F482876

General Info

Members Datasets Scaffolds Average Seq Length
836 327 1672 150

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10885447|Ga0105240_108854472
Length 151
Sequence MKPRSKFLLGGALVVGVAGYLMASSIRETGQYYLTPTELSTKLKDPRFTDVGVKVGARVVPGTIQKAPSGKEYAFKVTDGAYTFPVVYRGIAPDTFADSVDVVIGGRMGQDGTFHATELLAKCASRYENAPDANKYNKYKQTPGYKAGSRA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
283 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
289 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
290 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
293 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
294 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
295 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
296 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
297 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
298 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
299 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
300 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
301 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
304 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
305 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
306 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
307 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
308 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
309 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
310 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
311 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
312 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
316 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
317 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 20.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10885447 3300009093 Archaea 961
2 LJQas_1022040 3300000549 Bacteria 741
3 JGI25406J46586_10035716 3300003203 Bacteria 1811
4 Ga0058861_11597264 3300004800 Bacteria 969
5 Ga0058861_11821463 3300004800 Bacteria 761
6 Ga0058862_11984558 3300004803 Unclassified 952
7 Ga0065712_10122626 3300005290 Bacteria 1649
8 Ga0070676_10244029 3300005328 Bacteria 1196
9 Ga0070676_10408129 3300005328 Bacteria 947
10 Ga0070683_100008911 3300005329 Bacteria 8550
11 Ga0070683_100010847 3300005329 Bacteria 7845
12 Ga0070683_100029283 3300005329 Bacteria 4983
13 Ga0070683_100030109 3300005329 Bacteria 4922
14 Ga0070683_100033117 3300005329 Bacteria 4710
15 Ga0070683_100043330 3300005329 Bacteria 4148
16 Ga0070683_100089458 3300005329 Bacteria 2889
17 Ga0070683_100093758 3300005329 Bacteria 2821
18 Ga0070683_100396682 3300005329 Bacteria 1316
19 Ga0070683_100691803 3300005329 Unclassified 976
20 Ga0070683_101019140 3300005329 Bacteria 795
21 Ga0070690_100033881 3300005330 Bacteria 3199
22 Ga0070690_100034418 3300005330 Bacteria 3175
23 Ga0070670_100142790 3300005331 Bacteria 2070
24 Ga0070670_100559445 3300005331 Bacteria 1021
25 Ga0070670_101222738 3300005331 Bacteria 687
26 Ga0070677_10379961 3300005333 Unclassified 739
27 Ga0068869_100110383 3300005334 Unclassified 2092
28 Ga0070666_10096576 3300005335 Bacteria 2034
29 Ga0070666_10903275 3300005335 Unclassified 653
30 Ga0070680_100003079 3300005336 Bacteria 12372
31 Ga0070680_100009518 3300005336 Bacteria 7462
32 Ga0070680_100028872 3300005336 Bacteria 4452
33 Ga0070680_100032501 3300005336 Bacteria 4201
34 Ga0070680_100042743 3300005336 Bacteria 3678
35 Ga0070680_100115650 3300005336 Unclassified 2235
36 Ga0070680_100519839 3300005336 Bacteria 1019
37 Ga0070680_100894698 3300005336 Unclassified 766
38 Ga0070680_101795097 3300005336 Unclassified 531
39 Ga0070682_100000777 3300005337 Bacteria 18759
40 Ga0070682_100127222 3300005337 Unclassified 1719
41 Ga0070682_100417200 3300005337 Bacteria 1019
42 Ga0070682_100489770 3300005337 Bacteria 950
43 Ga0068868_100390726 3300005338 Unclassified 1199
44 Ga0070660_100815774 3300005339 Unclassified 785
45 Ga0070689_100383811 3300005340 Bacteria 1184
46 Ga0070689_100872484 3300005340 Bacteria 795
47 Ga0070687_100018672 3300005343 Bacteria 3212
48 Ga0070687_100129882 3300005343 Bacteria 1453
49 Ga0070687_100250449 3300005343 Unclassified 1100
50 Ga0070661_100002266 3300005344 Bacteria 13192
51 Ga0070661_100034029 3300005344 Bacteria 3695
52 Ga0070661_100155754 3300005344 Unclassified 1728
53 Ga0070661_100415276 3300005344 Bacteria 1066
54 Ga0070661_100483879 3300005344 Unclassified 989
55 Ga0070661_100577313 3300005344 Unclassified 907
56 Ga0070661_100733709 3300005344 Unclassified 807
57 Ga0070692_10818243 3300005345 Unclassified 637
58 Ga0070668_100006537 3300005347 Bacteria 8639
59 Ga0070669_100379015 3300005353 Bacteria 1153
60 Ga0070675_100024854 3300005354 Bacteria 4800
61 Ga0070675_100039319 3300005354 Bacteria 3860
62 Ga0070671_100342887 3300005355 Bacteria 1275
63 Ga0070674_100401418 3300005356 Unclassified 1120
64 Ga0070674_100584820 3300005356 Unclassified 941
65 Ga0070674_100850288 3300005356 Bacteria 791
66 Ga0070673_100051314 3300005364 Bacteria 3230
67 Ga0070673_100593991 3300005364 Unclassified 1009
68 Ga0070688_100091449 3300005365 Unclassified 1989
69 Ga0070688_100555925 3300005365 Unclassified 873
70 Ga0070659_100084686 3300005366 Bacteria 2535
71 Ga0070659_100130460 3300005366 Bacteria 2041
72 Ga0070659_100324334 3300005366 Bacteria 1288
73 Ga0070667_100051136 3300005367 Bacteria 3483
74 Ga0070703_10151962 3300005406 Bacteria 870
75 Ga0070709_10001179 3300005434 Bacteria 14368
76 Ga0070709_10030577 3300005434 Bacteria 3232
77 Ga0070709_11016704 3300005434 Bacteria 660
78 Ga0070709_11149537 3300005434 Unclassified 622
79 Ga0070714_100019816 3300005435 Bacteria 5486
80 Ga0070714_100059496 3300005435 Bacteria 3276
81 Ga0070714_100165468 3300005435 Bacteria 2004
82 Ga0070714_100615583 3300005435 Unclassified 1044
83 Ga0070713_100000236 3300005436 Bacteria 36563
84 Ga0070713_100023018 3300005436 Bacteria 4826
85 Ga0070713_100256787 3300005436 Unclassified 1596
86 Ga0070713_100382085 3300005436 Bacteria 1312
87 Ga0070710_10035324 3300005437 Unclassified 2725
88 Ga0070710_10043488 3300005437 Bacteria 2488
89 Ga0070710_10410229 3300005437 Bacteria 910
90 Ga0070711_100088094 3300005439 Bacteria 2230
91 Ga0070711_100090410 3300005439 Bacteria 2205
92 Ga0070711_100148788 3300005439 Bacteria 1763
93 Ga0070711_101857415 3300005439 Unclassified 529
94 Ga0070700_100679190 3300005441 Bacteria 816
95 Ga0070700_100937667 3300005441 Unclassified 707
96 Ga0070694_100161765 3300005444 Bacteria 1643
97 Ga0070708_100000077 3300005445 Bacteria 63116
98 Ga0070678_100311328 3300005456 Bacteria 1342
99 Ga0070678_100428723 3300005456 Bacteria 1154
100 Ga0070662_100345178 3300005457 Bacteria 1218
101 Ga0070662_100475888 3300005457 Bacteria 1039
102 Ga0070662_100810349 3300005457 Unclassified 796
103 Ga0070681_10000268 3300005458 Bacteria 41473
104 Ga0070681_10004677 3300005458 Bacteria 13086
105 Ga0070681_10006742 3300005458 Bacteria 11176
106 Ga0070681_10019163 3300005458 Bacteria 6847
107 Ga0070681_10029520 3300005458 Bacteria 5507
108 Ga0070681_10029878 3300005458 Bacteria 5469
109 Ga0070681_10055490 3300005458 Bacteria 3944
110 Ga0070681_10066276 3300005458 Bacteria 3579
111 Ga0070681_10155345 3300005458 Bacteria 2213
112 Ga0070681_10209352 3300005458 Bacteria 1866
113 Ga0070681_10217070 3300005458 Unclassified 1828
114 Ga0070681_10248375 3300005458 Bacteria 1692
115 Ga0070681_10340793 3300005458 Bacteria 1409
116 Ga0070681_10445674 3300005458 Unclassified 1207
117 Ga0070681_10513514 3300005458 Bacteria 1111
118 Ga0068867_100036988 3300005459 Bacteria 3547
119 Ga0068867_100228267 3300005459 Bacteria 1504
120 Ga0068867_100241163 3300005459 Bacteria 1466
121 Ga0068867_101831725 3300005459 Unclassified 571
122 Ga0070685_10037576 3300005466 Bacteria 2743
123 Ga0070685_10300043 3300005466 Bacteria 1082
124 Ga0070706_100332309 3300005467 Bacteria 1417
125 Ga0070706_100648009 3300005467 Unclassified 981
126 Ga0070706_100988013 3300005467 Bacteria 776
127 Ga0070707_100004123 3300005468 Bacteria 13639
128 Ga0070707_100692183 3300005468 Unclassified 982
