F482795

General Info

Members Datasets Scaffolds Average Seq Length
834 303 1668 85

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_12278192|Ga0207702_122781922
Length 98
Sequence VKDVVMGIETKRMSKAIAAAADDDSLLGRAKAWPVRVKSFYNDVRTEMRKVTTPSLKEVRATTAVVIITVFLFGLYFGIVDYIIAHSIDYVLHTLTRR

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
107 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
135 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
201 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
291 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 4.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.04
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_12278192 3300026078 Bacteria 530
2 Ga0058859_11776048 3300004798 Bacteria 927
3 Ga0058863_10009298 3300004799 Bacteria 1042
4 Ga0058861_10003762 3300004800 Bacteria 1282
5 Ga0058862_10016397 3300004803 Bacteria 2636
6 Ga0058862_12865961 3300004803 Bacteria 2427
7 Ga0058862_12875680 3300004803 Bacteria 1420
8 Ga0058862_12876419 3300004803 Bacteria 1617
9 Ga0065714_10238578 3300005288 Bacteria 798
10 Ga0065712_10093379 3300005290 Bacteria 2291
11 Ga0065712_10236954 3300005290 Bacteria 995
12 Ga0065715_10069923 3300005293 Bacteria 630
13 Ga0065715_10507514 3300005293 Bacteria 773
14 Ga0070658_10786642 3300005327 Bacteria 826
15 Ga0070676_10427567 3300005328 Bacteria 927
16 Ga0070676_10575774 3300005328 Unclassified 809
17 Ga0070683_100046820 3300005329 Bacteria 3996
18 Ga0070683_100103713 3300005329 Bacteria 2680
19 Ga0070683_100215401 3300005329 Bacteria 1825
20 Ga0070683_100218178 3300005329 Bacteria 1813
21 Ga0070683_101177026 3300005329 Bacteria 737
22 Ga0070690_100007637 3300005330 Bacteria 6195
23 Ga0070690_100530762 3300005330 Bacteria 885
24 Ga0070690_100617512 3300005330 Bacteria 825
25 Ga0070670_100015850 3300005331 Bacteria 6468
26 Ga0070670_101814343 3300005331 Bacteria 561
27 Ga0068869_100015654 3300005334 Bacteria 5094
28 Ga0068869_100028941 3300005334 Bacteria 3876
29 Ga0068869_100101213 3300005334 Bacteria 2180
30 Ga0070666_10013567 3300005335 Bacteria 5174
31 Ga0070666_10041467 3300005335 Bacteria 3076
32 Ga0070666_11409959 3300005335 Bacteria 521
33 Ga0070680_100087235 3300005336 Bacteria 2580
34 Ga0070680_100183048 3300005336 Bacteria 1765
35 Ga0070680_100761976 3300005336 Bacteria 833
36 Ga0070680_101119369 3300005336 Bacteria 681
37 Ga0070682_100144735 3300005337 Bacteria 1624
38 Ga0070682_100358453 3300005337 Bacteria 1090
39 Ga0070682_101141087 3300005337 Bacteria 655
40 Ga0068868_100004403 3300005338 Bacteria 9874
41 Ga0068868_100005029 3300005338 Bacteria 9287
42 Ga0068868_100016257 3300005338 Bacteria 5521
43 Ga0068868_100029306 3300005338 Bacteria 4214
44 Ga0068868_100169248 3300005338 Bacteria 1808
45 Ga0068868_100448629 3300005338 Bacteria 1122
46 Ga0070660_100027710 3300005339 Bacteria 4230
47 Ga0070660_100291851 3300005339 Bacteria 1336
48 Ga0070660_100847874 3300005339 Bacteria 769
49 Ga0070689_100209806 3300005340 Bacteria 1594
50 Ga0070691_10031902 3300005341 Bacteria 2473
51 Ga0070691_10503302 3300005341 Bacteria 701
52 Ga0070661_100009094 3300005344 Bacteria 6871
53 Ga0070661_100029191 3300005344 Bacteria 3980
54 Ga0070661_100965864 3300005344 Bacteria 706
55 Ga0070661_101000237 3300005344 Bacteria 694
56 Ga0070661_101051972 3300005344 Bacteria 677
57 Ga0070661_101613376 3300005344 Bacteria 549
58 Ga0070661_101625451 3300005344 Bacteria 547
59 Ga0070668_100143989 3300005347 Bacteria 1922
60 Ga0070668_100418010 3300005347 Bacteria 1148
61 Ga0070669_100028322 3300005353 Bacteria 4034
62 Ga0070669_101298514 3300005353 Unclassified 630
63 Ga0070675_101993980 3300005354 Bacteria 535
64 Ga0070671_100198194 3300005355 Bacteria 1702
65 Ga0070671_100345072 3300005355 Bacteria 1270
66 Ga0070671_100544397 3300005355 Bacteria 1001
67 Ga0070674_100058197 3300005356 Bacteria 2686
68 Ga0070673_100050381 3300005364 Bacteria 3256
69 Ga0070673_100255940 3300005364 Bacteria 1528
70 Ga0070673_100310081 3300005364 Bacteria 1392
71 Ga0070673_100316930 3300005364 Bacteria 1377
72 Ga0070673_100475006 3300005364 Bacteria 1128
73 Ga0070673_100490003 3300005364 Bacteria 1111
74 Ga0070673_101480017 3300005364 Unclassified 640
75 Ga0070688_100271250 3300005365 Bacteria 1216
76 Ga0070688_101517074 3300005365 Bacteria 546
77 Ga0070659_100182773 3300005366 Bacteria 1721
78 Ga0070659_100496763 3300005366 Bacteria 1039
79 Ga0070659_100665283 3300005366 Bacteria 899
80 Ga0070667_100058346 3300005367 Bacteria 3263
81 Ga0070709_10007319 3300005434 Bacteria 6049
82 Ga0070709_10469829 3300005434 Bacteria 951
83 Ga0070709_10492798 3300005434 Bacteria 930
84 Ga0070709_10814394 3300005434 Bacteria 734
85 Ga0070709_10939177 3300005434 Bacteria 686
86 Ga0070709_11250119 3300005434 Bacteria 598
87 Ga0070714_100013743 3300005435 Bacteria 6492
88 Ga0070714_100172908 3300005435 Bacteria 1961
89 Ga0070713_100003633 3300005436 Bacteria 10209
90 Ga0070713_100012002 3300005436 Bacteria 6340
91 Ga0070713_100118692 3300005436 Bacteria 2316
92 Ga0070713_100385445 3300005436 Bacteria 1306
93 Ga0070713_100525351 3300005436 Bacteria 1119
94 Ga0070713_100530224 3300005436 Bacteria 1113
95 Ga0070713_101366886 3300005436 Bacteria 687
96 Ga0070713_101957135 3300005436 Bacteria 569
97 Ga0070710_10064116 3300005437 Bacteria 2101
98 Ga0070710_10071060 3300005437 Bacteria 2006
99 Ga0070710_10254742 3300005437 Bacteria 1130
100 Ga0070710_10338610 3300005437 Bacteria 992
101 Ga0070701_10046899 3300005438 Bacteria 2224
102 Ga0070711_100001451 3300005439 Bacteria 13031
103 Ga0070711_100769988 3300005439 Bacteria 814
104 Ga0070711_101993408 3300005439 Bacteria 511
105 Ga0070705_100283053 3300005440 Bacteria 1180
106 Ga0070705_100520215 3300005440 Bacteria 907
107 Ga0070705_100853741 3300005440 Bacteria 729
108 Ga0070694_100458515 3300005444 Bacteria 1008
109 Ga0070708_100001162 3300005445 Bacteria 20260
110 Ga0070708_100046385 3300005445 Bacteria 3834
111 Ga0070708_100046478 3300005445 Bacteria 3830
112 Ga0070708_100640725 3300005445 Bacteria 1002
113 Ga0070708_101927635 3300005445 Bacteria 548
114 Ga0070708_102237445 3300005445 Unclassified 505
115 Ga0070663_100046765 3300005455 Bacteria 3063
116 Ga0070678_100238385 3300005456 Bacteria 1520
117 Ga0070678_100504001 3300005456 Bacteria 1068
118 Ga0070678_100504606 3300005456 Bacteria 1068
119 Ga0070678_100579287 3300005456 Bacteria 1000
120 Ga0070662_100004105 3300005457 Bacteria 9147
121 Ga0070662_100061302 3300005457 Bacteria 2746
122 Ga0070662_101289277 3300005457 Bacteria 629
123 Ga0070662_101931437 3300005457 Unclassified 510
124 Ga0070681_10024410 3300005458 Bacteria 6086
125 Ga0070681_10037672 3300005458 Bacteria 4851
126 Ga0070681_10061399 3300005458 Bacteria 3733
127 Ga0070681_10100876 3300005458 Bacteria 2832
128 Ga0070681_10153734 3300005458 Bacteria 2226
129 Ga0070681_10219108 3300005458 Bacteria 1818
130 Ga0070681_10248809 3300005458 Bacteria 1690
131 Ga0070681_10299860 3300005458 Bacteria 1517
132 Ga0070681_10769235 3300005458 Bacteria 880
133 Ga0068867_100058972 3300005459 Bacteria 2844
134 Ga0068867_100077178 3300005459 Bacteria 2503
135 Ga0068867_100273887 3300005459 Bacteria 1381
136 Ga0068867_100934025 3300005459 Bacteria 783
137 Ga0070706_100001933 3300005467 Bacteria 21354
138 Ga0070706_100020123 3300005467 Bacteria 6150
139 Ga0070706_100078207 3300005467 Bacteria 3063
140 Ga0070706_100372348 3300005467 Bacteria 1331
141 Ga0070706_100914157 3300005467 Bacteria 811
142 Ga0070706_101162429 3300005467 Bacteria 710
143 Ga0070707_100036739 3300005468 Bacteria 4675
144 Ga0070707_100088791 3300005468 Bacteria 2991
