | 3300003203 | Bacteria | 1811 |
| 4 | Ga0058861_11597264 | 3300004800 | Bacteria | 969 |
| 5 | Ga0058861_11821463 | 3300004800 | Bacteria | 761 |
| 6 | Ga0058862_11984558 | 3300004803 | Unclassified | 952 |
| 7 | Ga0065712_10122626 | 3300005290 | Bacteria | 1649 |
| 8 | Ga0070676_10244029 | 3300005328 | Bacteria | 1196 |
| 9 | Ga0070676_10408129 | 3300005328 | Bacteria | 947 |
| 10 | Ga0070683_100008911 | 3300005329 | Bacteria | 8550 |
| 11 | Ga0070683_100010847 | 3300005329 | Bacteria | 7845 |
| 12 | Ga0070683_100029283 | 3300005329 | Bacteria | 4983 |
| 13 | Ga0070683_100030109 | 3300005329 | Bacteria | 4922 |
| 14 | Ga0070683_100033117 | 3300005329 | Bacteria | 4710 |
| 15 | Ga0070683_100043330 | 3300005329 | Bacteria | 4148 |
| 16 | Ga0070683_100089458 | 3300005329 | Bacteria | 2889 |
| 17 | Ga0070683_100093758 | 3300005329 | Bacteria | 2821 |
| 18 | Ga0070683_100396682 | 3300005329 | Bacteria | 1316 |
| 19 | Ga0070683_100691803 | 3300005329 | Unclassified | 976 |
| 20 | Ga0070683_101019140 | 3300005329 | Bacteria | 795 |
| 21 | Ga0070690_100033881 | 3300005330 | Bacteria | 3199 |
| 22 | Ga0070690_100034418 | 3300005330 | Bacteria | 3175 |
| 23 | Ga0070670_100142790 | 3300005331 | Bacteria | 2070 |
| 24 | Ga0070670_100559445 | 3300005331 | Bacteria | 1021 |
| 25 | Ga0070670_101222738 | 3300005331 | Bacteria | 687 |
| 26 | Ga0070677_10379961 | 3300005333 | Unclassified | 739 |
| 27 | Ga0068869_100110383 | 3300005334 | Unclassified | 2092 |
| 28 | Ga0070666_10096576 | 3300005335 | Bacteria | 2034 |
| 29 | Ga0070666_10903275 | 3300005335 | Unclassified | 653 |
| 30 | Ga0070680_100003079 | 3300005336 | Bacteria | 12372 |
| 31 | Ga0070680_100009518 | 3300005336 | Bacteria | 7462 |
| 32 | Ga0070680_100028872 | 3300005336 | Bacteria | 4452 |
| 33 | Ga0070680_100032501 | 3300005336 | Bacteria | 4201 |
| 34 | Ga0070680_100042743 | 3300005336 | Bacteria | 3678 |
| 35 | Ga0070680_100115650 | 3300005336 | Unclassified | 2235 |
| 36 | Ga0070680_100519839 | 3300005336 | Bacteria | 1019 |
| 37 | Ga0070680_100894698 | 3300005336 | Unclassified | 766 |
| 38 | Ga0070680_101795097 | 3300005336 | Unclassified | 531 |
| 39 | Ga0070682_100000777 | 3300005337 | Bacteria | 18759 |
| 40 | Ga0070682_100127222 | 3300005337 | Unclassified | 1719 |
| 41 | Ga0070682_100417200 | 3300005337 | Bacteria | 1019 |
| 42 | Ga0070682_100489770 | 3300005337 | Bacteria | 950 |
| 43 | Ga0068868_100390726 | 3300005338 | Unclassified | 1199 |
| 44 | Ga0070660_100815774 | 3300005339 | Unclassified | 785 |
| 45 | Ga0070689_100383811 | 3300005340 | Bacteria | 1184 |
| 46 | Ga0070689_100872484 | 3300005340 | Bacteria | 795 |
| 47 | Ga0070687_100018672 | 3300005343 | Bacteria | 3212 |
| 48 | Ga0070687_100129882 | 3300005343 | Bacteria | 1453 |
| 49 | Ga0070687_100250449 | 3300005343 | Unclassified | 1100 |
| 50 | Ga0070661_100002266 | 3300005344 | Bacteria | 13192 |
| 51 | Ga0070661_100034029 | 3300005344 | Bacteria | 3695 |
| 52 | Ga0070661_100155754 | 3300005344 | Unclassified | 1728 |
| 53 | Ga0070661_100415276 | 3300005344 | Bacteria | 1066 |
| 54 | Ga0070661_100483879 | 3300005344 | Unclassified | 989 |
| 55 | Ga0070661_100577313 | 3300005344 | Unclassified | 907 |
| 56 | Ga0070661_100733709 | 3300005344 | Unclassified | 807 |
| 57 | Ga0070692_10818243 | 3300005345 | Unclassified | 637 |
| 58 | Ga0070668_100006537 | 3300005347 | Bacteria | 8639 |
| 59 | Ga0070669_100379015 | 3300005353 | Bacteria | 1153 |
| 60 | Ga0070675_100024854 | 3300005354 | Bacteria | 4800 |
| 61 | Ga0070675_100039319 | 3300005354 | Bacteria | 3860 |
| 62 | Ga0070671_100342887 | 3300005355 | Bacteria | 1275 |
| 63 | Ga0070674_100401418 | 3300005356 | Unclassified | 1120 |
| 64 | Ga0070674_100584820 | 3300005356 | Unclassified | 941 |
| 65 | Ga0070674_100850288 | 3300005356 | Bacteria | 791 |
| 66 | Ga0070673_100051314 | 3300005364 | Bacteria | 3230 |
| 67 | Ga0070673_100593991 | 3300005364 | Unclassified | 1009 |
| 68 | Ga0070688_100091449 | 3300005365 | Unclassified | 1989 |
| 69 | Ga0070688_100555925 | 3300005365 | Unclassified | 873 |
| 70 | Ga0070659_100084686 | 3300005366 | Bacteria | 2535 |
| 71 | Ga0070659_100130460 | 3300005366 | Bacteria | 2041 |
| 72 | Ga0070659_100324334 | 3300005366 | Bacteria | 1288 |
| 73 | Ga0070667_100051136 | 3300005367 | Bacteria | 3483 |
| 74 | Ga0070703_10151962 | 3300005406 | Bacteria | 870 |
| 75 | Ga0070709_10001179 | 3300005434 | Bacteria | 14368 |
| 76 | Ga0070709_10030577 | 3300005434 | Bacteria | 3232 |
| 77 | Ga0070709_11016704 | 3300005434 | Bacteria | 660 |
| 78 | Ga0070709_11149537 | 3300005434 | Unclassified | 622 |
| 79 | Ga0070714_100019816 | 3300005435 | Bacteria | 5486 |
| 80 | Ga0070714_100059496 | 3300005435 | Bacteria | 3276 |
| 81 | Ga0070714_100165468 | 3300005435 | Bacteria | 2004 |
| 82 | Ga0070714_100615583 | 3300005435 | Unclassified | 1044 |
| 83 | Ga0070713_100000236 | 3300005436 | Bacteria | 36563 |
| 84 | Ga0070713_100023018 | 3300005436 | Bacteria | 4826 |
| 85 | Ga0070713_100256787 | 3300005436 | Unclassified | 1596 |
| 86 | Ga0070713_100382085 | 3300005436 | Bacteria | 1312 |
| 87 | Ga0070710_10035324 | 3300005437 | Unclassified | 2725 |
| 88 | Ga0070710_10043488 | 3300005437 | Bacteria | 2488 |
| 89 | Ga0070710_10410229 | 3300005437 | Bacteria | 910 |
| 90 | Ga0070711_100088094 | 3300005439 | Bacteria | 2230 |
| 91 | Ga0070711_100090410 | 3300005439 | Bacteria | 2205 |
| 92 | Ga0070711_100148788 | 3300005439 | Bacteria | 1763 |
| 93 | Ga0070711_101857415 | 3300005439 | Unclassified | 529 |
| 94 | Ga0070700_100679190 | 3300005441 | Bacteria | 816 |
| 95 | Ga0070700_100937667 | 3300005441 | Unclassified | 707 |
| 96 | Ga0070694_100161765 | 3300005444 | Bacteria | 1643 |
| 97 | Ga0070708_100000077 | 3300005445 | Bacteria | 63116 |
| 98 | Ga0070678_100311328 | 3300005456 | Bacteria | 1342 |
| 99 | Ga0070678_100428723 | 3300005456 | Bacteria | 1154 |
| 100 | Ga0070662_100345178 | 3300005457 | Bacteria | 1218 |
| 101 | Ga0070662_100475888 | 3300005457 | Bacteria | 1039 |
| 102 | Ga0070662_100810349 | 3300005457 | Unclassified | 796 |
| 103 | Ga0070681_10000268 | 3300005458 | Bacteria | 41473 |
| 104 | Ga0070681_10004677 | 3300005458 | Bacteria | 13086 |
| 105 | Ga0070681_10006742 | 3300005458 | Bacteria | 11176 |
| 106 | Ga0070681_10019163 | 3300005458 | Bacteria | 6847 |
| 107 | Ga0070681_10029520 | 3300005458 | Bacteria | 5507 |
| 108 | Ga0070681_10029878 | 3300005458 | Bacteria | 5469 |
| 109 | Ga0070681_10055490 | 3300005458 | Bacteria | 3944 |
| 110 | Ga0070681_10066276 | 3300005458 | Bacteria | 3579 |
| 111 | Ga0070681_10155345 | 3300005458 | Bacteria | 2213 |
| 112 | Ga0070681_10209352 | 3300005458 | Bacteria | 1866 |
| 113 | Ga0070681_10217070 | 3300005458 | Unclassified | 1828 |
| 114 | Ga0070681_10248375 | 3300005458 | Bacteria | 1692 |
| 115 | Ga0070681_10340793 | 3300005458 | Bacteria | 1409 |
| 116 | Ga0070681_10445674 | 3300005458 | Unclassified | 1207 |
| 117 | Ga0070681_10513514 | 3300005458 | Bacteria | 1111 |
| 118 | Ga0068867_100036988 | 3300005459 | Bacteria | 3547 |
| 119 | Ga0068867_100228267 | 3300005459 | Bacteria | 1504 |
| 120 | Ga0068867_100241163 | 3300005459 | Bacteria | 1466 |
| 121 | Ga0068867_101831725 | 3300005459 | Unclassified | 571 |
| 122 | Ga0070685_10037576 | 3300005466 | Bacteria | 2743 |
| 123 | Ga0070685_10300043 | 3300005466 | Bacteria | 1082 |
| 124 | Ga0070706_100332309 | 3300005467 | Bacteria | 1417 |
| 125 | Ga0070706_100648009 | 3300005467 | Unclassified | 981 |
| 126 | Ga0070706_100988013 | 3300005467 | Bacteria | 776 |
| 127 | Ga0070707_100004123 | 3300005468 | Bacteria | 13639 |
| 128 | Ga0070707_100692183 | 3300005468 | Unclassified | 982 |
| 129 | Ga0070698_100009824 | 3300005471 | Bacteria | 10227 |
| 130 | Ga0070698_100012000 | 3300005471 | Bacteria | 9188 |
| 131 | Ga0070698_100140136 | 3300005471 | Bacteria | 2370 |
| 132 | Ga0070698_100174115 | 3300005471 | Bacteria | 2092 |
| 133 | Ga0070698_100557747 | 3300005471 | Unclassified | 1085 |
| 134 | Ga0070699_100027568 | 3300005518 | Bacteria | 4899 |
| 135 | Ga0070699_100226674 | 3300005518 | Bacteria | 1666 |
| 136 | Ga0070679_100000785 | 3300005530 | Bacteria | 27628 |
| 137 | Ga0070679_100003319 | 3300005530 | Bacteria | 14743 |
| 138 | Ga0070679_100014852 | 3300005530 | Bacteria | 7481 |
| 139 | Ga0070679_100019052 | 3300005530 | Bacteria | 6666 |
| 140 | Ga0070679_100026433 | 3300005530 | Bacteria | 5702 |
| 141 | Ga0070679_100048359 | 3300005530 | Bacteria | 4238 |
| 142 | Ga0070679_100056817 | 3300005530 | Bacteria | 3900 |
| 143 | Ga0070679_100058591 | 3300005530 | Bacteria | 3838 |
| 144 | Ga0070679_100101747 | 3300005530 | Bacteria | 2860 |
| 145 | Ga0070679_100146617 | 3300005530 | Bacteria | 2337 |
| 146 | Ga0070679_100282631 | 3300005530 | Unclassified | 1612 |
| 147 | Ga0070679_100333819 | 3300005530 | Bacteria | 1464 |
| 148 | Ga0070679_100588673 | 3300005530 | Bacteria | 1056 |
| 149 | Ga0070679_100906345 | 3300005530 | Unclassified | 825 |
| 150 | Ga0070684_100008138 | 3300005535 | Bacteria | 8185 |
| 151 | Ga0070684_100012724 | 3300005535 | Bacteria | 6754 |
| 152 | Ga0070684_100017914 | 3300005535 | Bacteria | 5822 |
| 153 | Ga0070684_100032796 | 3300005535 | Bacteria | 4430 |
| 154 | Ga0070684_100046679 | 3300005535 | Bacteria | 3753 |
| 155 | Ga0070684_100060974 | 3300005535 | Bacteria | 3301 |
| 156 | Ga0070684_100066529 | 3300005535 | Bacteria | 3164 |
| 157 | Ga0070684_100329142 | 3300005535 | Unclassified | 1404 |
| 158 | Ga0070684_100361996 | 3300005535 | Bacteria | 1335 |
| 159 | Ga0070684_100508522 | 3300005535 | Unclassified | 1116 |
| 160 | Ga0070684_100661161 | 3300005535 | Unclassified | 973 |
| 161 | Ga0070697_100050142 | 3300005536 | Bacteria | 3388 |
| 162 | Ga0070697_100061516 | 3300005536 | Bacteria | 3062 |
| 163 | Ga0068853_100031861 | 3300005539 | Bacteria | 4462 |
| 164 | Ga0070672_100019396 | 3300005543 | Bacteria | 4936 |
| 165 | Ga0070672_100264328 | 3300005543 | Bacteria | 1452 |
| 166 | Ga0070672_100480533 | 3300005543 | Unclassified | 1073 |
| 167 | Ga0070672_100523962 | 3300005543 | Bacteria | 1027 |