129 Ga0070698_100009824 3300005471 Bacteria 10227
130 Ga0070698_100012000 3300005471 Bacteria 9188
131 Ga0070698_100140136 3300005471 Bacteria 2370
132 Ga0070698_100174115 3300005471 Bacteria 2092
133 Ga0070698_100557747 3300005471 Unclassified 1085
134 Ga0070699_100027568 3300005518 Bacteria 4899
135 Ga0070699_100226674 3300005518 Bacteria 1666
136 Ga0070679_100000785 3300005530 Bacteria 27628
137 Ga0070679_100003319 3300005530 Bacteria 14743
138 Ga0070679_100014852 3300005530 Bacteria 7481
139 Ga0070679_100019052 3300005530 Bacteria 6666
140 Ga0070679_100026433 3300005530 Bacteria 5702
141 Ga0070679_100048359 3300005530 Bacteria 4238
142 Ga0070679_100056817 3300005530 Bacteria 3900
143 Ga0070679_100058591 3300005530 Bacteria 3838
144 Ga0070679_100101747 3300005530 Bacteria 2860
145 Ga0070679_100146617 3300005530 Bacteria 2337
146 Ga0070679_100282631 3300005530 Unclassified 1612
147 Ga0070679_100333819 3300005530 Bacteria 1464
148 Ga0070679_100588673 3300005530 Bacteria 1056
149 Ga0070679_100906345 3300005530 Unclassified 825
150 Ga0070684_100008138 3300005535 Bacteria 8185
151 Ga0070684_100012724 3300005535 Bacteria 6754
152 Ga0070684_100017914 3300005535 Bacteria 5822
153 Ga0070684_100032796 3300005535 Bacteria 4430
154 Ga0070684_100046679 3300005535 Bacteria 3753
155 Ga0070684_100060974 3300005535 Bacteria 3301
156 Ga0070684_100066529 3300005535 Bacteria 3164
157 Ga0070684_100329142 3300005535 Unclassified 1404
158 Ga0070684_100361996 3300005535 Bacteria 1335
159 Ga0070684_100508522 3300005535 Unclassified 1116
160 Ga0070684_100661161 3300005535 Unclassified 973
161 Ga0070697_100050142 3300005536 Bacteria 3388
162 Ga0070697_100061516 3300005536 Bacteria 3062
163 Ga0068853_100031861 3300005539 Bacteria 4462
164 Ga0070672_100019396 3300005543 Bacteria 4936
165 Ga0070672_100264328 3300005543 Bacteria 1452
166 Ga0070672_100480533 3300005543 Unclassified 1073
167 Ga0070672_100523962 3300005543 Bacteria 1027
168 Ga0070686_100088222 3300005544 Bacteria 2069
169 Ga0070686_101333554 3300005544 Bacteria 600
170 Ga0070695_100350561 3300005545 Bacteria 1106
171 Ga0070695_100559592 3300005545 Unclassified 892
172 Ga0070695_101259703 3300005545 Unclassified 610
173 Ga0070696_100032012 3300005546 Bacteria 3606
174 Ga0070693_100001053 3300005547 Bacteria 12318
175 Ga0070693_100192199 3300005547 Bacteria 1321
176 Ga0070693_100238001 3300005547 Bacteria 1201
177 Ga0070693_100254565 3300005547 Bacteria 1165
178 Ga0070665_100390087 3300005548 Bacteria 1400
179 Ga0070665_100391109 3300005548 Bacteria 1398
180 Ga0070704_100032796 3300005549 Bacteria 3507
181 Ga0068855_100003743 3300005563 Bacteria 18580
182 Ga0068855_100019685 3300005563 Bacteria 8105
183 Ga0068855_100091731 3300005563 Bacteria 3504
184 Ga0068855_100288282 3300005563 Bacteria 1821
185 Ga0068855_100688835 3300005563 Bacteria 1095
186 Ga0068855_101085959 3300005563 Bacteria 837
187 Ga0068855_101253543 3300005563 Unclassified 769
188 Ga0070664_100001222 3300005564 Bacteria 20514
189 Ga0070664_100004722 3300005564 Bacteria 10928
190 Ga0070664_100276568 3300005564 Bacteria 1513
191 Ga0070664_100449984 3300005564 Unclassified 1182
192 Ga0070664_100564773 3300005564 Bacteria 1053
193 Ga0068857_100006845 3300005577 Bacteria 9812
194 Ga0068857_100034949 3300005577 Bacteria 4448
195 Ga0068857_100223305 3300005577 Unclassified 1721
196 Ga0068857_100520702 3300005577 Bacteria 1118
197 Ga0068857_100734255 3300005577 Unclassified 940
198 Ga0068854_100181670 3300005578 Bacteria 1644
199 Ga0068856_100032636 3300005614 Bacteria 5098
200 Ga0068856_100098284 3300005614 Bacteria 2917
201 Ga0068856_100172096 3300005614 Bacteria 2178
202 Ga0068856_100249409 3300005614 Bacteria 1790
203 Ga0068856_100281361 3300005614 Bacteria 1680
204 Ga0068856_100498961 3300005614 Bacteria 1238
205 Ga0068856_101568072 3300005614 Unclassified 672
206 Ga0070702_100419143 3300005615 Unclassified 963
207 Ga0070702_100435972 3300005615 Unclassified 947
208 Ga0068852_100003352 3300005616 Bacteria 11183
209 Ga0068852_100118925 3300005616 Bacteria 2415
210 Ga0068859_100106933 3300005617 Bacteria 2857
211 Ga0068859_100270130 3300005617 Bacteria 1793
212 Ga0068859_100980986 3300005617 Unclassified 927
213 Ga0068864_100062483 3300005618 Bacteria 3226
214 Ga0068864_100188233 3300005618 Bacteria 1891
215 Ga0068864_101454169 3300005618 Bacteria 688
216 Ga0068870_10370660 3300005840 Bacteria 924
217 Ga0068870_10952909 3300005840 Unclassified 609
218 Ga0068863_101054263 3300005841 Unclassified 817
219 Ga0068863_101224046 3300005841 Bacteria 757
220 Ga0068858_100099389 3300005842 Bacteria 2713
221 Ga0068858_100839149 3300005842 Bacteria 897
222 Ga0068860_100458526 3300005843 Bacteria 1268
223 Ga0081455_10226039 3300005937 Bacteria 1384
224 Ga0081539_10000019 3300005985 Bacteria 369381
225 Ga0081539_10047812 3300005985 Bacteria 2439
226 Ga0070717_10001248 3300006028 Bacteria 17343
227 Ga0070717_10191344 3300006028 Bacteria 1788
228 Ga0070717_10390484 3300006028 Bacteria 1249
229 Ga0070717_10395441 3300006028 Bacteria 1241
230 Ga0070717_11220094 3300006028 Unclassified 684
231 Ga0070716_100135570 3300006173 Bacteria 1563
232 Ga0070712_100023679 3300006175 Bacteria 4060
233 Ga0070712_100026447 3300006175 Bacteria 3865
234 Ga0070712_100124156 3300006175 Bacteria 1947
235 Ga0068871_100179361 3300006358 Bacteria 1819
236 Ga0068871_100466335 3300006358 Bacteria 1134
237 Ga0068871_101175591 3300006358 Unclassified 719
238 Ga0075430_100000207 3300006846 Bacteria 40207
239 Ga0075430_100068459 3300006846 Bacteria 2978
240 Ga0075430_100086952 3300006846 Bacteria 2616
241 Ga0075431_100028270 3300006847 Bacteria 5759
242 Ga0075431_100093701 3300006847 Bacteria 3099
243 Ga0075431_100529645 3300006847 Bacteria 1167
244 Ga0075434_100121501 3300006871 Unclassified 2627
245 Ga0075429_100070638 3300006880 Bacteria 3040
246 Ga0068865_100129626 3300006881 Unclassified 1888
247 Ga0068865_100329835 3300006881 Bacteria 1230
248 Ga0075436_100016735 3300006914 Bacteria 5018
249 Ga0075436_100159579 3300006914 Bacteria 1589
250 Ga0097620_100106923 3300006931 Bacteria 2857
251 Ga0097620_100270132 3300006931 Bacteria 1793
252 Ga0097620_100981001 3300006931 Unclassified 927
253 Ga0075435_100337607 3300007076 Bacteria 1291
254 Ga0075435_100469550 3300007076 Unclassified 1086
255 Ga0075435_100582087 3300007076 Unclassified 970
256 Ga0105240_10050510 3300009093 Bacteria 5242
257 Ga0105240_10054991 3300009093 Bacteria 4985
258 Ga0105240_10068321 3300009093 Bacteria 4402
259 Ga0105240_10757575 3300009093 Unclassified 1055
260 Ga0105245_10046020 3300009098 Bacteria 3898
261 Ga0105245_10723173 3300009098 Bacteria 1030
262 Ga0105243_10848797 3300009148 Bacteria 904
263 Ga0105243_12033306 3300009148 Bacteria 609
264 Ga0105241_10066995 3300009174 Bacteria 2778
265 Ga0105241_11480571 3300009174 Unclassified 653
266 Ga0105241_12268324 3300009174 Unclassified 540
267 Ga0105242_10030734 3300009176 Bacteria 4289
268 Ga0105242_10142290 3300009176 Bacteria 2083
269 Ga0105242_10327004 3300009176 Bacteria 1408
270 Ga0105242_10340818 3300009176 Bacteria 1381
271 Ga0105248_10113354 3300009177 Bacteria 3058
272 Ga0105248_10248855 3300009177 Unclassified 2001
273 Ga0105248_11767916 3300009177 Unclassified 701
274 Ga0105237_10123608 3300009545 Bacteria 2582
275 Ga0105237_10493282 3300009545 Unclassified 1231
276 Ga0105238_10196133 3300009551 Bacteria 1995
277 Ga0105238_10391171 3300009551 Bacteria 1382
278 Ga0105238_11015524 3300009551 Bacteria 850
279 Ga0105238_12625519 3300009551 Unclassified 540
280 Ga0105249_10000344 3300009553 Bacteria 46859
281 Ga0105249_10616937 3300009553 Bacteria 1140
282 Ga0105239_10877840 3300010375 Bacteria 1029
283 Ga0105239_11108156 3300010375 Bacteria 911
284 Ga0105246_10769518 3300011119 Bacteria 851
285 Ga0157373_10172683 3300013100 Bacteria 1521
286 Ga0157373_10230716 3300013100 Bacteria 1307
287 Ga0157373_10244606 3300013100 Bacteria 1268
288 Ga0157371_10008593 3300013102 Bacteria 8116
289 Ga0157371_10052955 3300013102 Bacteria 2882
290 Ga0157370_10001913 3300013104 Bacteria 25621