145 Ga0070707_100093184 3300005468 Bacteria 2916
146 Ga0070707_100216432 3300005468 Bacteria 1866
147 Ga0070707_100242177 3300005468 Bacteria 1755
148 Ga0070707_100452523 3300005468 Bacteria 1244
149 Ga0070698_101159651 3300005471 Bacteria 722
150 Ga0070698_101331070 3300005471 Bacteria 669
151 Ga0070699_100068307 3300005518 Bacteria 3086
152 Ga0070699_100228134 3300005518 Bacteria 1660
153 Ga0070699_101104247 3300005518 Bacteria 728
154 Ga0070679_100126746 3300005530 Bacteria 2535
155 Ga0070679_100157002 3300005530 Bacteria 2250
156 Ga0070679_100164761 3300005530 Bacteria 2191
157 Ga0070679_100338193 3300005530 Bacteria 1453
158 Ga0070679_100665942 3300005530 Bacteria 983
159 Ga0070684_100160557 3300005535 Bacteria 2039
160 Ga0070684_100195891 3300005535 Bacteria 1840
161 Ga0070684_100226196 3300005535 Bacteria 1707
162 Ga0070684_100432322 3300005535 Bacteria 1216
163 Ga0070697_100000283 3300005536 Bacteria 41017
164 Ga0070697_100003995 3300005536 Bacteria 11317
165 Ga0070697_100075175 3300005536 Bacteria 2776
166 Ga0070697_100159240 3300005536 Bacteria 1907
167 Ga0070697_100595319 3300005536 Bacteria 972
168 Ga0070697_100670736 3300005536 Bacteria 914
169 Ga0068853_100008387 3300005539 Bacteria 8299
170 Ga0068853_100107273 3300005539 Bacteria 2476
171 Ga0068853_100134729 3300005539 Bacteria 2213
172 Ga0068853_100319298 3300005539 Bacteria 1439
173 Ga0070686_100021492 3300005544 Bacteria 3837
174 Ga0070695_100136049 3300005545 Bacteria 1699
175 Ga0070696_100057952 3300005546 Bacteria 2704
176 Ga0070693_100015864 3300005547 Bacteria 3887
177 Ga0070693_100020059 3300005547 Bacteria 3518
178 Ga0070665_100031578 3300005548 Bacteria 5331
179 Ga0070665_100457827 3300005548 Bacteria 1286
180 Ga0068855_100017602 3300005563 Bacteria 8593
181 Ga0068855_100040905 3300005563 Bacteria 5498
182 Ga0068855_100046563 3300005563 Bacteria 5127
183 Ga0068855_100081320 3300005563 Bacteria 3755
184 Ga0068855_100277185 3300005563 Bacteria 1863
185 Ga0068855_100283033 3300005563 Bacteria 1841
186 Ga0068855_100813324 3300005563 Bacteria 992
187 Ga0070664_100031709 3300005564 Bacteria 4418
188 Ga0070664_100068500 3300005564 Bacteria 3034
189 Ga0070664_101315918 3300005564 Bacteria 683
190 Ga0070664_102198197 3300005564 Bacteria 524
191 Ga0068857_100004001 3300005577 Bacteria 12421
192 Ga0068857_100120845 3300005577 Bacteria 2358
193 Ga0068857_100163484 3300005577 Bacteria 2020
194 Ga0068857_100224792 3300005577 Bacteria 1715
195 Ga0068857_100493325 3300005577 Bacteria 1149
196 Ga0068857_101200294 3300005577 Bacteria 735
197 Ga0068854_100099920 3300005578 Bacteria 2174
198 Ga0068854_100154255 3300005578 Bacteria 1773
199 Ga0068854_100328389 3300005578 Bacteria 1246
200 Ga0068854_101239261 3300005578 Bacteria 669
201 Ga0068856_100001110 3300005614 Bacteria 28423
202 Ga0068856_100018558 3300005614 Bacteria 6740
203 Ga0068856_100042765 3300005614 Bacteria 4458
204 Ga0068856_100045664 3300005614 Bacteria 4314
205 Ga0068856_100198386 3300005614 Bacteria 2021
206 Ga0068856_100217918 3300005614 Bacteria 1924
207 Ga0068856_100530377 3300005614 Bacteria 1198
208 Ga0068856_100561768 3300005614 Bacteria 1162
209 Ga0068856_101105834 3300005614 Bacteria 810
210 Ga0068856_101303086 3300005614 Bacteria 742
211 Ga0070702_100433103 3300005615 Bacteria 950
212 Ga0068852_100142901 3300005616 Bacteria 2217
213 Ga0068852_100236033 3300005616 Bacteria 1745
214 Ga0068852_100457504 3300005616 Bacteria 1264
215 Ga0068859_100007438 3300005617 Bacteria 11114
216 Ga0068859_100025384 3300005617 Bacteria 5944
217 Ga0068859_100086640 3300005617 Bacteria 3179
218 Ga0068864_100022179 3300005618 Bacteria 5324
219 Ga0068864_100050781 3300005618 Bacteria 3570
220 Ga0068864_100142237 3300005618 Bacteria 2165
221 Ga0068864_100381590 3300005618 Bacteria 1336
222 Ga0068864_101459707 3300005618 Bacteria 686
223 Ga0068866_10041105 3300005718 Bacteria 2292
224 Ga0068866_10132746 3300005718 Bacteria 1418
225 Ga0068866_10365917 3300005718 Bacteria 921
226 Ga0068861_100027368 3300005719 Bacteria 4151
227 Ga0068861_100450147 3300005719 Bacteria 1153
228 Ga0068851_10016669 3300005834 Bacteria 3520
229 Ga0068851_10768158 3300005834 Bacteria 597
230 Ga0068851_11088937 3300005834 Bacteria 507
231 Ga0068870_10052211 3300005840 Bacteria 2167
232 Ga0068870_10161054 3300005840 Bacteria 1331
233 Ga0068863_100021102 3300005841 Bacteria 6221
234 Ga0068863_100210389 3300005841 Bacteria 1873
235 Ga0068863_100244460 3300005841 Bacteria 1732
236 Ga0068863_100456493 3300005841 Bacteria 1254
237 Ga0068858_100040536 3300005842 Bacteria 4319
238 Ga0068858_100049628 3300005842 Bacteria 3886
239 Ga0068858_100056365 3300005842 Bacteria 3633
240 Ga0068858_100080042 3300005842 Bacteria 3035
241 Ga0068858_100297352 3300005842 Bacteria 1540
242 Ga0068858_100729854 3300005842 Bacteria 965
243 Ga0068860_100021796 3300005843 Bacteria 6198
244 Ga0068860_100029103 3300005843 Bacteria 5313
245 Ga0068860_100042911 3300005843 Bacteria 4316
246 Ga0068860_100252843 3300005843 Bacteria 1717
247 Ga0068860_100378743 3300005843 Bacteria 1397
248 Ga0068860_101471744 3300005843 Bacteria 703
249 Ga0068862_100031281 3300005844 Bacteria 4491
250 Ga0068862_100040176 3300005844 Bacteria 3976
251 Ga0081540_1018394 3300005983 Bacteria 4288
252 Ga0070717_10027475 3300006028 Bacteria 4548
253 Ga0070717_10034156 3300006028 Bacteria 4109
254 Ga0070717_10082603 3300006028 Bacteria 2700
255 Ga0070717_10234144 3300006028 Bacteria 1618
256 Ga0070717_10322067 3300006028 Bacteria 1377
257 Ga0070717_10341823 3300006028 Bacteria 1336
258 Ga0070717_10387129 3300006028 Bacteria 1254
259 Ga0070717_10472588 3300006028 Bacteria 1132
260 Ga0070717_10714604 3300006028 Bacteria 910
261 Ga0070717_11075572 3300006028 Bacteria 733
262 Ga0070715_10024522 3300006163 Bacteria 2378
263 Ga0070715_10101146 3300006163 Bacteria 1344
264 Ga0070715_10483385 3300006163 Bacteria 706
265 Ga0070716_100018336 3300006173 Bacteria 3644
266 Ga0070716_100068423 3300006173 Bacteria 2077
267 Ga0070716_100225176 3300006173 Bacteria 1262
268 Ga0070716_100572360 3300006173 Bacteria 845
269 Ga0070716_100578155 3300006173 Bacteria 842
270 Ga0070716_100647812 3300006173 Bacteria 801
271 Ga0070712_100001874 3300006175 Bacteria 12837
272 Ga0070712_100026751 3300006175 Bacteria 3847
273 Ga0070712_100117725 3300006175 Bacteria 1994
274 Ga0070712_100287843 3300006175 Bacteria 1325
275 Ga0070712_100373870 3300006175 Bacteria 1171
276 Ga0097621_100001595 3300006237 Bacteria 15516
277 Ga0097621_100022785 3300006237 Bacteria 4866
278 Ga0097621_100051715 3300006237 Bacteria 3344
279 Ga0097621_100056302 3300006237 Bacteria 3212
280 Ga0097621_100206677 3300006237 Bacteria 1706
281 Ga0097621_100652535 3300006237 Bacteria 966
282 Ga0097621_102420088 3300006237 Bacteria 502
283 Ga0068871_100008540 3300006358 Bacteria 7362
284 Ga0068871_100016458 3300006358 Bacteria 5569
285 Ga0068871_100038763 3300006358 Bacteria 3808
286 Ga0068871_100076465 3300006358 Bacteria 2765
287 Ga0068871_100084679 3300006358 Bacteria 2631
288 Ga0068871_100163154 3300006358 Bacteria 1906
289 Ga0068871_100323105 3300006358 Bacteria 1359
290 Ga0068871_101294147 3300006358 Bacteria 685
291 Ga0075433_10287813 3300006852 Bacteria 1455
292 Ga0075434_100160271 3300006871 Bacteria 2270
293 Ga0075434_101369541 3300006871 Bacteria 718
294 Ga0075434_101495270 3300006871 Bacteria 685
295 Ga0068865_100085999 3300006881 Bacteria 2269
296 Ga0068865_100108014 3300006881 Bacteria 2047
297 Ga0068865_100143790 3300006881 Bacteria 1801
298 Ga0068865_100199208 3300006881 Bacteria 1554
299 Ga0075436_100035402 3300006914 Bacteria 3445