| 168 | Ga0070686_100088222 | 3300005544 | Bacteria | 2069 |
| 169 | Ga0070686_101333554 | 3300005544 | Bacteria | 600 |
| 170 | Ga0070695_100350561 | 3300005545 | Bacteria | 1106 |
| 171 | Ga0070695_100559592 | 3300005545 | Unclassified | 892 |
| 172 | Ga0070695_101259703 | 3300005545 | Unclassified | 610 |
| 173 | Ga0070696_100032012 | 3300005546 | Bacteria | 3606 |
| 174 | Ga0070693_100001053 | 3300005547 | Bacteria | 12318 |
| 175 | Ga0070693_100192199 | 3300005547 | Bacteria | 1321 |
| 176 | Ga0070693_100238001 | 3300005547 | Bacteria | 1201 |
| 177 | Ga0070693_100254565 | 3300005547 | Bacteria | 1165 |
| 178 | Ga0070665_100390087 | 3300005548 | Bacteria | 1400 |
| 179 | Ga0070665_100391109 | 3300005548 | Bacteria | 1398 |
| 180 | Ga0070704_100032796 | 3300005549 | Bacteria | 3507 |
| 181 | Ga0068855_100003743 | 3300005563 | Bacteria | 18580 |
| 182 | Ga0068855_100019685 | 3300005563 | Bacteria | 8105 |
| 183 | Ga0068855_100091731 | 3300005563 | Bacteria | 3504 |
| 184 | Ga0068855_100288282 | 3300005563 | Bacteria | 1821 |
| 185 | Ga0068855_100688835 | 3300005563 | Bacteria | 1095 |
| 186 | Ga0068855_101085959 | 3300005563 | Bacteria | 837 |
| 187 | Ga0068855_101253543 | 3300005563 | Unclassified | 769 |
| 188 | Ga0070664_100001222 | 3300005564 | Bacteria | 20514 |
| 189 | Ga0070664_100004722 | 3300005564 | Bacteria | 10928 |
| 190 | Ga0070664_100276568 | 3300005564 | Bacteria | 1513 |
| 191 | Ga0070664_100449984 | 3300005564 | Unclassified | 1182 |
| 192 | Ga0070664_100564773 | 3300005564 | Bacteria | 1053 |
| 193 | Ga0068857_100006845 | 3300005577 | Bacteria | 9812 |
| 194 | Ga0068857_100034949 | 3300005577 | Bacteria | 4448 |
| 195 | Ga0068857_100223305 | 3300005577 | Unclassified | 1721 |
| 196 | Ga0068857_100520702 | 3300005577 | Bacteria | 1118 |
| 197 | Ga0068857_100734255 | 3300005577 | Unclassified | 940 |
| 198 | Ga0068854_100181670 | 3300005578 | Bacteria | 1644 |
| 199 | Ga0068856_100032636 | 3300005614 | Bacteria | 5098 |
| 200 | Ga0068856_100098284 | 3300005614 | Bacteria | 2917 |
| 201 | Ga0068856_100172096 | 3300005614 | Bacteria | 2178 |
| 202 | Ga0068856_100249409 | 3300005614 | Bacteria | 1790 |
| 203 | Ga0068856_100281361 | 3300005614 | Bacteria | 1680 |
| 204 | Ga0068856_100498961 | 3300005614 | Bacteria | 1238 |
| 205 | Ga0068856_101568072 | 3300005614 | Unclassified | 672 |
| 206 | Ga0070702_100419143 | 3300005615 | Unclassified | 963 |
| 207 | Ga0070702_100435972 | 3300005615 | Unclassified | 947 |
| 208 | Ga0068852_100003352 | 3300005616 | Bacteria | 11183 |
| 209 | Ga0068852_100118925 | 3300005616 | Bacteria | 2415 |
| 210 | Ga0068859_100106933 | 3300005617 | Bacteria | 2857 |
| 211 | Ga0068859_100270130 | 3300005617 | Bacteria | 1793 |
| 212 | Ga0068859_100980986 | 3300005617 | Unclassified | 927 |
| 213 | Ga0068864_100062483 | 3300005618 | Bacteria | 3226 |
| 214 | Ga0068864_100188233 | 3300005618 | Bacteria | 1891 |
| 215 | Ga0068864_101454169 | 3300005618 | Bacteria | 688 |
| 216 | Ga0068870_10370660 | 3300005840 | Bacteria | 924 |
| 217 | Ga0068870_10952909 | 3300005840 | Unclassified | 609 |
| 218 | Ga0068863_101054263 | 3300005841 | Unclassified | 817 |
| 219 | Ga0068863_101224046 | 3300005841 | Bacteria | 757 |
| 220 | Ga0068858_100099389 | 3300005842 | Bacteria | 2713 |
| 221 | Ga0068858_100839149 | 3300005842 | Bacteria | 897 |
| 222 | Ga0068860_100458526 | 3300005843 | Bacteria | 1268 |
| 223 | Ga0081455_10226039 | 3300005937 | Bacteria | 1384 |
| 224 | Ga0081539_10000019 | 3300005985 | Bacteria | 369381 |
| 225 | Ga0081539_10047812 | 3300005985 | Bacteria | 2439 |
| 226 | Ga0070717_10001248 | 3300006028 | Bacteria | 17343 |
| 227 | Ga0070717_10191344 | 3300006028 | Bacteria | 1788 |
| 228 | Ga0070717_10390484 | 3300006028 | Bacteria | 1249 |
| 229 | Ga0070717_10395441 | 3300006028 | Bacteria | 1241 |
| 230 | Ga0070717_11220094 | 3300006028 | Unclassified | 684 |
| 231 | Ga0070716_100135570 | 3300006173 | Bacteria | 1563 |
| 232 | Ga0070712_100023679 | 3300006175 | Bacteria | 4060 |
| 233 | Ga0070712_100026447 | 3300006175 | Bacteria | 3865 |
| 234 | Ga0070712_100124156 | 3300006175 | Bacteria | 1947 |
| 235 | Ga0068871_100179361 | 3300006358 | Bacteria | 1819 |
| 236 | Ga0068871_100466335 | 3300006358 | Bacteria | 1134 |
| 237 | Ga0068871_101175591 | 3300006358 | Unclassified | 719 |
| 238 | Ga0075430_100000207 | 3300006846 | Bacteria | 40207 |
| 239 | Ga0075430_100068459 | 3300006846 | Bacteria | 2978 |
| 240 | Ga0075430_100086952 | 3300006846 | Bacteria | 2616 |
| 241 | Ga0075431_100028270 | 3300006847 | Bacteria | 5759 |
| 242 | Ga0075431_100093701 | 3300006847 | Bacteria | 3099 |
| 243 | Ga0075431_100529645 | 3300006847 | Bacteria | 1167 |
| 244 | Ga0075434_100121501 | 3300006871 | Unclassified | 2627 |
| 245 | Ga0075429_100070638 | 3300006880 | Bacteria | 3040 |
| 246 | Ga0068865_100129626 | 3300006881 | Unclassified | 1888 |
| 247 | Ga0068865_100329835 | 3300006881 | Bacteria | 1230 |
| 248 | Ga0075436_100016735 | 3300006914 | Bacteria | 5018 |
| 249 | Ga0075436_100159579 | 3300006914 | Bacteria | 1589 |
| 250 | Ga0097620_100106923 | 3300006931 | Bacteria | 2857 |
| 251 | Ga0097620_100270132 | 3300006931 | Bacteria | 1793 |
| 252 | Ga0097620_100981001 | 3300006931 | Unclassified | 927 |
| 253 | Ga0075435_100337607 | 3300007076 | Bacteria | 1291 |
| 254 | Ga0075435_100469550 | 3300007076 | Unclassified | 1086 |
| 255 | Ga0075435_100582087 | 3300007076 | Unclassified | 970 |
| 256 | Ga0105240_10050510 | 3300009093 | Bacteria | 5242 |
| 257 | Ga0105240_10054991 | 3300009093 | Bacteria | 4985 |
| 258 | Ga0105240_10068321 | 3300009093 | Bacteria | 4402 |
| 259 | Ga0105240_10757575 | 3300009093 | Unclassified | 1055 |
| 260 | Ga0105245_10046020 | 3300009098 | Bacteria | 3898 |
| 261 | Ga0105245_10723173 | 3300009098 | Bacteria | 1030 |
| 262 | Ga0105243_10848797 | 3300009148 | Bacteria | 904 |
| 263 | Ga0105243_12033306 | 3300009148 | Bacteria | 609 |
| 264 | Ga0105241_10066995 | 3300009174 | Bacteria | 2778 |
| 265 | Ga0105241_11480571 | 3300009174 | Unclassified | 653 |
| 266 | Ga0105241_12268324 | 3300009174 | Unclassified | 540 |
| 267 | Ga0105242_10030734 | 3300009176 | Bacteria | 4289 |
| 268 | Ga0105242_10142290 | 3300009176 | Bacteria | 2083 |
| 269 | Ga0105242_10327004 | 3300009176 | Bacteria | 1408 |
| 270 | Ga0105242_10340818 | 3300009176 | Bacteria | 1381 |
| 271 | Ga0105248_10113354 | 3300009177 | Bacteria | 3058 |
| 272 | Ga0105248_10248855 | 3300009177 | Unclassified | 2001 |
| 273 | Ga0105248_11767916 | 3300009177 | Unclassified | 701 |
| 274 | Ga0105237_10123608 | 3300009545 | Bacteria | 2582 |
| 275 | Ga0105237_10493282 | 3300009545 | Unclassified | 1231 |
| 276 | Ga0105238_10196133 | 3300009551 | Bacteria | 1995 |
| 277 | Ga0105238_10391171 | 3300009551 | Bacteria | 1382 |
| 278 | Ga0105238_11015524 | 3300009551 | Bacteria | 850 |
| 279 | Ga0105238_12625519 | 3300009551 | Unclassified | 540 |
| 280 | Ga0105249_10000344 | 3300009553 | Bacteria | 46859 |
| 281 | Ga0105249_10616937 | 3300009553 | Bacteria | 1140 |
| 282 | Ga0105239_10877840 | 3300010375 | Bacteria | 1029 |
| 283 | Ga0105239_11108156 | 3300010375 | Bacteria | 911 |
| 284 | Ga0105246_10769518 | 3300011119 | Bacteria | 851 |
| 285 | Ga0157373_10172683 | 3300013100 | Bacteria | 1521 |
| 286 | Ga0157373_10230716 | 3300013100 | Bacteria | 1307 |
| 287 | Ga0157373_10244606 | 3300013100 | Bacteria | 1268 |
| 288 | Ga0157371_10008593 | 3300013102 | Bacteria | 8116 |
| 289 | Ga0157371_10052955 | 3300013102 | Bacteria | 2882 |
| 290 | Ga0157370_10001913 | 3300013104 | Bacteria | 25621 |
| 291 | Ga0157370_10002900 | 3300013104 | Bacteria | 20453 |
| 292 | Ga0157370_10047062 | 3300013104 | Bacteria | 4135 |
| 293 | Ga0157370_10168066 | 3300013104 | Bacteria | 2039 |
| 294 | Ga0157370_10259951 | 3300013104 | Bacteria | 1605 |
| 295 | Ga0157370_10746903 | 3300013104 | Bacteria | 891 |
| 296 | Ga0157369_10009822 | 3300013105 | Bacteria | 10942 |
| 297 | Ga0157369_10050902 | 3300013105 | Bacteria | 4484 |
| 298 | Ga0157369_10082059 | 3300013105 | Bacteria | 3450 |
| 299 | Ga0157369_10157260 | 3300013105 | Bacteria | 2400 |
| 300 | Ga0157369_10250771 | 3300013105 | Bacteria | 1847 |
| 301 | Ga0157369_10381890 | 3300013105 | Unclassified | 1462 |
| 302 | Ga0157369_10402632 | 3300013105 | Unclassified | 1420 |
| 303 | Ga0157369_10567249 | 3300013105 | Unclassified | 1173 |
| 304 | Ga0157369_10573784 | 3300013105 | Unclassified | 1165 |
| 305 | Ga0157369_10594942 | 3300013105 | Bacteria | 1142 |
| 306 | Ga0157369_10715030 | 3300013105 | Unclassified | 1031 |
| 307 | Ga0157374_10066339 | 3300013296 | Bacteria | 3392 |
| 308 | Ga0157374_10112218 | 3300013296 | Bacteria | 2623 |
| 309 | Ga0157374_10258090 | 3300013296 | Bacteria | 1716 |
| 310 | Ga0157378_10069111 | 3300013297 | Bacteria | 3168 |
| 311 | Ga0157378_10070637 | 3300013297 | Bacteria | 3135 |
| 312 | Ga0157378_10109136 | 3300013297 | Bacteria | 2534 |
| 313 | Ga0157378_10311572 | 3300013297 | Bacteria | 1527 |
| 314 | Ga0157378_10520922 | 3300013297 | Bacteria | 1190 |
| 315 | Ga0157378_10601153 | 3300013297 | Bacteria | 1111 |
| 316 | Ga0157378_11201884 | 3300013297 | Unclassified | 797 |
| 317 | Ga0163162_10103421 | 3300013306 | Bacteria | 2942 |
| 318 | Ga0163162_10243058 | 3300013306 | Bacteria | 1931 |
| 319 | Ga0163162_10568940 | 3300013306 | Bacteria | 1261 |
| 320 | Ga0157372_10014486 | 3300013307 | Bacteria | 8437 |
| 321 | Ga0157372_10018790 | 3300013307 | Bacteria | 7435 |
| 322 | Ga0157372_10052124 | 3300013307 | Bacteria | 4555 |
| 323 | Ga0157372_10203890 | 3300013307 | Bacteria | 2291 |
| 324 | Ga0157372_10204039 | 3300013307 | Bacteria | 2290 |
| 325 | Ga0157372_10417421 | 3300013307 | Unclassified | 1564 |
| 326 | Ga0157372_10519307 | 3300013307 | Bacteria | 1388 |
| 327 | Ga0157372_10844141 | 3300013307 | Bacteria | 1063 |
| 328 | Ga0157375_10066920 | 3300013308 | Bacteria | 3588 |
| 329 | Ga0157375_10115939 | 3300013308 | Bacteria | 2782 |
| 330 | Ga0157375_10117947 | 3300013308 | Bacteria | 2760 |
| 331 | Ga0157375_10125299 | 3300013308 | Bacteria | 2683 |
| 332 | Ga0157375_13066895 | 3300013308 | Unclassified | 557 |