291 Ga0157370_10002900 3300013104 Bacteria 20453
292 Ga0157370_10047062 3300013104 Bacteria 4135
293 Ga0157370_10168066 3300013104 Bacteria 2039
294 Ga0157370_10259951 3300013104 Bacteria 1605
295 Ga0157370_10746903 3300013104 Bacteria 891
296 Ga0157369_10009822 3300013105 Bacteria 10942
297 Ga0157369_10050902 3300013105 Bacteria 4484
298 Ga0157369_10082059 3300013105 Bacteria 3450
299 Ga0157369_10157260 3300013105 Bacteria 2400
300 Ga0157369_10250771 3300013105 Bacteria 1847
301 Ga0157369_10381890 3300013105 Unclassified 1462
302 Ga0157369_10402632 3300013105 Unclassified 1420
303 Ga0157369_10567249 3300013105 Unclassified 1173
304 Ga0157369_10573784 3300013105 Unclassified 1165
305 Ga0157369_10594942 3300013105 Bacteria 1142
306 Ga0157369_10715030 3300013105 Unclassified 1031
307 Ga0157374_10066339 3300013296 Bacteria 3392
308 Ga0157374_10112218 3300013296 Bacteria 2623
309 Ga0157374_10258090 3300013296 Bacteria 1716
310 Ga0157378_10069111 3300013297 Bacteria 3168
311 Ga0157378_10070637 3300013297 Bacteria 3135
312 Ga0157378_10109136 3300013297 Bacteria 2534
313 Ga0157378_10311572 3300013297 Bacteria 1527
314 Ga0157378_10520922 3300013297 Bacteria 1190
315 Ga0157378_10601153 3300013297 Bacteria 1111
316 Ga0157378_11201884 3300013297 Unclassified 797
317 Ga0163162_10103421 3300013306 Bacteria 2942
318 Ga0163162_10243058 3300013306 Bacteria 1931
319 Ga0163162_10568940 3300013306 Bacteria 1261
320 Ga0157372_10014486 3300013307 Bacteria 8437
321 Ga0157372_10018790 3300013307 Bacteria 7435
322 Ga0157372_10052124 3300013307 Bacteria 4555
323 Ga0157372_10203890 3300013307 Bacteria 2291
324 Ga0157372_10204039 3300013307 Bacteria 2290
325 Ga0157372_10417421 3300013307 Unclassified 1564
326 Ga0157372_10519307 3300013307 Bacteria 1388
327 Ga0157372_10844141 3300013307 Bacteria 1063
328 Ga0157375_10066920 3300013308 Bacteria 3588
329 Ga0157375_10115939 3300013308 Bacteria 2782
330 Ga0157375_10117947 3300013308 Bacteria 2760
331 Ga0157375_10125299 3300013308 Bacteria 2683
332 Ga0157375_13066895 3300013308 Unclassified 557
333 Ga0163163_10005933 3300014325 Bacteria 10631
334 Ga0163163_10301929 3300014325 Unclassified 1653
335 Ga0163163_10562424 3300014325 Unclassified 1203
336 Ga0157380_12926639 3300014326 Bacteria 544
337 Ga0182008_10007500 3300014497 Bacteria 6020
338 Ga0157377_10457987 3300014745 Bacteria 882
339 Ga0157377_10728120 3300014745 Unclassified 723
340 Ga0157376_10022816 3300014969 Bacteria 4886
341 Ga0157376_10574039 3300014969 Bacteria 1119
342 Ga0182006_1264514 3300015261 Unclassified 564
343 Ga0182007_10383122 3300015262 Unclassified 533
344 Ga0163161_10556280 3300017792 Unclassified 941
345 Ga0206356_10312477 3300020070 Unclassified 977
346 Ga0206356_10876331 3300020070 Unclassified 1200
347 Ga0206355_1271556 3300020076 Unclassified 593
348 Ga0206352_10863516 3300020078 Unclassified 1933
349 Ga0206353_11982606 3300020082 Unclassified 904
350 Ga0154015_1021647 3300020610 Unclassified 583
351 Ga0213875_10433873 3300021388 Bacteria 628
352 Ga0224712_10232664 3300022467 Unclassified 846
353 Ga0207697_10214111 3300025315 Bacteria 849
354 Ga0207656_10037691 3300025321 Bacteria 2035
355 Ga0207682_10008787 3300025893 Bacteria 3994
356 Ga0207692_10105766 3300025898 Bacteria 1553
357 Ga0207642_10022043 3300025899 Bacteria 2519
358 Ga0207680_10209636 3300025903 Bacteria 1332
359 Ga0207699_10007770 3300025906 Bacteria 5252
360 Ga0207699_10024022 3300025906 Bacteria 3327
361 Ga0207699_10029982 3300025906 Bacteria 3040
362 Ga0207699_10104251 3300025906 Bacteria 1806
363 Ga0207699_10511112 3300025906 Unclassified 868
364 Ga0207699_10883611 3300025906 Unclassified 659
365 Ga0207645_10441453 3300025907 Unclassified 878
366 Ga0207645_10608326 3300025907 Bacteria 742
367 Ga0207643_10085435 3300025908 Bacteria 1833
368 Ga0207705_10006137 3300025909 Bacteria 8938
369 Ga0207705_10148043 3300025909 Unclassified 1758
370 Ga0207705_10235699 3300025909 Unclassified 1393
371 Ga0207705_10892748 3300025909 Bacteria 689
372 Ga0207684_10340787 3300025910 Bacteria 1291
373 Ga0207707_10000432 3300025912 Bacteria 43560
374 Ga0207707_10001510 3300025912 Bacteria 21481
375 Ga0207707_10003571 3300025912 Bacteria 13788
376 Ga0207707_10004623 3300025912 Bacteria 12091
377 Ga0207707_10018559 3300025912 Bacteria 6062
378 Ga0207707_10034569 3300025912 Bacteria 4422
379 Ga0207707_10037065 3300025912 Bacteria 4260
380 Ga0207707_10054407 3300025912 Bacteria 3484
381 Ga0207707_10059825 3300025912 Bacteria 3315
382 Ga0207707_10063257 3300025912 Bacteria 3221
383 Ga0207707_10106981 3300025912 Bacteria 2445
384 Ga0207707_10108305 3300025912 Bacteria 2429
385 Ga0207707_10406278 3300025912 Bacteria 1169
386 Ga0207707_10463787 3300025912 Unclassified 1083
387 Ga0207707_10764535 3300025912 Unclassified 807
388 Ga0207695_10008593 3300025913 Bacteria 12759
389 Ga0207695_10158014 3300025913 Bacteria 2201
390 Ga0207695_10175595 3300025913 Bacteria 2065
391 Ga0207695_10592750 3300025913 Archaea 989
392 Ga0207671_10072677 3300025914 Bacteria 2567
393 Ga0207693_10004917 3300025915 Bacteria 11228
394 Ga0207693_10007418 3300025915 Bacteria 9018
395 Ga0207693_10254290 3300025915 Bacteria 1378
396 Ga0207663_10063064 3300025916 Bacteria 2359
397 Ga0207663_10104501 3300025916 Bacteria 1910
398 Ga0207663_10108698 3300025916 Bacteria 1878
399 Ga0207660_10008548 3300025917 Bacteria 6625
400 Ga0207660_10019370 3300025917 Bacteria 4549
401 Ga0207660_10020911 3300025917 Bacteria 4396
402 Ga0207660_10032801 3300025917 Bacteria 3587
403 Ga0207660_10067801 3300025917 Bacteria 2586
404 Ga0207660_10072435 3300025917 Bacteria 2509
405 Ga0207660_10076721 3300025917 Bacteria 2444
406 Ga0207660_10092920 3300025917 Bacteria 2240
407 Ga0207660_10116649 3300025917 Bacteria 2017
408 Ga0207660_11142453 3300025917 Unclassified 634
409 Ga0207662_10048611 3300025918 Bacteria 2513
410 Ga0207657_10013870 3300025919 Bacteria 7885
411 Ga0207649_10034732 3300025920 Bacteria 3024
412 Ga0207649_10558425 3300025920 Bacteria 877
413 Ga0207649_10718860 3300025920 Bacteria 775
414 Ga0207652_10002065 3300025921 Bacteria 17280
415 Ga0207652_10005307 3300025921 Bacteria 10456
416 Ga0207652_10012052 3300025921 Bacteria 6978
417 Ga0207652_10017735 3300025921 Bacteria 5830
418 Ga0207652_10022604 3300025921 Bacteria 5204
419 Ga0207652_10074619 3300025921 Bacteria 2954
420 Ga0207652_10075399 3300025921 Bacteria 2940
421 Ga0207652_10080750 3300025921 Bacteria 2844
422 Ga0207652_10159471 3300025921 Bacteria 2022
423 Ga0207652_10726941 3300025921 Unclassified 885
424 Ga0207652_10903141 3300025921 Bacteria 780
425 Ga0207652_11374133 3300025921 Bacteria 609
426 Ga0207646_10002998 3300025922 Bacteria 19494
427 Ga0207646_10490518 3300025922 Bacteria 1107
428 Ga0207681_10264484 3300025923 Bacteria 1348
429 Ga0207681_10569348 3300025923 Bacteria 934
430 Ga0207681_10688955 3300025923 Unclassified 849
431 Ga0207694_10038232 3300025924 Bacteria 3690
432 Ga0207694_10073796 3300025924 Bacteria 2670
433 Ga0207650_10011749 3300025925 Bacteria 6037
434 Ga0207650_10039545 3300025925 Bacteria 3446
435 Ga0207650_10116241 3300025925 Bacteria 2077
436 Ga0207650_10792533 3300025925 Bacteria 803
437 Ga0207659_10030128 3300025926 Bacteria 3704
438 Ga0207659_10136891 3300025926 Bacteria 1897
439 Ga0207659_11178600 3300025926 Unclassified 659
440 Ga0207687_10630005 3300025927 Unclassified 906
441 Ga0207700_10000814 3300025928 Bacteria 18060
442 Ga0207700_10007740 3300025928 Bacteria 6600
443 Ga0207700_10024246 3300025928 Bacteria 4196
444 Ga0207700_10415899 3300025928 Bacteria 1180
445 Ga0207700_10555205 3300025928 Bacteria 1020
446 Ga0207700_11005884 3300025928 Bacteria 746
447 Ga0207664_10022875 3300025929 Bacteria 4675
448 Ga0207664_10051966 3300025929 Bacteria 3239
449 Ga0207664_10239913 3300025929 Bacteria 1578
450 Ga0207664_10306276 3300025929 Bacteria 1399
451 Ga0207690_10020334 3300025932 Bacteria 4100
452 Ga0207706_10066338 3300025933 Bacteria 3176
453 Ga0207706_10079090 3300025933 Bacteria 2892
454 Ga0207706_10082151 3300025933 Bacteria 2832