300 Ga0075436_100101251 3300006914 Bacteria 2006
301 Ga0097620_100007438 3300006931 Bacteria 11114
302 Ga0097620_100025387 3300006931 Bacteria 5944
303 Ga0097620_100086636 3300006931 Bacteria 3179
304 Ga0075435_100048069 3300007076 Bacteria 3426
305 Ga0075435_101893829 3300007076 Bacteria 524
306 Ga0099794_10163053 3300007265 Bacteria 1134
307 Ga0099795_10047311 3300007788 Bacteria 1554
308 Ga0105250_10093803 3300009092 Bacteria 1223
309 Ga0105240_10381075 3300009093 Bacteria 1593
310 Ga0105240_10392446 3300009093 Bacteria 1565
311 Ga0105240_12069244 3300009093 Bacteria 591
312 Ga0105240_12210772 3300009093 Unclassified 570
313 Ga0105240_12463916 3300009093 Bacteria 538
314 Ga0105245_10026029 3300009098 Bacteria 5148
315 Ga0105245_10119600 3300009098 Bacteria 2459
316 Ga0105245_11499884 3300009098 Bacteria 725
317 Ga0105247_10056655 3300009101 Bacteria 2421
318 Ga0114129_10486609 3300009147 Bacteria 1614
319 Ga0105243_10030797 3300009148 Bacteria 4134
320 Ga0105243_11157270 3300009148 Bacteria 785
321 Ga0105241_10011009 3300009174 Bacteria 6634
322 Ga0105241_10135542 3300009174 Bacteria 1999
323 Ga0105241_10164549 3300009174 Bacteria 1827
324 Ga0105241_10182797 3300009174 Bacteria 1740
325 Ga0105241_10191517 3300009174 Bacteria 1703
326 Ga0105241_10205403 3300009174 Bacteria 1648
327 Ga0105241_10281765 3300009174 Bacteria 1420
328 Ga0105241_10546148 3300009174 Bacteria 1040
329 Ga0105241_11004137 3300009174 Bacteria 781
330 Ga0105242_10029837 3300009176 Bacteria 4353
331 Ga0105242_10139310 3300009176 Bacteria 2103
332 Ga0105242_10150672 3300009176 Bacteria 2028
333 Ga0105242_10327865 3300009176 Bacteria 1406
334 Ga0105242_10971996 3300009176 Bacteria 855
335 Ga0105248_10055715 3300009177 Bacteria 4435
336 Ga0105248_10066472 3300009177 Bacteria 4048
337 Ga0105248_10133043 3300009177 Bacteria 2806
338 Ga0105248_10212589 3300009177 Bacteria 2179
339 Ga0105248_10447911 3300009177 Bacteria 1455
340 Ga0105248_12069749 3300009177 Bacteria 647
341 Ga0105248_12106852 3300009177 Bacteria 641
342 Ga0105237_10096326 3300009545 Bacteria 2950
343 Ga0105237_10360259 3300009545 Bacteria 1458
344 Ga0105237_10462213 3300009545 Bacteria 1275
345 Ga0105237_11531688 3300009545 Bacteria 673
346 Ga0105238_10020606 3300009551 Bacteria 6716
347 Ga0105238_10145324 3300009551 Bacteria 2348
348 Ga0105238_10256984 3300009551 Bacteria 1726
349 Ga0105238_10320346 3300009551 Bacteria 1536
350 Ga0105238_10369040 3300009551 Bacteria 1425
351 Ga0105238_11004231 3300009551 Bacteria 855
352 Ga0105249_10012680 3300009553 Bacteria 7434
353 Ga0105249_10186546 3300009553 Bacteria 2021
354 Ga0099796_10104441 3300010159 Bacteria 1070
355 Ga0105239_10049333 3300010375 Bacteria 4616
356 Ga0105239_10121817 3300010375 Bacteria 2897
357 Ga0105239_10237627 3300010375 Bacteria 2045
358 Ga0105239_10247201 3300010375 Bacteria 2003
359 Ga0105239_11134094 3300010375 Bacteria 900
360 Ga0105246_10040895 3300011119 Bacteria 3131
361 Ga0157340_1026617 3300012473 Bacteria 519
362 Ga0157335_1011701 3300012492 Bacteria 723
363 Ga0157373_10026972 3300013100 Bacteria 4146
364 Ga0157373_10127906 3300013100 Bacteria 1786
365 Ga0157373_10613933 3300013100 Bacteria 792
366 Ga0157373_10789000 3300013100 Bacteria 700
367 Ga0157371_10091632 3300013102 Bacteria 2153
368 Ga0157371_10121148 3300013102 Bacteria 1860
369 Ga0157370_10344323 3300013104 Bacteria 1374
370 Ga0157369_10000674 3300013105 Bacteria 44019
371 Ga0157369_10052158 3300013105 Bacteria 4426
372 Ga0157369_10253552 3300013105 Bacteria 1836
373 Ga0157369_10672454 3300013105 Bacteria 1067
374 Ga0157369_12429885 3300013105 Bacteria 531
375 Ga0157374_10000602 3300013296 Bacteria 31865
376 Ga0157374_10006374 3300013296 Bacteria 10011
377 Ga0157374_10047190 3300013296 Bacteria 3993
378 Ga0157374_10054821 3300013296 Bacteria 3720
379 Ga0157374_10107246 3300013296 Bacteria 2684
380 Ga0157374_10168023 3300013296 Bacteria 2139
381 Ga0157374_10423847 3300013296 Bacteria 1330
382 Ga0157374_11395414 3300013296 Bacteria 723
383 Ga0157378_10000634 3300013297 Bacteria 32985
384 Ga0157378_10000855 3300013297 Bacteria 28249
385 Ga0157378_10020155 3300013297 Bacteria 5865
386 Ga0157378_10069524 3300013297 Bacteria 3159
387 Ga0157378_10154890 3300013297 Bacteria 2138
388 Ga0157378_10257528 3300013297 Bacteria 1673
389 Ga0157378_12445690 3300013297 Bacteria 574
390 Ga0163162_10019277 3300013306 Bacteria 6688
391 Ga0163162_10033025 3300013306 Bacteria 5141
392 Ga0163162_10114118 3300013306 Bacteria 2801
393 Ga0157372_10001167 3300013307 Bacteria 28410
394 Ga0157372_10009122 3300013307 Bacteria 10538
395 Ga0157372_10011399 3300013307 Bacteria 9457
396 Ga0157372_10077586 3300013307 Bacteria 3752
397 Ga0157372_10495693 3300013307 Bacteria 1424
398 Ga0157372_11266370 3300013307 Bacteria 851
399 Ga0157372_11779807 3300013307 Bacteria 708
400 Ga0157372_12020439 3300013307 Bacteria 662
401 Ga0157372_13370054 3300013307 Bacteria 509
402 Ga0157375_10011888 3300013308 Bacteria 7702
403 Ga0157375_10546020 3300013308 Bacteria 1321
404 Ga0163163_10017278 3300014325 Bacteria 6726
405 Ga0163163_10061034 3300014325 Bacteria 3735
406 Ga0163163_10083706 3300014325 Bacteria 3195
407 Ga0157377_10514663 3300014745 Bacteria 839
408 Ga0157377_11530347 3300014745 Bacteria 531
409 Ga0157379_10050490 3300014968 Bacteria 3713
410 Ga0157379_10831876 3300014968 Bacteria 873
411 Ga0157379_10858665 3300014968 Bacteria 859
412 Ga0157379_11228320 3300014968 Bacteria 722
413 Ga0157379_12483028 3300014968 Bacteria 518
414 Ga0157376_10007821 3300014969 Bacteria 7664
415 Ga0157376_10063726 3300014969 Bacteria 3106
416 Ga0157376_10144336 3300014969 Bacteria 2139
417 Ga0157376_10178549 3300014969 Bacteria 1939
418 Ga0157376_10334594 3300014969 Bacteria 1444
419 Ga0157376_10530101 3300014969 Bacteria 1162
420 Ga0182007_10078417 3300015262 Bacteria 1083
421 Ga0163161_10181622 3300017792 Bacteria 1613
422 Ga0184602_110225 3300019161 Bacteria 1883
423 Ga0184598_141254 3300019182 Bacteria 534
424 Ga0184601_124451 3300019183 Bacteria 1309
425 Ga0184599_123307 3300019188 Bacteria 3800
426 Ga0184600_118255 3300019190 Bacteria 1148
427 Ga0184600_138149 3300019190 Bacteria 1345
428 Ga0184603_101673 3300019192 Bacteria 805
429 Ga0184603_101976 3300019192 Unclassified 509
430 Ga0206356_11168208 3300020070 Bacteria 1635
431 Ga0206356_11567653 3300020070 Bacteria 748
432 Ga0206352_10895068 3300020078 Bacteria 690
433 Ga0206352_10900217 3300020078 Bacteria 911
434 Ga0206352_11074900 3300020078 Bacteria 2197
435 Ga0206350_11263485 3300020080 Bacteria 1118
436 Ga0206353_10215080 3300020082 Bacteria 977
437 Ga0213873_10125631 3300021358 Bacteria 756
438 Ga0224571_107568 3300022734 Bacteria 734
439 Ga0224571_111697 3300022734 Bacteria 613
440 Ga0247553_100190 3300023672 Bacteria 1980
441 Ga0224572_1001024 3300024225 Bacteria 3878
442 Ga0224572_1013782 3300024225 Bacteria 1542
443 Ga0228598_1000178 3300024227 Bacteria 11355
444 Ga0228598_1086844 3300024227 Bacteria 628
445 Ga0207697_10396622 3300025315 Bacteria 613
446 Ga0207656_10061450 3300025321 Bacteria 1649
447 Ga0207682_10606693 3300025893 Bacteria 516
448 Ga0207692_10313442 3300025898 Bacteria 958
449 Ga0207692_10333033 3300025898 Bacteria 932
450 Ga0207642_10060480 3300025899 Bacteria 1757
451 Ga0207642_10078937 3300025899 Bacteria 1592
452 Ga0207642_10738747 3300025899 Bacteria 622
453 Ga0207710_10168724 3300025900 Bacteria 1069
454 Ga0207680_10018084 3300025903 Bacteria 3738
455 Ga0207680_10071430 3300025903 Bacteria 2152
456 Ga0207647_10003885 3300025904 Bacteria 11167
457 Ga0207647_10038561 3300025904 Bacteria 3020
458 Ga0207647_10113457 3300025904 Bacteria 1602