| 333 | Ga0163163_10005933 | 3300014325 | Bacteria | 10631 |
| 334 | Ga0163163_10301929 | 3300014325 | Unclassified | 1653 |
| 335 | Ga0163163_10562424 | 3300014325 | Unclassified | 1203 |
| 336 | Ga0157380_12926639 | 3300014326 | Bacteria | 544 |
| 337 | Ga0182008_10007500 | 3300014497 | Bacteria | 6020 |
| 338 | Ga0157377_10457987 | 3300014745 | Bacteria | 882 |
| 339 | Ga0157377_10728120 | 3300014745 | Unclassified | 723 |
| 340 | Ga0157376_10022816 | 3300014969 | Bacteria | 4886 |
| 341 | Ga0157376_10574039 | 3300014969 | Bacteria | 1119 |
| 342 | Ga0182006_1264514 | 3300015261 | Unclassified | 564 |
| 343 | Ga0182007_10383122 | 3300015262 | Unclassified | 533 |
| 344 | Ga0163161_10556280 | 3300017792 | Unclassified | 941 |
| 345 | Ga0206356_10312477 | 3300020070 | Unclassified | 977 |
| 346 | Ga0206356_10876331 | 3300020070 | Unclassified | 1200 |
| 347 | Ga0206355_1271556 | 3300020076 | Unclassified | 593 |
| 348 | Ga0206352_10863516 | 3300020078 | Unclassified | 1933 |
| 349 | Ga0206353_11982606 | 3300020082 | Unclassified | 904 |
| 350 | Ga0154015_1021647 | 3300020610 | Unclassified | 583 |
| 351 | Ga0213875_10433873 | 3300021388 | Bacteria | 628 |
| 352 | Ga0224712_10232664 | 3300022467 | Unclassified | 846 |
| 353 | Ga0207697_10214111 | 3300025315 | Bacteria | 849 |
| 354 | Ga0207656_10037691 | 3300025321 | Bacteria | 2035 |
| 355 | Ga0207682_10008787 | 3300025893 | Bacteria | 3994 |
| 356 | Ga0207692_10105766 | 3300025898 | Bacteria | 1553 |
| 357 | Ga0207642_10022043 | 3300025899 | Bacteria | 2519 |
| 358 | Ga0207680_10209636 | 3300025903 | Bacteria | 1332 |
| 359 | Ga0207699_10007770 | 3300025906 | Bacteria | 5252 |
| 360 | Ga0207699_10024022 | 3300025906 | Bacteria | 3327 |
| 361 | Ga0207699_10029982 | 3300025906 | Bacteria | 3040 |
| 362 | Ga0207699_10104251 | 3300025906 | Bacteria | 1806 |
| 363 | Ga0207699_10511112 | 3300025906 | Unclassified | 868 |
| 364 | Ga0207699_10883611 | 3300025906 | Unclassified | 659 |
| 365 | Ga0207645_10441453 | 3300025907 | Unclassified | 878 |
| 366 | Ga0207645_10608326 | 3300025907 | Bacteria | 742 |
| 367 | Ga0207643_10085435 | 3300025908 | Bacteria | 1833 |
| 368 | Ga0207705_10006137 | 3300025909 | Bacteria | 8938 |
| 369 | Ga0207705_10148043 | 3300025909 | Unclassified | 1758 |
| 370 | Ga0207705_10235699 | 3300025909 | Unclassified | 1393 |
| 371 | Ga0207705_10892748 | 3300025909 | Bacteria | 689 |
| 372 | Ga0207684_10340787 | 3300025910 | Bacteria | 1291 |
| 373 | Ga0207707_10000432 | 3300025912 | Bacteria | 43560 |
| 374 | Ga0207707_10001510 | 3300025912 | Bacteria | 21481 |
| 375 | Ga0207707_10003571 | 3300025912 | Bacteria | 13788 |
| 376 | Ga0207707_10004623 | 3300025912 | Bacteria | 12091 |
| 377 | Ga0207707_10018559 | 3300025912 | Bacteria | 6062 |
| 378 | Ga0207707_10034569 | 3300025912 | Bacteria | 4422 |
| 379 | Ga0207707_10037065 | 3300025912 | Bacteria | 4260 |
| 380 | Ga0207707_10054407 | 3300025912 | Bacteria | 3484 |
| 381 | Ga0207707_10059825 | 3300025912 | Bacteria | 3315 |
| 382 | Ga0207707_10063257 | 3300025912 | Bacteria | 3221 |
| 383 | Ga0207707_10106981 | 3300025912 | Bacteria | 2445 |
| 384 | Ga0207707_10108305 | 3300025912 | Bacteria | 2429 |
| 385 | Ga0207707_10406278 | 3300025912 | Bacteria | 1169 |
| 386 | Ga0207707_10463787 | 3300025912 | Unclassified | 1083 |
| 387 | Ga0207707_10764535 | 3300025912 | Unclassified | 807 |
| 388 | Ga0207695_10008593 | 3300025913 | Bacteria | 12759 |
| 389 | Ga0207695_10158014 | 3300025913 | Bacteria | 2201 |
| 390 | Ga0207695_10175595 | 3300025913 | Bacteria | 2065 |
| 391 | Ga0207695_10592750 | 3300025913 | Archaea | 989 |
| 392 | Ga0207671_10072677 | 3300025914 | Bacteria | 2567 |
| 393 | Ga0207693_10004917 | 3300025915 | Bacteria | 11228 |
| 394 | Ga0207693_10007418 | 3300025915 | Bacteria | 9018 |
| 395 | Ga0207693_10254290 | 3300025915 | Bacteria | 1378 |
| 396 | Ga0207663_10063064 | 3300025916 | Bacteria | 2359 |
| 397 | Ga0207663_10104501 | 3300025916 | Bacteria | 1910 |
| 398 | Ga0207663_10108698 | 3300025916 | Bacteria | 1878 |
| 399 | Ga0207660_10008548 | 3300025917 | Bacteria | 6625 |
| 400 | Ga0207660_10019370 | 3300025917 | Bacteria | 4549 |
| 401 | Ga0207660_10020911 | 3300025917 | Bacteria | 4396 |
| 402 | Ga0207660_10032801 | 3300025917 | Bacteria | 3587 |
| 403 | Ga0207660_10067801 | 3300025917 | Bacteria | 2586 |
| 404 | Ga0207660_10072435 | 3300025917 | Bacteria | 2509 |
| 405 | Ga0207660_10076721 | 3300025917 | Bacteria | 2444 |
| 406 | Ga0207660_10092920 | 3300025917 | Bacteria | 2240 |
| 407 | Ga0207660_10116649 | 3300025917 | Bacteria | 2017 |
| 408 | Ga0207660_11142453 | 3300025917 | Unclassified | 634 |
| 409 | Ga0207662_10048611 | 3300025918 | Bacteria | 2513 |
| 410 | Ga0207657_10013870 | 3300025919 | Bacteria | 7885 |
| 411 | Ga0207649_10034732 | 3300025920 | Bacteria | 3024 |
| 412 | Ga0207649_10558425 | 3300025920 | Bacteria | 877 |
| 413 | Ga0207649_10718860 | 3300025920 | Bacteria | 775 |
| 414 | Ga0207652_10002065 | 3300025921 | Bacteria | 17280 |
| 415 | Ga0207652_10005307 | 3300025921 | Bacteria | 10456 |
| 416 | Ga0207652_10012052 | 3300025921 | Bacteria | 6978 |
| 417 | Ga0207652_10017735 | 3300025921 | Bacteria | 5830 |
| 418 | Ga0207652_10022604 | 3300025921 | Bacteria | 5204 |
| 419 | Ga0207652_10074619 | 3300025921 | Bacteria | 2954 |
| 420 | Ga0207652_10075399 | 3300025921 | Bacteria | 2940 |
| 421 | Ga0207652_10080750 | 3300025921 | Bacteria | 2844 |
| 422 | Ga0207652_10159471 | 3300025921 | Bacteria | 2022 |
| 423 | Ga0207652_10726941 | 3300025921 | Unclassified | 885 |
| 424 | Ga0207652_10903141 | 3300025921 | Bacteria | 780 |
| 425 | Ga0207652_11374133 | 3300025921 | Bacteria | 609 |
| 426 | Ga0207646_10002998 | 3300025922 | Bacteria | 19494 |
| 427 | Ga0207646_10490518 | 3300025922 | Bacteria | 1107 |
| 428 | Ga0207681_10264484 | 3300025923 | Bacteria | 1348 |
| 429 | Ga0207681_10569348 | 3300025923 | Bacteria | 934 |
| 430 | Ga0207681_10688955 | 3300025923 | Unclassified | 849 |
| 431 | Ga0207694_10038232 | 3300025924 | Bacteria | 3690 |
| 432 | Ga0207694_10073796 | 3300025924 | Bacteria | 2670 |
| 433 | Ga0207650_10011749 | 3300025925 | Bacteria | 6037 |
| 434 | Ga0207650_10039545 | 3300025925 | Bacteria | 3446 |
| 435 | Ga0207650_10116241 | 3300025925 | Bacteria | 2077 |
| 436 | Ga0207650_10792533 | 3300025925 | Bacteria | 803 |
| 437 | Ga0207659_10030128 | 3300025926 | Bacteria | 3704 |
| 438 | Ga0207659_10136891 | 3300025926 | Bacteria | 1897 |
| 439 | Ga0207659_11178600 | 3300025926 | Unclassified | 659 |
| 440 | Ga0207687_10630005 | 3300025927 | Unclassified | 906 |
| 441 | Ga0207700_10000814 | 3300025928 | Bacteria | 18060 |
| 442 | Ga0207700_10007740 | 3300025928 | Bacteria | 6600 |
| 443 | Ga0207700_10024246 | 3300025928 | Bacteria | 4196 |
| 444 | Ga0207700_10415899 | 3300025928 | Bacteria | 1180 |
| 445 | Ga0207700_10555205 | 3300025928 | Bacteria | 1020 |
| 446 | Ga0207700_11005884 | 3300025928 | Bacteria | 746 |
| 447 | Ga0207664_10022875 | 3300025929 | Bacteria | 4675 |
| 448 | Ga0207664_10051966 | 3300025929 | Bacteria | 3239 |
| 449 | Ga0207664_10239913 | 3300025929 | Bacteria | 1578 |
| 450 | Ga0207664_10306276 | 3300025929 | Bacteria | 1399 |
| 451 | Ga0207690_10020334 | 3300025932 | Bacteria | 4100 |
| 452 | Ga0207706_10066338 | 3300025933 | Bacteria | 3176 |
| 453 | Ga0207706_10079090 | 3300025933 | Bacteria | 2892 |
| 454 | Ga0207706_10082151 | 3300025933 | Bacteria | 2832 |
| 455 | Ga0207706_10486493 | 3300025933 | Unclassified | 1066 |
| 456 | Ga0207686_10095202 | 3300025934 | Bacteria | 1976 |
| 457 | Ga0207686_10352119 | 3300025934 | Bacteria | 1109 |
| 458 | Ga0207686_10539149 | 3300025934 | Bacteria | 911 |
| 459 | Ga0207709_10907685 | 3300025935 | Bacteria | 716 |
| 460 | Ga0207670_10087637 | 3300025936 | Bacteria | 2193 |
| 461 | Ga0207670_10216939 | 3300025936 | Bacteria | 1462 |
| 462 | Ga0207669_10113371 | 3300025937 | Unclassified | 1823 |
| 463 | Ga0207669_10244206 | 3300025937 | Unclassified | 1333 |
| 464 | Ga0207669_11795770 | 3300025937 | Bacteria | 524 |
| 465 | Ga0207704_10278642 | 3300025938 | Bacteria | 1270 |
| 466 | Ga0207665_10050890 | 3300025939 | Bacteria | 2787 |
| 467 | Ga0207665_10052149 | 3300025939 | Bacteria | 2756 |
| 468 | Ga0207691_10060895 | 3300025940 | Bacteria | 3429 |
| 469 | Ga0207691_10155292 | 3300025940 | Bacteria | 2010 |
| 470 | Ga0207691_11164591 | 3300025940 | Unclassified | 640 |
| 471 | Ga0207711_10123709 | 3300025941 | Bacteria | 2312 |
| 472 | Ga0207711_10930991 | 3300025941 | Bacteria | 807 |
| 473 | Ga0207711_10988072 | 3300025941 | Unclassified | 781 |
| 474 | Ga0207689_10297140 | 3300025942 | Bacteria | 1338 |
| 475 | Ga0207661_10008490 | 3300025944 | Bacteria | 7344 |
| 476 | Ga0207661_10021377 | 3300025944 | Bacteria | 4847 |
| 477 | Ga0207661_10023246 | 3300025944 | Bacteria | 4683 |
| 478 | Ga0207661_10024956 | 3300025944 | Bacteria | 4539 |
| 479 | Ga0207661_10036648 | 3300025944 | Bacteria | 3830 |
| 480 | Ga0207661_10044991 | 3300025944 | Bacteria | 3491 |
| 481 | Ga0207661_10177636 | 3300025944 | Bacteria | 1857 |
| 482 | Ga0207661_10333950 | 3300025944 | Unclassified | 1365 |
| 483 | Ga0207661_10409436 | 3300025944 | Bacteria | 1230 |
| 484 | Ga0207661_10525083 | 3300025944 | Bacteria | 1083 |
| 485 | Ga0207661_10797729 | 3300025944 | Unclassified | 869 |
| 486 | Ga0207661_11931241 | 3300025944 | Bacteria | 536 |
| 487 | Ga0207679_10008405 | 3300025945 | Bacteria | 6577 |
| 488 | Ga0207679_10074138 | 3300025945 | Bacteria | 2578 |
| 489 | Ga0207679_10263822 | 3300025945 | Bacteria | 1470 |
| 490 | Ga0207679_10512571 | 3300025945 | Bacteria | 1072 |
| 491 | Ga0207679_10847292 | 3300025945 | Bacteria | 835 |
| 492 | Ga0207679_11465128 | 3300025945 | Bacteria | 626 |
| 493 | Ga0207667_10006008 | 3300025949 | Bacteria | 14774 |
| 494 | Ga0207667_10062683 | 3300025949 | Bacteria | 3886 |
| 495 | Ga0207667_10187991 | 3300025949 | Bacteria | 2120 |
| 496 | Ga0207667_10609592 | 3300025949 | Bacteria | 1100 |
| 497 | Ga0207651_10050558 | 3300025960 | Bacteria | 2823 |
| 498 | Ga0207651_10377718 | 3300025960 | Unclassified | 1200 |