455 Ga0207706_10486493 3300025933 Unclassified 1066
456 Ga0207686_10095202 3300025934 Bacteria 1976
457 Ga0207686_10352119 3300025934 Bacteria 1109
458 Ga0207686_10539149 3300025934 Bacteria 911
459 Ga0207709_10907685 3300025935 Bacteria 716
460 Ga0207670_10087637 3300025936 Bacteria 2193
461 Ga0207670_10216939 3300025936 Bacteria 1462
462 Ga0207669_10113371 3300025937 Unclassified 1823
463 Ga0207669_10244206 3300025937 Unclassified 1333
464 Ga0207669_11795770 3300025937 Bacteria 524
465 Ga0207704_10278642 3300025938 Bacteria 1270
466 Ga0207665_10050890 3300025939 Bacteria 2787
467 Ga0207665_10052149 3300025939 Bacteria 2756
468 Ga0207691_10060895 3300025940 Bacteria 3429
469 Ga0207691_10155292 3300025940 Bacteria 2010
470 Ga0207691_11164591 3300025940 Unclassified 640
471 Ga0207711_10123709 3300025941 Bacteria 2312
472 Ga0207711_10930991 3300025941 Bacteria 807
473 Ga0207711_10988072 3300025941 Unclassified 781
474 Ga0207689_10297140 3300025942 Bacteria 1338
475 Ga0207661_10008490 3300025944 Bacteria 7344
476 Ga0207661_10021377 3300025944 Bacteria 4847
477 Ga0207661_10023246 3300025944 Bacteria 4683
478 Ga0207661_10024956 3300025944 Bacteria 4539
479 Ga0207661_10036648 3300025944 Bacteria 3830
480 Ga0207661_10044991 3300025944 Bacteria 3491
481 Ga0207661_10177636 3300025944 Bacteria 1857
482 Ga0207661_10333950 3300025944 Unclassified 1365
483 Ga0207661_10409436 3300025944 Bacteria 1230
484 Ga0207661_10525083 3300025944 Bacteria 1083
485 Ga0207661_10797729 3300025944 Unclassified 869
486 Ga0207661_11931241 3300025944 Bacteria 536
487 Ga0207679_10008405 3300025945 Bacteria 6577
488 Ga0207679_10074138 3300025945 Bacteria 2578
489 Ga0207679_10263822 3300025945 Bacteria 1470
490 Ga0207679_10512571 3300025945 Bacteria 1072
491 Ga0207679_10847292 3300025945 Bacteria 835
492 Ga0207679_11465128 3300025945 Bacteria 626
493 Ga0207667_10006008 3300025949 Bacteria 14774
494 Ga0207667_10062683 3300025949 Bacteria 3886
495 Ga0207667_10187991 3300025949 Bacteria 2120
496 Ga0207667_10609592 3300025949 Bacteria 1100
497 Ga0207651_10050558 3300025960 Bacteria 2823
498 Ga0207651_10377718 3300025960 Unclassified 1200
499 Ga0207712_10000226 3300025961 Bacteria 55648
500 Ga0207668_10007763 3300025972 Bacteria 6383
501 Ga0207668_10180412 3300025972 Unclassified 1665
502 Ga0207640_10005816 3300025981 Bacteria 6724
503 Ga0207640_10364303 3300025981 Bacteria 1166
504 Ga0207640_10449088 3300025981 Unclassified 1062
505 Ga0207658_10027924 3300025986 Bacteria 3970
506 Ga0207677_10187172 3300026023 Unclassified 1634
507 Ga0207677_10367929 3300026023 Bacteria 1210
508 Ga0207703_10295391 3300026035 Bacteria 1476
509 Ga0207639_10250433 3300026041 Bacteria 1544
510 Ga0207678_10000124 3300026067 Bacteria 64383
511 Ga0207708_10185090 3300026075 Unclassified 1655
512 Ga0207708_10554895 3300026075 Bacteria 969
513 Ga0207708_11258847 3300026075 Bacteria 647
514 Ga0207702_10067607 3300026078 Bacteria 3067
515 Ga0207702_10161570 3300026078 Bacteria 2046
516 Ga0207702_10271923 3300026078 Bacteria 1598
517 Ga0207702_10524119 3300026078 Bacteria 1157
518 Ga0207702_10846211 3300026078 Unclassified 905
519 Ga0207648_10031391 3300026089 Bacteria 4697
520 Ga0207648_10075107 3300026089 Bacteria 2947
521 Ga0207648_10183973 3300026089 Bacteria 1850
522 Ga0207648_10537694 3300026089 Bacteria 1072
523 Ga0207648_10589625 3300026089 Bacteria 1024
524 Ga0207648_11027537 3300026089 Unclassified 772
525 Ga0207676_10014843 3300026095 Bacteria 5612
526 Ga0207676_10029133 3300026095 Bacteria 4131
527 Ga0207676_10597388 3300026095 Bacteria 1060
528 Ga0207674_10002216 3300026116 Bacteria 24604
529 Ga0207674_10048799 3300026116 Bacteria 4331
530 Ga0207674_10068033 3300026116 Bacteria 3585
531 Ga0207674_10247261 3300026116 Unclassified 1730
532 Ga0207674_10268695 3300026116 Bacteria 1653
533 Ga0207674_11274321 3300026116 Unclassified 704
534 Ga0207675_100299072 3300026118 Bacteria 1567
535 Ga0207675_101673329 3300026118 Unclassified 656
536 Ga0207683_10057400 3300026121 Bacteria 3417
537 Ga0207683_10313742 3300026121 Bacteria 1436
538 Ga0207683_10347778 3300026121 Unclassified 1360
539 Ga0207683_11499884 3300026121 Bacteria 623
540 Ga0207698_10001247 3300026142 Bacteria 14877
541 Ga0207698_10036324 3300026142 Bacteria 3615
542 Ga0207698_10290930 3300026142 Bacteria 1516
543 Ga0207698_10887283 3300026142 Bacteria 898
544 Ga0207698_11503900 3300026142 Unclassified 689
545 Ga0207698_11985280 3300026142 Bacteria 596
546 Ga0209969_1051347 3300027360 Unclassified 647
547 Ga0268266_11006645 3300028379 Bacteria 806
548 Ga0307408_100109383 3300031548 Bacteria 2120
549 Ga0307408_101786912 3300031548 Unclassified 587
550 Ga0307408_101829023 3300031548 Bacteria 581
551 Ga0307405_10047144 3300031731 Bacteria 2652
552 Ga0307405_10078325 3300031731 Bacteria 2151
553 Ga0307405_10484455 3300031731 Bacteria 988
554 Ga0307405_10599841 3300031731 Unclassified 898
555 Ga0307405_11298176 3300031731 Bacteria 633
556 Ga0307413_10006969 3300031824 Bacteria 5207
557 Ga0307413_10137547 3300031824 Bacteria 1682
558 Ga0307413_10333439 3300031824 Unclassified 1164
559 Ga0307413_10908755 3300031824 Unclassified 748
560 Ga0307410_10145603 3300031852 Bacteria 1758
561 Ga0307410_10242709 3300031852 Unclassified 1397
562 Ga0307410_10281927 3300031852 Bacteria 1304
563 Ga0307410_10694890 3300031852 Bacteria 857
564 Ga0307406_10074864 3300031901 Bacteria 2231
565 Ga0307406_10417760 3300031901 Bacteria 1068
566 Ga0307406_10911077 3300031901 Unclassified 749
567 Ga0307406_11198278 3300031901 Bacteria 659
568 Ga0307407_10110341 3300031903 Unclassified 1725
569 Ga0307407_10257216 3300031903 Bacteria 1199
570 Ga0307407_10904462 3300031903 Unclassified 677
571 Ga0307412_10213509 3300031911 Unclassified 1474
572 Ga0307412_10357274 3300031911 Unclassified 1175
573 Ga0307412_11239783 3300031911 Unclassified 669
574 Ga0307412_11243104 3300031911 Bacteria 668
575 Ga0307412_11302074 3300031911 Bacteria 654
576 Ga0307412_11327304 3300031911 Bacteria 648
577 Ga0307409_100002809 3300031995 Bacteria 9209
578 Ga0307409_100033606 3300031995 Bacteria 3734
579 Ga0307409_100194692 3300031995 Unclassified 1808
580 Ga0307409_100475264 3300031995 Bacteria 1211
581 Ga0307416_100189059 3300032002 Unclassified 1939
582 Ga0307416_100228056 3300032002 Bacteria 1793
583 Ga0307416_100347272 3300032002 Bacteria 1500
584 Ga0307416_100698232 3300032002 Bacteria 1103
585 Ga0307416_100734978 3300032002 Bacteria 1078
586 Ga0307416_100981549 3300032002 Bacteria 947
587 Ga0307416_102634115 3300032002 Bacteria 600
588 Ga0307416_102707696 3300032002 Bacteria 592
589 Ga0307416_102727573 3300032002 Unclassified 590
590 Ga0307414_10037708 3300032004 Bacteria 3239
591 Ga0307414_10221800 3300032004 Bacteria 1553
592 Ga0307414_10293469 3300032004 Unclassified 1372
593 Ga0307414_10393255 3300032004 Bacteria 1202
594 Ga0307414_11588483 3300032004 Bacteria 609
595 Ga0307411_10020590 3300032005 Bacteria 3840
596 Ga0307411_10051501 3300032005 Bacteria 2687
597 Ga0307411_10548234 3300032005 Bacteria 986
598 Ga0307415_100062457 3300032126 Bacteria 2584
599 Ga0307415_100458562 3300032126 Bacteria 1104
600 Ga0307415_101448333 3300032126 Bacteria 655
601 Ga0307415_101467360 3300032126 Unclassified 651
602 Ga0373959_0026780 3300034820 Unclassified 1141
603 Ga0373959_0197164 3300034820 Bacteria 530
604 Ga0373938_0114305 3300034957 Bacteria 690
605 Ga0373926_0000406 3300035083 Bacteria 11084
606 Ga0373926_0092110 3300035083 Bacteria 1128
607 Ga0373934_0000795 3300035086 Bacteria 11356
608 Ga0373934_0007440 3300035086 Bacteria 4065
609 Ga0373934_0241556 3300035086 Bacteria 746
610 Ga0373940_0119298 3300035088 Unclassified 817
611 Ga0373923_0009846 3300035111 Bacteria 3460
612 Ga0373945_0110231 3300035116 Bacteria 1085
613 Ga0373953_0001700 3300035117 Bacteria 6477
614 Ga0373954_0014580 3300035118 Bacteria 3505
615 Ga0373954_0017794 3300035118 Bacteria 3195
616 Ga0373956_0000374 3300035119 Bacteria 18296
617 Ga0373956_0063468 3300035119 Bacteria 1675
618 Ga0373960_0020933 3300035121 Bacteria 1734