459 Ga0207685_10123886 3300025905 Bacteria 1138
460 Ga0207699_10565843 3300025906 Bacteria 825
461 Ga0207699_10987901 3300025906 Bacteria 622
462 Ga0207699_10998348 3300025906 Bacteria 619
463 Ga0207699_11415100 3300025906 Bacteria 514
464 Ga0207645_10294779 3300025907 Bacteria 1079
465 Ga0207643_10058626 3300025908 Bacteria 2195
466 Ga0207684_10048147 3300025910 Bacteria 3615
467 Ga0207684_10073943 3300025910 Bacteria 2895
468 Ga0207684_10123483 3300025910 Bacteria 2221
469 Ga0207684_10245199 3300025910 Bacteria 1546
470 Ga0207684_10639296 3300025910 Bacteria 907
471 Ga0207654_10024015 3300025911 Bacteria 3273
472 Ga0207654_10074458 3300025911 Bacteria 2027
473 Ga0207654_10191685 3300025911 Bacteria 1340
474 Ga0207654_10357404 3300025911 Bacteria 1007
475 Ga0207654_10491465 3300025911 Bacteria 865
476 Ga0207707_10005075 3300025912 Bacteria 11550
477 Ga0207707_10034211 3300025912 Bacteria 4446
478 Ga0207707_10423782 3300025912 Bacteria 1141
479 Ga0207707_10498929 3300025912 Bacteria 1038
480 Ga0207707_10716357 3300025912 Bacteria 839
481 Ga0207707_10852466 3300025912 Bacteria 756
482 Ga0207707_10964382 3300025912 Bacteria 702
483 Ga0207695_10024406 3300025913 Bacteria 6806
484 Ga0207695_10034528 3300025913 Bacteria 5499
485 Ga0207695_10063777 3300025913 Bacteria 3796
486 Ga0207695_10535400 3300025913 Bacteria 1053
487 Ga0207695_11092918 3300025913 Bacteria 677
488 Ga0207695_11246269 3300025913 Bacteria 624
489 Ga0207671_10059946 3300025914 Bacteria 2823
490 Ga0207671_10142508 3300025914 Bacteria 1847
491 Ga0207671_10232028 3300025914 Bacteria 1448
492 Ga0207693_10000766 3300025915 Bacteria 28858
493 Ga0207693_10008775 3300025915 Bacteria 8262
494 Ga0207693_10008832 3300025915 Bacteria 8232
495 Ga0207693_10288889 3300025915 Bacteria 1285
496 Ga0207693_11046622 3300025915 Bacteria 622
497 Ga0207663_10001556 3300025916 Bacteria 10751
498 Ga0207663_10027442 3300025916 Bacteria 3319
499 Ga0207663_10243814 3300025916 Bacteria 1319
500 Ga0207660_10283083 3300025917 Bacteria 1316
501 Ga0207660_11066663 3300025917 Bacteria 659
502 Ga0207660_11206485 3300025917 Bacteria 616
503 Ga0207662_11169742 3300025918 Bacteria 547
504 Ga0207657_10013013 3300025919 Bacteria 8176
505 Ga0207657_10168517 3300025919 Bacteria 1775
506 Ga0207649_10026589 3300025920 Bacteria 3387
507 Ga0207649_10031612 3300025920 Bacteria 3147
508 Ga0207652_10017495 3300025921 Bacteria 5866
509 Ga0207652_10039350 3300025921 Bacteria 4013
510 Ga0207652_10253138 3300025921 Bacteria 1588
511 Ga0207652_10952477 3300025921 Bacteria 756
512 Ga0207646_10034371 3300025922 Bacteria 4581
513 Ga0207646_10115362 3300025922 Bacteria 2412
514 Ga0207646_10211681 3300025922 Bacteria 1751
515 Ga0207646_10236759 3300025922 Bacteria 1649
516 Ga0207646_10755955 3300025922 Bacteria 867
517 Ga0207646_11419735 3300025922 Bacteria 603
518 Ga0207681_10074336 3300025923 Bacteria 2380
519 Ga0207694_10011633 3300025924 Bacteria 6640
520 Ga0207694_10060399 3300025924 Bacteria 2950
521 Ga0207694_10584288 3300025924 Bacteria 939
522 Ga0207694_10990376 3300025924 Bacteria 711
523 Ga0207650_10194786 3300025925 Bacteria 1621
524 Ga0207650_10517120 3300025925 Bacteria 999
525 Ga0207687_10006149 3300025927 Bacteria 7942
526 Ga0207687_10018361 3300025927 Bacteria 4615
527 Ga0207687_10051087 3300025927 Bacteria 2880
528 Ga0207687_10158313 3300025927 Bacteria 1735
529 Ga0207700_10000087 3300025928 Bacteria 57996
530 Ga0207700_10023782 3300025928 Bacteria 4232
531 Ga0207700_10059233 3300025928 Bacteria 2896
532 Ga0207700_10124451 3300025928 Bacteria 2095
533 Ga0207700_10350135 3300025928 Bacteria 1286
534 Ga0207700_10943867 3300025928 Bacteria 772
535 Ga0207700_11309941 3300025928 Bacteria 645
536 Ga0207664_10004592 3300025929 Bacteria 9357
537 Ga0207664_10257086 3300025929 Bacteria 1526
538 Ga0207644_10066138 3300025931 Bacteria 2631
539 Ga0207644_11707289 3300025931 Bacteria 527
540 Ga0207690_10096064 3300025932 Bacteria 2106
541 Ga0207706_10005136 3300025933 Bacteria 12215
542 Ga0207706_10081070 3300025933 Bacteria 2852
543 Ga0207706_11025249 3300025933 Bacteria 692
544 Ga0207686_10021357 3300025934 Bacteria 3715
545 Ga0207686_10042369 3300025934 Bacteria 2782
546 Ga0207686_10431845 3300025934 Bacteria 1010
547 Ga0207686_10597615 3300025934 Bacteria 868
548 Ga0207709_10133568 3300025935 Bacteria 1695
549 Ga0207670_10248352 3300025936 Bacteria 1374
550 Ga0207670_11050096 3300025936 Bacteria 687
551 Ga0207669_10060938 3300025937 Bacteria 2316
552 Ga0207669_11331191 3300025937 Bacteria 610
553 Ga0207704_10007472 3300025938 Bacteria 5166
554 Ga0207704_10130069 3300025938 Bacteria 1742
555 Ga0207704_10163000 3300025938 Bacteria 1589
556 Ga0207704_11217675 3300025938 Bacteria 642
557 Ga0207665_10004152 3300025939 Bacteria 9646
558 Ga0207665_10048305 3300025939 Bacteria 2856
559 Ga0207665_10373001 3300025939 Bacteria 1081
560 Ga0207665_10698306 3300025939 Bacteria 797
561 Ga0207665_10811223 3300025939 Bacteria 740
562 Ga0207691_11117790 3300025940 Bacteria 655
563 Ga0207711_10019539 3300025941 Bacteria 5639
564 Ga0207711_10084741 3300025941 Bacteria 2775
565 Ga0207711_10098456 3300025941 Bacteria 2584
566 Ga0207711_10103486 3300025941 Bacteria 2521
567 Ga0207711_10168241 3300025941 Bacteria 1988
568 Ga0207711_11030592 3300025941 Bacteria 763
569 Ga0207689_10000477 3300025942 Bacteria 37709
570 Ga0207689_10018281 3300025942 Bacteria 5916
571 Ga0207689_10125054 3300025942 Bacteria 2116
572 Ga0207661_10009739 3300025944 Bacteria 6901
573 Ga0207661_10028024 3300025944 Bacteria 4310
574 Ga0207661_10041485 3300025944 Bacteria 3623
575 Ga0207679_10009388 3300025945 Bacteria 6266
576 Ga0207679_10083841 3300025945 Bacteria 2444
577 Ga0207667_10002621 3300025949 Bacteria 22287
578 Ga0207667_10003999 3300025949 Bacteria 18107
579 Ga0207667_10010952 3300025949 Bacteria 10568
580 Ga0207667_10024863 3300025949 Bacteria 6567
581 Ga0207667_10218009 3300025949 Bacteria 1955
582 Ga0207667_10405724 3300025949 Bacteria 1387
583 Ga0207651_10073649 3300025960 Bacteria 2429
584 Ga0207651_10079759 3300025960 Bacteria 2353
585 Ga0207651_10165355 3300025960 Bacteria 1739
586 Ga0207651_10579855 3300025960 Bacteria 978
587 Ga0207651_10586043 3300025960 Bacteria 973
588 Ga0207712_10051690 3300025961 Bacteria 2875
589 Ga0207668_10173226 3300025972 Bacteria 1694
590 Ga0207640_10019897 3300025981 Bacteria 3975
591 Ga0207640_10028893 3300025981 Bacteria 3396
592 Ga0207640_10079429 3300025981 Bacteria 2236
593 Ga0207640_10136815 3300025981 Bacteria 1780
594 Ga0207658_10049663 3300025986 Bacteria 3083
595 Ga0207677_10001140 3300026023 Bacteria 14484
596 Ga0207677_10015112 3300026023 Bacteria 4530
597 Ga0207677_10035144 3300026023 Bacteria 3251
598 Ga0207677_10111976 3300026023 Bacteria 2034
599 Ga0207677_10172825 3300026023 Bacteria 1691
600 Ga0207677_10227824 3300026023 Bacteria 1499
601 Ga0207703_10004867 3300026035 Bacteria 10922
602 Ga0207703_10006284 3300026035 Bacteria 9500
603 Ga0207703_10066455 3300026035 Bacteria 2966
604 Ga0207703_10122186 3300026035 Bacteria 2237
605 Ga0207703_10329906 3300026035 Bacteria 1399
606 Ga0207703_10674357 3300026035 Bacteria 982
607 Ga0207639_10010188 3300026041 Bacteria 6503
608 Ga0207639_10065776 3300026041 Bacteria 2815
609 Ga0207639_10588103 3300026041 Bacteria 1025
610 Ga0207678_10011947 3300026067 Bacteria 7626
611 Ga0207678_11202226 3300026067 Bacteria 671
612 Ga0207702_10000926 3300026078 Bacteria 30268
613 Ga0207702_10002504 3300026078 Bacteria 17340
614 Ga0207702_10104452 3300026078 Bacteria 2507
615 Ga0207702_10148461 3300026078 Bacteria 2130
616 Ga0207702_10169408 3300026078 Bacteria 2001