| 499 | Ga0207712_10000226 | 3300025961 | Bacteria | 55648 |
| 500 | Ga0207668_10007763 | 3300025972 | Bacteria | 6383 |
| 501 | Ga0207668_10180412 | 3300025972 | Unclassified | 1665 |
| 502 | Ga0207640_10005816 | 3300025981 | Bacteria | 6724 |
| 503 | Ga0207640_10364303 | 3300025981 | Bacteria | 1166 |
| 504 | Ga0207640_10449088 | 3300025981 | Unclassified | 1062 |
| 505 | Ga0207658_10027924 | 3300025986 | Bacteria | 3970 |
| 506 | Ga0207677_10187172 | 3300026023 | Unclassified | 1634 |
| 507 | Ga0207677_10367929 | 3300026023 | Bacteria | 1210 |
| 508 | Ga0207703_10295391 | 3300026035 | Bacteria | 1476 |
| 509 | Ga0207639_10250433 | 3300026041 | Bacteria | 1544 |
| 510 | Ga0207678_10000124 | 3300026067 | Bacteria | 64383 |
| 511 | Ga0207708_10185090 | 3300026075 | Unclassified | 1655 |
| 512 | Ga0207708_10554895 | 3300026075 | Bacteria | 969 |
| 513 | Ga0207708_11258847 | 3300026075 | Bacteria | 647 |
| 514 | Ga0207702_10067607 | 3300026078 | Bacteria | 3067 |
| 515 | Ga0207702_10161570 | 3300026078 | Bacteria | 2046 |
| 516 | Ga0207702_10271923 | 3300026078 | Bacteria | 1598 |
| 517 | Ga0207702_10524119 | 3300026078 | Bacteria | 1157 |
| 518 | Ga0207702_10846211 | 3300026078 | Unclassified | 905 |
| 519 | Ga0207648_10031391 | 3300026089 | Bacteria | 4697 |
| 520 | Ga0207648_10075107 | 3300026089 | Bacteria | 2947 |
| 521 | Ga0207648_10183973 | 3300026089 | Bacteria | 1850 |
| 522 | Ga0207648_10537694 | 3300026089 | Bacteria | 1072 |
| 523 | Ga0207648_10589625 | 3300026089 | Bacteria | 1024 |
| 524 | Ga0207648_11027537 | 3300026089 | Unclassified | 772 |
| 525 | Ga0207676_10014843 | 3300026095 | Bacteria | 5612 |
| 526 | Ga0207676_10029133 | 3300026095 | Bacteria | 4131 |
| 527 | Ga0207676_10597388 | 3300026095 | Bacteria | 1060 |
| 528 | Ga0207674_10002216 | 3300026116 | Bacteria | 24604 |
| 529 | Ga0207674_10048799 | 3300026116 | Bacteria | 4331 |
| 530 | Ga0207674_10068033 | 3300026116 | Bacteria | 3585 |
| 531 | Ga0207674_10247261 | 3300026116 | Unclassified | 1730 |
| 532 | Ga0207674_10268695 | 3300026116 | Bacteria | 1653 |
| 533 | Ga0207674_11274321 | 3300026116 | Unclassified | 704 |
| 534 | Ga0207675_100299072 | 3300026118 | Bacteria | 1567 |
| 535 | Ga0207675_101673329 | 3300026118 | Unclassified | 656 |
| 536 | Ga0207683_10057400 | 3300026121 | Bacteria | 3417 |
| 537 | Ga0207683_10313742 | 3300026121 | Bacteria | 1436 |
| 538 | Ga0207683_10347778 | 3300026121 | Unclassified | 1360 |
| 539 | Ga0207683_11499884 | 3300026121 | Bacteria | 623 |
| 540 | Ga0207698_10001247 | 3300026142 | Bacteria | 14877 |
| 541 | Ga0207698_10036324 | 3300026142 | Bacteria | 3615 |
| 542 | Ga0207698_10290930 | 3300026142 | Bacteria | 1516 |
| 543 | Ga0207698_10887283 | 3300026142 | Bacteria | 898 |
| 544 | Ga0207698_11503900 | 3300026142 | Unclassified | 689 |
| 545 | Ga0207698_11985280 | 3300026142 | Bacteria | 596 |
| 546 | Ga0209969_1051347 | 3300027360 | Unclassified | 647 |
| 547 | Ga0268266_11006645 | 3300028379 | Bacteria | 806 |
| 548 | Ga0307408_100109383 | 3300031548 | Bacteria | 2120 |
| 549 | Ga0307408_101786912 | 3300031548 | Unclassified | 587 |
| 550 | Ga0307408_101829023 | 3300031548 | Bacteria | 581 |
| 551 | Ga0307405_10047144 | 3300031731 | Bacteria | 2652 |
| 552 | Ga0307405_10078325 | 3300031731 | Bacteria | 2151 |
| 553 | Ga0307405_10484455 | 3300031731 | Bacteria | 988 |
| 554 | Ga0307405_10599841 | 3300031731 | Unclassified | 898 |
| 555 | Ga0307405_11298176 | 3300031731 | Bacteria | 633 |
| 556 | Ga0307413_10006969 | 3300031824 | Bacteria | 5207 |
| 557 | Ga0307413_10137547 | 3300031824 | Bacteria | 1682 |
| 558 | Ga0307413_10333439 | 3300031824 | Unclassified | 1164 |
| 559 | Ga0307413_10908755 | 3300031824 | Unclassified | 748 |
| 560 | Ga0307410_10145603 | 3300031852 | Bacteria | 1758 |
| 561 | Ga0307410_10242709 | 3300031852 | Unclassified | 1397 |
| 562 | Ga0307410_10281927 | 3300031852 | Bacteria | 1304 |
| 563 | Ga0307410_10694890 | 3300031852 | Bacteria | 857 |
| 564 | Ga0307406_10074864 | 3300031901 | Bacteria | 2231 |
| 565 | Ga0307406_10417760 | 3300031901 | Bacteria | 1068 |
| 566 | Ga0307406_10911077 | 3300031901 | Unclassified | 749 |
| 567 | Ga0307406_11198278 | 3300031901 | Bacteria | 659 |
| 568 | Ga0307407_10110341 | 3300031903 | Unclassified | 1725 |
| 569 | Ga0307407_10257216 | 3300031903 | Bacteria | 1199 |
| 570 | Ga0307407_10904462 | 3300031903 | Unclassified | 677 |
| 571 | Ga0307412_10213509 | 3300031911 | Unclassified | 1474 |
| 572 | Ga0307412_10357274 | 3300031911 | Unclassified | 1175 |
| 573 | Ga0307412_11239783 | 3300031911 | Unclassified | 669 |
| 574 | Ga0307412_11243104 | 3300031911 | Bacteria | 668 |
| 575 | Ga0307412_11302074 | 3300031911 | Bacteria | 654 |
| 576 | Ga0307412_11327304 | 3300031911 | Bacteria | 648 |
| 577 | Ga0307409_100002809 | 3300031995 | Bacteria | 9209 |
| 578 | Ga0307409_100033606 | 3300031995 | Bacteria | 3734 |
| 579 | Ga0307409_100194692 | 3300031995 | Unclassified | 1808 |
| 580 | Ga0307409_100475264 | 3300031995 | Bacteria | 1211 |
| 581 | Ga0307416_100189059 | 3300032002 | Unclassified | 1939 |
| 582 | Ga0307416_100228056 | 3300032002 | Bacteria | 1793 |
| 583 | Ga0307416_100347272 | 3300032002 | Bacteria | 1500 |
| 584 | Ga0307416_100698232 | 3300032002 | Bacteria | 1103 |
| 585 | Ga0307416_100734978 | 3300032002 | Bacteria | 1078 |
| 586 | Ga0307416_100981549 | 3300032002 | Bacteria | 947 |
| 587 | Ga0307416_102634115 | 3300032002 | Bacteria | 600 |
| 588 | Ga0307416_102707696 | 3300032002 | Bacteria | 592 |
| 589 | Ga0307416_102727573 | 3300032002 | Unclassified | 590 |
| 590 | Ga0307414_10037708 | 3300032004 | Bacteria | 3239 |
| 591 | Ga0307414_10221800 | 3300032004 | Bacteria | 1553 |
| 592 | Ga0307414_10293469 | 3300032004 | Unclassified | 1372 |
| 593 | Ga0307414_10393255 | 3300032004 | Bacteria | 1202 |
| 594 | Ga0307414_11588483 | 3300032004 | Bacteria | 609 |
| 595 | Ga0307411_10020590 | 3300032005 | Bacteria | 3840 |
| 596 | Ga0307411_10051501 | 3300032005 | Bacteria | 2687 |
| 597 | Ga0307411_10548234 | 3300032005 | Bacteria | 986 |
| 598 | Ga0307415_100062457 | 3300032126 | Bacteria | 2584 |
| 599 | Ga0307415_100458562 | 3300032126 | Bacteria | 1104 |
| 600 | Ga0307415_101448333 | 3300032126 | Bacteria | 655 |
| 601 | Ga0307415_101467360 | 3300032126 | Unclassified | 651 |
| 602 | Ga0373959_0026780 | 3300034820 | Unclassified | 1141 |
| 603 | Ga0373959_0197164 | 3300034820 | Bacteria | 530 |
| 604 | Ga0373938_0114305 | 3300034957 | Bacteria | 690 |
| 605 | Ga0373926_0000406 | 3300035083 | Bacteria | 11084 |
| 606 | Ga0373926_0092110 | 3300035083 | Bacteria | 1128 |
| 607 | Ga0373934_0000795 | 3300035086 | Bacteria | 11356 |
| 608 | Ga0373934_0007440 | 3300035086 | Bacteria | 4065 |
| 609 | Ga0373934_0241556 | 3300035086 | Bacteria | 746 |
| 610 | Ga0373940_0119298 | 3300035088 | Unclassified | 817 |
| 611 | Ga0373923_0009846 | 3300035111 | Bacteria | 3460 |
| 612 | Ga0373945_0110231 | 3300035116 | Bacteria | 1085 |
| 613 | Ga0373953_0001700 | 3300035117 | Bacteria | 6477 |
| 614 | Ga0373954_0014580 | 3300035118 | Bacteria | 3505 |
| 615 | Ga0373954_0017794 | 3300035118 | Bacteria | 3195 |
| 616 | Ga0373956_0000374 | 3300035119 | Bacteria | 18296 |
| 617 | Ga0373956_0063468 | 3300035119 | Bacteria | 1675 |
| 618 | Ga0373960_0020933 | 3300035121 | Bacteria | 1734 |
| 619 | Ga0373943_0000799 | 3300035170 | Bacteria | 13810 |
| 620 | Ga0373943_0221095 | 3300035170 | Bacteria | 1055 |
| 621 | Ga0373943_0281446 | 3300035170 | Bacteria | 940 |
| 622 | Ga0373943_0531651 | 3300035170 | Unclassified | 689 |
| 623 | Ga0373955_0059879 | 3300035172 | Bacteria | 2098 |
| 624 | Ga0373924_0001016 | 3300035410 | Bacteria | 8900 |
| 625 | Ga0373924_0263533 | 3300035410 | Bacteria | 764 |
| 626 | Ga0373931_0533432 | 3300035691 | Bacteria | 761 |
| 627 | Ga0373935_0038208 | 3300035692 | Bacteria | 3005 |
| 628 | Ga0373935_0119913 | 3300035692 | Bacteria | 1756 |
| 629 | Ga0373935_0976432 | 3300035692 | Bacteria | 629 |
| 630 | Ga0373927_0009895 | 3300035695 | Bacteria | 6393 |
| 631 | Ga0373927_0217398 | 3300035695 | Bacteria | 1255 |
| 632 | Ga0373927_0541478 | 3300035695 | Bacteria | 769 |
| 633 | Ga0373933_0000104 | 3300035724 | Bacteria | 53573 |
| 634 | Ga0373933_0527778 | 3300035724 | Bacteria | 774 |
| 635 | Ga0373947_0000102 | 3300035725 | Bacteria | 42788 |
| 636 | Ga0373947_0190476 | 3300035725 | Bacteria | 1338 |
| 637 | Ga0373947_0362013 | 3300035725 | Bacteria | 974 |
| 638 | Ga0373947_0478239 | 3300035725 | Bacteria | 845 |
| 639 | Ga0373937_0000161 | 3300036401 | Bacteria | 64761 |
| 640 | Ga0373937_0019820 | 3300036401 | Bacteria | 6023 |
| 641 | Ga0373925_0000385 | 3300037068 | Bacteria | 45502 |
| 642 | Ga0395900_0033451 | 3300037418 | Bacteria | 5291 |
| 643 | Ga0395905_0061334 | 3300037471 | Bacteria | 3518 |
| 644 | Ga0395905_0149515 | 3300037471 | Bacteria | 2197 |
| 645 | Ga0436364_1330477 | 3300037853 | Bacteria | 1559 |
| 646 | Ga0395901_0004951 | 3300038443 | Bacteria | 13442 |
| 647 | Ga0436365_0932097 | 3300039437 | Bacteria | 4616 |
| 648 | Ga0436365_1418704 | 3300039437 | Bacteria | 1026 |
| 649 | Ga0436363_1147403 | 3300039450 | Unclassified | 672 |
| 650 | Ga0450898_040104 | 3300042134 | Unclassified | 883 |
| 651 | Ga0450910_060202 | 3300042147 | Bacteria | 640 |
| 652 | Ga0451577_0289349 | 3300042876 | Unclassified | 1485 |
| 653 | Ga0466966_0013164 | 3300044684 | Bacteria | 5478 |
| 654 | Ga0466963_0174411 | 3300044694 | Bacteria | 1500 |
| 655 | Ga0466971_0243162 | 3300044719 | Unclassified | 856 |
| 656 | Ga0466957_0276971 | 3300044842 | Unclassified | 1122 |
| 657 | Ga0466957_0492095 | 3300044842 | Bacteria | 849 |
| 658 | Ga0466957_0693503 | 3300044842 | Bacteria | 718 |
| 659 | Ga0466957_1270242 | 3300044842 | Bacteria | 534 |
| 660 | Ga0466959_0005948 | 3300045049 | Bacteria | 8413 |
| 661 | Ga0466959_0145242 | 3300045049 | Bacteria | 1674 |
| 662 | Ga0451576_0149349 | 3300045051 | Bacteria | 2437 |
| 663 | Ga0451576_1238557 | 3300045051 | Bacteria | 779 |
| 664 | Ga0466958_0055868 | 3300045836 | Bacteria | 2397 |
| 665 | Ga0466967_0035357 | 3300045976 | Bacteria | 4252 |