619 Ga0373943_0000799 3300035170 Bacteria 13810
620 Ga0373943_0221095 3300035170 Bacteria 1055
621 Ga0373943_0281446 3300035170 Bacteria 940
622 Ga0373943_0531651 3300035170 Unclassified 689
623 Ga0373955_0059879 3300035172 Bacteria 2098
624 Ga0373924_0001016 3300035410 Bacteria 8900
625 Ga0373924_0263533 3300035410 Bacteria 764
626 Ga0373931_0533432 3300035691 Bacteria 761
627 Ga0373935_0038208 3300035692 Bacteria 3005
628 Ga0373935_0119913 3300035692 Bacteria 1756
629 Ga0373935_0976432 3300035692 Bacteria 629
630 Ga0373927_0009895 3300035695 Bacteria 6393
631 Ga0373927_0217398 3300035695 Bacteria 1255
632 Ga0373927_0541478 3300035695 Bacteria 769
633 Ga0373933_0000104 3300035724 Bacteria 53573
634 Ga0373933_0527778 3300035724 Bacteria 774
635 Ga0373947_0000102 3300035725 Bacteria 42788
636 Ga0373947_0190476 3300035725 Bacteria 1338
637 Ga0373947_0362013 3300035725 Bacteria 974
638 Ga0373947_0478239 3300035725 Bacteria 845
639 Ga0373937_0000161 3300036401 Bacteria 64761
640 Ga0373937_0019820 3300036401 Bacteria 6023
641 Ga0373925_0000385 3300037068 Bacteria 45502
642 Ga0395900_0033451 3300037418 Bacteria 5291
643 Ga0395905_0061334 3300037471 Bacteria 3518
644 Ga0395905_0149515 3300037471 Bacteria 2197
645 Ga0436364_1330477 3300037853 Bacteria 1559
646 Ga0395901_0004951 3300038443 Bacteria 13442
647 Ga0436365_0932097 3300039437 Bacteria 4616
648 Ga0436365_1418704 3300039437 Bacteria 1026
649 Ga0436363_1147403 3300039450 Unclassified 672
650 Ga0450898_040104 3300042134 Unclassified 883
651 Ga0450910_060202 3300042147 Bacteria 640
652 Ga0451577_0289349 3300042876 Unclassified 1485
653 Ga0466966_0013164 3300044684 Bacteria 5478
654 Ga0466963_0174411 3300044694 Bacteria 1500
655 Ga0466971_0243162 3300044719 Unclassified 856
656 Ga0466957_0276971 3300044842 Unclassified 1122
657 Ga0466957_0492095 3300044842 Bacteria 849
658 Ga0466957_0693503 3300044842 Bacteria 718
659 Ga0466957_1270242 3300044842 Bacteria 534
660 Ga0466959_0005948 3300045049 Bacteria 8413
661 Ga0466959_0145242 3300045049 Bacteria 1674
662 Ga0451576_0149349 3300045051 Bacteria 2437
663 Ga0451576_1238557 3300045051 Bacteria 779
664 Ga0466958_0055868 3300045836 Bacteria 2397
665 Ga0466967_0035357 3300045976 Bacteria 4252
666 Ga0466967_0076357 3300045976 Bacteria 3014
667 Ga0466967_0259130 3300045976 Unclassified 1664
668 Ga0466967_0342537 3300045976 Bacteria 1446
669 Ga0466967_0417896 3300045976 Bacteria 1307
670 Ga0466967_1256533 3300045976 Unclassified 738
671 Ga0466967_1402312 3300045976 Unclassified 696
672 Ga0495592_0003552 3300046454 Bacteria 11203
673 Ga0495592_0112280 3300046454 Bacteria 1927
674 Ga0495603_0000884 3300046455 Bacteria 17238
675 Ga0495590_0168664 3300046457 Bacteria 797
676 Ga0495629_0020378 3300046459 Bacteria 4737
677 Ga0495651_0000077 3300046462 Bacteria 71891
678 Ga0495651_0008363 3300046462 Bacteria 7932
679 Ga0495653_0000153 3300046463 Bacteria 57262
680 Ga0495653_0012086 3300046463 Bacteria 7044
681 Ga0495580_0002602 3300046472 Bacteria 15676
682 Ga0495580_0005715 3300046472 Bacteria 10229
683 Ga0495580_0028349 3300046472 Bacteria 4070
684 Ga0495582_0008629 3300046473 Bacteria 5619
685 Ga0495582_0021341 3300046473 Bacteria 3545
686 Ga0495639_0000781 3300046475 Bacteria 14482
687 Ga0495639_0084296 3300046475 Bacteria 1484
688 Ga0495639_0455623 3300046475 Unclassified 650
689 Ga0495662_0579013 3300046476 Bacteria 549
690 Ga0495664_0058005 3300046477 Bacteria 2303
691 Ga0495664_0443688 3300046477 Unclassified 777
692 Ga0495594_0005034 3300046499 Bacteria 6800
693 Ga0495594_0272574 3300046499 Bacteria 964
694 Ga0495608_0000166 3300046511 Bacteria 46948
695 Ga0495608_0028104 3300046511 Bacteria 3823
696 Ga0495618_0477979 3300046514 Bacteria 753
697 Ga0495628_0000243 3300046516 Bacteria 48123
698 Ga0495628_0019421 3300046516 Bacteria 5619
699 Ga0495630_0007147 3300046517 Bacteria 7958
700 Ga0495630_0008799 3300046517 Bacteria 7249
701 Ga0495630_0022603 3300046517 Bacteria 4645
702 Ga0495666_0259681 3300046526 Bacteria 790
703 Ga0495652_0001211 3300046529 Bacteria 28906
704 Ga0495652_0002098 3300046529 Bacteria 21042
705 Ga0495665_0000002 3300046531 Bacteria 128983
706 Ga0495665_0005046 3300046531 Bacteria 7118
707 Ga0495665_0259588 3300046531 Unclassified 893
708 Ga0495586_0052282 3300046535 Bacteria 2212
709 Ga0495586_0117462 3300046535 Bacteria 1484
710 Ga0495587_0000452 3300046536 Bacteria 28656
711 Ga0495587_0000999 3300046536 Bacteria 18595
712 Ga0495598_0276021 3300046537 Unclassified 630
713 Ga0495621_0365418 3300046539 Bacteria 607
714 Ga0495645_0000471 3300046543 Bacteria 27874
715 Ga0495645_0000982 3300046543 Bacteria 19437
716 Ga0495645_0640106 3300046543 Bacteria 650
717 Ga0495667_0003199 3300046559 Bacteria 10978
718 Ga0495667_0011862 3300046559 Bacteria 5905
719 Ga0495634_0141367 3300046642 Bacteria 1528
720 Ga0495635_0000048 3300046663 Bacteria 79393
721 Ga0495635_0044941 3300046663 Bacteria 3047
722 Ga0495635_0172381 3300046663 Bacteria 1471
723 Ga0495635_0602769 3300046663 Bacteria 717
724 Ga0495588_0000368 3300046674 Bacteria 27477
725 Ga0495588_0186956 3300046674 Unclassified 1094
726 Ga0495657_0000318 3300046675 Bacteria 44307
727 Ga0495657_0121545 3300046675 Bacteria 1644
728 Ga0495599_0000215 3300046678 Bacteria 36967
729 Ga0495599_0000314 3300046678 Bacteria 28981
730 Ga0495599_0102580 3300046678 Bacteria 1783
731 Ga0495623_0000110 3300046679 Bacteria 50112
732 Ga0495646_0030363 3300046680 Bacteria 3375
733 Ga0495646_0235040 3300046680 Unclassified 986
734 Ga0495658_0000017 3300046683 Bacteria 93346
735 Ga0495658_0400623 3300046683 Bacteria 875
736 Ga0495613_0108468 3300046689 Bacteria 2002
737 Ga0495613_0124705 3300046689 Bacteria 1847
738 Ga0495624_0314852 3300046690 Bacteria 943
739 Ga0495600_0000158 3300046809 Bacteria 39122
740 Ga0495600_0047139 3300046809 Bacteria 2811
741 Ga0495600_0313080 3300046809 Bacteria 988
742 Ga0495581_0003593 3300047315 Bacteria 8917
743 Ga0495581_0117848 3300047315 Bacteria 1544
744 Ga0495581_0571350 3300047315 Unclassified 656
745 Ga0495604_0000017 3300047317 Bacteria 192029
746 Ga0495604_0008370 3300047317 Bacteria 8178
747 Ga0495674_0054988 3300047319 Bacteria 3492
748 Ga0495674_0066067 3300047319 Bacteria 3140
749 Ga0495674_0152042 3300047319 Bacteria 1940
750 Ga0495674_0387934 3300047319 Bacteria 1129
751 Ga0495674_0905920 3300047319 Bacteria 680
752 Ga0495680_0010952 3300047322 Bacteria 8057
753 Ga0495680_0399654 3300047322 Bacteria 949
754 Ga0495675_0010842 3300047444 Bacteria 5712
755 Ga0495675_0056892 3300047444 Bacteria 2479
756 Ga0495675_0325049 3300047444 Unclassified 909
757 Ga0495675_0542737 3300047444 Bacteria 664
758 Ga0495684_0000118 3300047471 Bacteria 57785
759 Ga0495684_0011756 3300047471 Bacteria 6758
760 Ga0495684_0016220 3300047471 Bacteria 5736
761 Ga0495593_0000009 3300047673 Bacteria 85608
762 Ga0495593_0049300 3300047673 Bacteria 2235
763 Ga0495593_0105630 3300047673 Bacteria 1441
764 Ga0495602_0000891 3300048088 Bacteria 28810
765 Ga0495602_0033523 3300048088 Bacteria 4816
766 Ga0495614_0000005 3300048089 Bacteria 74692
767 Ga0496105_0061254 3300048908 Bacteria 3105
768 Ga0496106_0942037 3300048909 Bacteria 681
769 Ga0496107_0766076 3300048910 Bacteria 708
770 Ga0496112_0106171 3300048915 Bacteria 2778
771 Ga0496112_0271262 3300048915 Bacteria 1645
772 Ga0496112_0718216 3300048915 Bacteria 927
773 Ga0496112_0863594 3300048915 Bacteria 828
774 Ga0501298_032334 3300049521 Bacteria 1032
775 Ga0501299_115669 3300049522 Unclassified 640
776 Ga0501034_0312248 3300049571 Bacteria 1506
777 Ga0501046_0049836 3300049580 Bacteria 3311
778 Ga0501067_0069369 3300049583 Bacteria 1952
779 Ga0501067_0529398 3300049583 Unclassified 660
780 Ga0501069_0129996 3300049585 Bacteria 1442
781 Ga0501198_017263 3300049649 Bacteria 1123
782 Ga0501199_024541 3300049650 Unclassified 716
783 Ga0501201_010350 3300049651 Bacteria 913
784 Ga0501202_015320 3300049652 Unclassified 1476
785 Ga0501216_044805 3300049660 Unclassified 855
786 Ga0501217_018500 3300049661 Bacteria 1618
787 Ga0501217_159542 3300049661 Bacteria 679