617 Ga0207702_10271499 3300026078 Bacteria 1600
618 Ga0207702_10339856 3300026078 Bacteria 1434
619 Ga0207702_10925089 3300026078 Bacteria 864
620 Ga0207641_10015494 3300026088 Bacteria 6247
621 Ga0207641_10029912 3300026088 Bacteria 4506
622 Ga0207641_10080996 3300026088 Bacteria 2818
623 Ga0207648_10038411 3300026089 Bacteria 4212
624 Ga0207648_10440527 3300026089 Bacteria 1185
625 Ga0207676_10041646 3300026095 Bacteria 3527
626 Ga0207676_10045403 3300026095 Bacteria 3394
627 Ga0207676_10195711 3300026095 Bacteria 1782
628 Ga0207676_11566192 3300026095 Bacteria 656
629 Ga0207674_10001827 3300026116 Bacteria 27162
630 Ga0207674_10031464 3300026116 Bacteria 5575
631 Ga0207674_10055913 3300026116 Bacteria 4009
632 Ga0207674_10200637 3300026116 Bacteria 1944
633 Ga0207674_11090859 3300026116 Bacteria 768
634 Ga0207674_11122933 3300026116 Bacteria 755
635 Ga0207675_100014206 3300026118 Bacteria 7425
636 Ga0207675_101479038 3300026118 Bacteria 700
637 Ga0207683_10085654 3300026121 Bacteria 2801
638 Ga0207683_10329425 3300026121 Bacteria 1399
639 Ga0207683_10730498 3300026121 Bacteria 918
640 Ga0207683_12157340 3300026121 Bacteria 505
641 Ga0207698_10022925 3300026142 Bacteria 4352
642 Ga0207698_10027727 3300026142 Bacteria 4026
643 Ga0207698_12388625 3300026142 Bacteria 540
644 Ga0265354_1007899 3300028016 Bacteria 1037
645 Ga0265356_1000738 3300028017 Bacteria 5557
646 Ga0268266_10020432 3300028379 Bacteria 5644
647 Ga0268266_12375199 3300028379 Unclassified 501
648 Ga0268265_10027522 3300028380 Bacteria 4059
649 Ga0268265_10231107 3300028380 Bacteria 1625
650 Ga0268264_10028017 3300028381 Bacteria 4607
651 Ga0268264_10074120 3300028381 Bacteria 2890
652 Ga0268264_10462935 3300028381 Bacteria 1230
653 Ga0268264_11092493 3300028381 Bacteria 806
654 Ga0265336_10165802 3300028666 Bacteria 657
655 Ga0265338_10019782 3300028800 Bacteria 7118
656 Ga0265338_10170424 3300028800 Bacteria 1670
657 Ga0265338_10352018 3300028800 Bacteria 1059
658 Ga0265338_10441373 3300028800 Bacteria 922
659 Ga0265338_10771847 3300028800 Unclassified 660
660 Ga0265762_1003404 3300030760 Bacteria 2848
661 Ga0265764_103465 3300030882 Bacteria 820
662 Ga0265760_10003178 3300031090 Bacteria 4806
663 Ga0265760_10018221 3300031090 Bacteria 2020
664 Ga0265760_10032054 3300031090 Bacteria 1551
665 Ga0265325_10234406 3300031241 Bacteria 836
666 Ga0265325_10265025 3300031241 Bacteria 774
667 Ga0265340_10067969 3300031247 Bacteria 1693
668 Ga0265339_10025615 3300031249 Bacteria 3384
669 Ga0265339_10540436 3300031249 Bacteria 536
670 Ga0265316_10268331 3300031344 Bacteria 1249
671 Ga0265314_10449840 3300031711 Bacteria 686
672 Ga0265314_10599711 3300031711 Bacteria 567
673 Ga0265314_10723843 3300031711 Bacteria 501
674 Ga0265342_10097512 3300031712 Bacteria 1679
675 Ga0316053_100401 3300032120 Bacteria 1947
676 Ga0316214_1063165 3300033545 Bacteria 542
677 Ga0373958_0085635 3300034819 Bacteria 720
678 Ga0373926_0075269 3300035083 Bacteria 1244
679 Ga0373926_0198356 3300035083 Bacteria 772
680 Ga0373929_0015569 3300035085 Bacteria 1480
681 Ga0373932_0150851 3300035112 Bacteria 797
682 Ga0373936_0024140 3300035113 Bacteria 2372
683 Ga0373936_0128804 3300035113 Bacteria 1086
684 Ga0373939_0016146 3300035114 Bacteria 1964
685 Ga0373945_0098615 3300035116 Bacteria 1141
686 Ga0373945_0369528 3300035116 Bacteria 624
687 Ga0373956_0138533 3300035119 Bacteria 1142
688 Ga0373957_0164942 3300035120 Bacteria 914
689 Ga0373960_0009253 3300035121 Bacteria 2381
690 Ga0373943_0152590 3300035170 Bacteria 1252
691 Ga0373943_0165006 3300035170 Bacteria 1208
692 Ga0373955_0031015 3300035172 Bacteria 2797
693 Ga0373955_0460616 3300035172 Bacteria 775
694 Ga0373961_0065935 3300035241 Bacteria 1110
695 Ga0373962_0064382 3300035242 Bacteria 1083
696 Ga0373924_0091507 3300035410 Bacteria 1302
697 Ga0373931_0012589 3300035691 Bacteria 4101
698 Ga0373931_0041311 3300035691 Bacteria 2422
699 Ga0373931_0060265 3300035691 Bacteria 2042
700 Ga0373931_0434867 3300035691 Bacteria 836
701 Ga0373931_1010950 3300035691 Bacteria 563
702 Ga0373935_0018013 3300035692 Bacteria 4292
703 Ga0373935_0028039 3300035692 Bacteria 3480
704 Ga0373935_0224815 3300035692 Bacteria 1305
705 Ga0373927_0021628 3300035695 Bacteria 4217
706 Ga0373927_0325554 3300035695 Bacteria 1012
707 Ga0373927_0815813 3300035695 Bacteria 616
708 Ga0373933_0164655 3300035724 Bacteria 1409
709 Ga0373933_0311978 3300035724 Bacteria 1019
710 Ga0373933_1104394 3300035724 Bacteria 522
711 Ga0373947_0195501 3300035725 Bacteria 1321
712 Ga0373947_0585379 3300035725 Bacteria 760
713 Ga0373937_0036128 3300036401 Bacteria 4501
714 Ga0373937_0055578 3300036401 Bacteria 3634
715 Ga0373937_0324505 3300036401 Bacteria 1457
716 Ga0373937_0383119 3300036401 Bacteria 1334
717 Ga0373937_1057633 3300036401 Bacteria 760
718 Ga0373937_1159921 3300036401 Bacteria 721
719 Ga0265778_016648 3300036457 Bacteria 883
720 Ga0373925_0021990 3300037068 Bacteria 4648
721 Ga0373925_0271202 3300037068 Bacteria 1365
722 Ga0373925_0781440 3300037068 Bacteria 787
723 Ga0395905_0474101 3300037471 Bacteria 1151
724 Ga0436364_0117652 3300037853 Bacteria 1016
725 Ga0436365_0812652 3300039437 Bacteria 2160
726 Ga0436365_0912356 3300039437 Bacteria 1070
727 Ga0436365_1440475 3300039437 Bacteria 612
728 Ga0436363_0006929 3300039450 Bacteria 2333
729 Ga0436362_0706503 3300039453 Bacteria 7300
730 Ga0436362_0818284 3300039453 Bacteria 740
731 Ga0451839_1347351 3300041496 Bacteria 974
732 Ga0439448_0004559 3300042005 Bacteria 3913
733 Ga0451577_1899034 3300042876 Unclassified 521
734 Ga0466965_0688848 3300044683 Bacteria 586
735 Ga0466964_0076769 3300044706 Bacteria 1425
736 Ga0453684_0451509 3300044712 Bacteria 1431
737 Ga0466957_0385335 3300044842 Bacteria 957
738 Ga0466960_0825268 3300044901 Bacteria 562
739 Ga0451576_0456705 3300045051 Bacteria 1341
740 Ga0451576_1092106 3300045051 Bacteria 835
741 Ga0451576_1502630 3300045051 Bacteria 700
742 Ga0466958_0917116 3300045836 Bacteria 572
743 Ga0466967_0255635 3300045976 Bacteria 1675
744 Ga0466967_0567323 3300045976 Bacteria 1118
745 Ga0495629_0056320 3300046459 Bacteria 2749
746 Ga0495580_0000596 3300046472 Bacteria 30558
747 Ga0495580_0004582 3300046472 Bacteria 11601
748 Ga0495580_0011222 3300046472 Bacteria 6933
749 Ga0495580_0018707 3300046472 Bacteria 5156
750 Ga0495580_0029636 3300046472 Bacteria 3970
751 Ga0495580_0037820 3300046472 Bacteria 3461
752 Ga0495580_0260878 3300046472 Bacteria 1185
753 Ga0495582_0060323 3300046473 Bacteria 2093
754 Ga0495594_0498129 3300046499 Bacteria 692
755 Ga0495630_0296373 3300046517 Bacteria 1236
756 Ga0495630_0430333 3300046517 Bacteria 1011
757 Ga0495665_0012256 3300046531 Bacteria 4640
758 Ga0495645_0197326 3300046543 Bacteria 1368
759 Ga0495657_0353788 3300046675 Bacteria 869
760 Ga0495657_0792832 3300046675 Bacteria 542
761 Ga0495658_0041735 3300046683 Bacteria 2558
762 Ga0495669_0009359 3300046684 Bacteria 4127
763 Ga0495669_0051347 3300046684 Bacteria 1851
764 Ga0495669_0463847 3300046684 Bacteria 615
765 Ga0495624_0251005 3300046690 Bacteria 1070
766 Ga0495581_0651119 3300047315 Bacteria 609
767 Ga0495674_0139787 3300047319 Bacteria 2036
768 Ga0495674_0428447 3300047319 Bacteria 1065
769 Ga0495593_0636053 3300047673 Bacteria 535
770 Ga0495602_0276219 3300048088 Bacteria 1240
771 Ga0495602_0653358 3300048088 Bacteria 718
772 Ga0495614_0085416 3300048089 Bacteria 1370
773 Ga0496100_0083006 3300048903 Bacteria 2168
774 Ga0496101_0100833 3300048904 Bacteria 2161
775 Ga0496101_0259716 3300048904 Bacteria 1354
776 Ga0496101_0751050 3300048904 Bacteria 770