| 666 | Ga0466967_0076357 | 3300045976 | Bacteria | 3014 |
| 667 | Ga0466967_0259130 | 3300045976 | Unclassified | 1664 |
| 668 | Ga0466967_0342537 | 3300045976 | Bacteria | 1446 |
| 669 | Ga0466967_0417896 | 3300045976 | Bacteria | 1307 |
| 670 | Ga0466967_1256533 | 3300045976 | Unclassified | 738 |
| 671 | Ga0466967_1402312 | 3300045976 | Unclassified | 696 |
| 672 | Ga0495592_0003552 | 3300046454 | Bacteria | 11203 |
| 673 | Ga0495592_0112280 | 3300046454 | Bacteria | 1927 |
| 674 | Ga0495603_0000884 | 3300046455 | Bacteria | 17238 |
| 675 | Ga0495590_0168664 | 3300046457 | Bacteria | 797 |
| 676 | Ga0495629_0020378 | 3300046459 | Bacteria | 4737 |
| 677 | Ga0495651_0000077 | 3300046462 | Bacteria | 71891 |
| 678 | Ga0495651_0008363 | 3300046462 | Bacteria | 7932 |
| 679 | Ga0495653_0000153 | 3300046463 | Bacteria | 57262 |
| 680 | Ga0495653_0012086 | 3300046463 | Bacteria | 7044 |
| 681 | Ga0495580_0002602 | 3300046472 | Bacteria | 15676 |
| 682 | Ga0495580_0005715 | 3300046472 | Bacteria | 10229 |
| 683 | Ga0495580_0028349 | 3300046472 | Bacteria | 4070 |
| 684 | Ga0495582_0008629 | 3300046473 | Bacteria | 5619 |
| 685 | Ga0495582_0021341 | 3300046473 | Bacteria | 3545 |
| 686 | Ga0495639_0000781 | 3300046475 | Bacteria | 14482 |
| 687 | Ga0495639_0084296 | 3300046475 | Bacteria | 1484 |
| 688 | Ga0495639_0455623 | 3300046475 | Unclassified | 650 |
| 689 | Ga0495662_0579013 | 3300046476 | Bacteria | 549 |
| 690 | Ga0495664_0058005 | 3300046477 | Bacteria | 2303 |
| 691 | Ga0495664_0443688 | 3300046477 | Unclassified | 777 |
| 692 | Ga0495594_0005034 | 3300046499 | Bacteria | 6800 |
| 693 | Ga0495594_0272574 | 3300046499 | Bacteria | 964 |
| 694 | Ga0495608_0000166 | 3300046511 | Bacteria | 46948 |
| 695 | Ga0495608_0028104 | 3300046511 | Bacteria | 3823 |
| 696 | Ga0495618_0477979 | 3300046514 | Bacteria | 753 |
| 697 | Ga0495628_0000243 | 3300046516 | Bacteria | 48123 |
| 698 | Ga0495628_0019421 | 3300046516 | Bacteria | 5619 |
| 699 | Ga0495630_0007147 | 3300046517 | Bacteria | 7958 |
| 700 | Ga0495630_0008799 | 3300046517 | Bacteria | 7249 |
| 701 | Ga0495630_0022603 | 3300046517 | Bacteria | 4645 |
| 702 | Ga0495666_0259681 | 3300046526 | Bacteria | 790 |
| 703 | Ga0495652_0001211 | 3300046529 | Bacteria | 28906 |
| 704 | Ga0495652_0002098 | 3300046529 | Bacteria | 21042 |
| 705 | Ga0495665_0000002 | 3300046531 | Bacteria | 128983 |
| 706 | Ga0495665_0005046 | 3300046531 | Bacteria | 7118 |
| 707 | Ga0495665_0259588 | 3300046531 | Unclassified | 893 |
| 708 | Ga0495586_0052282 | 3300046535 | Bacteria | 2212 |
| 709 | Ga0495586_0117462 | 3300046535 | Bacteria | 1484 |
| 710 | Ga0495587_0000452 | 3300046536 | Bacteria | 28656 |
| 711 | Ga0495587_0000999 | 3300046536 | Bacteria | 18595 |
| 712 | Ga0495598_0276021 | 3300046537 | Unclassified | 630 |
| 713 | Ga0495621_0365418 | 3300046539 | Bacteria | 607 |
| 714 | Ga0495645_0000471 | 3300046543 | Bacteria | 27874 |
| 715 | Ga0495645_0000982 | 3300046543 | Bacteria | 19437 |
| 716 | Ga0495645_0640106 | 3300046543 | Bacteria | 650 |
| 717 | Ga0495667_0003199 | 3300046559 | Bacteria | 10978 |
| 718 | Ga0495667_0011862 | 3300046559 | Bacteria | 5905 |
| 719 | Ga0495634_0141367 | 3300046642 | Bacteria | 1528 |
| 720 | Ga0495635_0000048 | 3300046663 | Bacteria | 79393 |
| 721 | Ga0495635_0044941 | 3300046663 | Bacteria | 3047 |
| 722 | Ga0495635_0172381 | 3300046663 | Bacteria | 1471 |
| 723 | Ga0495635_0602769 | 3300046663 | Bacteria | 717 |
| 724 | Ga0495588_0000368 | 3300046674 | Bacteria | 27477 |
| 725 | Ga0495588_0186956 | 3300046674 | Unclassified | 1094 |
| 726 | Ga0495657_0000318 | 3300046675 | Bacteria | 44307 |
| 727 | Ga0495657_0121545 | 3300046675 | Bacteria | 1644 |
| 728 | Ga0495599_0000215 | 3300046678 | Bacteria | 36967 |
| 729 | Ga0495599_0000314 | 3300046678 | Bacteria | 28981 |
| 730 | Ga0495599_0102580 | 3300046678 | Bacteria | 1783 |
| 731 | Ga0495623_0000110 | 3300046679 | Bacteria | 50112 |
| 732 | Ga0495646_0030363 | 3300046680 | Bacteria | 3375 |
| 733 | Ga0495646_0235040 | 3300046680 | Unclassified | 986 |
| 734 | Ga0495658_0000017 | 3300046683 | Bacteria | 93346 |
| 735 | Ga0495658_0400623 | 3300046683 | Bacteria | 875 |
| 736 | Ga0495613_0108468 | 3300046689 | Bacteria | 2002 |
| 737 | Ga0495613_0124705 | 3300046689 | Bacteria | 1847 |
| 738 | Ga0495624_0314852 | 3300046690 | Bacteria | 943 |
| 739 | Ga0495600_0000158 | 3300046809 | Bacteria | 39122 |
| 740 | Ga0495600_0047139 | 3300046809 | Bacteria | 2811 |
| 741 | Ga0495600_0313080 | 3300046809 | Bacteria | 988 |
| 742 | Ga0495581_0003593 | 3300047315 | Bacteria | 8917 |
| 743 | Ga0495581_0117848 | 3300047315 | Bacteria | 1544 |
| 744 | Ga0495581_0571350 | 3300047315 | Unclassified | 656 |
| 745 | Ga0495604_0000017 | 3300047317 | Bacteria | 192029 |
| 746 | Ga0495604_0008370 | 3300047317 | Bacteria | 8178 |
| 747 | Ga0495674_0054988 | 3300047319 | Bacteria | 3492 |
| 748 | Ga0495674_0066067 | 3300047319 | Bacteria | 3140 |
| 749 | Ga0495674_0152042 | 3300047319 | Bacteria | 1940 |
| 750 | Ga0495674_0387934 | 3300047319 | Bacteria | 1129 |
| 751 | Ga0495674_0905920 | 3300047319 | Bacteria | 680 |
| 752 | Ga0495680_0010952 | 3300047322 | Bacteria | 8057 |
| 753 | Ga0495680_0399654 | 3300047322 | Bacteria | 949 |
| 754 | Ga0495675_0010842 | 3300047444 | Bacteria | 5712 |
| 755 | Ga0495675_0056892 | 3300047444 | Bacteria | 2479 |
| 756 | Ga0495675_0325049 | 3300047444 | Unclassified | 909 |
| 757 | Ga0495675_0542737 | 3300047444 | Bacteria | 664 |
| 758 | Ga0495684_0000118 | 3300047471 | Bacteria | 57785 |
| 759 | Ga0495684_0011756 | 3300047471 | Bacteria | 6758 |
| 760 | Ga0495684_0016220 | 3300047471 | Bacteria | 5736 |
| 761 | Ga0495593_0000009 | 3300047673 | Bacteria | 85608 |
| 762 | Ga0495593_0049300 | 3300047673 | Bacteria | 2235 |
| 763 | Ga0495593_0105630 | 3300047673 | Bacteria | 1441 |
| 764 | Ga0495602_0000891 | 3300048088 | Bacteria | 28810 |
| 765 | Ga0495602_0033523 | 3300048088 | Bacteria | 4816 |
| 766 | Ga0495614_0000005 | 3300048089 | Bacteria | 74692 |
| 767 | Ga0496105_0061254 | 3300048908 | Bacteria | 3105 |
| 768 | Ga0496106_0942037 | 3300048909 | Bacteria | 681 |
| 769 | Ga0496107_0766076 | 3300048910 | Bacteria | 708 |
| 770 | Ga0496112_0106171 | 3300048915 | Bacteria | 2778 |
| 771 | Ga0496112_0271262 | 3300048915 | Bacteria | 1645 |
| 772 | Ga0496112_0718216 | 3300048915 | Bacteria | 927 |
| 773 | Ga0496112_0863594 | 3300048915 | Bacteria | 828 |
| 774 | Ga0501298_032334 | 3300049521 | Bacteria | 1032 |
| 775 | Ga0501299_115669 | 3300049522 | Unclassified | 640 |
| 776 | Ga0501034_0312248 | 3300049571 | Bacteria | 1506 |
| 777 | Ga0501046_0049836 | 3300049580 | Bacteria | 3311 |
| 778 | Ga0501067_0069369 | 3300049583 | Bacteria | 1952 |
| 779 | Ga0501067_0529398 | 3300049583 | Unclassified | 660 |
| 780 | Ga0501069_0129996 | 3300049585 | Bacteria | 1442 |
| 781 | Ga0501198_017263 | 3300049649 | Bacteria | 1123 |
| 782 | Ga0501199_024541 | 3300049650 | Unclassified | 716 |
| 783 | Ga0501201_010350 | 3300049651 | Bacteria | 913 |
| 784 | Ga0501202_015320 | 3300049652 | Unclassified | 1476 |
| 785 | Ga0501216_044805 | 3300049660 | Unclassified | 855 |
| 786 | Ga0501217_018500 | 3300049661 | Bacteria | 1618 |
| 787 | Ga0501217_159542 | 3300049661 | Bacteria | 679 |
| 788 | Ga0501223_034388 | 3300049663 | Unclassified | 986 |
| 789 | Ga0501227_010058 | 3300049665 | Bacteria | 2046 |
| 790 | Ga0501233_096015 | 3300049668 | Unclassified | 779 |
| 791 | Ga0501235_012727 | 3300049669 | Bacteria | 1851 |
| 792 | Ga0501240_020245 | 3300049673 | Bacteria | 994 |
| 793 | Ga0501242_008340 | 3300049674 | Unclassified | 1211 |
| 794 | Ga0501242_075100 | 3300049674 | Bacteria | 535 |
| 795 | Ga0501247_026622 | 3300049677 | Unclassified | 773 |
| 796 | Ga0501247_056276 | 3300049677 | Bacteria | 595 |
| 797 | Ga0501248_025618 | 3300049678 | Unclassified | 642 |
| 798 | Ga0501249_007683 | 3300049679 | Bacteria | 2232 |
| 799 | Ga0501249_059967 | 3300049679 | Bacteria | 881 |
| 800 | Ga0501257_061269 | 3300049686 | Unclassified | 951 |
| 801 | Ga0501259_001644 | 3300049688 | Bacteria | 3720 |
| 802 | Ga0501260_052290 | 3300049689 | Unclassified | 517 |
| 803 | Ga0501261_005195 | 3300049690 | Bacteria | 1633 |
| 804 | Ga0501221_003758 | 3300049704 | Bacteria | 2505 |
| 805 | Ga0501225_0002510 | 3300049705 | Bacteria | 5680 |
| 806 | Ga0501225_0023781 | 3300049705 | Bacteria | 1688 |
| 807 | Ga0501229_019382 | 3300049706 | Unclassified | 896 |
| 808 | Ga0501234_026033 | 3300049707 | Unclassified | 939 |
| 809 | Ga0501245_005198 | 3300049708 | Bacteria | 1801 |
| 810 | Ga0501232_007979 | 3300049757 | Bacteria | 1131 |
| 811 | Ga0501266_025714 | 3300049763 | Unclassified | 822 |
| 812 | Ga0501268_000846 | 3300049765 | Bacteria | 3553 |
| 813 | Ga0501268_124431 | 3300049765 | Bacteria | 574 |
| 814 | Ga0501270_016890 | 3300049767 | Unclassified | 1061 |
| 815 | Ga0501274_005818 | 3300049771 | Unclassified | 1051 |
| 816 | Ga0501283_012482 | 3300049779 | Bacteria | 1278 |
| 817 | Ga0501044_0235290 | 3300049823 | Unclassified | 1778 |
| 818 | nmdc:mga09592_370510_c1 | 3300050508 | Unclassified | 1239 |
| 819 | nmdc:mga0qj67_22784_c1 | 3300050509 | Bacteria | 4812 |
| 820 | nmdc:mga0qj67_382_c1 | 3300050509 | Bacteria | 30484 |
| 821 | nmdc:mga0qj67_78994_c1 | 3300050509 | Bacteria | 2634 |
| 822 | nmdc:mga06r32_279396_c1 | 3300050510 | Bacteria | 1657 |
| 823 | nmdc:mga0n895_53043_c1 | 3300050512 | Bacteria | 3982 |
| 824 | nmdc:mga0n895_827708_c1 | 3300050512 | Bacteria | 915 |
| 825 | nmdc:mga0rr50_170280_c1 | 3300050513 | Bacteria | 1774 |
| 826 | nmdc:mga0rr50_229858_c1 | 3300050513 | Bacteria | 1534 |
| 827 | nmdc:mga08x19_124098_c1 | 3300050514 | Unclassified | 1733 |
| 828 | nmdc:mga08x19_45884_c1 | 3300050514 | Bacteria | 2793 |
| 829 | nmdc:mga08x19_990150_c1 | 3300050514 | Bacteria | 597 |
| 830 | Ga0495601_0122231 | 3300053077 | Bacteria | 1691 |
| 831 | Ga0495601_0232687 | 3300053077 | Bacteria | 1203 |
| 832 | Ga0495601_0494684 | 3300053077 | Bacteria | 789 |
| 833 | Ga0495612_0000191 | 3300053078 | Bacteria | 26117 |
| 834 | Ga0495612_0008071 | 3300053078 | Bacteria | 4285 |