788 Ga0501223_034388 3300049663 Unclassified 986
789 Ga0501227_010058 3300049665 Bacteria 2046
790 Ga0501233_096015 3300049668 Unclassified 779
791 Ga0501235_012727 3300049669 Bacteria 1851
792 Ga0501240_020245 3300049673 Bacteria 994
793 Ga0501242_008340 3300049674 Unclassified 1211
794 Ga0501242_075100 3300049674 Bacteria 535
795 Ga0501247_026622 3300049677 Unclassified 773
796 Ga0501247_056276 3300049677 Bacteria 595
797 Ga0501248_025618 3300049678 Unclassified 642
798 Ga0501249_007683 3300049679 Bacteria 2232
799 Ga0501249_059967 3300049679 Bacteria 881
800 Ga0501257_061269 3300049686 Unclassified 951
801 Ga0501259_001644 3300049688 Bacteria 3720
802 Ga0501260_052290 3300049689 Unclassified 517
803 Ga0501261_005195 3300049690 Bacteria 1633
804 Ga0501221_003758 3300049704 Bacteria 2505
805 Ga0501225_0002510 3300049705 Bacteria 5680
806 Ga0501225_0023781 3300049705 Bacteria 1688
807 Ga0501229_019382 3300049706 Unclassified 896
808 Ga0501234_026033 3300049707 Unclassified 939
809 Ga0501245_005198 3300049708 Bacteria 1801
810 Ga0501232_007979 3300049757 Bacteria 1131
811 Ga0501266_025714 3300049763 Unclassified 822
812 Ga0501268_000846 3300049765 Bacteria 3553
813 Ga0501268_124431 3300049765 Bacteria 574
814 Ga0501270_016890 3300049767 Unclassified 1061
815 Ga0501274_005818 3300049771 Unclassified 1051
816 Ga0501283_012482 3300049779 Bacteria 1278
817 Ga0501044_0235290 3300049823 Unclassified 1778
818 nmdc:mga09592_370510_c1 3300050508 Unclassified 1239
819 nmdc:mga0qj67_22784_c1 3300050509 Bacteria 4812
820 nmdc:mga0qj67_382_c1 3300050509 Bacteria 30484
821 nmdc:mga0qj67_78994_c1 3300050509 Bacteria 2634
822 nmdc:mga06r32_279396_c1 3300050510 Bacteria 1657
823 nmdc:mga0n895_53043_c1 3300050512 Bacteria 3982
824 nmdc:mga0n895_827708_c1 3300050512 Bacteria 915
825 nmdc:mga0rr50_170280_c1 3300050513 Bacteria 1774
826 nmdc:mga0rr50_229858_c1 3300050513 Bacteria 1534
827 nmdc:mga08x19_124098_c1 3300050514 Unclassified 1733
828 nmdc:mga08x19_45884_c1 3300050514 Bacteria 2793
829 nmdc:mga08x19_990150_c1 3300050514 Bacteria 597
830 Ga0495601_0122231 3300053077 Bacteria 1691
831 Ga0495601_0232687 3300053077 Bacteria 1203
832 Ga0495601_0494684 3300053077 Bacteria 789
833 Ga0495612_0000191 3300053078 Bacteria 26117
834 Ga0495612_0008071 3300053078 Bacteria 4285
835 Ga0495619_0001005 3300053085 Bacteria 18461
836 Ga0495619_0177752 3300053085 Bacteria 1472
837 Ga0105240_10885447
838 LJQas_1022040
839 JGI25406J46586_10035716
840 Ga0058861_11597264
841 Ga0058861_11821463
842 Ga0058862_11984558
843 Ga0065712_10122626
844 Ga0070676_10244029
845 Ga0070676_10408129
846 Ga0070683_100008911
847 Ga0070683_100010847
848 Ga0070683_100029283
849 Ga0070683_100030109
850 Ga0070683_100033117
851 Ga0070683_100043330
852 Ga0070683_100089458
853 Ga0070683_100093758
854 Ga0070683_100396682
855 Ga0070683_100691803
856 Ga0070683_101019140
857 Ga0070690_100033881
858 Ga0070690_100034418
859 Ga0070670_100142790
860 Ga0070670_100559445
861 Ga0070670_101222738
862 Ga0070677_10379961
863 Ga0068869_100110383
864 Ga0070666_10096576
865 Ga0070666_10903275
866 Ga0070680_100003079
867 Ga0070680_100009518
868 Ga0070680_100028872
869 Ga0070680_100032501
870 Ga0070680_100042743
871 Ga0070680_100115650
872 Ga0070680_100519839
873 Ga0070680_100894698
874 Ga0070680_101795097
875 Ga0070682_100000777
876 Ga0070682_100127222
877 Ga0070682_100417200
878 Ga0070682_100489770
879 Ga0068868_100390726
880 Ga0070660_100815774
881 Ga0070689_100383811
882 Ga0070689_100872484
883 Ga0070687_100018672
884 Ga0070687_100129882
885 Ga0070687_100250449
886 Ga0070661_100002266
887 Ga0070661_100034029
888 Ga0070661_100155754
889 Ga0070661_100415276
890 Ga0070661_100483879
891 Ga0070661_100577313
892 Ga0070661_100733709
893 Ga0070692_10818243
894 Ga0070668_100006537
895 Ga0070669_100379015
896 Ga0070675_100024854
897 Ga0070675_100039319
898 Ga0070671_100342887
899 Ga0070674_100401418
900 Ga0070674_100584820
901 Ga0070674_100850288
902 Ga0070673_100051314
903 Ga0070673_100593991
904 Ga0070688_100091449
905 Ga0070688_100555925
906 Ga0070659_100084686
907 Ga0070659_100130460
908 Ga0070659_100324334
909 Ga0070667_100051136
910 Ga0070703_10151962
911 Ga0070709_10001179
912 Ga0070709_10030577
913 Ga0070709_11016704
914 Ga0070709_11149537
915 Ga0070714_100019816
916 Ga0070714_100059496
917 Ga0070714_100165468
918 Ga0070714_100615583
919 Ga0070713_100000236
920 Ga0070713_100023018
921 Ga0070713_100256787
922 Ga0070713_100382085
923 Ga0070710_10035324
924 Ga0070710_10043488
925 Ga0070710_10410229
926 Ga0070711_100088094
927 Ga0070711_100090410
928 Ga0070711_100148788
929 Ga0070711_101857415
930 Ga0070700_100679190
931 Ga0070700_100937667
932 Ga0070694_100161765
933 Ga0070708_100000077
934 Ga0070678_100311328
935 Ga0070678_100428723
936 Ga0070662_100345178
937 Ga0070662_100475888
938 Ga0070662_100810349
939 Ga0070681_10000268
940 Ga0070681_10004677
941 Ga0070681_10006742
942 Ga0070681_10019163
943 Ga0070681_10029520
944 Ga0070681_10029878
945 Ga0070681_10055490
946 Ga0070681_10066276
947 Ga0070681_10155345
948 Ga0070681_10209352
949 Ga0070681_10217070
950 Ga0070681_10248375
951 Ga0070681_10340793
952 Ga0070681_10445674
953 Ga0070681_10513514
954 Ga0068867_100036988
955 Ga0068867_100228267
956 Ga0068867_100241163
957 Ga0068867_101831725
958 Ga0070685_10037576
959 Ga0070685_10300043
960 Ga0070706_100332309
961 Ga0070706_100648009
962 Ga0070706_100988013
963 Ga0070707_100004123
964 Ga0070707_100692183
965 Ga0070698_100009824
966 Ga0070698_100012000
967 Ga0070698_100140136
968 Ga0070698_100174115
969 Ga0070698_100557747
970 Ga0070699_100027568
971 Ga0070699_100226674
972 Ga0070679_100000785
973 Ga0070679_100003319
974 Ga0070679_100014852
975 Ga0070679_100019052
976 Ga0070679_100026433
977 Ga0070679_100048359
978 Ga0070679_100056817
979 Ga0070679_100058591
980 Ga0070679_100101747
981 Ga0070679_100146617
982 Ga0070679_100282631
983 Ga0070679_100333819
984 Ga0070679_100588673
985 Ga0070679_100906345
986 Ga0070684_100008138
987 Ga0070684_100012724
988 Ga0070684_100017914
989 Ga0070684_100032796
990 Ga0070684_100046679
991 Ga0070684_100060974
992 Ga0070684_100066529
993 Ga0070684_100329142
994 Ga0070684_100361996
995 Ga0070684_100508522
996 Ga0070684_100661161
997 Ga0070697_100050142
998 Ga0070697_100061516
999 Ga0068853_100031861
1000 Ga0070672_100019396
1001 Ga0070672_100264328
1002 Ga0070672_100480533
1003 Ga0070672_100523962
1004 Ga0070686_100088222
1005 Ga0070686_101333554
1006 Ga0070695_100350561
1007 Ga0070695_100559592
1008 Ga0070695_101259703
1009 Ga0070696_100032012
1010 Ga0070693_100001053
1011 Ga0070693_100192199
1012 Ga0070693_100238001
1013 Ga0070693_100254565
1014 Ga0070665_100390087
1015 Ga0070665_100391109
1016 Ga0070704_100032796
1017 Ga0068855_100003743
1018 Ga0068855_100019685
1019 Ga0068855_100091731
1020 Ga0068855_100288282
1021 Ga0068855_100688835
1022 Ga0068855_101085959
1023 Ga0068855_101253543
1024 Ga0070664_100001222
1025 Ga0070664_100004722
1026 Ga0070664_100276568
1027 Ga0070664_100449984
1028 Ga0070664_100564773
1029 Ga0068857_100006845
1030 Ga0068857_100034949
1031 Ga0068857_100223305
1032 Ga0068857_100520702
1033 Ga0068857_100734255
1034 Ga0068854_100181670
1035 Ga0068856_100032636
1036 Ga0068856_100098284
1037 Ga0068856_100172096
1038 Ga0068856_100249409
1039 Ga0068856_100281361
1040 Ga0068856_100498961
1041 Ga0068856_101568072
1042 Ga0070702_100419143
1043 Ga0070702_100435972
1044 Ga0068852_100003352
1045 Ga0068852_100118925
1046 Ga0068859_100106933
1047 Ga0068859_100270130
1048 Ga0068859_100980986
1049 Ga0068864_100062483
1050 Ga0068864_100188233
1051 Ga0068864_101454169
1052 Ga0068870_10370660
1053 Ga0068870_10952909
1054 Ga0068863_101054263
1055 Ga0068863_101224046
1056 Ga0068858_100099389
1057 Ga0068858_100839149
1058 Ga0068860_100458526
1059 Ga0081455_10226039
1060 Ga0081539_10000019
1061 Ga0081539_10047812
1062 Ga0070717_10001248
1063 Ga0070717_10191344
1064 Ga0070717_10390484
1065 Ga0070717_10395441
1066 Ga0070717_11220094
1067 Ga0070716_100135570
1068 Ga0070712_100023679