777 Ga0496102_0086836 3300048905 Bacteria 2890
778 Ga0496102_0146502 3300048905 Bacteria 2216
779 Ga0496102_0542353 3300048905 Bacteria 1086
780 Ga0496102_1023121 3300048905 Bacteria 746
781 Ga0496102_1119843 3300048905 Bacteria 707
782 Ga0496103_0578059 3300048906 Bacteria 716
783 Ga0496104_0033497 3300048907 Bacteria 4787
784 Ga0496104_0368831 3300048907 Bacteria 1348
785 Ga0496104_0391214 3300048907 Bacteria 1302
786 Ga0496104_0405377 3300048907 Bacteria 1276
787 Ga0496104_0667156 3300048907 Bacteria 948
788 Ga0496105_0239721 3300048908 Bacteria 1472
789 Ga0496105_0993263 3300048908 Bacteria 628
790 Ga0496106_0032266 3300048909 Bacteria 3905
791 Ga0496106_0370231 3300048909 Bacteria 1151
792 Ga0496106_0616547 3300048909 Bacteria 868
793 Ga0496108_0160473 3300048911 Bacteria 1943
794 Ga0496108_0401882 3300048911 Bacteria 1196
795 Ga0496109_0020569 3300048912 Bacteria 5829
796 Ga0496109_0023992 3300048912 Bacteria 5418
797 Ga0496109_0394437 3300048912 Bacteria 1308
798 Ga0496111_0988457 3300048914 Bacteria 603
799 Ga0496112_0006950 3300048915 Bacteria 9990
800 Ga0496112_0013647 3300048915 Bacteria 7506
801 Ga0496112_0059972 3300048915 Bacteria 3749
802 Ga0496112_0074330 3300048915 Bacteria 3360
803 Ga0496112_0755229 3300048915 Bacteria 899
804 Ga0496112_1778265 3300048915 Bacteria 528
805 Ga0496113_0026790 3300048916 Bacteria 4126
806 Ga0496113_0144467 3300048916 Bacteria 1873
807 Ga0496114_0821934 3300048917 Bacteria 808
808 Ga0496114_1113375 3300048917 Bacteria 675
809 Ga0496115_0001132 3300048918 Bacteria 19254
810 Ga0496115_0085862 3300048918 Bacteria 2567
811 Ga0496115_0100980 3300048918 Bacteria 2365
812 Ga0496115_0193843 3300048918 Bacteria 1679
813 Ga0496115_0212905 3300048918 Bacteria 1596
814 Ga0496115_1158035 3300048918 Unclassified 583
815 Ga0495682_0164039 3300049460 Bacteria 791
816 Ga0501299_056186 3300049522 Bacteria 824
817 Ga0501067_0106688 3300049583 Bacteria 1557
818 Ga0501247_062289 3300049677 Bacteria 575
819 Ga0501253_148013 3300049683 Bacteria 590
820 Ga0501083_0288561 3300049744 Bacteria 1067
821 nmdc:mga0n895_2053824_c1 3300050512 Bacteria 529
822 nmdc:mga0n895_27995_c1 3300050512 Bacteria 5357
823 nmdc:mga08x19_195542_c1 3300050514 Bacteria 1385
824 Ga0495601_0414826 3300053077 Bacteria 872
825 Ga0495601_0453548 3300053077 Bacteria 829
826 Ga0495601_0719292 3300053077 Bacteria 636
827 Ga0587066_027137 3300059490 Bacteria 994
828 Ga0587070_229043 3300059491 Bacteria 507
829 Ga0587073_0284225 3300059492 Bacteria 532
830 Ga0587088_093592 3300059508 Bacteria 662
831 Ga0587128_033618 3300059630 Bacteria 863
832 Ga0587079_041174 3300059647 Bacteria 934
833 Ga0587107_110786 3300059652 Unclassified 555
834 Ga0587060_017814 3300060243 Bacteria 659
835 Ga0207702_12278192
836 Ga0058859_11776048
837 Ga0058863_10009298
838 Ga0058861_10003762
839 Ga0058862_10016397
840 Ga0058862_12865961
841 Ga0058862_12875680
842 Ga0058862_12876419
843 Ga0065714_10238578
844 Ga0065712_10093379
845 Ga0065712_10236954
846 Ga0065715_10069923
847 Ga0065715_10507514
848 Ga0070658_10786642
849 Ga0070676_10427567
850 Ga0070676_10575774
851 Ga0070683_100046820
852 Ga0070683_100103713
853 Ga0070683_100215401
854 Ga0070683_100218178
855 Ga0070683_101177026
856 Ga0070690_100007637
857 Ga0070690_100530762
858 Ga0070690_100617512
859 Ga0070670_100015850
860 Ga0070670_101814343
861 Ga0068869_100015654
862 Ga0068869_100028941
863 Ga0068869_100101213
864 Ga0070666_10013567
865 Ga0070666_10041467
866 Ga0070666_11409959
867 Ga0070680_100087235
868 Ga0070680_100183048
869 Ga0070680_100761976
870 Ga0070680_101119369
871 Ga0070682_100144735
872 Ga0070682_100358453
873 Ga0070682_101141087
874 Ga0068868_100004403
875 Ga0068868_100005029
876 Ga0068868_100016257
877 Ga0068868_100029306
878 Ga0068868_100169248
879 Ga0068868_100448629
880 Ga0070660_100027710
881 Ga0070660_100291851
882 Ga0070660_100847874
883 Ga0070689_100209806
884 Ga0070691_10031902
885 Ga0070691_10503302
886 Ga0070661_100009094
887 Ga0070661_100029191
888 Ga0070661_100965864
889 Ga0070661_101000237
890 Ga0070661_101051972
891 Ga0070661_101613376
892 Ga0070661_101625451
893 Ga0070668_100143989
894 Ga0070668_100418010
895 Ga0070669_100028322
896 Ga0070669_101298514
897 Ga0070675_101993980
898 Ga0070671_100198194
899 Ga0070671_100345072
900 Ga0070671_100544397
901 Ga0070674_100058197
902 Ga0070673_100050381
903 Ga0070673_100255940
904 Ga0070673_100310081
905 Ga0070673_100316930
906 Ga0070673_100475006
907 Ga0070673_100490003
908 Ga0070673_101480017
909 Ga0070688_100271250
910 Ga0070688_101517074
911 Ga0070659_100182773
912 Ga0070659_100496763
913 Ga0070659_100665283
914 Ga0070667_100058346
915 Ga0070709_10007319
916 Ga0070709_10469829
917 Ga0070709_10492798
918 Ga0070709_10814394
919 Ga0070709_10939177
920 Ga0070709_11250119
921 Ga0070714_100013743
922 Ga0070714_100172908
923 Ga0070713_100003633
924 Ga0070713_100012002
925 Ga0070713_100118692
926 Ga0070713_100385445
927 Ga0070713_100525351
928 Ga0070713_100530224
929 Ga0070713_101366886
930 Ga0070713_101957135
931 Ga0070710_10064116
932 Ga0070710_10071060
933 Ga0070710_10254742
934 Ga0070710_10338610
935 Ga0070701_10046899
936 Ga0070711_100001451
937 Ga0070711_100769988
938 Ga0070711_101993408
939 Ga0070705_100283053
940 Ga0070705_100520215
941 Ga0070705_100853741
942 Ga0070694_100458515
943 Ga0070708_100001162
944 Ga0070708_100046385
945 Ga0070708_100046478
946 Ga0070708_100640725
947 Ga0070708_101927635
948 Ga0070708_102237445
949 Ga0070663_100046765
950 Ga0070678_100238385
951 Ga0070678_100504001
952 Ga0070678_100504606
953 Ga0070678_100579287
954 Ga0070662_100004105
955 Ga0070662_100061302
956 Ga0070662_101289277
957 Ga0070662_101931437
958 Ga0070681_10024410
959 Ga0070681_10037672
960 Ga0070681_10061399
961 Ga0070681_10100876
962 Ga0070681_10153734
963 Ga0070681_10219108
964 Ga0070681_10248809
965 Ga0070681_10299860
966 Ga0070681_10769235
967 Ga0068867_100058972
968 Ga0068867_100077178
969 Ga0068867_100273887
970 Ga0068867_100934025
971 Ga0070706_100001933
972 Ga0070706_100020123
973 Ga0070706_100078207
974 Ga0070706_100372348
975 Ga0070706_100914157
976 Ga0070706_101162429
977 Ga0070707_100036739
978 Ga0070707_100088791
979 Ga0070707_100093184
980 Ga0070707_100216432
981 Ga0070707_100242177
982 Ga0070707_100452523
983 Ga0070698_101159651
984 Ga0070698_101331070
985 Ga0070699_100068307
986 Ga0070699_100228134
987 Ga0070699_101104247
988 Ga0070679_100126746
989 Ga0070679_100157002
990 Ga0070679_100164761
991 Ga0070679_100338193
992 Ga0070679_100665942
993 Ga0070684_100160557
994 Ga0070684_100195891
995 Ga0070684_100226196
996 Ga0070684_100432322
997 Ga0070697_100000283
998 Ga0070697_100003995
999 Ga0070697_100075175
1000 Ga0070697_100159240
1001 Ga0070697_100595319
1002 Ga0070697_100670736
1003 Ga0068853_100008387
1004 Ga0068853_100107273
1005 Ga0068853_100134729
1006 Ga0068853_100319298
1007 Ga0070686_100021492
1008 Ga0070695_100136049
1009 Ga0070696_100057952
1010 Ga0070693_100015864
1011 Ga0070693_100020059
1012 Ga0070665_100031578
1013 Ga0070665_100457827
1014 Ga0068855_100017602
1015 Ga0068855_100040905
1016 Ga0068855_100046563
1017 Ga0068855_100081320
1018 Ga0068855_100277185
1019 Ga0068855_100283033
1020 Ga0068855_100813324
1021 Ga0070664_100031709
1022 Ga0070664_100068500
1023 Ga0070664_101315918
1024 Ga0070664_102198197
1025 Ga0068857_100004001
1026 Ga0068857_100120845
1027 Ga0068857_100163484
1028 Ga0068857_100224792
1029 Ga0068857_100493325
1030 Ga0068857_101200294
1031 Ga0068854_100099920
1032 Ga0068854_100154255
1033 Ga0068854_100328389
1034 Ga0068854_101239261
1035 Ga0068856_100001110
1036 Ga0068856_100018558
1037 Ga0068856_100042765
1038 Ga0068856_100045664
1039 Ga0068856_100198386
1040 Ga0068856_100217918
1041 Ga0068856_100530377
1042 Ga0068856_100561768
1043 Ga0068856_101105834
1044 Ga0068856_101303086
1045 Ga0070702_100433103
1046 Ga0068852_100142901
1047 Ga0068852_100236033
1048 Ga0068852_100457504
1049 Ga0068859_100007438
1050 Ga0068859_100025384
1051 Ga0068859_100086640
1052 Ga0068864_100022179
1053 Ga0068864_100050781
1054 Ga0068864_100142237
1055 Ga0068864_100381590
1056 Ga0068864_101459707
1057 Ga0068866_10041105
1058 Ga0068866_10132746
1059 Ga0068866_10365917
1060 Ga0068861_100027368
1061 Ga0068861_100450147
1062 Ga0068851_10016669
1063 Ga0068851_10768158
1064 Ga0068851_11088937
1065 Ga0068870_10052211
1066 Ga0068870_10161054
1067 Ga0068863_100021102
1068 Ga0068863_100210389
1069 Ga0068863_100244460
1070 Ga0068863_100456493
1071 Ga0068858_100040536
1072 Ga0068858_100049628
1073 Ga0068858_100056365
1074 Ga0068858_100080042
1075 Ga0068858_100297352
1076 Ga0068858_100729854
1077 Ga0068860_100021796
1078 Ga0068860_100029103
1079 Ga0068860_100042911
1080 Ga0068860_100252843
1081 Ga0068860_100378743
1082 Ga0068860_101471744
1083 Ga0068862_100031281
1084 Ga0068862_100040176
1085 Ga0081540_1018394
1086 Ga0070717_10027475
1087 Ga0070717_10034156
1088 Ga0070717_10082603
1089 Ga0070717_10234144
1090 Ga0070717_10322067
1091 Ga0070717_10341823
1092 Ga0070717_10387129
1093 Ga0070717_10472588
1094 Ga0070717_10714604
1095 Ga0070717_11075572
1096 Ga0070715_10024522
1097 Ga0070715_10101146
1098 Ga0070715_10483385
1099 Ga0070716_100018336
1100 Ga0070716_100068423
1101 Ga0070716_100225176
1102 Ga0070716_100572360
1103 Ga0070716_100578155
1104 Ga0070716_100647812
1105 Ga0070712_100001874
1106 Ga0070712_100026751
1107 Ga0070712_100117725
1108 Ga0070712_100287843
1109 Ga0070712_100373870
1110 Ga0097621_100001595
1111 Ga0097621_100022785
1112 Ga0097621_100051715
1113 Ga0097621_100056302
1114 Ga0097621_100206677
1115 Ga0097621_100652535
1116 Ga0097621_102420088
1117 Ga0068871_100008540
1118 Ga0068871_100016458
1119 Ga0068871_100038763
1120 Ga0068871_100076465
1121 Ga0068871_100084679
1122 Ga0068871_100163154
1123 Ga0068871_100323105
1124 Ga0068871_101294147
1125 Ga0075433_10287813
1126 Ga0075434_100160271
1127 Ga0075434_101369541
1128 Ga0075434_101495270
1129 Ga0068865_100085999
1130 Ga0068865_100108014
1131 Ga0068865_100143790
1132 Ga0068865_100199208
1133 Ga0075436_100035402
1134 Ga0075436_100101251
1135 Ga0097620_100007438
1136 Ga0097620_100025387
1137 Ga0097620_100086636
1138 Ga0075435_100048069
1139 Ga0075435_101893829
1140 Ga0099794_10163053
1141 Ga0099795_10047311
1142 Ga0105250_10093803
1143 Ga0105240_10381075
1144 Ga0105240_10392446
1145 Ga0105240_12069244
1146 Ga0105240_12210772
1147 Ga0105240_12463916
1148 Ga0105245_10026029
1149 Ga0105245_10119600
1150 Ga0105245_11499884
1151 Ga0105247_10056655
1152 Ga0114129_10486609
1153 Ga0105243_10030797
1154 Ga0105243_11157270
1155 Ga0105241_10011009
1156 Ga0105241_10135542
1157 Ga0105241_10164549
1158 Ga0105241_10182797
1159 Ga0105241_10191517
1160 Ga0105241_10205403
1161 Ga0105241_10281765
1162 Ga0105241_10546148
1163 Ga0105241_11004137
1164 Ga0105242_10029837
1165 Ga0105242_10139310
1166 Ga0105242_10150672
1167 Ga0105242_10327865
1168 Ga0105242_10971996
1169 Ga0105248_10055715
1170 Ga0105248_10066472
1171 Ga0105248_10133043
1172 Ga0105248_10212589
1173 Ga0105248_10447911
1174 Ga0105248_12069749
1175 Ga0105248_12106852
1176 Ga0105237_10096326
1177 Ga0105237_10360259
1178 Ga0105237_10462213
1179 Ga0105237_11531688
1180 Ga0105238_10020606
1181 Ga0105238_10145324
1182 Ga0105238_10256984
1183 Ga0105238_10320346
1184 Ga0105238_10369040
1185 Ga0105238_11004231
1186 Ga0105249_10012680
1187 Ga0105249_10186546
1188 Ga0099796_10104441
1189 Ga0105239_10049333
1190 Ga0105239_10121817
1191 Ga0105239_10237627
1192 Ga0105239_10247201
1193 Ga0105239_11134094
1194 Ga0105246_10040895
1195 Ga0157340_1026617
1196 Ga0157335_1011701
1197 Ga0157373_10026972
1198 Ga0157373_10127906
1199 Ga0157373_10613933
1200 Ga0157373_10789000
1201 Ga0157371_10091632
1202 Ga0157371_10121148
1203 Ga0157370_10344323
1204 Ga0157369_10000674
1205 Ga0157369_10052158
1206 Ga0157369_10253552
1207 Ga0157369_10672454
1208 Ga0157369_12429885
1209 Ga0157374_10000602
1210 Ga0157374_10006374
1211 Ga0157374_10047190
1212 Ga0157374_10054821
1213 Ga0157374_10107246
1214 Ga0157374_10168023
1215 Ga0157374_10423847
1216 Ga0157374_11395414
1217 Ga0157378_10000634
1218 Ga0157378_10000855
1219 Ga0157378_10020155
1220 Ga0157378_10069524
1221 Ga0157378_10154890
1222 Ga0157378_10257528
1223 Ga0157378_12445690
1224 Ga0163162_10019277
1225 Ga0163162_10033025
1226 Ga0163162_10114118
1227 Ga0157372_10001167
1228 Ga0157372_10009122
1229 Ga0157372_10011399
1230 Ga0157372_10077586
1231 Ga0157372_10495693
1232 Ga0157372_11266370
1233 Ga0157372_11779807
1234 Ga0157372_12020439
1235 Ga0157372_13370054
1236 Ga0157375_10011888
1237 Ga0157375_10546020
1238 Ga0163163_10017278
1239 Ga0163163_10061034
1240 Ga0163163_10083706
1241 Ga0157377_10514663
1242 Ga0157377_11530347
1243 Ga0157379_10050490
1244 Ga0157379_10831876
1245 Ga0157379_10858665
1246 Ga0157379_11228320
1247 Ga0157379_12483028
1248 Ga0157376_10007821
1249 Ga0157376_10063726
1250 Ga0157376_10144336
1251 Ga0157376_10178549
1252 Ga0157376_10334594
1253 Ga0157376_10530101
1254 Ga0182007_10078417
1255 Ga0163161_10181622
1256 Ga0184602_110225
1257 Ga0184598_141254
1258 Ga0184601_124451
1259 Ga0184599_123307
1260 Ga0184600_118255
1261 Ga0184600_138149
1262 Ga0184603_101673
1263 Ga0184603_101976
1264 Ga0206356_11168208
1265 Ga0206356_11567653
1266 Ga0206352_10895068
1267 Ga0206352_10900217
1268 Ga0206352_11074900
1269 Ga0206350_11263485
1270 Ga0206353_10215080
1271 Ga0213873_10125631
1272 Ga0224571_107568
1273 Ga0224571_111697
1274 Ga0247553_100190
1275 Ga0224572_1001024
1276 Ga0224572_1013782
1277 Ga0228598_1000178
1278 Ga0228598_1086844
1279 Ga0207697_10396622
1280 Ga0207656_10061450
1281 Ga0207682_10606693
1282 Ga0207692_10313442
1283 Ga0207692_10333033
1284 Ga0207642_10060480
1285 Ga0207642_10078937
1286 Ga0207642_10738747
1287 Ga0207710_10168724
1288 Ga0207680_10018084
1289 Ga0207680_10071430
1290 Ga0207647_10003885
1291 Ga0207647_10038561
1292 Ga0207647_10113457
1293 Ga0207685_10123886
1294 Ga0207699_10565843
1295 Ga0207699_10987901
1296 Ga0207699_10998348
1297 Ga0207699_11415100
1298 Ga0207645_10294779
1299 Ga0207643_10058626
1300 Ga0207684_10048147
1301 Ga0207684_10073943
1302 Ga0207684_10123483
1303 Ga0207684_10245199
1304 Ga0207684_10639296
1305 Ga0207654_10024015
1306 Ga0207654_10074458
1307 Ga0207654_10191685
1308 Ga0207654_10357404
1309 Ga0207654_10491465
1310 Ga0207707_10005075
1311 Ga0207707_10034211
1312 Ga0207707_10423782
1313 Ga0207707_10498929
1314 Ga0207707_10716357
1315 Ga0207707_10852466
1316 Ga0207707_10964382
1317 Ga0207695_10024406
1318 Ga0207695_10034528
1319 Ga0207695_10063777
1320 Ga0207695_10535400
1321 Ga0207695_11092918
1322 Ga0207695_11246269
1323 Ga0207671_10059946
1324 Ga0207671_10142508
1325 Ga0207671_10232028
1326 Ga0207693_10000766
1327 Ga0207693_10008775
1328 Ga0207693_10008832
1329 Ga0207693_10288889
1330 Ga0207693_11046622
1331 Ga0207663_10001556
1332 Ga0207663_10027442
1333 Ga0207663_10243814
1334 Ga0207660_10283083
1335 Ga0207660_11066663
1336 Ga0207660_11206485
1337 Ga0207662_11169742
1338 Ga0207657_10013013
1339 Ga0207657_10168517
1340 Ga0207649_10026589
1341 Ga0207649_10031612
1342 Ga0207652_10017495
1343 Ga0207652_10039350
1344 Ga0207652_10253138
1345 Ga0207652_10952477
1346 Ga0207646_10034371
1347 Ga0207646_10115362
1348 Ga0207646_10211681
1349 Ga0207646_10236759
1350 Ga0207646_10755955
1351 Ga0207646_11419735
1352 Ga0207681_10074336
1353 Ga0207694_10011633
1354 Ga0207694_10060399
1355 Ga0207694_10584288
1356 Ga0207694_10990376
1357 Ga0207650_10194786
1358 Ga0207650_10517120
1359 Ga0207687_10006149
1360 Ga0207687_10018361
1361 Ga0207687_10051087
1362 Ga0207687_10158313
1363 Ga0207700_10000087
1364 Ga0207700_10023782
1365 Ga0207700_10059233
1366 Ga0207700_10124451
1367 Ga0207700_10350135
1368 Ga0207700_10943867
1369 Ga0207700_11309941
1370 Ga0207664_10004592
1371 Ga0207664_10257086
1372 Ga0207644_10066138
1373 Ga0207644_11707289
1374 Ga0207690_10096064
1375 Ga0207706_10005136
1376 Ga0207706_10081070
1377 Ga0207706_11025249
1378 Ga0207686_10021357
1379 Ga0207686_10042369
1380 Ga0207686_10431845
1381 Ga0207686_10597615
1382 Ga0207709_10133568
1383 Ga0207670_10248352
1384 Ga0207670_11050096
1385 Ga0207669_10060938
1386 Ga0207669_11331191
1387 Ga0207704_10007472
1388 Ga0207704_10130069
1389 Ga0207704_10163000
1390 Ga0207704_11217675
1391 Ga0207665_10004152
1392 Ga0207665_10048305
1393 Ga0207665_10373001
1394 Ga0207665_10698306
1395 Ga0207665_10811223
1396 Ga0207691_11117790
1397 Ga0207711_10019539
1398 Ga0207711_10084741
1399 Ga0207711_10098456
1400 Ga0207711_10103486
1401 Ga0207711_10168241
1402 Ga0207711_11030592
1403 Ga0207689_10000477
1404 Ga0207689_10018281
1405 Ga0207689_10125054
1406 Ga0207661_10009739
1407 Ga0207661_10028024
1408 Ga0207661_10041485
1409 Ga0207679_10009388
1410 Ga0207679_10083841
1411 Ga0207667_10002621
1412 Ga0207667_10003999
1413 Ga0207667_10010952
1414 Ga0207667_10024863
1415 Ga0207667_10218009
1416 Ga0207667_10405724
1417 Ga0207651_10073649
1418 Ga0207651_10079759
1419 Ga0207651_10165355
1420 Ga0207651_10579855
1421 Ga0207651_10586043
1422 Ga0207712_10051690
1423 Ga0207668_10173226
1424 Ga0207640_10019897
1425 Ga0207640_10028893
1426 Ga0207640_10079429
1427 Ga0207640_10136815
1428 Ga0207658_10049663
1429 Ga0207677_10001140
1430 Ga0207677_10015112
1431 Ga0207677_10035144
1432 Ga0207677_10111976
1433 Ga0207677_10172825
1434 Ga0207677_10227824
1435 Ga0207703_10004867
1436 Ga0207703_10006284
1437 Ga0207703_10066455
1438 Ga0207703_10122186
1439 Ga0207703_10329906
1440 Ga0207703_10674357
1441 Ga0207639_10010188
1442 Ga0207639_10065776
1443 Ga0207639_10588103
1444 Ga0207678_10011947
1445 Ga0207678_11202226
1446 Ga0207702_10000926
1447 Ga0207702_10002504
1448 Ga0207702_10104452
1449 Ga0207702_10148461
1450 Ga0207702_10169408
1451 Ga0207702_10271499
1452 Ga0207702_10339856
1453 Ga0207702_10925089
1454 Ga0207641_10015494
1455 Ga0207641_10029912
1456 Ga0207641_10080996
1457 Ga0207648_10038411
1458 Ga0207648_10440527
1459 Ga0207676_10041646
1460 Ga0207676_10045403
1461 Ga0207676_10195711
1462 Ga0207676_11566192
1463 Ga0207674_10001827
1464 Ga0207674_10031464
1465 Ga0207674_10055913
1466 Ga0207674_10200637
1467 Ga0207674_11090859
1468 Ga0207674_11122933
1469 Ga0207675_100014206
1470 Ga0207675_101479038
1471 Ga0207683_10085654
1472 Ga0207683_10329425
1473 Ga0207683_10730498
1474 Ga0207683_12157340
1475 Ga0207698_10022925
1476 Ga0207698_10027727
1477 Ga0207698_12388625
1478 Ga0265354_1007899
1479 Ga0265356_1000738
1480 Ga0268266_10020432
1481 Ga0268266_12375199
1482 Ga0268265_10027522
1483 Ga0268265_10231107
1484 Ga0268264_10028017
1485 Ga0268264_10074120
1486 Ga0268264_10462935
1487 Ga0268264_11092493
1488 Ga0265336_10165802
1489 Ga0265338_10019782
1490 Ga0265338_10170424
1491 Ga0265338_10352018
1492 Ga0265338_10441373
1493 Ga0265338_10771847
1494 Ga0265762_1003404
1495 Ga0265764_103465
1496 Ga0265760_10003178
1497 Ga0265760_10018221
1498 Ga0265760_10032054
1499 Ga0265325_10234406
1500 Ga0265325_10265025
1501 Ga0265340_10067969
1502 Ga0265339_10025615
1503 Ga0265339_10540436
1504 Ga0265316_10268331
1505 Ga0265314_10449840
1506 Ga0265314_10599711
1507 Ga0265314_10723843
1508 Ga0265342_10097512
1509 Ga0316053_100401
1510 Ga0316214_1063165
1511 Ga0373958_0085635
1512 Ga0373926_0075269
1513 Ga0373926_0198356
1514 Ga0373929_0015569
1515 Ga0373932_0150851
1516 Ga0373936_0024140
1517 Ga0373936_0128804
1518 Ga0373939_0016146
1519 Ga0373945_0098615
1520 Ga0373945_0369528
1521 Ga0373956_0138533
1522 Ga0373957_0164942
1523 Ga0373960_0009253
1524 Ga0373943_0152590
1525 Ga0373943_0165006
1526 Ga0373955_0031015
1527 Ga0373955_0460616
1528 Ga0373961_0065935
1529 Ga0373962_0064382
1530 Ga0373924_0091507
1531 Ga0373931_0012589
1532 Ga0373931_0041311
1533 Ga0373931_0060265
1534 Ga0373931_0434867
1535 Ga0373931_1010950
1536 Ga0373935_0018013
1537 Ga0373935_0028039
1538 Ga0373935_0224815
1539 Ga0373927_0021628
1540 Ga0373927_0325554
1541 Ga0373927_0815813
1542 Ga0373933_0164655
1543 Ga0373933_0311978
1544 Ga0373933_1104394
1545 Ga0373947_0195501
1546 Ga0373947_0585379
1547 Ga0373937_0036128
1548 Ga0373937_0055578
1549 Ga0373937_0324505
1550 Ga0373937_0383119
1551 Ga0373937_1057633
1552 Ga0373937_1159921
1553 Ga0265778_016648
1554 Ga0373925_0021990
1555 Ga0373925_0271202
1556 Ga0373925_0781440
1557 Ga0395905_0474101
1558 Ga0436364_0117652
1559 Ga0436365_0812652
1560 Ga0436365_0912356
1561 Ga0436365_1440475
1562 Ga0436363_0006929
1563 Ga0436362_0706503
1564 Ga0436362_0818284
1565 Ga0451839_1347351
1566 Ga0439448_0004559
1567 Ga0451577_1899034
1568 Ga0466965_0688848
1569 Ga0466964_0076769
1570 Ga0453684_0451509
1571 Ga0466957_0385335
1572 Ga0466960_0825268
1573 Ga0451576_0456705
1574 Ga0451576_1092106
1575 Ga0451576_1502630
1576 Ga0466958_0917116
1577 Ga0466967_0255635
1578 Ga0466967_0567323
1579 Ga0495629_0056320
1580 Ga0495580_0000596
1581 Ga0495580_0004582
1582 Ga0495580_0011222
1583 Ga0495580_0018707
1584 Ga0495580_0029636
1585 Ga0495580_0037820
1586 Ga0495580_0260878
1587 Ga0495582_0060323
1588 Ga0495594_0498129
1589 Ga0495630_0296373
1590 Ga0495630_0430333
1591 Ga0495665_0012256
1592 Ga0495645_0197326
1593 Ga0495657_0353788
1594 Ga0495657_0792832
1595 Ga0495658_0041735
1596 Ga0495669_0009359
1597 Ga0495669_0051347
1598 Ga0495669_0463847
1599 Ga0495624_0251005
1600 Ga0495581_0651119
1601 Ga0495674_0139787
1602 Ga0495674_0428447
1603 Ga0495593_0636053
1604 Ga0495602_0276219
1605 Ga0495602_0653358
1606 Ga0495614_0085416
1607 Ga0496100_0083006
1608 Ga0496101_0100833
1609 Ga0496101_0259716
1610 Ga0496101_0751050
1611 Ga0496102_0086836
1612 Ga0496102_0146502
1613 Ga0496102_0542353
1614 Ga0496102_1023121
1615 Ga0496102_1119843
1616 Ga0496103_0578059
1617 Ga0496104_0033497
1618 Ga0496104_0368831
1619 Ga0496104_0391214
1620 Ga0496104_0405377
1621 Ga0496104_0667156
1622 Ga0496105_0239721
1623 Ga0496105_0993263
1624 Ga0496106_0032266
1625 Ga0496106_0370231
1626 Ga0496106_0616547
1627 Ga0496108_0160473
1628 Ga0496108_0401882
1629 Ga0496109_0020569
1630 Ga0496109_0023992
1631 Ga0496109_0394437
1632 Ga0496111_0988457
1633 Ga0496112_0006950
1634 Ga0496112_0013647
1635 Ga0496112_0059972
1636 Ga0496112_0074330
1637 Ga0496112_0755229
1638 Ga0496112_1778265
1639 Ga0496113_0026790
1640 Ga0496113_0144467
1641 Ga0496114_0821934
1642 Ga0496114_1113375
1643 Ga0496115_0001132
1644 Ga0496115_0085862
1645 Ga0496115_0100980
1646 Ga0496115_0193843
1647 Ga0496115_0212905
1648 Ga0496115_1158035
1649 Ga0495682_0164039
1650 Ga0501299_056186
1651 Ga0501067_0106688
1652 Ga0501247_062289
1653 Ga0501253_148013
1654 Ga0501083_0288561
1655 nmdc:mga0n895_2053824_c1
1656 nmdc:mga0n895_27995_c1
1657 nmdc:mga08x19_195542_c1
1658 Ga0495601_0414826
1659 Ga0495601_0453548
1660 Ga0495601_0719292
1661 Ga0587066_027137
1662 Ga0587070_229043
1663 Ga0587073_0284225
1664 Ga0587088_093592
1665 Ga0587128_033618
1666 Ga0587079_041174
1667 Ga0587107_110786
1668 Ga0587060_017814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

38

92

0.95

Map