| 835 | Ga0495619_0001005 | 3300053085 | Bacteria | 18461 |
| 836 | Ga0495619_0177752 | 3300053085 | Bacteria | 1472 |
| 837 | Ga0105240_10885447 | |||
| 838 | LJQas_1022040 | |||
| 839 | JGI25406J46586_10035716 | |||
| 840 | Ga0058861_11597264 | |||
| 841 | Ga0058861_11821463 | |||
| 842 | Ga0058862_11984558 | |||
| 843 | Ga0065712_10122626 | |||
| 844 | Ga0070676_10244029 | |||
| 845 | Ga0070676_10408129 | |||
| 846 | Ga0070683_100008911 | |||
| 847 | Ga0070683_100010847 | |||
| 848 | Ga0070683_100029283 | |||
| 849 | Ga0070683_100030109 | |||
| 850 | Ga0070683_100033117 | |||
| 851 | Ga0070683_100043330 | |||
| 852 | Ga0070683_100089458 | |||
| 853 | Ga0070683_100093758 | |||
| 854 | Ga0070683_100396682 | |||
| 855 | Ga0070683_100691803 | |||
| 856 | Ga0070683_101019140 | |||
| 857 | Ga0070690_100033881 | |||
| 858 | Ga0070690_100034418 | |||
| 859 | Ga0070670_100142790 | |||
| 860 | Ga0070670_100559445 | |||
| 861 | Ga0070670_101222738 | |||
| 862 | Ga0070677_10379961 | |||
| 863 | Ga0068869_100110383 | |||
| 864 | Ga0070666_10096576 | |||
| 865 | Ga0070666_10903275 | |||
| 866 | Ga0070680_100003079 | |||
| 867 | Ga0070680_100009518 | |||
| 868 | Ga0070680_100028872 | |||
| 869 | Ga0070680_100032501 | |||
| 870 | Ga0070680_100042743 | |||
| 871 | Ga0070680_100115650 | |||
| 872 | Ga0070680_100519839 | |||
| 873 | Ga0070680_100894698 | |||
| 874 | Ga0070680_101795097 | |||
| 875 | Ga0070682_100000777 | |||
| 876 | Ga0070682_100127222 | |||
| 877 | Ga0070682_100417200 | |||
| 878 | Ga0070682_100489770 | |||
| 879 | Ga0068868_100390726 | |||
| 880 | Ga0070660_100815774 | |||
| 881 | Ga0070689_100383811 | |||
| 882 | Ga0070689_100872484 | |||
| 883 | Ga0070687_100018672 | |||
| 884 | Ga0070687_100129882 | |||
| 885 | Ga0070687_100250449 | |||
| 886 | Ga0070661_100002266 | |||
| 887 | Ga0070661_100034029 | |||
| 888 | Ga0070661_100155754 | |||
| 889 | Ga0070661_100415276 | |||
| 890 | Ga0070661_100483879 | |||
| 891 | Ga0070661_100577313 | |||
| 892 | Ga0070661_100733709 | |||
| 893 | Ga0070692_10818243 | |||
| 894 | Ga0070668_100006537 | |||
| 895 | Ga0070669_100379015 | |||
| 896 | Ga0070675_100024854 | |||
| 897 | Ga0070675_100039319 | |||
| 898 | Ga0070671_100342887 | |||
| 899 | Ga0070674_100401418 | |||
| 900 | Ga0070674_100584820 | |||
| 901 | Ga0070674_100850288 | |||
| 902 | Ga0070673_100051314 | |||
| 903 | Ga0070673_100593991 | |||
| 904 | Ga0070688_100091449 | |||
| 905 | Ga0070688_100555925 | |||
| 906 | Ga0070659_100084686 | |||
| 907 | Ga0070659_100130460 | |||
| 908 | Ga0070659_100324334 | |||
| 909 | Ga0070667_100051136 | |||
| 910 | Ga0070703_10151962 | |||
| 911 | Ga0070709_10001179 | |||
| 912 | Ga0070709_10030577 | |||
| 913 | Ga0070709_11016704 | |||
| 914 | Ga0070709_11149537 | |||
| 915 | Ga0070714_100019816 | |||
| 916 | Ga0070714_100059496 | |||
| 917 | Ga0070714_100165468 | |||
| 918 | Ga0070714_100615583 | |||
| 919 | Ga0070713_100000236 | |||
| 920 | Ga0070713_100023018 | |||
| 921 | Ga0070713_100256787 | |||
| 922 | Ga0070713_100382085 | |||
| 923 | Ga0070710_10035324 | |||
| 924 | Ga0070710_10043488 | |||
| 925 | Ga0070710_10410229 | |||
| 926 | Ga0070711_100088094 | |||
| 927 | Ga0070711_100090410 | |||
| 928 | Ga0070711_100148788 | |||
| 929 | Ga0070711_101857415 | |||
| 930 | Ga0070700_100679190 | |||
| 931 | Ga0070700_100937667 | |||
| 932 | Ga0070694_100161765 | |||
| 933 | Ga0070708_100000077 | |||
| 934 | Ga0070678_100311328 | |||
| 935 | Ga0070678_100428723 | |||
| 936 | Ga0070662_100345178 | |||
| 937 | Ga0070662_100475888 | |||
| 938 | Ga0070662_100810349 | |||
| 939 | Ga0070681_10000268 | |||
| 940 | Ga0070681_10004677 | |||
| 941 | Ga0070681_10006742 | |||
| 942 | Ga0070681_10019163 | |||
| 943 | Ga0070681_10029520 | |||
| 944 | Ga0070681_10029878 | |||
| 945 | Ga0070681_10055490 | |||
| 946 | Ga0070681_10066276 | |||
| 947 | Ga0070681_10155345 | |||
| 948 | Ga0070681_10209352 | |||
| 949 | Ga0070681_10217070 | |||
| 950 | Ga0070681_10248375 | |||
| 951 | Ga0070681_10340793 | |||
| 952 | Ga0070681_10445674 | |||
| 953 | Ga0070681_10513514 | |||
| 954 | Ga0068867_100036988 | |||
| 955 | Ga0068867_100228267 | |||
| 956 | Ga0068867_100241163 | |||
| 957 | Ga0068867_101831725 | |||
| 958 | Ga0070685_10037576 | |||
| 959 | Ga0070685_10300043 | |||
| 960 | Ga0070706_100332309 | |||
| 961 | Ga0070706_100648009 | |||
| 962 | Ga0070706_100988013 | |||
| 963 | Ga0070707_100004123 | |||
| 964 | Ga0070707_100692183 | |||
| 965 | Ga0070698_100009824 | |||
| 966 | Ga0070698_100012000 | |||
| 967 | Ga0070698_100140136 | |||
| 968 | Ga0070698_100174115 | |||
| 969 | Ga0070698_100557747 | |||
| 970 | Ga0070699_100027568 | |||
| 971 | Ga0070699_100226674 | |||
| 972 | Ga0070679_100000785 | |||
| 973 | Ga0070679_100003319 | |||
| 974 | Ga0070679_100014852 | |||
| 975 | Ga0070679_100019052 | |||
| 976 | Ga0070679_100026433 | |||
| 977 | Ga0070679_100048359 | |||
| 978 | Ga0070679_100056817 | |||
| 979 | Ga0070679_100058591 | |||
| 980 | Ga0070679_100101747 | |||
| 981 | Ga0070679_100146617 | |||
| 982 | Ga0070679_100282631 | |||
| 983 | Ga0070679_100333819 | |||
| 984 | Ga0070679_100588673 | |||
| 985 | Ga0070679_100906345 | |||
| 986 | Ga0070684_100008138 | |||
| 987 | Ga0070684_100012724 | |||
| 988 | Ga0070684_100017914 | |||
| 989 | Ga0070684_100032796 | |||
| 990 | Ga0070684_100046679 | |||
| 991 | Ga0070684_100060974 | |||
| 992 | Ga0070684_100066529 | |||
| 993 | Ga0070684_100329142 | |||
| 994 | Ga0070684_100361996 | |||
| 995 | Ga0070684_100508522 | |||
| 996 | Ga0070684_100661161 | |||
| 997 | Ga0070697_100050142 | |||
| 998 | Ga0070697_100061516 | |||
| 999 | Ga0068853_100031861 | |||
| 1000 | Ga0070672_100019396 | |||
| 1001 | Ga0070672_100264328 | |||
| 1002 | Ga0070672_100480533 | |||
| 1003 | Ga0070672_100523962 | |||
| 1004 | Ga0070686_100088222 | |||
| 1005 | Ga0070686_101333554 | |||
| 1006 | Ga0070695_100350561 | |||
| 1007 | Ga0070695_100559592 | |||
| 1008 | Ga0070695_101259703 | |||
| 1009 | Ga0070696_100032012 | |||
| 1010 | Ga0070693_100001053 | |||
| 1011 | Ga0070693_100192199 | |||
| 1012 | Ga0070693_100238001 | |||
| 1013 | Ga0070693_100254565 | |||
| 1014 | Ga0070665_100390087 | |||
| 1015 | Ga0070665_100391109 | |||
| 1016 | Ga0070704_100032796 | |||
| 1017 | Ga0068855_100003743 | |||
| 1018 | Ga0068855_100019685 | |||
| 1019 | Ga0068855_100091731 | |||
| 1020 | Ga0068855_100288282 | |||
| 1021 | Ga0068855_100688835 | |||
| 1022 | Ga0068855_101085959 | |||
| 1023 | Ga0068855_101253543 | |||
| 1024 | Ga0070664_100001222 | |||
| 1025 | Ga0070664_100004722 | |||
| 1026 | Ga0070664_100276568 | |||
| 1027 | Ga0070664_100449984 | |||
| 1028 | Ga0070664_100564773 | |||
| 1029 | Ga0068857_100006845 | |||
| 1030 | Ga0068857_100034949 | |||
| 1031 | Ga0068857_100223305 | |||
| 1032 | Ga0068857_100520702 | |||
| 1033 | Ga0068857_100734255 | |||
| 1034 | Ga0068854_100181670 | |||
| 1035 | Ga0068856_100032636 | |||
| 1036 | Ga0068856_100098284 | |||
| 1037 | Ga0068856_100172096 | |||
| 1038 | Ga0068856_100249409 | |||
| 1039 | Ga0068856_100281361 | |||
| 1040 | Ga0068856_100498961 | |||
| 1041 | Ga0068856_101568072 | |||
| 1042 | Ga0070702_100419143 | |||
| 1043 | Ga0070702_100435972 | |||
| 1044 | Ga0068852_100003352 | |||
| 1045 | Ga0068852_100118925 | |||
| 1046 | Ga0068859_100106933 | |||
| 1047 | Ga0068859_100270130 | |||
| 1048 | Ga0068859_100980986 | |||
| 1049 | Ga0068864_100062483 | |||
| 1050 | Ga0068864_100188233 | |||
| 1051 | Ga0068864_101454169 | |||
| 1052 | Ga0068870_10370660 | |||
| 1053 | Ga0068870_10952909 | |||
| 1054 | Ga0068863_101054263 | |||
| 1055 | Ga0068863_101224046 | |||
| 1056 | Ga0068858_100099389 | |||
| 1057 | Ga0068858_100839149 | |||
| 1058 | Ga0068860_100458526 | |||
| 1059 | Ga0081455_10226039 | |||
| 1060 | Ga0081539_10000019 | |||
| 1061 | Ga0081539_10047812 | |||
| 1062 | Ga0070717_10001248 | |||
| 1063 | Ga0070717_10191344 | |||
| 1064 | Ga0070717_10390484 | |||
| 1065 | Ga0070717_10395441 | |||
| 1066 | Ga0070717_11220094 | |||
| 1067 | Ga0070716_100135570 | |||
| 1068 | Ga0070712_100023679 | |||
| 1069 | Ga0070712_100026447 | |||
| 1070 | Ga0070712_100124156 | |||
| 1071 | Ga0068871_100179361 | |||
| 1072 | Ga0068871_100466335 | |||
| 1073 | Ga0068871_101175591 | |||
| 1074 | Ga0075430_100000207 | |||
| 1075 | Ga0075430_100068459 | |||
| 1076 | Ga0075430_100086952 | |||
| 1077 | Ga0075431_100028270 | |||
| 1078 | Ga0075431_100093701 | |||
| 1079 | Ga0075431_100529645 | |||
| 1080 | Ga0075434_100121501 | |||
| 1081 | Ga0075429_100070638 | |||
| 1082 | Ga0068865_100129626 | |||
| 1083 | Ga0068865_100329835 | |||
| 1084 | Ga0075436_100016735 | |||
| 1085 | Ga0075436_100159579 | |||
| 1086 | Ga0097620_100106923 | |||
| 1087 | Ga0097620_100270132 | |||
| 1088 | Ga0097620_100981001 | |||
| 1089 | Ga0075435_100337607 | |||
| 1090 | Ga0075435_100469550 | |||
| 1091 | Ga0075435_100582087 | |||
| 1092 | Ga0105240_10050510 | |||
| 1093 | Ga0105240_10054991 | |||
| 1094 | Ga0105240_10068321 | |||
| 1095 | Ga0105240_10757575 | |||
| 1096 | Ga0105245_10046020 | |||
| 1097 | Ga0105245_10723173 | |||
| 1098 | Ga0105243_10848797 | |||
| 1099 | Ga0105243_12033306 | |||
| 1100 | Ga0105241_10066995 | |||
| 1101 | Ga0105241_11480571 | |||
| 1102 | Ga0105241_12268324 | |||
| 1103 | Ga0105242_10030734 | |||
| 1104 | Ga0105242_10142290 | |||
| 1105 | Ga0105242_10327004 | |||
| 1106 | Ga0105242_10340818 | |||
| 1107 | Ga0105248_10113354 | |||
| 1108 | Ga0105248_10248855 | |||
| 1109 | Ga0105248_11767916 | |||
| 1110 | Ga0105237_10123608 | |||
| 1111 | Ga0105237_10493282 | |||
| 1112 | Ga0105238_10196133 | |||
| 1113 | Ga0105238_10391171 | |||
| 1114 | Ga0105238_11015524 | |||
| 1115 | Ga0105238_12625519 | |||
| 1116 | Ga0105249_10000344 | |||
| 1117 | Ga0105249_10616937 | |||
| 1118 | Ga0105239_10877840 | |||
| 1119 | Ga0105239_11108156 | |||
| 1120 | Ga0105246_10769518 | |||
| 1121 | Ga0157373_10172683 | |||
| 1122 | Ga0157373_10230716 | |||
| 1123 | Ga0157373_10244606 | |||
| 1124 | Ga0157371_10008593 | |||
| 1125 | Ga0157371_10052955 | |||
| 1126 | Ga0157370_10001913 | |||
| 1127 | Ga0157370_10002900 | |||