1069 Ga0070712_100026447
1070 Ga0070712_100124156
1071 Ga0068871_100179361
1072 Ga0068871_100466335
1073 Ga0068871_101175591
1074 Ga0075430_100000207
1075 Ga0075430_100068459
1076 Ga0075430_100086952
1077 Ga0075431_100028270
1078 Ga0075431_100093701
1079 Ga0075431_100529645
1080 Ga0075434_100121501
1081 Ga0075429_100070638
1082 Ga0068865_100129626
1083 Ga0068865_100329835
1084 Ga0075436_100016735
1085 Ga0075436_100159579
1086 Ga0097620_100106923
1087 Ga0097620_100270132
1088 Ga0097620_100981001
1089 Ga0075435_100337607
1090 Ga0075435_100469550
1091 Ga0075435_100582087
1092 Ga0105240_10050510
1093 Ga0105240_10054991
1094 Ga0105240_10068321
1095 Ga0105240_10757575
1096 Ga0105245_10046020
1097 Ga0105245_10723173
1098 Ga0105243_10848797
1099 Ga0105243_12033306
1100 Ga0105241_10066995
1101 Ga0105241_11480571
1102 Ga0105241_12268324
1103 Ga0105242_10030734
1104 Ga0105242_10142290
1105 Ga0105242_10327004
1106 Ga0105242_10340818
1107 Ga0105248_10113354
1108 Ga0105248_10248855
1109 Ga0105248_11767916
1110 Ga0105237_10123608
1111 Ga0105237_10493282
1112 Ga0105238_10196133
1113 Ga0105238_10391171
1114 Ga0105238_11015524
1115 Ga0105238_12625519
1116 Ga0105249_10000344
1117 Ga0105249_10616937
1118 Ga0105239_10877840
1119 Ga0105239_11108156
1120 Ga0105246_10769518
1121 Ga0157373_10172683
1122 Ga0157373_10230716
1123 Ga0157373_10244606
1124 Ga0157371_10008593
1125 Ga0157371_10052955
1126 Ga0157370_10001913
1127 Ga0157370_10002900
1128 Ga0157370_10047062
1129 Ga0157370_10168066
1130 Ga0157370_10259951
1131 Ga0157370_10746903
1132 Ga0157369_10009822
1133 Ga0157369_10050902
1134 Ga0157369_10082059
1135 Ga0157369_10157260
1136 Ga0157369_10250771
1137 Ga0157369_10381890
1138 Ga0157369_10402632
1139 Ga0157369_10567249
1140 Ga0157369_10573784
1141 Ga0157369_10594942
1142 Ga0157369_10715030
1143 Ga0157374_10066339
1144 Ga0157374_10112218
1145 Ga0157374_10258090
1146 Ga0157378_10069111
1147 Ga0157378_10070637
1148 Ga0157378_10109136
1149 Ga0157378_10311572
1150 Ga0157378_10520922
1151 Ga0157378_10601153
1152 Ga0157378_11201884
1153 Ga0163162_10103421
1154 Ga0163162_10243058
1155 Ga0163162_10568940
1156 Ga0157372_10014486
1157 Ga0157372_10018790
1158 Ga0157372_10052124
1159 Ga0157372_10203890
1160 Ga0157372_10204039
1161 Ga0157372_10417421
1162 Ga0157372_10519307
1163 Ga0157372_10844141
1164 Ga0157375_10066920
1165 Ga0157375_10115939
1166 Ga0157375_10117947
1167 Ga0157375_10125299
1168 Ga0157375_13066895
1169 Ga0163163_10005933
1170 Ga0163163_10301929
1171 Ga0163163_10562424
1172 Ga0157380_12926639
1173 Ga0182008_10007500
1174 Ga0157377_10457987
1175 Ga0157377_10728120
1176 Ga0157376_10022816
1177 Ga0157376_10574039
1178 Ga0182006_1264514
1179 Ga0182007_10383122
1180 Ga0163161_10556280
1181 Ga0206356_10312477
1182 Ga0206356_10876331
1183 Ga0206355_1271556
1184 Ga0206352_10863516
1185 Ga0206353_11982606
1186 Ga0154015_1021647
1187 Ga0213875_10433873
1188 Ga0224712_10232664
1189 Ga0207697_10214111
1190 Ga0207656_10037691
1191 Ga0207682_10008787
1192 Ga0207692_10105766
1193 Ga0207642_10022043
1194 Ga0207680_10209636
1195 Ga0207699_10007770
1196 Ga0207699_10024022
1197 Ga0207699_10029982
1198 Ga0207699_10104251
1199 Ga0207699_10511112
1200 Ga0207699_10883611
1201 Ga0207645_10441453
1202 Ga0207645_10608326
1203 Ga0207643_10085435
1204 Ga0207705_10006137
1205 Ga0207705_10148043
1206 Ga0207705_10235699
1207 Ga0207705_10892748
1208 Ga0207684_10340787
1209 Ga0207707_10000432
1210 Ga0207707_10001510
1211 Ga0207707_10003571
1212 Ga0207707_10004623
1213 Ga0207707_10018559
1214 Ga0207707_10034569
1215 Ga0207707_10037065
1216 Ga0207707_10054407
1217 Ga0207707_10059825
1218 Ga0207707_10063257
1219 Ga0207707_10106981
1220 Ga0207707_10108305
1221 Ga0207707_10406278
1222 Ga0207707_10463787
1223 Ga0207707_10764535
1224 Ga0207695_10008593
1225 Ga0207695_10158014
1226 Ga0207695_10175595
1227 Ga0207695_10592750
1228 Ga0207671_10072677
1229 Ga0207693_10004917
1230 Ga0207693_10007418
1231 Ga0207693_10254290
1232 Ga0207663_10063064
1233 Ga0207663_10104501
1234 Ga0207663_10108698
1235 Ga0207660_10008548
1236 Ga0207660_10019370
1237 Ga0207660_10020911
1238 Ga0207660_10032801
1239 Ga0207660_10067801
1240 Ga0207660_10072435
1241 Ga0207660_10076721
1242 Ga0207660_10092920
1243 Ga0207660_10116649
1244 Ga0207660_11142453
1245 Ga0207662_10048611
1246 Ga0207657_10013870
1247 Ga0207649_10034732
1248 Ga0207649_10558425
1249 Ga0207649_10718860
1250 Ga0207652_10002065
1251 Ga0207652_10005307
1252 Ga0207652_10012052
1253 Ga0207652_10017735
1254 Ga0207652_10022604
1255 Ga0207652_10074619
1256 Ga0207652_10075399
1257 Ga0207652_10080750
1258 Ga0207652_10159471
1259 Ga0207652_10726941
1260 Ga0207652_10903141
1261 Ga0207652_11374133
1262 Ga0207646_10002998
1263 Ga0207646_10490518
1264 Ga0207681_10264484
1265 Ga0207681_10569348
1266 Ga0207681_10688955
1267 Ga0207694_10038232
1268 Ga0207694_10073796
1269 Ga0207650_10011749
1270 Ga0207650_10039545
1271 Ga0207650_10116241
1272 Ga0207650_10792533
1273 Ga0207659_10030128
1274 Ga0207659_10136891
1275 Ga0207659_11178600
1276 Ga0207687_10630005
1277 Ga0207700_10000814
1278 Ga0207700_10007740
1279 Ga0207700_10024246
1280 Ga0207700_10415899
1281 Ga0207700_10555205
1282 Ga0207700_11005884
1283 Ga0207664_10022875
1284 Ga0207664_10051966
1285 Ga0207664_10239913
1286 Ga0207664_10306276
1287 Ga0207690_10020334
1288 Ga0207706_10066338
1289 Ga0207706_10079090
1290 Ga0207706_10082151
1291 Ga0207706_10486493
1292 Ga0207686_10095202
1293 Ga0207686_10352119
1294 Ga0207686_10539149
1295 Ga0207709_10907685
1296 Ga0207670_10087637
1297 Ga0207670_10216939
1298 Ga0207669_10113371
1299 Ga0207669_10244206
1300 Ga0207669_11795770
1301 Ga0207704_10278642
1302 Ga0207665_10050890
1303 Ga0207665_10052149
1304 Ga0207691_10060895
1305 Ga0207691_10155292
1306 Ga0207691_11164591
1307 Ga0207711_10123709
1308 Ga0207711_10930991
1309 Ga0207711_10988072
1310 Ga0207689_10297140
1311 Ga0207661_10008490
1312 Ga0207661_10021377
1313 Ga0207661_10023246
1314 Ga0207661_10024956
1315 Ga0207661_10036648
1316 Ga0207661_10044991
1317 Ga0207661_10177636
1318 Ga0207661_10333950
1319 Ga0207661_10409436
1320 Ga0207661_10525083
1321 Ga0207661_10797729
1322 Ga0207661_11931241
1323 Ga0207679_10008405
1324 Ga0207679_10074138
1325 Ga0207679_10263822
1326 Ga0207679_10512571
1327 Ga0207679_10847292
1328 Ga0207679_11465128
1329 Ga0207667_10006008
1330 Ga0207667_10062683
1331 Ga0207667_10187991
1332 Ga0207667_10609592
1333 Ga0207651_10050558
1334 Ga0207651_10377718
1335 Ga0207712_10000226
1336 Ga0207668_10007763
1337 Ga0207668_10180412
1338 Ga0207640_10005816
1339 Ga0207640_10364303
1340 Ga0207640_10449088
1341 Ga0207658_10027924
1342 Ga0207677_10187172
1343 Ga0207677_10367929
1344 Ga0207703_10295391
1345 Ga0207639_10250433
1346 Ga0207678_10000124
1347 Ga0207708_10185090
1348 Ga0207708_10554895
1349 Ga0207708_11258847
1350 Ga0207702_10067607
1351 Ga0207702_10161570
1352 Ga0207702_10271923
1353 Ga0207702_10524119
1354 Ga0207702_10846211
1355 Ga0207648_10031391
1356 Ga0207648_10075107
1357 Ga0207648_10183973
1358 Ga0207648_10537694
1359 Ga0207648_10589625
1360 Ga0207648_11027537
1361 Ga0207676_10014843
1362 Ga0207676_10029133
1363 Ga0207676_10597388
1364 Ga0207674_10002216
1365 Ga0207674_10048799
1366 Ga0207674_10068033
1367 Ga0207674_10247261
1368 Ga0207674_10268695
1369 Ga0207674_11274321
1370 Ga0207675_100299072
1371 Ga0207675_101673329
1372 Ga0207683_10057400
1373 Ga0207683_10313742
1374 Ga0207683_10347778
1375 Ga0207683_11499884
1376 Ga0207698_10001247
1377 Ga0207698_10036324
1378 Ga0207698_10290930
1379 Ga0207698_10887283
1380 Ga0207698_11503900
1381 Ga0207698_11985280
1382 Ga0209969_1051347
1383 Ga0268266_11006645
1384 Ga0307408_100109383
1385 Ga0307408_101786912
1386 Ga0307408_101829023
1387 Ga0307405_10047144
1388 Ga0307405_10078325
1389 Ga0307405_10484455
1390 Ga0307405_10599841
1391 Ga0307405_11298176
1392 Ga0307413_10006969
1393 Ga0307413_10137547
1394 Ga0307413_10333439
1395 Ga0307413_10908755
1396 Ga0307410_10145603
1397 Ga0307410_10242709
1398 Ga0307410_10281927
1399 Ga0307410_10694890
1400 Ga0307406_10074864
1401 Ga0307406_10417760
1402 Ga0307406_10911077
1403 Ga0307406_11198278
1404 Ga0307407_10110341
1405 Ga0307407_10257216
1406 Ga0307407_10904462
1407 Ga0307412_10213509
1408 Ga0307412_10357274
1409 Ga0307412_11239783
1410 Ga0307412_11243104
1411 Ga0307412_11302074
1412 Ga0307412_11327304
1413 Ga0307409_100002809
1414 Ga0307409_100033606
1415 Ga0307409_100194692
1416 Ga0307409_100475264
1417 Ga0307416_100189059
1418 Ga0307416_100228056
1419 Ga0307416_100347272
1420 Ga0307416_100698232
1421 Ga0307416_100734978
1422 Ga0307416_100981549
1423 Ga0307416_102634115
1424 Ga0307416_102707696
1425 Ga0307416_102727573
1426 Ga0307414_10037708
1427 Ga0307414_10221800
1428 Ga0307414_10293469
1429 Ga0307414_10393255
1430 Ga0307414_11588483
1431 Ga0307411_10020590
1432 Ga0307411_10051501
1433 Ga0307411_10548234
1434 Ga0307415_100062457
1435 Ga0307415_100458562
1436 Ga0307415_101448333
1437 Ga0307415_101467360
1438 Ga0373959_0026780
1439 Ga0373959_0197164
1440 Ga0373938_0114305
1441 Ga0373926_0000406
1442 Ga0373926_0092110
1443 Ga0373934_0000795
1444 Ga0373934_0007440
1445 Ga0373934_0241556
1446 Ga0373940_0119298
1447 Ga0373923_0009846
1448 Ga0373945_0110231
1449 Ga0373953_0001700
1450 Ga0373954_0014580
1451 Ga0373954_0017794
1452 Ga0373956_0000374
1453 Ga0373956_0063468
1454 Ga0373960_0020933
1455 Ga0373943_0000799
1456 Ga0373943_0221095
1457 Ga0373943_0281446
1458 Ga0373943_0531651
1459 Ga0373955_0059879
1460 Ga0373924_0001016
1461 Ga0373924_0263533
1462 Ga0373931_0533432
1463 Ga0373935_0038208
1464 Ga0373935_0119913
1465 Ga0373935_0976432
1466 Ga0373927_0009895
1467 Ga0373927_0217398
1468 Ga0373927_0541478
1469 Ga0373933_0000104
1470 Ga0373933_0527778
1471 Ga0373947_0000102
1472 Ga0373947_0190476
1473 Ga0373947_0362013
1474 Ga0373947_0478239
1475 Ga0373937_0000161
1476 Ga0373937_0019820
1477 Ga0373925_0000385
1478 Ga0395900_0033451
1479 Ga0395905_0061334
1480 Ga0395905_0149515
1481 Ga0436364_1330477
1482 Ga0395901_0004951
1483 Ga0436365_0932097
1484 Ga0436365_1418704
1485 Ga0436363_1147403
1486 Ga0450898_040104
1487 Ga0450910_060202
1488 Ga0451577_0289349
1489 Ga0466966_0013164
1490 Ga0466963_0174411
1491 Ga0466971_0243162
1492 Ga0466957_0276971
1493 Ga0466957_0492095
1494 Ga0466957_0693503
1495 Ga0466957_1270242
1496 Ga0466959_0005948
1497 Ga0466959_0145242
1498 Ga0451576_0149349
1499 Ga0451576_1238557
1500 Ga0466958_0055868
1501 Ga0466967_0035357
1502 Ga0466967_0076357
1503 Ga0466967_0259130
1504 Ga0466967_0342537
1505 Ga0466967_0417896
1506 Ga0466967_1256533
1507 Ga0466967_1402312
1508 Ga0495592_0003552
1509 Ga0495592_0112280
1510 Ga0495603_0000884
1511 Ga0495590_0168664
1512 Ga0495629_0020378
1513 Ga0495651_0000077
1514 Ga0495651_0008363
1515 Ga0495653_0000153
1516 Ga0495653_0012086
1517 Ga0495580_0002602
1518 Ga0495580_0005715
1519 Ga0495580_0028349
1520 Ga0495582_0008629
1521 Ga0495582_0021341
1522 Ga0495639_0000781
1523 Ga0495639_0084296
1524 Ga0495639_0455623
1525 Ga0495662_0579013
1526 Ga0495664_0058005
1527 Ga0495664_0443688
1528 Ga0495594_0005034
1529 Ga0495594_0272574
1530 Ga0495608_0000166
1531 Ga0495608_0028104
1532 Ga0495618_0477979
1533 Ga0495628_0000243
1534 Ga0495628_0019421
1535 Ga0495630_0007147
1536 Ga0495630_0008799
1537 Ga0495630_0022603
1538 Ga0495666_0259681
1539 Ga0495652_0001211
1540 Ga0495652_0002098
1541 Ga0495665_0000002
1542 Ga0495665_0005046
1543 Ga0495665_0259588
1544 Ga0495586_0052282
1545 Ga0495586_0117462
1546 Ga0495587_0000452
1547 Ga0495587_0000999
1548 Ga0495598_0276021
1549 Ga0495621_0365418
1550 Ga0495645_0000471
1551 Ga0495645_0000982
1552 Ga0495645_0640106
1553 Ga0495667_0003199
1554 Ga0495667_0011862
1555 Ga0495634_0141367
1556 Ga0495635_0000048
1557 Ga0495635_0044941
1558 Ga0495635_0172381
1559 Ga0495635_0602769
1560 Ga0495588_0000368
1561 Ga0495588_0186956
1562 Ga0495657_0000318
1563 Ga0495657_0121545
1564 Ga0495599_0000215
1565 Ga0495599_0000314
1566 Ga0495599_0102580
1567 Ga0495623_0000110
1568 Ga0495646_0030363
1569 Ga0495646_0235040
1570 Ga0495658_0000017
1571 Ga0495658_0400623
1572 Ga0495613_0108468
1573 Ga0495613_0124705
1574 Ga0495624_0314852
1575 Ga0495600_0000158
1576 Ga0495600_0047139
1577 Ga0495600_0313080
1578 Ga0495581_0003593
1579 Ga0495581_0117848
1580 Ga0495581_0571350
1581 Ga0495604_0000017
1582 Ga0495604_0008370
1583 Ga0495674_0054988
1584 Ga0495674_0066067
1585 Ga0495674_0152042
1586 Ga0495674_0387934
1587 Ga0495674_0905920
1588 Ga0495680_0010952
1589 Ga0495680_0399654
1590 Ga0495675_0010842
1591 Ga0495675_0056892
1592 Ga0495675_0325049
1593 Ga0495675_0542737
1594 Ga0495684_0000118
1595 Ga0495684_0011756
1596 Ga0495684_0016220
1597 Ga0495593_0000009
1598 Ga0495593_0049300
1599 Ga0495593_0105630
1600 Ga0495602_0000891
1601 Ga0495602_0033523
1602 Ga0495614_0000005
1603 Ga0496105_0061254
1604 Ga0496106_0942037
1605 Ga0496107_0766076
1606 Ga0496112_0106171
1607 Ga0496112_0271262
1608 Ga0496112_0718216
1609 Ga0496112_0863594
1610 Ga0501298_032334
1611 Ga0501299_115669
1612 Ga0501034_0312248
1613 Ga0501046_0049836
1614 Ga0501067_0069369
1615 Ga0501067_0529398
1616 Ga0501069_0129996
1617 Ga0501198_017263
1618 Ga0501199_024541
1619 Ga0501201_010350
1620 Ga0501202_015320
1621 Ga0501216_044805
1622 Ga0501217_018500
1623 Ga0501217_159542
1624 Ga0501223_034388
1625 Ga0501227_010058
1626 Ga0501233_096015
1627 Ga0501235_012727
1628 Ga0501240_020245
1629 Ga0501242_008340
1630 Ga0501242_075100
1631 Ga0501247_026622
1632 Ga0501247_056276
1633 Ga0501248_025618
1634 Ga0501249_007683
1635 Ga0501249_059967
1636 Ga0501257_061269
1637 Ga0501259_001644
1638 Ga0501260_052290
1639 Ga0501261_005195
1640 Ga0501221_003758
1641 Ga0501225_0002510
1642 Ga0501225_0023781
1643 Ga0501229_019382
1644 Ga0501234_026033
1645 Ga0501245_005198
1646 Ga0501232_007979
1647 Ga0501266_025714
1648 Ga0501268_000846
1649 Ga0501268_124431
1650 Ga0501270_016890
1651 Ga0501274_005818
1652 Ga0501283_012482
1653 Ga0501044_0235290
1654 nmdc:mga09592_370510_c1
1655 nmdc:mga0qj67_22784_c1
1656 nmdc:mga0qj67_382_c1
1657 nmdc:mga0qj67_78994_c1
1658 nmdc:mga06r32_279396_c1
1659 nmdc:mga0n895_53043_c1
1660 nmdc:mga0n895_827708_c1
1661 nmdc:mga0rr50_170280_c1
1662 nmdc:mga0rr50_229858_c1
1663 nmdc:mga08x19_124098_c1
1664 nmdc:mga08x19_45884_c1
1665 nmdc:mga08x19_990150_c1
1666 Ga0495601_0122231
1667 Ga0495601_0232687
1668 Ga0495601_0494684
1669 Ga0495612_0000191
1670 Ga0495612_0008071
1671 Ga0495619_0001005
1672 Ga0495619_0177752

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

1

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8917 54 125
3m4q-assembly1.cif.gz_B entamoeba histolytica asparaginyl-trna synthetase (asnrs) 0.8101 54 124
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.8094 54 124
8ppv-assembly1.cif.gz_A intermediate conformer of pyrococcus abyssi dna polymerase d (pold) bound to a primer/template substrate containing three consecutive mismatches 0.8061 54 122
2xti-assembly1.cif.gz_B asparaginyl-trna synthetase from brugia malayi complexed with atp:mg and l-asp-beta-noh adenylate:ppi:mg 0.8018 51 124
ID Description Score Start End Superfamily
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8917 54 125 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8654 28 129 2.40.50.140
3m4qB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8101 54 124 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7989 31 124 2.40.50.140
af_Q9LMK5_4_158_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7908 54 124 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C5SRW8-F1-model_v4 Cytochrome c maturation protein CcmE 0.936 54 129 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A535C3Q1-F1-model_v4 Cytochrome c maturation protein CcmE 0.9062 54 133 GO:0005886
GO:0017004
GO:0020037
AF-A0A3C0FJL2-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8923 56 131 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A382TMA9-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8804 53 133 GO:0005886
GO:0017004
GO:0020037
AF-A0A2M7N481-F1-model_v4 Cytochrome c maturation protein CcmE 0.877 29 129 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Map