| 1128 | Ga0157370_10047062 | |||
| 1129 | Ga0157370_10168066 | |||
| 1130 | Ga0157370_10259951 | |||
| 1131 | Ga0157370_10746903 | |||
| 1132 | Ga0157369_10009822 | |||
| 1133 | Ga0157369_10050902 | |||
| 1134 | Ga0157369_10082059 | |||
| 1135 | Ga0157369_10157260 | |||
| 1136 | Ga0157369_10250771 | |||
| 1137 | Ga0157369_10381890 | |||
| 1138 | Ga0157369_10402632 | |||
| 1139 | Ga0157369_10567249 | |||
| 1140 | Ga0157369_10573784 | |||
| 1141 | Ga0157369_10594942 | |||
| 1142 | Ga0157369_10715030 | |||
| 1143 | Ga0157374_10066339 | |||
| 1144 | Ga0157374_10112218 | |||
| 1145 | Ga0157374_10258090 | |||
| 1146 | Ga0157378_10069111 | |||
| 1147 | Ga0157378_10070637 | |||
| 1148 | Ga0157378_10109136 | |||
| 1149 | Ga0157378_10311572 | |||
| 1150 | Ga0157378_10520922 | |||
| 1151 | Ga0157378_10601153 | |||
| 1152 | Ga0157378_11201884 | |||
| 1153 | Ga0163162_10103421 | |||
| 1154 | Ga0163162_10243058 | |||
| 1155 | Ga0163162_10568940 | |||
| 1156 | Ga0157372_10014486 | |||
| 1157 | Ga0157372_10018790 | |||
| 1158 | Ga0157372_10052124 | |||
| 1159 | Ga0157372_10203890 | |||
| 1160 | Ga0157372_10204039 | |||
| 1161 | Ga0157372_10417421 | |||
| 1162 | Ga0157372_10519307 | |||
| 1163 | Ga0157372_10844141 | |||
| 1164 | Ga0157375_10066920 | |||
| 1165 | Ga0157375_10115939 | |||
| 1166 | Ga0157375_10117947 | |||
| 1167 | Ga0157375_10125299 | |||
| 1168 | Ga0157375_13066895 | |||
| 1169 | Ga0163163_10005933 | |||
| 1170 | Ga0163163_10301929 | |||
| 1171 | Ga0163163_10562424 | |||
| 1172 | Ga0157380_12926639 | |||
| 1173 | Ga0182008_10007500 | |||
| 1174 | Ga0157377_10457987 | |||
| 1175 | Ga0157377_10728120 | |||
| 1176 | Ga0157376_10022816 | |||
| 1177 | Ga0157376_10574039 | |||
| 1178 | Ga0182006_1264514 | |||
| 1179 | Ga0182007_10383122 | |||
| 1180 | Ga0163161_10556280 | |||
| 1181 | Ga0206356_10312477 | |||
| 1182 | Ga0206356_10876331 | |||
| 1183 | Ga0206355_1271556 | |||
| 1184 | Ga0206352_10863516 | |||
| 1185 | Ga0206353_11982606 | |||
| 1186 | Ga0154015_1021647 | |||
| 1187 | Ga0213875_10433873 | |||
| 1188 | Ga0224712_10232664 | |||
| 1189 | Ga0207697_10214111 | |||
| 1190 | Ga0207656_10037691 | |||
| 1191 | Ga0207682_10008787 | |||
| 1192 | Ga0207692_10105766 | |||
| 1193 | Ga0207642_10022043 | |||
| 1194 | Ga0207680_10209636 | |||
| 1195 | Ga0207699_10007770 | |||
| 1196 | Ga0207699_10024022 | |||
| 1197 | Ga0207699_10029982 | |||
| 1198 | Ga0207699_10104251 | |||
| 1199 | Ga0207699_10511112 | |||
| 1200 | Ga0207699_10883611 | |||
| 1201 | Ga0207645_10441453 | |||
| 1202 | Ga0207645_10608326 | |||
| 1203 | Ga0207643_10085435 | |||
| 1204 | Ga0207705_10006137 | |||
| 1205 | Ga0207705_10148043 | |||
| 1206 | Ga0207705_10235699 | |||
| 1207 | Ga0207705_10892748 | |||
| 1208 | Ga0207684_10340787 | |||
| 1209 | Ga0207707_10000432 | |||
| 1210 | Ga0207707_10001510 | |||
| 1211 | Ga0207707_10003571 | |||
| 1212 | Ga0207707_10004623 | |||
| 1213 | Ga0207707_10018559 | |||
| 1214 | Ga0207707_10034569 | |||
| 1215 | Ga0207707_10037065 | |||
| 1216 | Ga0207707_10054407 | |||
| 1217 | Ga0207707_10059825 | |||
| 1218 | Ga0207707_10063257 | |||
| 1219 | Ga0207707_10106981 | |||
| 1220 | Ga0207707_10108305 | |||
| 1221 | Ga0207707_10406278 | |||
| 1222 | Ga0207707_10463787 | |||
| 1223 | Ga0207707_10764535 | |||
| 1224 | Ga0207695_10008593 | |||
| 1225 | Ga0207695_10158014 | |||
| 1226 | Ga0207695_10175595 | |||
| 1227 | Ga0207695_10592750 | |||
| 1228 | Ga0207671_10072677 | |||
| 1229 | Ga0207693_10004917 | |||
| 1230 | Ga0207693_10007418 | |||
| 1231 | Ga0207693_10254290 | |||
| 1232 | Ga0207663_10063064 | |||
| 1233 | Ga0207663_10104501 | |||
| 1234 | Ga0207663_10108698 | |||
| 1235 | Ga0207660_10008548 | |||
| 1236 | Ga0207660_10019370 | |||
| 1237 | Ga0207660_10020911 | |||
| 1238 | Ga0207660_10032801 | |||
| 1239 | Ga0207660_10067801 | |||
| 1240 | Ga0207660_10072435 | |||
| 1241 | Ga0207660_10076721 | |||
| 1242 | Ga0207660_10092920 | |||
| 1243 | Ga0207660_10116649 | |||
| 1244 | Ga0207660_11142453 | |||
| 1245 | Ga0207662_10048611 | |||
| 1246 | Ga0207657_10013870 | |||
| 1247 | Ga0207649_10034732 | |||
| 1248 | Ga0207649_10558425 | |||
| 1249 | Ga0207649_10718860 | |||
| 1250 | Ga0207652_10002065 | |||
| 1251 | Ga0207652_10005307 | |||
| 1252 | Ga0207652_10012052 | |||
| 1253 | Ga0207652_10017735 | |||
| 1254 | Ga0207652_10022604 | |||
| 1255 | Ga0207652_10074619 | |||
| 1256 | Ga0207652_10075399 | |||
| 1257 | Ga0207652_10080750 | |||
| 1258 | Ga0207652_10159471 | |||
| 1259 | Ga0207652_10726941 | |||
| 1260 | Ga0207652_10903141 | |||
| 1261 | Ga0207652_11374133 | |||
| 1262 | Ga0207646_10002998 | |||
| 1263 | Ga0207646_10490518 | |||
| 1264 | Ga0207681_10264484 | |||
| 1265 | Ga0207681_10569348 | |||
| 1266 | Ga0207681_10688955 | |||
| 1267 | Ga0207694_10038232 | |||
| 1268 | Ga0207694_10073796 | |||
| 1269 | Ga0207650_10011749 | |||
| 1270 | Ga0207650_10039545 | |||
| 1271 | Ga0207650_10116241 | |||
| 1272 | Ga0207650_10792533 | |||
| 1273 | Ga0207659_10030128 | |||
| 1274 | Ga0207659_10136891 | |||
| 1275 | Ga0207659_11178600 | |||
| 1276 | Ga0207687_10630005 | |||
| 1277 | Ga0207700_10000814 | |||
| 1278 | Ga0207700_10007740 | |||
| 1279 | Ga0207700_10024246 | |||
| 1280 | Ga0207700_10415899 | |||
| 1281 | Ga0207700_10555205 | |||
| 1282 | Ga0207700_11005884 | |||
| 1283 | Ga0207664_10022875 | |||
| 1284 | Ga0207664_10051966 | |||
| 1285 | Ga0207664_10239913 | |||
| 1286 | Ga0207664_10306276 | |||
| 1287 | Ga0207690_10020334 | |||
| 1288 | Ga0207706_10066338 | |||
| 1289 | Ga0207706_10079090 | |||
| 1290 | Ga0207706_10082151 | |||
| 1291 | Ga0207706_10486493 | |||
| 1292 | Ga0207686_10095202 | |||
| 1293 | Ga0207686_10352119 | |||
| 1294 | Ga0207686_10539149 | |||
| 1295 | Ga0207709_10907685 | |||
| 1296 | Ga0207670_10087637 | |||
| 1297 | Ga0207670_10216939 | |||
| 1298 | Ga0207669_10113371 | |||
| 1299 | Ga0207669_10244206 | |||
| 1300 | Ga0207669_11795770 | |||
| 1301 | Ga0207704_10278642 | |||
| 1302 | Ga0207665_10050890 | |||
| 1303 | Ga0207665_10052149 | |||
| 1304 | Ga0207691_10060895 | |||
| 1305 | Ga0207691_10155292 | |||
| 1306 | Ga0207691_11164591 | |||
| 1307 | Ga0207711_10123709 | |||
| 1308 | Ga0207711_10930991 | |||
| 1309 | Ga0207711_10988072 | |||
| 1310 | Ga0207689_10297140 | |||
| 1311 | Ga0207661_10008490 | |||
| 1312 | Ga0207661_10021377 | |||
| 1313 | Ga0207661_10023246 | |||
| 1314 | Ga0207661_10024956 | |||
| 1315 | Ga0207661_10036648 | |||
| 1316 | Ga0207661_10044991 | |||
| 1317 | Ga0207661_10177636 | |||
| 1318 | Ga0207661_10333950 | |||
| 1319 | Ga0207661_10409436 | |||
| 1320 | Ga0207661_10525083 | |||
| 1321 | Ga0207661_10797729 | |||
| 1322 | Ga0207661_11931241 | |||
| 1323 | Ga0207679_10008405 | |||
| 1324 | Ga0207679_10074138 | |||
| 1325 | Ga0207679_10263822 | |||
| 1326 | Ga0207679_10512571 | |||
| 1327 | Ga0207679_10847292 | |||
| 1328 | Ga0207679_11465128 | |||
| 1329 | Ga0207667_10006008 | |||
| 1330 | Ga0207667_10062683 | |||
| 1331 | Ga0207667_10187991 | |||
| 1332 | Ga0207667_10609592 | |||
| 1333 | Ga0207651_10050558 | |||
| 1334 | Ga0207651_10377718 | |||
| 1335 | Ga0207712_10000226 | |||
| 1336 | Ga0207668_10007763 | |||
| 1337 | Ga0207668_10180412 | |||
| 1338 | Ga0207640_10005816 | |||
| 1339 | Ga0207640_10364303 | |||
| 1340 | Ga0207640_10449088 | |||
| 1341 | Ga0207658_10027924 | |||
| 1342 | Ga0207677_10187172 | |||
| 1343 | Ga0207677_10367929 | |||
| 1344 | Ga0207703_10295391 | |||
| 1345 | Ga0207639_10250433 | |||
| 1346 | Ga0207678_10000124 | |||
| 1347 | Ga0207708_10185090 | |||
| 1348 | Ga0207708_10554895 | |||
| 1349 | Ga0207708_11258847 | |||
| 1350 | Ga0207702_10067607 | |||
| 1351 | Ga0207702_10161570 | |||
| 1352 | Ga0207702_10271923 | |||
| 1353 | Ga0207702_10524119 | |||
| 1354 | Ga0207702_10846211 | |||
| 1355 | Ga0207648_10031391 | |||
| 1356 | Ga0207648_10075107 | |||
| 1357 | Ga0207648_10183973 | |||
| 1358 | Ga0207648_10537694 | |||
| 1359 | Ga0207648_10589625 | |||
| 1360 | Ga0207648_11027537 | |||
| 1361 | Ga0207676_10014843 | |||
| 1362 | Ga0207676_10029133 | |||
| 1363 | Ga0207676_10597388 | |||
| 1364 | Ga0207674_10002216 | |||
| 1365 | Ga0207674_10048799 | |||
| 1366 | Ga0207674_10068033 | |||
| 1367 | Ga0207674_10247261 | |||
| 1368 | Ga0207674_10268695 | |||
| 1369 | Ga0207674_11274321 | |||
| 1370 | Ga0207675_100299072 | |||
| 1371 | Ga0207675_101673329 | |||
| 1372 | Ga0207683_10057400 | |||
| 1373 | Ga0207683_10313742 | |||
| 1374 | Ga0207683_10347778 | |||
| 1375 | Ga0207683_11499884 | |||
| 1376 | Ga0207698_10001247 | |||
| 1377 | Ga0207698_10036324 | |||
| 1378 | Ga0207698_10290930 | |||
| 1379 | Ga0207698_10887283 | |||
| 1380 | Ga0207698_11503900 | |||
| 1381 | Ga0207698_11985280 | |||
| 1382 | Ga0209969_1051347 | |||
| 1383 | Ga0268266_11006645 | |||
| 1384 | Ga0307408_100109383 | |||
| 1385 | Ga0307408_101786912 | |||
| 1386 | Ga0307408_101829023 | |||
| 1387 | Ga0307405_10047144 | |||
| 1388 | Ga0307405_10078325 | |||
| 1389 | Ga0307405_10484455 | |||
| 1390 | Ga0307405_10599841 | |||
| 1391 | Ga0307405_11298176 | |||
| 1392 | Ga0307413_10006969 | |||
| 1393 | Ga0307413_10137547 | |||
| 1394 | Ga0307413_10333439 | |||
| 1395 | Ga0307413_10908755 | |||
| 1396 | Ga0307410_10145603 | |||
| 1397 | Ga0307410_10242709 | |||
| 1398 | Ga0307410_10281927 | |||
| 1399 | Ga0307410_10694890 | |||
| 1400 | Ga0307406_10074864 | |||
| 1401 | Ga0307406_10417760 | |||
| 1402 | Ga0307406_10911077 | |||
| 1403 | Ga0307406_11198278 | |||
| 1404 | Ga0307407_10110341 | |||
| 1405 | Ga0307407_10257216 | |||
| 1406 | Ga0307407_10904462 | |||
| 1407 | Ga0307412_10213509 | |||
| 1408 | Ga0307412_10357274 | |||
| 1409 | Ga0307412_11239783 | |||
| 1410 | Ga0307412_11243104 | |||
| 1411 | Ga0307412_11302074 | |||
| 1412 | Ga0307412_11327304 | |||
| 1413 | Ga0307409_100002809 | |||
| 1414 | Ga0307409_100033606 | |||
| 1415 | Ga0307409_100194692 | |||
| 1416 | Ga0307409_100475264 | |||
| 1417 | Ga0307416_100189059 | |||
| 1418 | Ga0307416_100228056 | |||
| 1419 | Ga0307416_100347272 | |||
| 1420 | Ga0307416_100698232 | |||
| 1421 | Ga0307416_100734978 | |||
| 1422 | Ga0307416_100981549 | |||
| 1423 | Ga0307416_102634115 | |||
| 1424 | Ga0307416_102707696 | |||
| 1425 | Ga0307416_102727573 | |||
| 1426 | Ga0307414_10037708 | |||
| 1427 | Ga0307414_10221800 | |||
| 1428 | Ga0307414_10293469 | |||
| 1429 | Ga0307414_10393255 | |||
| 1430 | Ga0307414_11588483 | |||
| 1431 | Ga0307411_10020590 | |||
| 1432 | Ga0307411_10051501 | |||
| 1433 | Ga0307411_10548234 | |||
| 1434 | Ga0307415_100062457 | |||
| 1435 | Ga0307415_100458562 | |||
| 1436 | Ga0307415_101448333 | |||
| 1437 | Ga0307415_101467360 | |||
| 1438 | Ga0373959_0026780 | |||
| 1439 | Ga0373959_0197164 | |||
| 1440 | Ga0373938_0114305 | |||
| 1441 | Ga0373926_0000406 | |||
| 1442 | Ga0373926_0092110 | |||
| 1443 | Ga0373934_0000795 | |||
| 1444 | Ga0373934_0007440 | |||
| 1445 | Ga0373934_0241556 | |||
| 1446 | Ga0373940_0119298 | |||
| 1447 | Ga0373923_0009846 | |||
| 1448 | Ga0373945_0110231 | |||
| 1449 | Ga0373953_0001700 | |||
| 1450 | Ga0373954_0014580 | |||
| 1451 | Ga0373954_0017794 | |||
| 1452 | Ga0373956_0000374 | |||
| 1453 | Ga0373956_0063468 | |||
| 1454 | Ga0373960_0020933 | |||
| 1455 | Ga0373943_0000799 | |||
| 1456 | Ga0373943_0221095 | |||
| 1457 | Ga0373943_0281446 | |||
| 1458 | Ga0373943_0531651 | |||
| 1459 | Ga0373955_0059879 | |||
| 1460 | Ga0373924_0001016 | |||
| 1461 | Ga0373924_0263533 | |||
| 1462 | Ga0373931_0533432 | |||
| 1463 | Ga0373935_0038208 | |||
| 1464 | Ga0373935_0119913 | |||
| 1465 | Ga0373935_0976432 | |||
| 1466 | Ga0373927_0009895 | |||
| 1467 | Ga0373927_0217398 | |||
| 1468 | Ga0373927_0541478 | |||
| 1469 | Ga0373933_0000104 | |||
| 1470 | Ga0373933_0527778 | |||
| 1471 | Ga0373947_0000102 | |||
| 1472 | Ga0373947_0190476 | |||
| 1473 | Ga0373947_0362013 | |||
| 1474 | Ga0373947_0478239 | |||
| 1475 | Ga0373937_0000161 | |||
| 1476 | Ga0373937_0019820 | |||
| 1477 | Ga0373925_0000385 | |||
| 1478 | Ga0395900_0033451 | |||
| 1479 | Ga0395905_0061334 | |||
| 1480 | Ga0395905_0149515 | |||
| 1481 | Ga0436364_1330477 | |||
| 1482 | Ga0395901_0004951 | |||
| 1483 | Ga0436365_0932097 | |||
| 1484 | Ga0436365_1418704 | |||
| 1485 | Ga0436363_1147403 | |||
| 1486 | Ga0450898_040104 | |||
| 1487 | Ga0450910_060202 | |||
| 1488 | Ga0451577_0289349 | |||
| 1489 | Ga0466966_0013164 | |||
| 1490 | Ga0466963_0174411 | |||
| 1491 | Ga0466971_0243162 | |||
| 1492 | Ga0466957_0276971 | |||
| 1493 | Ga0466957_0492095 | |||
| 1494 | Ga0466957_0693503 | |||
| 1495 | Ga0466957_1270242 | |||
| 1496 | Ga0466959_0005948 | |||
| 1497 | Ga0466959_0145242 | |||
| 1498 | Ga0451576_0149349 | |||
| 1499 | Ga0451576_1238557 | |||
| 1500 | Ga0466958_0055868 | |||
| 1501 | Ga0466967_0035357 | |||
| 1502 | Ga0466967_0076357 | |||
| 1503 | Ga0466967_0259130 | |||
| 1504 | Ga0466967_0342537 | |||
| 1505 | Ga0466967_0417896 | |||
| 1506 | Ga0466967_1256533 | |||
| 1507 | Ga0466967_1402312 | |||
| 1508 | Ga0495592_0003552 | |||
| 1509 | Ga0495592_0112280 | |||
| 1510 | Ga0495603_0000884 | |||
| 1511 | Ga0495590_0168664 | |||
| 1512 | Ga0495629_0020378 | |||
| 1513 | Ga0495651_0000077 | |||
| 1514 | Ga0495651_0008363 | |||
| 1515 | Ga0495653_0000153 | |||
| 1516 | Ga0495653_0012086 | |||
| 1517 | Ga0495580_0002602 | |||
| 1518 | Ga0495580_0005715 | |||
| 1519 | Ga0495580_0028349 | |||
| 1520 | Ga0495582_0008629 | |||
| 1521 | Ga0495582_0021341 | |||
| 1522 | Ga0495639_0000781 | |||
| 1523 | Ga0495639_0084296 | |||
| 1524 | Ga0495639_0455623 | |||
| 1525 | Ga0495662_0579013 | |||
| 1526 | Ga0495664_0058005 | |||
| 1527 | Ga0495664_0443688 | |||
| 1528 | Ga0495594_0005034 | |||
| 1529 | Ga0495594_0272574 | |||
| 1530 | Ga0495608_0000166 | |||
| 1531 | Ga0495608_0028104 | |||
| 1532 | Ga0495618_0477979 | |||
| 1533 | Ga0495628_0000243 | |||
| 1534 | Ga0495628_0019421 | |||
| 1535 | Ga0495630_0007147 | |||
| 1536 | Ga0495630_0008799 | |||
| 1537 | Ga0495630_0022603 | |||
| 1538 | Ga0495666_0259681 | |||
| 1539 | Ga0495652_0001211 | |||
| 1540 | Ga0495652_0002098 | |||
| 1541 | Ga0495665_0000002 | |||
| 1542 | Ga0495665_0005046 | |||
| 1543 | Ga0495665_0259588 | |||
| 1544 | Ga0495586_0052282 | |||
| 1545 | Ga0495586_0117462 | |||
| 1546 | Ga0495587_0000452 | |||
| 1547 | Ga0495587_0000999 | |||
| 1548 | Ga0495598_0276021 | |||
| 1549 | Ga0495621_0365418 | |||
| 1550 | Ga0495645_0000471 | |||
| 1551 | Ga0495645_0000982 | |||
| 1552 | Ga0495645_0640106 | |||
| 1553 | Ga0495667_0003199 | |||
| 1554 | Ga0495667_0011862 | |||
| 1555 | Ga0495634_0141367 | |||
| 1556 | Ga0495635_0000048 | |||
| 1557 | Ga0495635_0044941 | |||
| 1558 | Ga0495635_0172381 | |||
| 1559 | Ga0495635_0602769 | |||
| 1560 | Ga0495588_0000368 | |||
| 1561 | Ga0495588_0186956 | |||
| 1562 | Ga0495657_0000318 | |||
| 1563 | Ga0495657_0121545 | |||
| 1564 | Ga0495599_0000215 | |||
| 1565 | Ga0495599_0000314 | |||
| 1566 | Ga0495599_0102580 | |||
| 1567 | Ga0495623_0000110 | |||
| 1568 | Ga0495646_0030363 | |||
| 1569 | Ga0495646_0235040 | |||
| 1570 | Ga0495658_0000017 | |||
| 1571 | Ga0495658_0400623 | |||
| 1572 | Ga0495613_0108468 | |||
| 1573 | Ga0495613_0124705 | |||
| 1574 | Ga0495624_0314852 | |||
| 1575 | Ga0495600_0000158 | |||
| 1576 | Ga0495600_0047139 | |||
| 1577 | Ga0495600_0313080 | |||
| 1578 | Ga0495581_0003593 | |||
| 1579 | Ga0495581_0117848 | |||
| 1580 | Ga0495581_0571350 | |||
| 1581 | Ga0495604_0000017 | |||
| 1582 | Ga0495604_0008370 | |||
| 1583 | Ga0495674_0054988 | |||
| 1584 | Ga0495674_0066067 | |||
| 1585 | Ga0495674_0152042 | |||
| 1586 | Ga0495674_0387934 | |||
| 1587 | Ga0495674_0905920 | |||
| 1588 | Ga0495680_0010952 | |||
| 1589 | Ga0495680_0399654 | |||
| 1590 | Ga0495675_0010842 | |||
| 1591 | Ga0495675_0056892 | |||
| 1592 | Ga0495675_0325049 | |||
| 1593 | Ga0495675_0542737 | |||
| 1594 | Ga0495684_0000118 | |||
| 1595 | Ga0495684_0011756 | |||
| 1596 | Ga0495684_0016220 | |||
| 1597 | Ga0495593_0000009 | |||
| 1598 | Ga0495593_0049300 | |||
| 1599 | Ga0495593_0105630 | |||
| 1600 | Ga0495602_0000891 | |||
| 1601 | Ga0495602_0033523 | |||
| 1602 | Ga0495614_0000005 | |||
| 1603 | Ga0496105_0061254 | |||
| 1604 | Ga0496106_0942037 | |||
| 1605 | Ga0496107_0766076 | |||
| 1606 | Ga0496112_0106171 | |||
| 1607 | Ga0496112_0271262 | |||
| 1608 | Ga0496112_0718216 | |||
| 1609 | Ga0496112_0863594 | |||
| 1610 | Ga0501298_032334 | |||
| 1611 | Ga0501299_115669 | |||
| 1612 | Ga0501034_0312248 | |||
| 1613 | Ga0501046_0049836 | |||
| 1614 | Ga0501067_0069369 | |||
| 1615 | Ga0501067_0529398 | |||
| 1616 | Ga0501069_0129996 | |||
| 1617 | Ga0501198_017263 | |||
| 1618 | Ga0501199_024541 | |||
| 1619 | Ga0501201_010350 | |||
| 1620 | Ga0501202_015320 | |||
| 1621 | Ga0501216_044805 | |||
| 1622 | Ga0501217_018500 | |||
| 1623 | Ga0501217_159542 | |||
| 1624 | Ga0501223_034388 | |||
| 1625 | Ga0501227_010058 | |||
| 1626 | Ga0501233_096015 | |||
| 1627 | Ga0501235_012727 | |||
| 1628 | Ga0501240_020245 | |||
| 1629 | Ga0501242_008340 | |||
| 1630 | Ga0501242_075100 | |||
| 1631 | Ga0501247_026622 | |||
| 1632 | Ga0501247_056276 | |||
| 1633 | Ga0501248_025618 | |||
| 1634 | Ga0501249_007683 | |||
| 1635 | Ga0501249_059967 | |||
| 1636 | Ga0501257_061269 | |||
| 1637 | Ga0501259_001644 | |||
| 1638 | Ga0501260_052290 | |||
| 1639 | Ga0501261_005195 | |||
| 1640 | Ga0501221_003758 | |||
| 1641 | Ga0501225_0002510 | |||
| 1642 | Ga0501225_0023781 | |||
| 1643 | Ga0501229_019382 | |||
| 1644 | Ga0501234_026033 | |||
| 1645 | Ga0501245_005198 | |||
| 1646 | Ga0501232_007979 | |||
| 1647 | Ga0501266_025714 | |||
| 1648 | Ga0501268_000846 | |||
| 1649 | Ga0501268_124431 | |||
| 1650 | Ga0501270_016890 | |||
| 1651 | Ga0501274_005818 | |||
| 1652 | Ga0501283_012482 | |||
| 1653 | Ga0501044_0235290 | |||
| 1654 | nmdc:mga09592_370510_c1 | |||
| 1655 | nmdc:mga0qj67_22784_c1 | |||
| 1656 | nmdc:mga0qj67_382_c1 | |||
| 1657 | nmdc:mga0qj67_78994_c1 | |||
| 1658 | nmdc:mga06r32_279396_c1 | |||
| 1659 | nmdc:mga0n895_53043_c1 | |||
| 1660 | nmdc:mga0n895_827708_c1 | |||
| 1661 | nmdc:mga0rr50_170280_c1 | |||
| 1662 | nmdc:mga0rr50_229858_c1 | |||
| 1663 | nmdc:mga08x19_124098_c1 | |||
| 1664 | nmdc:mga08x19_45884_c1 | |||
| 1665 | nmdc:mga08x19_990150_c1 | |||
| 1666 | Ga0495601_0122231 | |||
| 1667 | Ga0495601_0232687 | |||
| 1668 | Ga0495601_0494684 | |||
| 1669 | Ga0495612_0000191 | |||
| 1670 | Ga0495612_0008071 | |||
| 1671 | Ga0495619_0001005 | |||
| 1672 | Ga0495619_0177752 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8917 | 54 | 125 |
| 3m4q-assembly1.cif.gz_B | entamoeba histolytica asparaginyl-trna synthetase (asnrs) | 0.8101 | 54 | 124 |
| 2pi2-assembly3.cif.gz_C | full-length replication protein a subunits rpa14 and rpa32 | 0.8094 | 54 | 124 |
| 8ppv-assembly1.cif.gz_A | intermediate conformer of pyrococcus abyssi dna polymerase d (pold) bound to a primer/template substrate containing three consecutive mismatches | 0.8061 | 54 | 122 |
| 2xti-assembly1.cif.gz_B | asparaginyl-trna synthetase from brugia malayi complexed with atp:mg and l-asp-beta-noh adenylate:ppi:mg | 0.8018 | 51 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8917 | 54 | 125 | 2.40.50.140 |
| af_K7VHZ3_96_226_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8654 | 28 | 129 | 2.40.50.140 |
| 3m4qB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8101 | 54 | 124 | 2.40.50.140 |
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7989 | 31 | 124 | 2.40.50.140 |
| af_Q9LMK5_4_158_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7908 | 54 | 124 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5SRW8-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.936 | 54 | 129 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A535C3Q1-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9062 | 54 | 133 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A3C0FJL2-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.8923 | 56 | 131 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A382TMA9-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.8804 | 53 | 133 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A2M7N481-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.877 | 29 | 129 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |