F482770

General Info

Members Datasets Scaffolds Average Seq Length
834 585 512 327

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10066611|rootH1_100666113
Length 394
Sequence MGMLVEGVWHDVWYDTKETKGHFKRAASQFRNWVTKDGEAGPSGTGGFKAEAGRYHLYVSLACPWAHRTLIFRKLKKLEDLISVSVVDPLMVENGWEFKISDGATGDHLFGARALWEIYVKADPNYSGRVTVPVLWDKQTGTIVNNESSEIIRMFNSAFDHLTGSTQDFYPENLAPGIDEINALVYDTVNNGVYKAGFATTQEAYEQNVVKLFGTLDALEERLGKGRYLLGDRVTEADWRLFTTLVRFDPVYVGHFKCNIRRIDDYPNLSAYLRDLYQTPGVKETVNMRHIKEHYYRSHKTINPTGIVPVGXSRPAAWPRQAGGCRLRITSNERRVPRRSAPGGGVSSPRSHSRRSPHPACAAPSARHRRGRRPHGRGGSPTYSGRLERAAARR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516143018 Ensifer sp. BR816 Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2519899620 Rhizobium sp. Pop5 Isolate Nodule
32 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
33 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
34 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
35 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
36 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
37 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
38 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
41 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
44 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
45 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
46 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
47 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
48 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
49 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
50 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
51 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
52 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
53 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
54 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
55 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
56 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
57 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
58 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
59 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
60 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
61 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
62 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
63 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
64 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
65 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
66 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
67 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
68 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
69 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
70 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
71 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
72 2643221557 Ensifer sp. Root558 Isolate Unclassified
73 2643221599 Rhizobium sp. Root708 Isolate Unclassified
74 2643221607 Rhizobium sp. Root73 Isolate Unclassified
75 2643221610 Ensifer sp. Root74 Isolate Unclassified
76 2643221618 Ensifer sp. Root231 Isolate Unclassified
77 2643221626 Ensifer sp. Root31 Isolate Unclassified
78 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
79 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
80 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
81 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
82 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
83 2643221655 Ensifer sp. Root1252 Isolate Unclassified
84 2643221659 Ensifer sp. Root127 Isolate Unclassified
85 2643221668 Ensifer sp. Root423 Isolate Unclassified
86 2643221675 Ensifer sp. Root1298 Isolate Unclassified
87 2643221680 Ensifer sp. Root1312 Isolate Unclassified
88 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
89 2643221688 Rhizobium sp. Root482 Isolate Unclassified
90 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
91 2643221698 Ensifer sp. Root142 Isolate Unclassified
92 2643221712 Ensifer sp. Root258 Isolate Unclassified
93 2643221718 Rhizobium sp. Root268 Isolate Unclassified
94 2643221719 Rhizobium sp. Root274 Isolate Unclassified
95 2643221723 Ensifer sp. Root278 Isolate Unclassified
96 2643221726 Ensifer sp. Root954 Isolate Unclassified
97 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
98 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
99 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
100 2718217882 Rhizobium sp. N741 Isolate Nodule
101 2718217927 Rhizobium sp. N324 Isolate Nodule
102 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
103 2718218009 Rhizobium sp. N561 Isolate Nodule
104 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
105 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
106 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
107 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
108 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
109 2718218363 Rhizobium sp. N113 Isolate Nodule
110 2718218365 Rhizobium sp. N731 Isolate Nodule
111 2718218366 Rhizobium sp. N621 Isolate Nodule
112 2718218423 Rhizobium sp. N941 Isolate Nodule
113 2721755514 Rhizobium sp. N6212 Isolate Nodule
114 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
115 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
116 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
117 2721755809 Rhizobium sp. N541 Isolate Nodule
118 2721755810 Rhizobium sp. N871 Isolate Nodule
119 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
120 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
121 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
122 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
123 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
124 2728369365 Rhizobium sp. N1341 Isolate Nodule
125 2728369397 Rhizobium sp. N1314 Isolate Nodule
126 2738541293 Rhizobium sp. GV031 Isolate Unclassified
127 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
128 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
129 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
130 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
131 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
132 2773857925 Microvirga vignae BR3299 Isolate Unclassified
133 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
134 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
135 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
136 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
137 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
138 2791355256 Rhizobium sp. M10 Isolate Nodule
139 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
140 2791355260 Rhizobium sp. L9 Isolate Nodule
141 2791355261 Rhizobium sp. J15 Isolate Nodule
142 2791355262 Rhizobium sp. M1 Isolate Nodule
143 2791355263 Rhizobium chutanense C5 Isolate Nodule
144 2791355264 Rhizobium sp. S9 Isolate Nodule
145 2791355265 Rhizobium sp. H4 Isolate Nodule
146 2791355266 Rhizobium sp. L43 Isolate Nodule
147 2791355267 Rhizobium sp. L18 Isolate Nodule
148 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
149 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
150 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
151 2802429633 Rhizobium anhuiense J3 Isolate Nodule
152 2802429634 Rhizobium anhuiense S10 Isolate Nodule
153 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
154 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
155 2802429637 Rhizobium anhuiense C15 Isolate Nodule
156 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
157 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
158 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
159 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
160 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
161 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
162 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
163 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
164 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
165 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
166 2838048938 Rhizobium pisi 27/80 Isolate Nodule
167 2838061910 Rhizobium phaseoli L15 Isolate Nodule
168 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
169 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
170 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
171 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
172 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
173 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
174 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
175 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
176 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
177 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
178 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
179 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
180 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
181 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
182 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
183 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
184 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
185 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
186 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
187 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
188 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
189 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
190 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
191 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
192 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
193 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
194 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
195 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
196 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
197 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
198 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
199 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
200 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
201 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
202 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
203 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
204 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
205 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
206 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
207 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
208 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
209 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
212 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
213 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
214 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
215 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
220 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
224 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
225 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
226 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
232 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
233 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
234 2844163670 Ensifer sp. 1H6 Isolate Unclassified
235 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
236 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
237 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
238 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
239 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
240 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
241 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
242 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
243 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
244 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
245 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
246 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
247 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
248 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
249 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
250 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
251 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
252 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
253 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
254 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
255 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
256 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
257 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
258 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
259 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
260 2933599457 Rhizobium phaseoli M3 Isolate Nodule
261 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
262 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
263 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
264 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
265 2936381700 Rhizobium chutanense C16 Isolate Unclassified
266 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
267 2941471342 Luteibacter sp. 621 Isolate Unclassified
268 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
269 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
270 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
271 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
272 2996887358 Rhizobium sp. R711 Isolate Nodule
273 2996893221 Rhizobium sp. R635 Isolate Nodule
274 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
275 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
276 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
277 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
278 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
279 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
280 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
281 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
282 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
283 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
284 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
285 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
286 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
287 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
288 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
289 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
290 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
291 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
292 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
293 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
294 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
295 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
296 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
297 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
298 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
299 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
300 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
301 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
302 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
303 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
304 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
305 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
306 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
307 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
308 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
309 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
310 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
311 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
312 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
313 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
314 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
315 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
316 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
317 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
318 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
319 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
320 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
321 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
322 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
323 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
324 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
325 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
326 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
327 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
328 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
329 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
330 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
331 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
332 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
333 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
334 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
335 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
336 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
337 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
338 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
339 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
340 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
341 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
342 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
343 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
344 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
345 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
346 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
347 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
348 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
349 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
350 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
351 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
352 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
353 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
354 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
355 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
356 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
357 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
358 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
359 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
360 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
361 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
362 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
363 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
364 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
366 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
367 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
368 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
369 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
371 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
372 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
373 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
376 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
382 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
383 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
400 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
402 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
403 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
406 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
407 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
408 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
409 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
410 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
411 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
412 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
413 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
414 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
416 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
417 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
418 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
419 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
420 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
421 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
422 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
423 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
424 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
425 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
426 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
427 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
428 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
429 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
430 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
431 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
432 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
433 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
434 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
435 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
436 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
439 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
440 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
441 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
442 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
445 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
446 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
447 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
448 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
449 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
450 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
451 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
452 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
453 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
454 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
455 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
461 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
462 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
463 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
464 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
465 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
466 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
467 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
468 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
469 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
470 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
471 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
474 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
475 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
476 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
479 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
483 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
484 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
496 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
497 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
503 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
504 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
505 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
506 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
508 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
509 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
510 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
511 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
512 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
513 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
514 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
515 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
516 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
517 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
518 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
519 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
520 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
521 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
522 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
523 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
524 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
525 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
526 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
527 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
528 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
529 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
530 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
531 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
532 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
533 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
534 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
535 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
536 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
537 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
538 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
539 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
540 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
543 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
544 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
545 8005258706 Rhizobium sp. R693 Isolate Nodule
546 8005275841 Rhizobium sp. N4311 Isolate Nodule
547 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
548 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
549 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
550 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
551 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
552 8005321885 Rhizobium sp. R72 Isolate Nodule
553 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
554 8005382845 Rhizobium sp. R634 Isolate Nodule
555 8005395548 Rhizobium sp. R339 Isolate Nodule
556 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
557 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
558 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
559 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
560 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
561 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
562 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
563 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
564 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
565 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
566 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
567 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
568 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
569 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
570 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
571 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
572 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
573 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
574 8018176218 Rhizobium sp. N122 Isolate Nodule
575 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
576 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
577 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
578 8024501048 Rhizobium sp. H4 Isolate Nodule
579 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
580 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
581 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
582 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
583 8056382006 Rhizobium croatiense 13T Isolate Nodule
584 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
585 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.15
Metatranscriptomes 0.24
Isolates 38.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.74
Nodule 24.46
Rhizoplane 1.44
Rhizosphere 29.86
Stem 0
Stem Tuber 0
Unclassified 20.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001277 3300001979 Bacteria 11432
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000037 3300002705 Bacteria 109690
4 JGI25156J39149_1000079 3300002705 Bacteria 73408
5 JGI25162J39368_1000379 3300002737 Bacteria 37841
6 JGI25154J39366_1000052 3300002738 Bacteria 120209
7 JGI25158J39367_1000367 3300002739 Bacteria 9734
8 JGI25158J39367_1003765 3300002739 Bacteria 2315
9 JGI25157J39369_1000040 3300002741 Bacteria 126165
10 JGI25152J39213_1000401 3300002773 Bacteria 26413
11 JGI25152J39213_1000670 3300002773 Bacteria 17822
12 JGI25152J39213_1002700 3300002773 Bacteria 6493
13 JGI25152J39213_1004954 3300002773 Bacteria 4032
14 JGI25152J39213_1014673 3300002773 Bacteria 1577
15 JGI25150J39212_1000088 3300002774 Bacteria 53538
16 JGI25150J39212_1003593 3300002774 Bacteria 3612
17 JGI25159J45721_1000004 3300002987 Bacteria 215789
18 JGI25159J45721_1000120 3300002987 Bacteria 37322
19 JGI25159J45721_1002994 3300002987 Bacteria 6140
20 JGI25151J46595_10000215 3300003187 Bacteria 69771
21 JGI25151J46595_10000280 3300003187 Bacteria 58125
22 JGI25151J46595_10009480 3300003187 Bacteria 4605
23 JGI25151J46595_10015294 3300003187 Bacteria 3387
24 JGI25151J46595_10033423 3300003187 Bacteria 1982
25 JGI25151J46595_10065817 3300003187 Bacteria 1126
26 JGI25165J46597_1000395 3300003214 Bacteria 46157
27 JGI25165J46597_1000469 3300003214 Bacteria 39844
28 JGI25165J46597_1003459 3300003214 Bacteria 3925
29 JGI25153J46596_10000069 3300003215 Bacteria 117156
30 JGI25153J46596_10002012 3300003215 Bacteria 11998
31 JGI25153J46596_10004388 3300003215 Bacteria 7609
32 JGI25153J46596_10009018 3300003215 Bacteria 4691
33 rootH1_10027563 3300003323 Bacteria 2667
34 rootH1_10066611 3300003323 Bacteria 3941
35 rootH1_10078680 3300003323 Bacteria 3909
36 JGI25160J50197_1000001 3300003354 Bacteria 782301
37 JGI25160J50197_1000021 3300003354 Bacteria 215789
38 JGI25160J50197_1002802 3300003354 Bacteria 7982
39 JGI25160J50197_1031376 3300003354 Bacteria 1369
40 JGI25161J50226_1000001 3300003374 Bacteria 655036
41 JGI25161J50226_1000385 3300003374 Bacteria 22233
42 JGI25161J50226_1000892 3300003374 Bacteria 10803
43 JGI25161J50226_1002378 3300003374 Bacteria 4847
44 Ga0055526_1000949 3300003771 Bacteria 21459
45 Ga0055526_1003373 3300003771 Bacteria 10188
46 Ga0055526_1003385 3300003771 Bacteria 10161
47 Ga0055526_1007868 3300003771 Bacteria 5441
48 Ga0055526_1018119 3300003771 Bacteria 2647
49 Ga0055524_1000704 3300003775 Bacteria 23169
50 Ga0055524_1008950 3300003775 Bacteria 4117
51 Ga0055536_1008749 3300003781 Bacteria 4295
52 Ga0055528_1000290 3300003790 Bacteria 42833
53 Ga0055528_1001102 3300003790 Bacteria 17735
54 Ga0055528_1003621 3300003790 Bacteria 7683
55 Ga0055528_1005111 3300003790 Bacteria 6181
56 Ga0055528_1009822 3300003790 Bacteria 3961
57 Ga0055540_1001179 3300003792 Bacteria 16124
58 Ga0055540_1002442 3300003792 Bacteria 9801
59 Ga0055540_1016744 3300003792 Bacteria 2072
60 Ga0055531_10010220 3300003794 Bacteria 4692
61 Ga0055531_10020767 3300003794 Bacteria 2581
62 Ga0055543_1000003 3300004625 Bacteria 358656
63 Ga0055543_1000705 3300004625 Bacteria 17007
64 Ga0055543_1001070 3300004625 Bacteria 12056
65 Ga0065165_1000008 3300005262 Bacteria 334429
66 Ga0065165_1000033 3300005262 Bacteria 215827
67 Ga0065165_1003175 3300005262 Bacteria 12038
68 Ga0065712_10071142 3300005290 Bacteria 5449
69 Ga0065715_10105176 3300005293 Bacteria 2905
70 Ga0070658_10027740 3300005327 Bacteria 4544
71 Ga0070658_10244599 3300005327 Bacteria 1521
72 Ga0070670_100001168 3300005331 Bacteria 20850
73 Ga0070660_100013349 3300005339 Bacteria 5889
74 Ga0070689_100188593 3300005340 Bacteria 1678
75 Ga0070661_100030454 3300005344 Bacteria 3898
76 Ga0070669_100119335 3300005353 Bacteria 2010
77 Ga0070671_100003323 3300005355 Bacteria 12547
78 Ga0070659_100039301 3300005366 Bacteria 3693
79 Ga0070705_100038050 3300005440 Bacteria 2718
80 Ga0070700_100319156 3300005441 Bacteria 1141
81 Ga0070694_100008686 3300005444 Bacteria 6221
82 Ga0070663_100256690 3300005455 Bacteria 1385
83 Ga0070679_100387644 3300005530 Bacteria 1344
84 Ga0070665_100077768 3300005548 Bacteria 3324
85 Ga0070665_100141967 3300005548 Bacteria 2404
86 Ga0070704_100088271 3300005549 Bacteria 2303
87 Ga0068856_100014895 3300005614 Bacteria 7506
88 Ga0068852_100019109 3300005616 Bacteria 5415
89 Ga0068851_10143217 3300005834 Bacteria 1301
90 Ga0081538_10042455 3300005981 Bacteria 2870
91 Ga0081539_10000161 3300005985 Bacteria 156560
92 Ga0075365_10001104 3300006038 Bacteria 11760
93 Ga0075365_10001846 3300006038 Bacteria 9937
94 Ga0075368_10038041 3300006042 Bacteria 1883
95 Ga0075363_100014360 3300006048 Bacteria 3867
96 Ga0075364_10000175 3300006051 Bacteria 28890
97 Ga0070715_10026277 3300006163 Bacteria 2315
98 Ga0070712_100070496 3300006175 Bacteria 2498
99 Ga0075362_10003504 3300006177 Bacteria 5506
100 Ga0075362_10078780 3300006177 Bacteria 1516
101 Ga0075367_10000097 3300006178 Bacteria 24356
102 Ga0075369_10003058 3300006186 Bacteria 6057
103 Ga0075369_10003688 3300006186 Bacteria 5598
104 Ga0075366_10001972 3300006195 Bacteria 10384
105 Ga0075366_10099891 3300006195 Bacteria 1741
106 Ga0075370_10001935 3300006353 Bacteria 9344
107 Ga0075370_10022752 3300006353 Bacteria 3445
108 Ga0075370_10041470 3300006353 Bacteria 2598
109 Ga0075370_10062269 3300006353 Bacteria 2126
110 Ga0075431_100279152 3300006847 Bacteria 1691
111 Ga0075434_100010139 3300006871 Bacteria 8824
112 Ga0079104_1000045 3300006946 Bacteria 183705
113 Ga0105251_10012063 3300009011 Bacteria 4904
114 Ga0105240_10000014 3300009093 Bacteria 482033
115 Ga0111539_10000067 3300009094 Bacteria 105394
116 Ga0111539_10366354 3300009094 Bacteria 1677
117 Ga0114129_10365076 3300009147 Bacteria 1909
118 Ga0105243_10069950 3300009148 Bacteria 2832
119 Ga0105237_10002417 3300009545 Bacteria 23180
120 Ga0105238_10006439 3300009551 Bacteria 11677
121 Ga0105249_10052441 3300009553 Bacteria 3725
122 Ga0123342_1023525 3300009766 Bacteria 3986
123 Ga0123342_1029211 3300009766 Bacteria 2885
124 Ga0105239_10000973 3300010375 Bacteria 40196
125 Ga0105239_10046631 3300010375 Bacteria 4749
126 Ga0105239_10076846 3300010375 Bacteria 3673
127 Ga0105239_10455602 3300010375 Bacteria 1451
128 Ga0157373_10069671 3300013100 Bacteria 2486
129 Ga0157370_10000327 3300013104 Bacteria 59705
130 Ga0157369_10004287 3300013105 Bacteria 16862
131 Ga0171463_1007 3300013249 Bacteria 301198
132 Ga0182008_10011435 3300014497 Bacteria 4721
133 Ga0182008_10044455 3300014497 Bacteria 2209
134 Ga0182006_1000550 3300015261 Bacteria 28293
135 Ga0182007_10002316 3300015262 Bacteria 9568
136 Ga0182005_1008827 3300015265 Bacteria 2959
137 Ga0214544_1000110 3300021320 Bacteria 113143
138 Ga0214542_1000268 3300021321 Bacteria 87082
139 Ga0214543_1000219 3300021327 Bacteria 87102
140 Ga0213872_10007629 3300021361 Bacteria 5304
141 Ga0213876_10028126 3300021384 Bacteria 2964
142 Ga0209435_100027 3300025206 Bacteria 196217
143 Ga0209436_100061 3300025208 Bacteria 58629
144 Ga0209436_106286 3300025208 Bacteria 2621
145 Ga0209563_106650 3300025230 Bacteria 1968
146 Ga0209437_100051 3300025233 Bacteria 392523
147 Ga0209437_100060 3300025233 Bacteria 355034
148 Ga0207425_1000432 3300025245 Bacteria 27708
149 Ga0207425_1001314 3300025245 Bacteria 10704
150 Ga0209646_1000086 3300025246 Bacteria 196217
151 Ga0209646_1008397 3300025246 Bacteria 1661
152 Ga0209026_1000082 3300025250 Bacteria 196315
153 Ga0209148_1003596 3300025254 Bacteria 4170
154 Ga0209759_1000063 3300025256 Bacteria 196315
155 Ga0209129_1000029 3300025258 Bacteria 401149
156 Ga0209129_1000307 3300025258 Bacteria 44447
157 Ga0209129_1000433 3300025258 Bacteria 31302
158 Ga0209129_1000607 3300025258 Bacteria 24231
159 Ga0209129_1000827 3300025258 Bacteria 19479
160 Ga0209129_1001238 3300025258 Bacteria 14649
161 Ga0209129_1003493 3300025258 Bacteria 6789
162 Ga0209233_1000095 3300025261 Bacteria 303783
163 Ga0209233_1000113 3300025261 Bacteria 253455
164 Ga0209233_1000190 3300025261 Bacteria 130713
165 Ga0209565_1010642 3300025263 Bacteria 2274
166 Ga0209673_1000010 3300025273 Bacteria 596656
167 Ga0209673_1000025 3300025273 Bacteria 404572
168 Ga0209673_1000858 3300025273 Bacteria 39511
169 Ga0209673_1000878 3300025273 Bacteria 39065
170 Ga0209673_1001058 3300025273 Bacteria 31480
171 Ga0209673_1003139 3300025273 Bacteria 10091
172 Ga0209673_1004088 3300025273 Bacteria 8038
173 Ga0209673_1006113 3300025273 Bacteria 5903
174 Ga0209673_1012505 3300025273 Bacteria 3413
175 Ga0209130_1000003 3300025284 Bacteria 677988
176 Ga0209130_1000017 3300025284 Bacteria 388431
177 Ga0209130_1000020 3300025284 Bacteria 379297
178 Ga0209676_1003867 3300025292 Bacteria 8745
179 Ga0209676_1006716 3300025292 Bacteria 5603
180 Ga0209676_1019193 3300025292 Bacteria 2359
181 Ga0209025_1000070 3300025294 Bacteria 287776
182 Ga0209025_1000091 3300025294 Bacteria 250401
183 Ga0209025_1000161 3300025294 Bacteria 166506
184 Ga0209025_1000171 3300025294 Bacteria 160478
185 Ga0209025_1003071 3300025294 Bacteria 16395
186 Ga0209025_1003763 3300025294 Bacteria 13899
187 Ga0209025_1021610 3300025294 Bacteria 3457
188 Ga0209025_1050169 3300025294 Bacteria 1671
189 Ga0209564_1000013 3300025295 Bacteria 775755
190 Ga0209564_1000265 3300025295 Bacteria 110606
191 Ga0209564_1000607 3300025295 Bacteria 55712
192 Ga0209564_1001274 3300025295 Bacteria 27732
193 Ga0209564_1006728 3300025295 Bacteria 6110
194 Ga0209564_1014538 3300025295 Bacteria 3267
195 Ga0209564_1038779 3300025295 Bacteria 1320
196 Ga0209758_1000005 3300025297 Bacteria 1368918
197 Ga0209758_1000058 3300025297 Bacteria 331603
198 Ga0209758_1000094 3300025297 Bacteria 241068
199 Ga0209758_1000671 3300025297 Bacteria 51169
200 Ga0209758_1001587 3300025297 Bacteria 26013
201 Ga0209758_1001902 3300025297 Bacteria 22788
202 Ga0209758_1002315 3300025297 Bacteria 19697
203 Ga0209758_1005320 3300025297 Bacteria 10030
204 Ga0209758_1012451 3300025297 Bacteria 4759
205 Ga0209758_1024120 3300025297 Bacteria 2722
206 Ga0209050_1017948 3300025298 Bacteria 2784
207 Ga0209256_1000153 3300025299 Bacteria 144736
208 Ga0209256_1000381 3300025299 Bacteria 70973
209 Ga0209256_1000655 3300025299 Bacteria 47114
210 Ga0209256_1001163 3300025299 Bacteria 29718
211 Ga0209256_1002239 3300025299 Bacteria 16454
212 Ga0209256_1004696 3300025299 Bacteria 8378
213 Ga0209256_1007362 3300025299 Bacteria 5463
214 Ga0209256_1011614 3300025299 Bacteria 3496
215 Ga0209256_1023649 3300025299 Bacteria 1827
216 Ga0207426_1000006 3300025302 Bacteria 1025969
217 Ga0207426_1000008 3300025302 Bacteria 848730
218 Ga0207426_1000011 3300025302 Bacteria 791203
219 Ga0207426_1000218 3300025302 Bacteria 135865
220 Ga0207426_1000941 3300025302 Bacteria 28895
221 Ga0207426_1020123 3300025302 Bacteria 2323
222 Ga0209051_1000393 3300025303 Bacteria 60776
223 Ga0209051_1003929 3300025303 Bacteria 9471
224 Ga0209051_1024266 3300025303 Bacteria 2497
225 Ga0209051_1026315 3300025303 Bacteria 2347
226 Ga0209051_1048030 3300025303 Bacteria 1451
227 Ga0209257_1002259 3300025304 Bacteria 19695
228 Ga0207685_10097233 3300025905 Bacteria 1252
229 Ga0207705_10156702 3300025909 Bacteria 1709
230 Ga0207695_10000037 3300025913 Bacteria 476303
231 Ga0207671_10000271 3300025914 Bacteria 77228
232 Ga0207660_10143029 3300025917 Bacteria 1830
233 Ga0207657_10060821 3300025919 Bacteria 3241
234 Ga0207652_10097868 3300025921 Bacteria 2587
235 Ga0207650_10000911 3300025925 Bacteria 22288
236 Ga0207644_10020032 3300025931 Bacteria 4544
237 Ga0207690_10112578 3300025932 Bacteria 1963
238 Ga0207709_10103910 3300025935 Bacteria 1884
239 Ga0207668_10236836 3300025972 Bacteria 1475
240 Ga0207639_10032244 3300026041 Bacteria 3856
241 Ga0207639_10034134 3300026041 Bacteria 3758
242 Ga0207675_100028073 3300026118 Bacteria 5239
243 Ga0209281_1000034 3300027111 Bacteria 382562
244 Ga0209371_1001220 3300027312 Bacteria 18539
245 Ga0209813_10027278 3300027866 Bacteria 1657
246 Ga0207428_10000922 3300027907 Bacteria 32865
247 Ga0268266_10044083 3300028379 Bacteria 3812
248 Ga0268266_10057894 3300028379 Bacteria 3336
249 Ga0268266_10106386 3300028379 Bacteria 2480
250 Ga0268266_10272624 3300028379 Bacteria 1571
251 Ga0268265_10071251 3300028380 Bacteria 2706
252 Ga0268265_10094434 3300028380 Bacteria 2399
253 Ga0307515_10000017 3300028794 Bacteria 550465
254 Ga0307515_10010712 3300028794 Bacteria 17520
255 Ga0307515_10034427 3300028794 Bacteria 8291
256 Ga0307515_10132752 3300028794 Bacteria 2729
257 Ga0268256_1002604 3300030500 Bacteria 8999
258 Ga0307513_10004133 3300031456 Bacteria 19451
259 Ga0307513_10011016 3300031456 Bacteria 11281
260 Ga0307408_100029916 3300031548 Bacteria 3778
261 Ga0265313_10013163 3300031595 Bacteria 4985
262 Ga0307508_10054194 3300031616 Bacteria 3557
263 Ga0307514_10209680 3300031649 Bacteria 1212
264 Ga0307405_10002161 3300031731 Bacteria 8582
265 Ga0307406_10011665 3300031901 Bacteria 4988
266 Ga0307406_10401095 3300031901 Bacteria 1087
267 Ga0316596_1026481 3300033541 Bacteria 1495
268 Ga0373931_0100707 3300035691 Bacteria 1625
269 Ga0373947_0002011 3300035725 Bacteria 12410
270 Ga0373937_0310707 3300036401 Bacteria 1491
271 Ga0395905_0000247 3300037471 Bacteria 81281
272 Ga0395905_0002775 3300037471 Bacteria 19188
273 Ga0400483_010781 3300039062 Bacteria 2197
274 Ga0400483_248403 3300039062 Bacteria 2075
275 Ga0436365_0076921 3300039437 Bacteria 40502
276 Ga0436361_0960873 3300039447 Bacteria 14932
277 Ga0439436_0001883 3300041404 Bacteria 6188
278 Ga0439436_0012061 3300041404 Bacteria 2624
279 Ga0439465_0062745 3300041413 Bacteria 1233
280 Ga0451807_1091382 3300041486 Bacteria 2324
281 Ga0451835_0232626 3300041492 Bacteria 2433
282 Ga0451835_0536437 3300041492 Bacteria 1787
283 Ga0451839_0005062 3300041496 Bacteria 1715
284 Ga0451839_0755420 3300041496 Bacteria 3473
285 Ga0451847_0197141 3300041503 Bacteria 3052
286 Ga0451851_0086492 3300041507 Bacteria 1843
287 Ga0451843_0142887 3300041509 Bacteria 1224
288 Ga0451853_0250572 3300041512 Bacteria 7138
289 Ga0439432_000558 3300042006 Bacteria 13896
290 Ga0450920_004851 3300042122 Bacteria 2378
291 Ga0450910_002662 3300042147 Bacteria 2347
292 Ga0450918_005603 3300042531 Bacteria 2253
293 Ga0466963_0039327 3300044694 Bacteria 3097
294 Ga0466970_0003192 3300044765 Bacteria 7970
295 Ga0466967_0232475 3300045976 Bacteria 1756
296 Ga0495627_006824 3300046453 Bacteria 4440
297 Ga0495592_0179911 3300046454 Bacteria 1441
298 Ga0495629_0013805 3300046459 Bacteria 5827
299 Ga0495638_0001134 3300046460 Bacteria 25773
300 Ga0495638_0046391 3300046460 Bacteria 2729
301 Ga0495638_0139840 3300046460 Bacteria 1414
302 Ga0495650_0013044 3300046471 Bacteria 4424
303 Ga0495605_0001730 3300046474 Bacteria 13987
304 Ga0495605_0036666 3300046474 Bacteria 2471
305 Ga0495585_0012690 3300046492 Bacteria 4959
306 Ga0495585_0051626 3300046492 Bacteria 2278
307 Ga0495607_0000098 3300046501 Bacteria 92012
308 Ga0495607_0027457 3300046501 Bacteria 3518
309 Ga0495607_0051826 3300046501 Bacteria 2381
310 Ga0495583_0004700 3300046506 Bacteria 9608
311 Ga0495583_0006663 3300046506 Bacteria 7489
312 Ga0495606_0002042 3300046507 Bacteria 24734
313 Ga0495606_0036266 3300046507 Bacteria 3360
314 Ga0495606_0055831 3300046507 Bacteria 2552
315 Ga0495606_0080502 3300046507 Bacteria 2027
316 Ga0495610_0001520 3300046512 Bacteria 20427
317 Ga0495610_0005659 3300046512 Bacteria 8812
318 Ga0495610_0091860 3300046512 Bacteria 1374
319 Ga0495620_0042046 3300046515 Bacteria 1999
320 Ga0495630_0422961 3300046517 Bacteria 1021
321 Ga0495632_0014446 3300046519 Bacteria 4466
322 Ga0495632_0022618 3300046519 Bacteria 3367
323 Ga0495632_0033844 3300046519 Bacteria 2620
324 Ga0495643_0005744 3300046522 Bacteria 8304
325 Ga0495643_0006351 3300046522 Bacteria 7806
326 Ga0495644_0009087 3300046523 Bacteria 3827
327 Ga0495648_0012382 3300046524 Bacteria 6370
328 Ga0495609_0013153 3300046538 Bacteria 3914
329 Ga0495609_0034268 3300046538 Bacteria 2302
330 Ga0495633_0037450 3300046558 Bacteria 2320
331 Ga0495668_0003677 3300046616 Bacteria 11331
332 Ga0495668_0030470 3300046616 Bacteria 3045
333 Ga0495668_0071821 3300046616 Bacteria 1902
334 Ga0495611_0004410 3300046648 Bacteria 6091
335 Ga0495625_0007306 3300046660 Bacteria 9653
336 Ga0495625_0052820 3300046660 Bacteria 2908
337 Ga0495625_0282792 3300046660 Bacteria 1067
338 Ga0495661_0058083 3300046665 Bacteria 2307
339 Ga0495661_0168317 3300046665 Bacteria 1171
340 Ga0495588_0018389 3300046674 Bacteria 3407
341 Ga0495649_0038484 3300046694 Bacteria 2624
342 Ga0495660_0034498 3300046810 Bacteria 2831
343 Ga0495672_0018588 3300047320 Bacteria 4609
344 Ga0495681_0014851 3300047470 Bacteria 4440
345 Ga0495681_0075000 3300047470 Bacteria 1524
346 Ga0495686_0001235 3300047472 Bacteria 29180
347 Ga0495686_0005343 3300047472 Bacteria 10172
348 Ga0495686_0021785 3300047472 Bacteria 4250
349 Ga0495686_0034761 3300047472 Bacteria 3243
350 Ga0496100_0034971 3300048903 Bacteria 3157
351 Ga0496103_0004502 3300048906 Bacteria 8444
352 Ga0496106_0000489 3300048909 Bacteria 28107
353 Ga0496111_0002475 3300048914 Bacteria 11145
354 Ga0496114_0340630 3300048917 Bacteria 1326
355 Ga0496116_0003199 3300048919 Bacteria 16377
356 Ga0496116_0004652 3300048919 Bacteria 12999
357 Ga0496116_0009375 3300048919 Bacteria 8351
358 Ga0496116_0014992 3300048919 Bacteria 6148
359 Ga0496117_0001519 3300048920 Bacteria 33158
360 Ga0496117_0004687 3300048920 Bacteria 14851
361 Ga0496117_0004948 3300048920 Bacteria 14309
362 Ga0496117_0011927 3300048920 Bacteria 7724
363 Ga0496117_0030038 3300048920 Bacteria 4178
364 Ga0496118_0001098 3300048921 Bacteria 42106
365 Ga0496118_0001657 3300048921 Bacteria 32712
366 Ga0496118_0006533 3300048921 Bacteria 12756
367 Ga0496118_0025572 3300048921 Bacteria 5056
368 Ga0496118_0032122 3300048921 Bacteria 4334
369 Ga0496119_0002067 3300048922 Bacteria 22707
370 Ga0496119_0076731 3300048922 Bacteria 1938
371 Ga0496120_0003006 3300048923 Bacteria 15992
372 Ga0496121_0000350 3300048924 Bacteria 96129
373 Ga0496121_0001450 3300048924 Bacteria 40031
374 Ga0496121_0003379 3300048924 Bacteria 22866
375 Ga0496121_0005364 3300048924 Bacteria 16480
376 Ga0496121_0024213 3300048924 Bacteria 5814
377 Ga0496121_0040826 3300048924 Bacteria 4064
378 Ga0496121_0060616 3300048924 Bacteria 3111
379 Ga0496122_0000464 3300048925 Bacteria 84473
380 Ga0496122_0005368 3300048925 Bacteria 15305
381 Ga0496122_0007038 3300048925 Bacteria 12643
382 Ga0496122_0008330 3300048925 Bacteria 11218
383 Ga0496122_0026341 3300048925 Bacteria 5016
384 Ga0496122_0031807 3300048925 Bacteria 4380
385 Ga0496122_0036804 3300048925 Bacteria 3950
386 Ga0496122_0038126 3300048925 Bacteria 3856
387 Ga0496122_0078142 3300048925 Bacteria 2319
388 Ga0496123_0000147 3300048926 Bacteria 143834
389 Ga0496123_0003801 3300048926 Bacteria 16515
390 Ga0496123_0009703 3300048926 Bacteria 8629
391 Ga0496123_0009726 3300048926 Bacteria 8610
392 Ga0496123_0016868 3300048926 Bacteria 5903
393 Ga0496123_0046675 3300048926 Bacteria 2935
394 Ga0496123_0050278 3300048926 Bacteria 2786
395 Ga0496123_0112118 3300048926 Bacteria 1556
396 Ga0496124_0001427 3300048927 Bacteria 35336
397 Ga0496124_0001440 3300048927 Bacteria 35173
398 Ga0496124_0002807 3300048927 Bacteria 22062
399 Ga0496124_0011943 3300048927 Bacteria 8642
400 Ga0496124_0028366 3300048927 Bacteria 5008
401 Ga0496124_0036039 3300048927 Bacteria 4320
402 Ga0496124_0069370 3300048927 Bacteria 2927
403 Ga0496124_0150030 3300048927 Bacteria 1830
404 Ga0496124_0209424 3300048927 Bacteria 1476
405 Ga0496125_0000848 3300048928 Bacteria 49020
406 Ga0496125_0005914 3300048928 Bacteria 13413
407 Ga0496125_0010583 3300048928 Bacteria 9322
408 Ga0496125_0038896 3300048928 Bacteria 4107
409 Ga0496126_0000601 3300048929 Bacteria 67983
410 Ga0496126_0014162 3300048929 Bacteria 8072
411 Ga0496126_0027727 3300048929 Bacteria 5405
412 Ga0496126_0035374 3300048929 Bacteria 4683
413 Ga0496126_0103973 3300048929 Bacteria 2481
414 Ga0496126_0370434 3300048929 Bacteria 1168
415 Ga0495678_030504 3300049459 Bacteria 2255
416 Ga0501032_0028045 3300049569 Bacteria 3869
417 Ga0501032_0030052 3300049569 Bacteria 3727
418 Ga0501033_0000162 3300049570 Bacteria 63932
419 Ga0501033_0007353 3300049570 Bacteria 8577
420 Ga0501034_0320839 3300049571 Bacteria 1482
421 Ga0501036_0037833 3300049572 Bacteria 4081
422 Ga0501037_0006549 3300049573 Bacteria 8524
423 Ga0501038_0008488 3300049574 Bacteria 9445
424 Ga0501038_0032858 3300049574 Bacteria 4573
425 Ga0501038_0036638 3300049574 Bacteria 4304
426 Ga0501038_0072823 3300049574 Bacteria 2911
427 Ga0501038_0084326 3300049574 Bacteria 2673
428 Ga0501039_0068852 3300049575 Bacteria 2747
429 Ga0501043_0009063 3300049579 Bacteria 7829
430 Ga0501046_0000636 3300049580 Bacteria 34297
431 Ga0501047_0031857 3300049581 Bacteria 5087
432 Ga0501047_0373617 3300049581 Bacteria 1260
433 Ga0501048_0014133 3300049582 Bacteria 5916
434 Ga0501067_0006344 3300049583 Bacteria 6557
435 Ga0501067_0053603 3300049583 Bacteria 2235
436 Ga0501068_0014303 3300049584 Bacteria 4535
437 Ga0501068_0023415 3300049584 Bacteria 3619
438 Ga0501069_0000722 3300049585 Bacteria 15375
439 Ga0501070_0006756 3300049586 Bacteria 9767
440 Ga0501070_0006807 3300049586 Bacteria 9723
441 Ga0501071_0250179 3300049587 Bacteria 1338
442 Ga0501073_0017192 3300049589 Bacteria 5238
443 Ga0501074_0002152 3300049590 Bacteria 13629
444 Ga0501076_0169922 3300049592 Bacteria 1777
445 Ga0501079_0116219 3300049741 Bacteria 2080
446 Ga0501079_0261351 3300049741 Bacteria 1353
447 Ga0501080_0001242 3300049742 Bacteria 21219
448 Ga0501080_0073224 3300049742 Bacteria 3187
449 Ga0501280_005903 3300049776 Bacteria 1738
450 Ga0501035_0000510 3300049822 Bacteria 43630
451 Ga0501035_0011406 3300049822 Bacteria 8239
452 Ga0501035_0032402 3300049822 Bacteria 4755
453 Ga0501035_0069834 3300049822 Bacteria 3112
454 Ga0501044_0010260 3300049823 Bacteria 10174
455 Ga0501044_0018345 3300049823 Bacteria 7498
456 Ga0501044_0089980 3300049823 Bacteria 3097
457 Ga0501044_0254770 3300049823 Bacteria 1695
458 nmdc:mga03683_1838_c1 3300050489 Bacteria 6445
459 nmdc:mga00v17_198_c1 3300050491 Bacteria 36155
460 nmdc:mga00v17_97679_c1 3300050491 Bacteria 1851
461 nmdc:mga0yw44_1428_c1 3300050492 Bacteria 7360
462 nmdc:mga0k408_16356_c1 3300050493 Bacteria 4116
463 nmdc:mga0k408_4393_c1 3300050493 Bacteria 4032
464 nmdc:mga0k408_70640_c1 3300050493 Bacteria 2037
465 nmdc:mga0k408_96409_c1 3300050493 Bacteria 1741
466 nmdc:mga06z11_2165_c1 3300050494 Bacteria 7455
467 nmdc:mga06z11_240_c1 3300050494 Bacteria 21340
468 nmdc:mga07m45_228605_c1 3300050496 Bacteria 1082
469 nmdc:mga05p37_43723_c1 3300050507 Bacteria 5512
470 nmdc:mga0qj67_267286_c1 3300050509 Bacteria 1387
471 nmdc:mga08y16_130_c1 3300050511 Bacteria 34016
472 nmdc:mga08y16_465538_c1 3300050511 Bacteria 1288
473 nmdc:mga08y16_71252_c1 3300050511 Bacteria 3622
474 nmdc:mga0rr50_89462_c1 3300050513 Bacteria 2394
475 nmdc:mga0a205_190400_c1 3300050515 Bacteria 1944
476 Ga0495601_0010995 3300053077 Bacteria 5406
477 Ga0495601_0059426 3300053077 Bacteria 2424
478 Ga0500610_0002510 3300053079 Bacteria 6798
479 Ga0495619_0014605 3300053085 Bacteria 4961
480 Ga0500578_0016602 3300053086 Bacteria 4729
481 Ga0500646_0013880 3300053090 Bacteria 2088
482 Ga0500650_0043574 3300053098 Bacteria 2076
483 Ga0500569_001073 3300053109 Bacteria 4979
484 Ga0500618_000440 3300053125 Bacteria 27274
485 Ga0500618_003308 3300053125 Bacteria 5586
486 Ga0500618_005561 3300053125 Bacteria 3813
487 Ga0500642_0000485 3300053130 Bacteria 12275
488 Ga0500658_0000240 3300053134 Bacteria 25716
489 Ga0500658_0001395 3300053134 Bacteria 9748
490 Ga0500559_0010784 3300053136 Bacteria 3918
491 Ga0500568_0001761 3300053139 Bacteria 13373
492 Ga0500568_0002000 3300053139 Bacteria 12420
493 Ga0500573_0002418 3300053140 Bacteria 9325
494 Ga0500573_0009094 3300053140 Bacteria 5498
495 Ga0500577_0033867 3300053142 Bacteria 1810
496 Ga0500577_0037870 3300053142 Bacteria 1738
497 Ga0500588_0009982 3300053146 Bacteria 2277
498 Ga0500590_001428 3300053148 Bacteria 9830
499 Ga0500616_0000309 3300053153 Bacteria 70113
500 Ga0500616_0001260 3300053153 Bacteria 25329
501 Ga0500616_0005585 3300053153 Bacteria 8497
502 Ga0500616_0027040 3300053153 Bacteria 3170
503 Ga0500616_0033094 3300053153 Bacteria 2822
504 Ga0500616_0069830 3300053153 Bacteria 1795
505 Ga0500622_0000743 3300053156 Bacteria 28461
506 Ga0500624_000390 3300053157 Bacteria 13890
507 Ga0500627_0007798 3300053158 Bacteria 3760
508 Ga0500627_0034908 3300053158 Bacteria 2135
509 Ga0500627_0061483 3300053158 Bacteria 1652
510 Ga0590075_005717 3300059424 Bacteria 2943
511 Ga0587088_013784 3300059508 Bacteria 1247
512 Ga0501082_0121871 3300060353 Bacteria 2260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2846952575 2846956302 309
2 iso_pu_bacteria 2511231221 2512035365 312
3 iso_pu_bacteria 2897803580 2897805280 312
4 iso_pu_bacteria 8054002106 8054009229 312
5 3300039447 Ga0436361_0960873 Ga0436361_0960873_4923_5873 313
6 3300005441 Ga0070700_100319156 Ga0070700_1003191561 314
7 3300005985 Ga0081539_10000161 Ga0081539_10000161123 314
8 iso_pu_bacteria 2941471342 2941475876 315
9 3300005327 Ga0070658_10027740 Ga0070658_100277404 316
10 3300005339 Ga0070660_100013349 Ga0070660_1000133493 316
11 3300005344 Ga0070661_100030454 Ga0070661_1000304543 316
12 3300005366 Ga0070659_100039301 Ga0070659_1000393015 316
13 3300005616 Ga0068852_100019109 Ga0068852_1000191095 316
14 3300009551 Ga0105238_10006439 Ga0105238_100064397 316
15 3300010375 Ga0105239_10046631 Ga0105239_100466314 316
16 3300013105 Ga0157369_10004287 Ga0157369_100042874 316
17 3300025919 Ga0207657_10060821 Ga0207657_100608214 316
18 3300026041 Ga0207639_10032244 Ga0207639_100322441 316
19 3300047470 Ga0495681_0075000 Ga0495681_0075000_22_972 316
20 3300048925 Ga0496122_0036804 Ga0496122_0036804_1117_2076 316
21 3300003215 JGI25153J46596_10000069 JGI25153J46596_10000069110 317
22 3300005548 Ga0070665_100141967 Ga0070665_1001419672 317
23 3300010375 Ga0105239_10076846 Ga0105239_100768462 317
24 3300025297 Ga0209758_1000005 Ga0209758_100000578 317
25 3300025302 Ga0207426_1020123 Ga0207426_10201233 317
26 3300028379 Ga0268266_10044083 Ga0268266_100440832 317
27 3300028794 Ga0307515_10132752 Ga0307515_101327523 317
28 3300037471 Ga0395905_0000247 Ga0395905_0000247_22002_22955 317
29 3300037471 Ga0395905_0002775 Ga0395905_0002775_187_1140 317
30 3300046453 Ga0495627_006824 Ga0495627_006824_1599_2561 317
31 3300046471 Ga0495650_0013044 Ga0495650_0013044_1881_2843 317
32 3300047470 Ga0495681_0014851 Ga0495681_0014851_1879_2841 317
33 3300049569 Ga0501032_0028045 Ga0501032_0028045_2647_3609 317
34 3300049570 Ga0501033_0007353 Ga0501033_0007353_3480_4442 317
35 3300049572 Ga0501036_0037833 Ga0501036_0037833_1408_2370 317
36 3300049573 Ga0501037_0006549 Ga0501037_0006549_2480_3442 317
37 3300049574 Ga0501038_0008488 Ga0501038_0008488_140_1102 317
38 3300049574 Ga0501038_0032858 Ga0501038_0032858_2175_3128 317
39 3300049574 Ga0501038_0036638 Ga0501038_0036638_339_1292 317
40 3300049575 Ga0501039_0068852 Ga0501039_0068852_518_1480 317
41 3300049579 Ga0501043_0009063 Ga0501043_0009063_1712_2674 317
42 3300049580 Ga0501046_0000636 Ga0501046_0000636_7360_8322 317
43 3300049581 Ga0501047_0031857 Ga0501047_0031857_2874_3827 317
44 3300049581 Ga0501047_0373617 Ga0501047_0373617_93_1055 317
45 3300049582 Ga0501048_0014133 Ga0501048_0014133_4044_5006 317
46 3300049583 Ga0501067_0006344 Ga0501067_0006344_206_1168 317
47 3300049583 Ga0501067_0053603 Ga0501067_0053603_452_1405 317
48 3300049584 Ga0501068_0014303 Ga0501068_0014303_81_1043 317
49 3300049584 Ga0501068_0023415 Ga0501068_0023415_1596_2549 317
50 3300049585 Ga0501069_0000722 Ga0501069_0000722_5548_6510 317
51 3300049586 Ga0501070_0006756 Ga0501070_0006756_3486_4448 317
52 3300049586 Ga0501070_0006807 Ga0501070_0006807_6073_7026 317
53 3300049587 Ga0501071_0250179 Ga0501071_0250179_290_1243 317
54 3300049589 Ga0501073_0017192 Ga0501073_0017192_1796_2758 317
55 3300049590 Ga0501074_0002152 Ga0501074_0002152_2662_3624 317
56 3300049592 Ga0501076_0169922 Ga0501076_0169922_252_1205 317
57 3300049741 Ga0501079_0261351 Ga0501079_0261351_134_1096 317
58 3300049742 Ga0501080_0001242 Ga0501080_0001242_15055_16017 317
59 3300049742 Ga0501080_0073224 Ga0501080_0073224_27_980 317
60 3300049822 Ga0501035_0011406 Ga0501035_0011406_6476_7438 317
61 3300049822 Ga0501035_0032402 Ga0501035_0032402_3086_4039 317
62 3300049823 Ga0501044_0010260 Ga0501044_0010260_4348_5301 317
63 3300049823 Ga0501044_0018345 Ga0501044_0018345_813_1766 317
64 3300053090 Ga0500646_0013880 Ga0500646_0013880_463_1416 317
65 3300053130 Ga0500642_0000485 Ga0500642_0000485_2226_3179 317
66 3300053153 Ga0500616_0069830 Ga0500616_0069830_715_1668 317
67 3300060353 Ga0501082_0121871 Ga0501082_0121871_366_1328 317
68 3300006195 Ga0075366_10099891 Ga0075366_100998912 318
69 3300031649 Ga0307514_10209680 Ga0307514_102096802 318
70 3300046460 Ga0495638_0046391 Ga0495638_0046391_1562_2518 318
71 3300050493 nmdc:mga0k408_96409_c1 nmdc:mga0k408_96409_c1_368_1324 318
72 3300039062 Ga0400483_248403 Ga0400483_248403_350_1321 319
73 3300046501 Ga0495607_0000098 Ga0495607_0000098_53805_54767 319
74 3300048920 Ga0496117_0030038 Ga0496117_0030038_487_1449 319
75 3300048921 Ga0496118_0001098 Ga0496118_0001098_1150_2112 319
76 3300048924 Ga0496121_0000350 Ga0496121_0000350_4729_5691 319
77 3300048926 Ga0496123_0112118 Ga0496123_0112118_179_1141 319
78 3300048929 Ga0496126_0370434 Ga0496126_0370434_180_1142 319
79 3300049823 Ga0501044_0254770 Ga0501044_0254770_149_1108 319
80 iso_pu_bacteria 2600254933 2600374130 319
81 iso_pu_bacteria 2643221637 2644208807 319
82 iso_pu_bacteria 2643221718 2644652337 319
83 iso_pu_bacteria 2721755823 2724111008 319
84 iso_pu_bacteria 2828305725 2828307647 319
85 iso_pu_bacteria 2842264693 2842269484 319
86 iso_pu_bacteria 2842428310 2842430514 319
87 iso_pu_bacteria 2842434925 2842436674 319
88 iso_pu_bacteria 2842441272 2842443484 319
89 iso_pu_bacteria 2842462802 2842466768 319
90 iso_pu_bacteria 2842469257 2842471456 319
91 iso_pu_bacteria 8005430974 8005437483 319
92 3300005353 Ga0070669_100119335 Ga0070669_1001193352 320
93 3300006163 Ga0070715_10026277 Ga0070715_100262772 320
94 3300009094 Ga0111539_10000067 Ga0111539_100000677 320
95 3300009094 Ga0111539_10366354 Ga0111539_103663542 320
96 3300025905 Ga0207685_10097233 Ga0207685_100972331 320
97 3300026118 Ga0207675_100028073 Ga0207675_1000280734 320
98 3300027907 Ga0207428_10000922 Ga0207428_100009227 320
99 3300028380 Ga0268265_10071251 Ga0268265_100712513 320
100 3300028380 Ga0268265_10094434 Ga0268265_100944342 320
101 3300050493 nmdc:mga0k408_70640_c1 nmdc:mga0k408_70640_c1_670_1635 320
102 3300050511 nmdc:mga08y16_130_c1 nmdc:mga08y16_130_c1_27196_28161 320
103 3300050511 nmdc:mga08y16_465538_c1 nmdc:mga08y16_465538_c1_298_1263 320
104 3300050515 nmdc:mga0a205_190400_c1 nmdc:mga0a205_190400_c1_728_1690 320
105 3300059424 Ga0590075_005717 Ga0590075_005717_914_1879 320
106 iso_pu_bacteria 2509276021 2509391827 320
107 iso_pu_bacteria 2513237103 2513707819 320
108 iso_pu_bacteria 2516653077 2517036925 320
109 iso_pu_bacteria 2718217927 2719386609 320
110 iso_pu_bacteria 2718217997 2719666358 320
111 iso_pu_bacteria 2718218199 2720492778 320
112 iso_pu_bacteria 2718218232 2720614245 320
113 iso_pu_bacteria 2718218233 2720621013 320
114 iso_pu_bacteria 2718218235 2720632337 320
115 iso_pu_bacteria 2718218269 2720776065 320
116 iso_pu_bacteria 2718218423 2721400313 320
117 iso_pu_bacteria 2721755556 2723027664 320
118 iso_pu_bacteria 2721755684 2723561292 320
119 iso_pu_bacteria 2721755685 2723567915 320
120 iso_pu_bacteria 2721755809 2724039126 320
121 iso_pu_bacteria 2721755819 2724090672 320
122 iso_pu_bacteria 2721755822 2724105180 320
123 iso_pu_bacteria 2728369352 2730108600 320
124 iso_pu_bacteria 2739367655 2739612521 320
125 iso_pu_bacteria 2791355266 2793361936 320
126 iso_pu_bacteria 2791355267 2793367693 320
127 iso_pu_bacteria 2802429605 2805926871 320
128 iso_pu_bacteria 2802429606 2805932786 320
129 iso_pu_bacteria 2838016132 2838021654 320
130 iso_pu_bacteria 2838048938 2838053352 320
131 iso_pu_bacteria 2838061910 2838065472 320
132 iso_pu_bacteria 2838068647 2838069951 320
133 iso_pu_bacteria 2838668709 2838670561 320
134 iso_pu_bacteria 2838680041 2838683249 320
135 iso_pu_bacteria 2838694306 2838697807 320
136 iso_pu_bacteria 2838701080 2838702932 320
137 iso_pu_bacteria 2838707686 2838710922 320
138 iso_pu_bacteria 2841864319 2841867158 320
139 iso_pu_bacteria 2842077413 2842079096 320
140 iso_pu_bacteria 2842146304 2842147810 320
141 iso_pu_bacteria 2842192696 2842195858 320
142 iso_pu_bacteria 2842217011 2842218150 320
143 iso_pu_bacteria 2842237096 2842240306 320
144 iso_pu_bacteria 2842250916 2842252876 320
145 iso_pu_bacteria 2842291075 2842292758 320
146 iso_pu_bacteria 2842311132 2842314022 320
147 iso_pu_bacteria 2842317721 2842319739 320
148 iso_pu_bacteria 2842341865 2842347316 320
149 iso_pu_bacteria 2842363717 2842370240 320
150 iso_pu_bacteria 2842370503 2842373880 320
151 iso_pu_bacteria 2842377471 2842379155 320
152 iso_pu_bacteria 2842384541 2842384904 320
153 iso_pu_bacteria 2842422224 2842423565 320
154 iso_pu_bacteria 2842447887 2842449354 320
155 iso_pu_bacteria 2842489311 2842492269 320
156 iso_pu_bacteria 2842495871 2842497871 320
157 iso_pu_bacteria 2933599457 2933600757 320
158 iso_pu_bacteria 2935894831 2935896808 320
159 iso_pu_bacteria 8005275841 8005281415 320
160 iso_pu_bacteria 8005282627 8005284616 320
161 iso_pu_bacteria 8005497431 8005501096 320
162 iso_pu_bacteria 8005619151 8005622463 320
163 iso_pu_bacteria 8005626139 8005629964 320
164 iso_pu_bacteria 8005668836 8005672514 320
165 iso_pu_bacteria 8018176218 8018176851 320
166 iso_pu_bacteria 8024501048 8024504636 320
167 iso_pu_bacteria 8056375014 8056378342 320
168 iso_pu_bacteria 8057874678 8057879861 320
169 3300005455 Ga0070663_100256690 Ga0070663_1002566901 321
170 3300025972 Ga0207668_10236836 Ga0207668_102368361 321
171 iso_pu_bacteria 2508501122 2509108168 321
172 iso_pu_bacteria 2516143018 2516206206 321
173 iso_pu_bacteria 2558860983 2561468620 321
174 iso_pu_bacteria 2599185352 2600194824 321
175 iso_pu_bacteria 2615840624 2616293159 321
176 iso_pu_bacteria 2643221557 2643804219 321
177 iso_pu_bacteria 2643221610 2644065007 321
178 iso_pu_bacteria 2643221618 2644107029 321
179 iso_pu_bacteria 2643221626 2644148773 321
180 iso_pu_bacteria 2643221655 2644309989 321
181 iso_pu_bacteria 2643221659 2644331135 321
182 iso_pu_bacteria 2643221668 2644376584 321
183 iso_pu_bacteria 2643221675 2644416680 321
184 iso_pu_bacteria 2643221680 2644449720 321
185 iso_pu_bacteria 2643221698 2644543865 321
186 iso_pu_bacteria 2643221712 2644616444 321
187 iso_pu_bacteria 2643221723 2644675845 321
188 iso_pu_bacteria 2643221726 2644689852 321
189 iso_pu_bacteria 2657244999 2657681711 321
190 iso_pu_bacteria 2690316117 2692315302 321
191 iso_pu_bacteria 2751185821 2753462340 321
192 iso_pu_bacteria 2791355091 2792620597 321
193 iso_pu_bacteria 2791355092 2792625956 321
194 iso_pu_bacteria 2791355094 2792638895 321
195 iso_pu_bacteria 2802429268 2804752899 321
196 iso_pu_bacteria 2844163670 2844164047 321
197 iso_pu_bacteria 2847417321 2847419639 321
198 iso_pu_bacteria 2848992105 2848994637 321
199 iso_pu_bacteria 2855872281 2855877156 321
200 iso_pu_bacteria 2920822456 2920825464 321
201 iso_pu_bacteria 2941499720 2941504756 321
202 iso_pu_bacteria 643692032 643826536 321
203 iso_pu_bacteria 8005382845 8005388916 321
204 iso_pu_bacteria 8005395548 8005395898 321
205 iso_pu_bacteria 8018127388 8018128001 321
206 3300050493 nmdc:mga0k408_4393_c1 nmdc:mga0k408_4393_c1_2929_3936 322
207 3300053157 Ga0500624_000390 Ga0500624_000390_5201_6208 322
208 iso_pu_bacteria 2775507049 2776914155 322
209 iso_pu_bacteria 2939669807 2939670214 322
210 3300005981 Ga0081538_10042455 Ga0081538_100424552 323
211 3300006178 Ga0075367_10000097 Ga0075367_1000009723 323
212 3300006847 Ga0075431_100279152 Ga0075431_1002791523 323
213 3300010375 Ga0105239_10455602 Ga0105239_104556021 323
214 3300021384 Ga0213876_10028126 Ga0213876_100281263 323
215 3300025230 Ga0209563_106650 Ga0209563_1066502 323
216 3300036401 Ga0373937_0310707 Ga0373937_0310707_372_1355 323
217 3300039437 Ga0436365_0076921 Ga0436365_0076921_21902_22876 323
218 3300046517 Ga0495630_0422961 Ga0495630_0422961_12_983 323
219 3300048927 Ga0496124_0001427 Ga0496124_0001427_1344_2342 323
220 3300049570 Ga0501033_0000162 Ga0501033_0000162_43690_44664 323
221 3300049822 Ga0501035_0000510 Ga0501035_0000510_26255_27229 323
222 3300050494 nmdc:mga06z11_240_c1 nmdc:mga06z11_240_c1_10859_11830 323
223 3300050509 nmdc:mga0qj67_267286_c1 nmdc:mga0qj67_267286_c1_231_1202 323
224 3300053077 Ga0495601_0010995 Ga0495601_0010995_908_1879 323
225 3300053085 Ga0495619_0014605 Ga0495619_0014605_2490_3461 323
226 iso_pu_bacteria 2510917022 2511133247 323
227 iso_pu_bacteria 2513237159 2513997705 323
228 iso_pu_bacteria 2582581283 2585167423 323
229 iso_pu_bacteria 2582581306 2585265647 323
230 iso_pu_bacteria 2582581307 2585271323 323
231 iso_pu_bacteria 2582581865 2585388852 323
232 iso_pu_bacteria 2582581866 2585395450 323
233 iso_pu_bacteria 2585427531 2585559066 323
234 iso_pu_bacteria 2585427609 2585903987 323
235 iso_pu_bacteria 2585428125 2587980895 323
236 iso_pu_bacteria 2643221607 2644050254 323
237 iso_pu_bacteria 2643221636 2644204684 323
238 iso_pu_bacteria 2643221653 2644298846 323
239 iso_pu_bacteria 2643221686 2644483174 323
240 iso_pu_bacteria 2643221688 2644494327 323
241 iso_pu_bacteria 2643221689 2644499733 323
242 iso_pu_bacteria 2643221719 2644657075 323
243 iso_pu_bacteria 2818991272 2819241151 323
244 iso_pu_bacteria 2821123053 2821125707 323
245 iso_pu_bacteria 2838736955 2838737842 323
246 iso_pu_bacteria 2841840854 2841841789 323
247 iso_pu_bacteria 2842118031 2842118394 323
248 iso_pu_bacteria 2842140634 2842141567 323
249 iso_pu_bacteria 2842521101 2842522047 323
250 iso_pu_bacteria 2857531043 2857532268 323
251 iso_pu_bacteria 2989776772 2989779405 323
252 iso_pu_bacteria 8005246636 8005248949 323
253 3300003792 Ga0055540_1001179 Ga0055540_100117910 324
254 3300006353 Ga0075370_10041470 Ga0075370_100414703 324
255 3300025273 Ga0209673_1000858 Ga0209673_100085823 324
256 3300025298 Ga0209050_1017948 Ga0209050_10179483 324
257 3300025303 Ga0209051_1000393 Ga0209051_100039356 324
258 3300025304 Ga0209257_1002259 Ga0209257_100225917 324
259 3300053136 Ga0500559_0010784 Ga0500559_0010784_2653_3627 324
260 iso_pu_bacteria 2510461076 2510895591 324
261 iso_pu_bacteria 2510917028 2511182497 324
262 iso_pu_bacteria 2513237085 2513577152 324
263 iso_pu_bacteria 2513237088 2513597693 324
264 iso_pu_bacteria 2513237138 2513865899 324
265 iso_pu_bacteria 2513237162 2514018097 324
266 iso_pu_bacteria 2515154113 2515636788 324
267 iso_pu_bacteria 2515154114 2515646346 324
268 iso_pu_bacteria 2515154116 2515655138 324
269 iso_pu_bacteria 2515154134 2515739685 324
270 iso_pu_bacteria 2516653085 2517077282 324
271 iso_pu_bacteria 2534681796 2535517081 324
272 iso_pu_bacteria 2582581294 2585202017 324
273 iso_pu_bacteria 2582581299 2585228496 324
274 iso_pu_bacteria 2582581304 2585258296 324
275 iso_pu_bacteria 2582581867 2585400932 324
276 iso_pu_bacteria 2585427526 2585524709 324
277 iso_pu_bacteria 2585427528 2585538397 324
278 iso_pu_bacteria 2585427590 2585822166 324
279 iso_pu_bacteria 2585427593 2585836350 324
280 iso_pu_bacteria 2585427594 2585843441 324
281 iso_pu_bacteria 2599185156 2599331994 324
282 iso_pu_bacteria 2599185236 2599721577 324
283 iso_pu_bacteria 2643221599 2644007061 324
284 iso_pu_bacteria 2643221634 2644191843 324
285 iso_pu_bacteria 2643221643 2644242542 324
286 iso_pu_bacteria 2738541293 2738800296 324
287 iso_pu_bacteria 2738541333 2739033038 324
288 iso_pu_bacteria 2765235942 2766066081 324
289 iso_pu_bacteria 2773857925 2774869783 324
290 iso_pu_bacteria 2791355263 2793339475 324
291 iso_pu_bacteria 2802429633 2806045177 324
292 iso_pu_bacteria 2802429634 2806050028 324
293 iso_pu_bacteria 2802429635 2806056866 324
294 iso_pu_bacteria 2802429636 2806064247 324
295 iso_pu_bacteria 2802429637 2806071515 324
296 iso_pu_bacteria 2838042994 2838045169 324
297 iso_pu_bacteria 2838686498 2838686845 324
298 iso_pu_bacteria 2838729681 2838730197 324
299 iso_pu_bacteria 2838742623 2838742788 324
300 iso_pu_bacteria 2841851746 2841852291 324
301 iso_pu_bacteria 2842110456 2842113057 324
302 iso_pu_bacteria 2842156927 2842158251 324
303 iso_pu_bacteria 2842163707 2842168590 324
304 iso_pu_bacteria 2842180545 2842181871 324
305 iso_pu_bacteria 2842229732 2842230078 324
306 iso_pu_bacteria 2842243621 2842243967 324
307 iso_pu_bacteria 2842257432 2842257948 324
308 iso_pu_bacteria 2842271015 2842271617 324
309 iso_pu_bacteria 2842304105 2842305248 324
310 iso_pu_bacteria 2842837860 2842841049 324
311 iso_pu_bacteria 2842922631 2842924330 324
312 iso_pu_bacteria 2844454524 2844458142 324
313 iso_pu_bacteria 2857516855 2857517217 324
314 iso_pu_bacteria 2891373044 2891373562 324
315 iso_pu_bacteria 2923556063 2923559307 324
316 iso_pu_bacteria 2933570622 2933571055 324
317 iso_pu_bacteria 2933586486 2933588886 324
318 iso_pu_bacteria 2935901341 2935901752 324
319 iso_pu_bacteria 2936381700 2936387839 324
320 iso_pu_bacteria 2989349275 2989350037 324
321 iso_pu_bacteria 2989771324 2989776022 324
322 iso_pu_bacteria 2996887358 2996892838 324
323 iso_pu_bacteria 2996893221 2996894940 324
324 iso_pu_bacteria 3003930520 3003934435 324
325 iso_pu_bacteria 3005452660 3005454889 324
326 iso_pu_bacteria 639633055 639649380 324
327 iso_pu_bacteria 8005258706 8005259395 324
328 iso_pu_bacteria 8005301065 8005303329 324
329 iso_pu_bacteria 8005307578 8005309595 324
330 iso_pu_bacteria 8005321885 8005327365 324
331 iso_pu_bacteria 8005542996 8005545895 324
332 iso_pu_bacteria 8005570704 8005573260 324
333 iso_pu_bacteria 8005688590 8005691899 324
334 iso_pu_bacteria 8023680758 8023682965 324
335 iso_pu_bacteria 8054558443 8054562207 324
336 3300002739 JGI25158J39367_1003765 JGI25158J39367_10037654 325
337 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000488 325
338 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021121 325
339 3300003374 JGI25161J50226_1000385 JGI25161J50226_10003854 325
340 3300003771 Ga0055526_1000949 Ga0055526_100094911 325
341 3300003775 Ga0055524_1000704 Ga0055524_100070424 325
342 3300003781 Ga0055536_1008749 Ga0055536_10087495 325
343 3300003794 Ga0055531_10020767 Ga0055531_100207672 325
344 3300004625 Ga0055543_1000705 Ga0055543_100070519 325
345 3300005262 Ga0065165_1000033 Ga0065165_1000033121 325
346 3300005327 Ga0070658_10244599 Ga0070658_102445992 325
347 3300005331 Ga0070670_100001168 Ga0070670_10000116810 325
348 3300005530 Ga0070679_100387644 Ga0070679_1003876441 325
349 3300013249 Ga0171463_1007 Ga0171463_100723 325
350 3300025263 Ga0209565_1010642 Ga0209565_10106422 325
351 3300025284 Ga0209130_1000017 Ga0209130_1000017261 325
352 3300025292 Ga0209676_1006716 Ga0209676_10067166 325
353 3300025294 Ga0209025_1000161 Ga0209025_100016187 325
354 3300025295 Ga0209564_1000013 Ga0209564_1000013708 325
355 3300025299 Ga0209256_1000153 Ga0209256_100015357 325
356 3300025299 Ga0209256_1001163 Ga0209256_10011637 325
357 3300025302 Ga0207426_1000006 Ga0207426_1000006260 325
358 3300025303 Ga0209051_1026315 Ga0209051_10263153 325
359 3300025909 Ga0207705_10156702 Ga0207705_101567023 325
360 3300025925 Ga0207650_10000911 Ga0207650_100009118 325
361 3300028794 Ga0307515_10000017 Ga0307515_1000001766 325
362 3300031456 Ga0307513_10004133 Ga0307513_1000413311 325
363 3300039062 Ga0400483_010781 Ga0400483_010781_1070_2062 325
364 3300041404 Ga0439436_0012061 Ga0439436_0012061_1051_2028 325
365 3300050496 nmdc:mga07m45_228605_c1 nmdc:mga07m45_228605_c1_59_1036 325
366 3300053140 Ga0500573_0002418 Ga0500573_0002418_4456_5475 325
367 3300053140 Ga0500573_0009094 Ga0500573_0009094_925_1902 325
368 iso_pu_bacteria 2509276033 2509447317 325
369 iso_pu_bacteria 2510065019 2510134157 325
370 iso_pu_bacteria 2510917026 2511173385 325
371 iso_pu_bacteria 2510917030 2511199227 325
372 iso_pu_bacteria 2513237084 2513567767 325
373 iso_pu_bacteria 2513237093 2513633177 325
374 iso_pu_bacteria 2513237144 2513908568 325
375 iso_pu_bacteria 2513237146 2513925206 325
376 iso_pu_bacteria 2515075009 2515113263 325
377 iso_pu_bacteria 2517093000 2517096040 325
378 iso_pu_bacteria 2517287029 2517407660 325
379 iso_pu_bacteria 2519899620 2520377049 325
380 iso_pu_bacteria 2524023209 2524458828 325
381 iso_pu_bacteria 2582581298 2585223057 325
382 iso_pu_bacteria 2582581308 2585279261 325
383 iso_pu_bacteria 2582581315 2585323134 325
384 iso_pu_bacteria 2582581316 2585331241 325
385 iso_pu_bacteria 2585427527 2585531254 325
386 iso_pu_bacteria 2585427529 2585545640 325
387 iso_pu_bacteria 2585427530 2585552823 325
388 iso_pu_bacteria 2585427608 2585898448 325
389 iso_pu_bacteria 2585427633 2585996651 325
390 iso_pu_bacteria 2585427634 2586001175 325
391 iso_pu_bacteria 2599185170 2599417113 325
392 iso_pu_bacteria 2615840626 2616311428 325
393 iso_pu_bacteria 2615840698 2616554442 325
394 iso_pu_bacteria 2617270742 2617384806 325
395 iso_pu_bacteria 2667528174 2671111238 325
396 iso_pu_bacteria 2718217882 2719181998 325
397 iso_pu_bacteria 2718218009 2719732715 325
398 iso_pu_bacteria 2718218363 2721148089 325
399 iso_pu_bacteria 2718218365 2721159540 325
400 iso_pu_bacteria 2718218366 2721164925 325
401 iso_pu_bacteria 2721755514 2722841095 325
402 iso_pu_bacteria 2721755810 2724045471 325
403 iso_pu_bacteria 2724679232 2725951397 325
404 iso_pu_bacteria 2728369365 2730165233 325
405 iso_pu_bacteria 2728369397 2730299172 325
406 iso_pu_bacteria 2738541317 2738948001 325
407 iso_pu_bacteria 2775507266 2778175624 325
408 iso_pu_bacteria 2791355256 2793294233 325
409 iso_pu_bacteria 2791355259 2793315889 325
410 iso_pu_bacteria 2791355260 2793319379 325
411 iso_pu_bacteria 2791355261 2793328464 325
412 iso_pu_bacteria 2791355262 2793335423 325
413 iso_pu_bacteria 2791355264 2793347048 325
414 iso_pu_bacteria 2791355265 2793351640 325
415 iso_pu_bacteria 2818991448 2819609332 325
416 iso_pu_bacteria 2818991453 2819641358 325
417 iso_pu_bacteria 2838022645 2838023651 325
418 iso_pu_bacteria 2838029111 2838033741 325
419 iso_pu_bacteria 2838035591 2838038680 325
420 iso_pu_bacteria 2838661181 2838661398 325
421 iso_pu_bacteria 2842198810 2842199165 325
422 iso_pu_bacteria 2842205361 2842209615 325
423 iso_pu_bacteria 2842278818 2842283069 325
424 iso_pu_bacteria 2842285085 2842285404 325
425 iso_pu_bacteria 2842298080 2842298177 325
426 iso_pu_bacteria 2842357229 2842360223 325
427 iso_pu_bacteria 2842395702 2842400144 325
428 iso_pu_bacteria 2842402390 2842402764 325
429 iso_pu_bacteria 2842409023 2842409865 325
430 iso_pu_bacteria 2842415677 2842416514 325
431 iso_pu_bacteria 2842475841 2842480488 325
432 iso_pu_bacteria 2842482326 2842483875 325
433 iso_pu_bacteria 2842502639 2842505291 325
434 iso_pu_bacteria 2842509118 2842514298 325
435 iso_pu_bacteria 2852387548 2852390453 325
436 iso_pu_bacteria 2854896431 2854901318 325
437 iso_pu_bacteria 2854916844 2854918698 325
438 iso_pu_bacteria 2896384573 2896392110 325
439 iso_pu_bacteria 2899803654 2899804157 325
440 iso_pu_bacteria 2913295892 2913296091 325
441 iso_pu_bacteria 2913308742 2913312789 325
442 iso_pu_bacteria 2919100787 2919106257 325
443 iso_pu_bacteria 2919171160 2919172937 325
444 iso_pu_bacteria 2919408235 2919410193 325
445 iso_pu_bacteria 2920760137 2920761329 325
446 iso_pu_bacteria 2933016740 2933019124 325
447 iso_pu_bacteria 2936367885 2936371835 325
448 iso_pu_bacteria 2936375103 2936379669 325
449 iso_pu_bacteria 3005409236 3005414364 325
450 iso_pu_bacteria 3005416602 3005418990 325
451 iso_pu_bacteria 3005445848 3005448652 325
452 iso_pu_bacteria 8005314921 8005318118 325
453 iso_pu_bacteria 8005376324 8005381133 325
454 iso_pu_bacteria 8005460587 8005463945 325
455 iso_pu_bacteria 8005484373 8005489004 325
456 iso_pu_bacteria 8005556819 8005561423 325
457 iso_pu_bacteria 8005563573 8005568201 325
458 iso_pu_bacteria 8005645114 8005646082 325
459 iso_pu_bacteria 8005682033 8005682695 325
460 iso_pu_bacteria 8005695170 8005697611 325
461 iso_pu_bacteria 8018150411 8018151361 325
462 iso_pu_bacteria 8018163183 8018164367 325
463 iso_pu_bacteria 8024479707 8024482659 325
464 iso_pu_bacteria 8024486573 8024488241 325
465 iso_pu_bacteria 8046767195 8046771748 325
466 iso_pu_bacteria 8057575449 8057575503 325
467 3300005440 Ga0070705_100038050 Ga0070705_1000380503 326
468 3300005444 Ga0070694_100008686 Ga0070694_1000086864 326
469 3300005549 Ga0070704_100088271 Ga0070704_1000882713 326
470 3300009147 Ga0114129_10365076 Ga0114129_103650762 326
471 3300013100 Ga0157373_10069671 Ga0157373_100696712 326
472 3300031616 Ga0307508_10054194 Ga0307508_100541942 326
473 3300033541 Ga0316596_1026481 Ga0316596_10264811 326
474 3300041496 Ga0451839_0005062 Ga0451839_0005062_596_1576 326
475 3300042147 Ga0450910_002662 Ga0450910_002662_783_1790 326
476 3300046454 Ga0495592_0179911 Ga0495592_0179911_233_1228 326
477 3300046519 Ga0495632_0014446 Ga0495632_0014446_2862_3842 326
478 3300046665 Ga0495661_0168317 Ga0495661_0168317_23_1003 326
479 3300049741 Ga0501079_0116219 Ga0501079_0116219_997_1992 326
480 3300053077 Ga0495601_0059426 Ga0495601_0059426_544_1539 326
481 3300053153 Ga0500616_0027040 Ga0500616_0027040_391_1371 326
482 3300053153 Ga0500616_0033094 Ga0500616_0033094_1705_2763 326
483 3300006175 Ga0070712_100070496 Ga0070712_1000704963 327
484 3300006946 Ga0079104_1000045 Ga0079104_1000045166 327
485 3300025297 Ga0209758_1024120 Ga0209758_10241203 327
486 3300025917 Ga0207660_10143029 Ga0207660_101430291 327
487 3300025921 Ga0207652_10097868 Ga0207652_100978683 327
488 3300026041 Ga0207639_10034134 Ga0207639_100341342 327
489 3300027111 Ga0209281_1000034 Ga0209281_1000034242 327
490 3300028794 Ga0307515_10010712 Ga0307515_100107124 327
491 3300031548 Ga0307408_100029916 Ga0307408_1000299163 327
492 3300035725 Ga0373947_0002011 Ga0373947_0002011_1353_2405 327
493 3300041404 Ga0439436_0001883 Ga0439436_0001883_3613_4599 327
494 3300041413 Ga0439465_0062745 Ga0439465_0062745_195_1181 327
495 3300042122 Ga0450920_004851 Ga0450920_004851_1221_2207 327
496 3300042531 Ga0450918_005603 Ga0450918_005603_211_1197 327
497 3300046660 Ga0495625_0282792 Ga0495625_0282792_14_1048 327
498 3300048914 Ga0496111_0002475 Ga0496111_0002475_9413_10396 327
499 3300048917 Ga0496114_0340630 Ga0496114_0340630_305_1288 327
500 3300048925 Ga0496122_0078142 Ga0496122_0078142_1189_2172 327
501 3300048926 Ga0496123_0046675 Ga0496123_0046675_1021_2004 327
502 3300049776 Ga0501280_005903 Ga0501280_005903_744_1727 327
503 3300053125 Ga0500618_000440 Ga0500618_000440_18193_19182 327
504 3300002773 JGI25152J39213_1000401 JGI25152J39213_100040118 328
505 3300002773 JGI25152J39213_1000670 JGI25152J39213_10006707 328
506 3300002773 JGI25152J39213_1014673 JGI25152J39213_10146732 328
507 3300002774 JGI25150J39212_1000088 JGI25150J39212_100008820 328
508 3300003187 JGI25151J46595_10000215 JGI25151J46595_1000021534 328
509 3300003187 JGI25151J46595_10000280 JGI25151J46595_1000028041 328
510 3300003187 JGI25151J46595_10033423 JGI25151J46595_100334232 328
511 3300003187 JGI25151J46595_10065817 JGI25151J46595_100658171 328
512 3300003215 JGI25153J46596_10004388 JGI25153J46596_100043882 328
513 3300003215 JGI25153J46596_10009018 JGI25153J46596_100090184 328
514 3300003354 JGI25160J50197_1002802 JGI25160J50197_10028023 328
515 3300003374 JGI25161J50226_1002378 JGI25161J50226_10023785 328
516 3300003771 Ga0055526_1003373 Ga0055526_10033734 328
517 3300003771 Ga0055526_1007868 Ga0055526_10078686 328
518 3300003775 Ga0055524_1008950 Ga0055524_10089505 328
519 3300003790 Ga0055528_1003621 Ga0055528_10036217 328
520 3300003790 Ga0055528_1005111 Ga0055528_10051112 328
521 3300005262 Ga0065165_1003175 Ga0065165_10031755 328
522 3300005290 Ga0065712_10071142 Ga0065712_100711424 328
523 3300005293 Ga0065715_10105176 Ga0065715_101051763 328
524 3300005340 Ga0070689_100188593 Ga0070689_1001885931 328
525 3300005355 Ga0070671_100003323 Ga0070671_10000332312 328
526 3300006038 Ga0075365_10001104 Ga0075365_100011049 328
527 3300006042 Ga0075368_10038041 Ga0075368_100380413 328
528 3300006048 Ga0075363_100014360 Ga0075363_1000143603 328
529 3300006177 Ga0075362_10003504 Ga0075362_100035044 328
530 3300006177 Ga0075362_10078780 Ga0075362_100787802 328
531 3300006186 Ga0075369_10003058 Ga0075369_100030582 328
532 3300006186 Ga0075369_10003688 Ga0075369_100036884 328
533 3300006195 Ga0075366_10001972 Ga0075366_100019726 328
534 3300006353 Ga0075370_10022752 Ga0075370_100227523 328
535 3300006353 Ga0075370_10062269 Ga0075370_100622692 328
536 3300009011 Ga0105251_10012063 Ga0105251_100120634 328
537 3300009553 Ga0105249_10052441 Ga0105249_100524414 328
538 3300009766 Ga0123342_1023525 Ga0123342_10235253 328
539 3300014497 Ga0182008_10011435 Ga0182008_100114352 328
540 3300015261 Ga0182006_1000550 Ga0182006_100055031 328
541 3300021320 Ga0214544_1000110 Ga0214544_1000110106 328
542 3300021321 Ga0214542_1000268 Ga0214542_100026880 328
543 3300021327 Ga0214543_1000219 Ga0214543_100021981 328
544 3300025245 Ga0207425_1000432 Ga0207425_100043221 328
545 3300025258 Ga0209129_1000029 Ga0209129_1000029360 328
546 3300025258 Ga0209129_1000433 Ga0209129_10004335 328
547 3300025258 Ga0209129_1001238 Ga0209129_10012382 328
548 3300025273 Ga0209673_1000025 Ga0209673_1000025228 328
549 3300025273 Ga0209673_1001058 Ga0209673_100105812 328
550 3300025273 Ga0209673_1003139 Ga0209673_10031396 328
551 3300025273 Ga0209673_1006113 Ga0209673_10061136 328
552 3300025273 Ga0209673_1012505 Ga0209673_10125053 328
553 3300025294 Ga0209025_1000070 Ga0209025_100007021 328
554 3300025294 Ga0209025_1000091 Ga0209025_1000091103 328
555 3300025294 Ga0209025_1000171 Ga0209025_100017162 328
556 3300025294 Ga0209025_1021610 Ga0209025_10216102 328
557 3300025295 Ga0209564_1000607 Ga0209564_10006076 328
558 3300025295 Ga0209564_1001274 Ga0209564_100127420 328
559 3300025295 Ga0209564_1014538 Ga0209564_10145383 328
560 3300025295 Ga0209564_1038779 Ga0209564_10387791 328
561 3300025297 Ga0209758_1000094 Ga0209758_1000094213 328
562 3300025297 Ga0209758_1000671 Ga0209758_10006714 328
563 3300025297 Ga0209758_1005320 Ga0209758_10053204 328
564 3300025297 Ga0209758_1012451 Ga0209758_10124516 328
565 3300025299 Ga0209256_1000381 Ga0209256_100038128 328
566 3300025299 Ga0209256_1002239 Ga0209256_100223910 328
567 3300025299 Ga0209256_1004696 Ga0209256_10046962 328
568 3300025299 Ga0209256_1011614 Ga0209256_10116144 328
569 3300025299 Ga0209256_1023649 Ga0209256_10236492 328
570 3300025302 Ga0207426_1000218 Ga0207426_10002189 328
571 3300025302 Ga0207426_1000941 Ga0207426_100094126 328
572 3300025303 Ga0209051_1024266 Ga0209051_10242662 328
573 3300025931 Ga0207644_10020032 Ga0207644_100200322 328
574 3300025932 Ga0207690_10112578 Ga0207690_101125783 328
575 3300027866 Ga0209813_10027278 Ga0209813_100272782 328
576 3300028794 Ga0307515_10034427 Ga0307515_100344272 328
577 3300031456 Ga0307513_10011016 Ga0307513_100110166 328
578 3300031731 Ga0307405_10002161 Ga0307405_100021616 328
579 3300031901 Ga0307406_10011665 Ga0307406_100116655 328
580 3300031901 Ga0307406_10401095 Ga0307406_104010951 328
581 3300035691 Ga0373931_0100707 Ga0373931_0100707_73_1059 328
582 3300041492 Ga0451835_0232626 Ga0451835_0232626_1254_2408 328
583 3300041507 Ga0451851_0086492 Ga0451851_0086492_581_1567 328
584 3300041509 Ga0451843_0142887 Ga0451843_0142887_143_1129 328
585 3300041512 Ga0451853_0250572 Ga0451853_0250572_5805_6791 328
586 3300042006 Ga0439432_000558 Ga0439432_000558_10423_11418 328
587 3300046460 Ga0495638_0139840 Ga0495638_0139840_363_1358 328
588 3300046474 Ga0495605_0036666 Ga0495605_0036666_326_1321 328
589 3300046492 Ga0495585_0051626 Ga0495585_0051626_600_1586 328
590 3300046501 Ga0495607_0027457 Ga0495607_0027457_345_1346 328
591 3300046501 Ga0495607_0051826 Ga0495607_0051826_1220_2215 328
592 3300046506 Ga0495583_0004700 Ga0495583_0004700_5927_6928 328
593 3300046506 Ga0495583_0006663 Ga0495583_0006663_3927_4913 328
594 3300046507 Ga0495606_0036266 Ga0495606_0036266_854_1849 328
595 3300046507 Ga0495606_0055831 Ga0495606_0055831_438_1424 328
596 3300046507 Ga0495606_0080502 Ga0495606_0080502_424_1410 328
597 3300046512 Ga0495610_0001520 Ga0495610_0001520_14871_15857 328
598 3300046512 Ga0495610_0091860 Ga0495610_0091860_271_1266 328
599 3300046515 Ga0495620_0042046 Ga0495620_0042046_237_1232 328
600 3300046519 Ga0495632_0022618 Ga0495632_0022618_1981_2967 328
601 3300046519 Ga0495632_0033844 Ga0495632_0033844_60_1055 328
602 3300046522 Ga0495643_0005744 Ga0495643_0005744_1674_2669 328
603 3300046523 Ga0495644_0009087 Ga0495644_0009087_2757_3758 328
604 3300046524 Ga0495648_0012382 Ga0495648_0012382_434_1429 328
605 3300046538 Ga0495609_0034268 Ga0495609_0034268_1115_2110 328
606 3300046558 Ga0495633_0037450 Ga0495633_0037450_485_1480 328
607 3300046616 Ga0495668_0030470 Ga0495668_0030470_1478_2473 328
608 3300046616 Ga0495668_0071821 Ga0495668_0071821_766_1752 328
609 3300046660 Ga0495625_0052820 Ga0495625_0052820_764_1759 328
610 3300046665 Ga0495661_0058083 Ga0495661_0058083_400_1386 328
611 3300046694 Ga0495649_0038484 Ga0495649_0038484_138_1133 328
612 3300046810 Ga0495660_0034498 Ga0495660_0034498_846_1841 328
613 3300047472 Ga0495686_0005343 Ga0495686_0005343_5895_6881 328
614 3300047472 Ga0495686_0034761 Ga0495686_0034761_1277_2272 328
615 3300048919 Ga0496116_0003199 Ga0496116_0003199_4337_5323 328
616 3300048919 Ga0496116_0004652 Ga0496116_0004652_11507_12493 328
617 3300048919 Ga0496116_0014992 Ga0496116_0014992_814_1800 328
618 3300048920 Ga0496117_0004687 Ga0496117_0004687_12671_13657 328
619 3300048920 Ga0496117_0004948 Ga0496117_0004948_6021_7007 328
620 3300048920 Ga0496117_0011927 Ga0496117_0011927_5526_6512 328
621 3300048921 Ga0496118_0006533 Ga0496118_0006533_4563_5558 328
622 3300048921 Ga0496118_0025572 Ga0496118_0025572_2239_3225 328
623 3300048921 Ga0496118_0032122 Ga0496118_0032122_2206_3192 328
624 3300048924 Ga0496121_0005364 Ga0496121_0005364_2276_3262 328
625 3300048924 Ga0496121_0024213 Ga0496121_0024213_516_1502 328
626 3300048924 Ga0496121_0040826 Ga0496121_0040826_2503_3489 328
627 3300048925 Ga0496122_0000464 Ga0496122_0000464_70632_71618 328
628 3300048925 Ga0496122_0005368 Ga0496122_0005368_797_1783 328
629 3300048925 Ga0496122_0031807 Ga0496122_0031807_513_1499 328
630 3300048925 Ga0496122_0038126 Ga0496122_0038126_2170_3156 328
631 3300048926 Ga0496123_0000147 Ga0496123_0000147_62556_63542 328
632 3300048926 Ga0496123_0003801 Ga0496123_0003801_14802_15788 328
633 3300048926 Ga0496123_0016868 Ga0496123_0016868_451_1437 328
634 3300048926 Ga0496123_0050278 Ga0496123_0050278_1160_2146 328
635 3300048927 Ga0496124_0001440 Ga0496124_0001440_28372_29358 328
636 3300048927 Ga0496124_0002807 Ga0496124_0002807_16389_17375 328
637 3300048927 Ga0496124_0011943 Ga0496124_0011943_2195_3181 328
638 3300048927 Ga0496124_0028366 Ga0496124_0028366_3533_4528 328
639 3300048927 Ga0496124_0150030 Ga0496124_0150030_402_1388 328
640 3300048927 Ga0496124_0209424 Ga0496124_0209424_49_1035 328
641 3300048928 Ga0496125_0000848 Ga0496125_0000848_32888_33931 328
642 3300048928 Ga0496125_0005914 Ga0496125_0005914_4575_5561 328
643 3300048929 Ga0496126_0000601 Ga0496126_0000601_61457_62443 328
644 3300048929 Ga0496126_0014162 Ga0496126_0014162_1268_2254 328
645 3300048929 Ga0496126_0035374 Ga0496126_0035374_1914_2900 328
646 3300048929 Ga0496126_0103973 Ga0496126_0103973_958_1944 328
647 3300049459 Ga0495678_030504 Ga0495678_030504_1217_2203 328
648 3300049571 Ga0501034_0320839 Ga0501034_0320839_46_1077 328
649 3300049574 Ga0501038_0072823 Ga0501038_0072823_1444_2463 328
650 3300049822 Ga0501035_0069834 Ga0501035_0069834_1971_2990 328
651 3300049823 Ga0501044_0089980 Ga0501044_0089980_1758_2798 328
652 3300050489 nmdc:mga03683_1838_c1 nmdc:mga03683_1838_c1_3017_4012 328
653 3300050493 nmdc:mga0k408_16356_c1 nmdc:mga0k408_16356_c1_2208_3203 328
654 3300050494 nmdc:mga06z11_2165_c1 nmdc:mga06z11_2165_c1_914_1909 328
655 3300053086 Ga0500578_0016602 Ga0500578_0016602_147_1142 328
656 3300053109 Ga0500569_001073 Ga0500569_001073_757_1752 328
657 3300053125 Ga0500618_003308 Ga0500618_003308_4242_5228 328
658 3300053134 Ga0500658_0000240 Ga0500658_0000240_9317_10312 328
659 3300053142 Ga0500577_0033867 Ga0500577_0033867_764_1759 328
660 3300053153 Ga0500616_0005585 Ga0500616_0005585_6635_7630 328
661 3300053158 Ga0500627_0034908 Ga0500627_0034908_527_1522 328
662 iso_pu_bacteria 2529292951 2530646596 328
663 iso_pu_bacteria 8005289223 8005295717 328
664 iso_pu_bacteria 8056382006 8056384217 328
665 3300001979 JGI24740J21852_10001277 JGI24740J21852_1000127711 329
666 3300002704 JGI25155J39150_1000014 JGI25155J39150_100001462 329
667 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003749 329
668 3300002705 JGI25156J39149_1000079 JGI25156J39149_100007968 329
669 3300002737 JGI25162J39368_1000379 JGI25162J39368_10003799 329
670 3300002738 JGI25154J39366_1000052 JGI25154J39366_1000052102 329
671 3300002739 JGI25158J39367_1000367 JGI25158J39367_10003679 329
672 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004060 329
673 3300002773 JGI25152J39213_1002700 JGI25152J39213_10027002 329
674 3300002773 JGI25152J39213_1004954 JGI25152J39213_10049543 329
675 3300002774 JGI25150J39212_1003593 JGI25150J39212_10035933 329
676 3300002987 JGI25159J45721_1000120 JGI25159J45721_100012035 329
677 3300002987 JGI25159J45721_1002994 JGI25159J45721_10029946 329
678 3300003187 JGI25151J46595_10009480 JGI25151J46595_100094804 329
679 3300003187 JGI25151J46595_10015294 JGI25151J46595_100152943 329
680 3300003214 JGI25165J46597_1000395 JGI25165J46597_100039540 329
681 3300003214 JGI25165J46597_1000469 JGI25165J46597_100046933 329
682 3300003214 JGI25165J46597_1003459 JGI25165J46597_10034593 329
683 3300003215 JGI25153J46596_10002012 JGI25153J46596_100020129 329
684 3300003323 rootH1_10027563 rootH1_100275631 329
685 3300003323 rootH1_10066611 rootH1_100666113 329
686 3300003323 rootH1_10078680 rootH1_100786801 329
687 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001422 329
688 3300003354 JGI25160J50197_1031376 JGI25160J50197_10313762 329
689 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001336 329
690 3300003374 JGI25161J50226_1000892 JGI25161J50226_100089210 329
691 3300003771 Ga0055526_1003385 Ga0055526_100338510 329
692 3300003771 Ga0055526_1018119 Ga0055526_10181193 329
693 3300003790 Ga0055528_1000290 Ga0055528_100029044 329
694 3300003790 Ga0055528_1001102 Ga0055528_10011028 329
695 3300003790 Ga0055528_1009822 Ga0055528_10098225 329
696 3300003792 Ga0055540_1002442 Ga0055540_10024428 329
697 3300003792 Ga0055540_1016744 Ga0055540_10167441 329
698 3300003794 Ga0055531_10010220 Ga0055531_100102206 329
699 3300004625 Ga0055543_1000003 Ga0055543_1000003352 329
700 3300004625 Ga0055543_1001070 Ga0055543_10010705 329
701 3300005262 Ga0065165_1000008 Ga0065165_100000831 329
702 3300005548 Ga0070665_100077768 Ga0070665_1000777683 329
703 3300005614 Ga0068856_100014895 Ga0068856_1000148955 329
704 3300005834 Ga0068851_10143217 Ga0068851_101432171 329
705 3300006038 Ga0075365_10001846 Ga0075365_100018466 329
706 3300006051 Ga0075364_10000175 Ga0075364_100001756 329
707 3300006353 Ga0075370_10001935 Ga0075370_100019353 329
708 3300006871 Ga0075434_100010139 Ga0075434_1000101398 329
709 3300009093 Ga0105240_10000014 Ga0105240_10000014323 329
710 3300009148 Ga0105243_10069950 Ga0105243_100699503 329
711 3300009545 Ga0105237_10002417 Ga0105237_100024174 329
712 3300009766 Ga0123342_1029211 Ga0123342_10292113 329
713 3300010375 Ga0105239_10000973 Ga0105239_1000097319 329
714 3300013104 Ga0157370_10000327 Ga0157370_1000032733 329
715 3300014497 Ga0182008_10044455 Ga0182008_100444552 329
716 3300015262 Ga0182007_10002316 Ga0182007_100023168 329
717 3300015265 Ga0182005_1008827 Ga0182005_10088272 329
718 3300021361 Ga0213872_10007629 Ga0213872_100076295 329
719 3300025206 Ga0209435_100027 Ga0209435_10002761 329
720 3300025208 Ga0209436_100061 Ga0209436_10006117 329
721 3300025208 Ga0209436_106286 Ga0209436_1062862 329
722 3300025233 Ga0209437_100051 Ga0209437_100051100 329
723 3300025233 Ga0209437_100060 Ga0209437_100060321 329
724 3300025245 Ga0207425_1001314 Ga0207425_10013147 329
725 3300025246 Ga0209646_1000086 Ga0209646_100008661 329
726 3300025246 Ga0209646_1008397 Ga0209646_10083971 329
727 3300025250 Ga0209026_1000082 Ga0209026_100008261 329
728 3300025254 Ga0209148_1003596 Ga0209148_10035965 329
729 3300025256 Ga0209759_1000063 Ga0209759_1000063140 329
730 3300025258 Ga0209129_1000307 Ga0209129_100030733 329
731 3300025258 Ga0209129_1000607 Ga0209129_100060719 329
732 3300025258 Ga0209129_1000827 Ga0209129_100082718 329
733 3300025258 Ga0209129_1003493 Ga0209129_10034935 329
734 3300025261 Ga0209233_1000095 Ga0209233_100009593 329
735 3300025261 Ga0209233_1000113 Ga0209233_1000113239 329
736 3300025261 Ga0209233_1000190 Ga0209233_100019039 329
737 3300025273 Ga0209673_1000010 Ga0209673_1000010459 329
738 3300025273 Ga0209673_1000878 Ga0209673_10008786 329
739 3300025273 Ga0209673_1004088 Ga0209673_10040885 329
740 3300025284 Ga0209130_1000003 Ga0209130_1000003352 329
741 3300025284 Ga0209130_1000020 Ga0209130_100002050 329
742 3300025292 Ga0209676_1003867 Ga0209676_10038677 329
743 3300025292 Ga0209676_1019193 Ga0209676_10191931 329
744 3300025294 Ga0209025_1003071 Ga0209025_100307114 329
745 3300025294 Ga0209025_1003763 Ga0209025_100376313 329
746 3300025294 Ga0209025_1050169 Ga0209025_10501692 329
747 3300025295 Ga0209564_1000265 Ga0209564_100026535 329
748 3300025295 Ga0209564_1006728 Ga0209564_10067285 329
749 3300025297 Ga0209758_1000058 Ga0209758_100005830 329
750 3300025297 Ga0209758_1001587 Ga0209758_10015878 329
751 3300025297 Ga0209758_1001902 Ga0209758_100190211 329
752 3300025297 Ga0209758_1002315 Ga0209758_10023153 329
753 3300025299 Ga0209256_1000655 Ga0209256_100065533 329
754 3300025299 Ga0209256_1007362 Ga0209256_10073624 329
755 3300025302 Ga0207426_1000008 Ga0207426_1000008119 329
756 3300025302 Ga0207426_1000011 Ga0207426_1000011423 329
757 3300025303 Ga0209051_1003929 Ga0209051_10039297 329
758 3300025303 Ga0209051_1048030 Ga0209051_10480302 329
759 3300025913 Ga0207695_10000037 Ga0207695_10000037325 329
760 3300025914 Ga0207671_10000271 Ga0207671_1000027147 329
761 3300025935 Ga0207709_10103910 Ga0207709_101039101 329
762 3300027312 Ga0209371_1001220 Ga0209371_100122014 329
763 3300028379 Ga0268266_10057894 Ga0268266_100578943 329
764 3300028379 Ga0268266_10106386 Ga0268266_101063862 329
765 3300028379 Ga0268266_10272624 Ga0268266_102726242 329
766 3300030500 Ga0268256_1002604 Ga0268256_10026044 329
767 3300031595 Ga0265313_10013163 Ga0265313_100131632 329
768 3300041486 Ga0451807_1091382 Ga0451807_1091382_514_1503 329
769 3300041492 Ga0451835_0536437 Ga0451835_0536437_37_1056 329
770 3300041496 Ga0451839_0755420 Ga0451839_0755420_290_1309 329
771 3300041503 Ga0451847_0197141 Ga0451847_0197141_1519_2538 329
772 3300044694 Ga0466963_0039327 Ga0466963_0039327_1348_2361 329
773 3300044765 Ga0466970_0003192 Ga0466970_0003192_5827_6840 329
774 3300045976 Ga0466967_0232475 Ga0466967_0232475_480_1469 329
775 3300046459 Ga0495629_0013805 Ga0495629_0013805_4532_5521 329
776 3300046460 Ga0495638_0001134 Ga0495638_0001134_17893_18882 329
777 3300046474 Ga0495605_0001730 Ga0495605_0001730_11075_12064 329
778 3300046492 Ga0495585_0012690 Ga0495585_0012690_1469_2458 329
779 3300046507 Ga0495606_0002042 Ga0495606_0002042_5034_6131 329
780 3300046512 Ga0495610_0005659 Ga0495610_0005659_4587_5576 329
781 3300046522 Ga0495643_0006351 Ga0495643_0006351_3986_4975 329
782 3300046538 Ga0495609_0013153 Ga0495609_0013153_1816_2805 329
783 3300046616 Ga0495668_0003677 Ga0495668_0003677_8711_9700 329
784 3300046648 Ga0495611_0004410 Ga0495611_0004410_2411_3400 329
785 3300046660 Ga0495625_0007306 Ga0495625_0007306_7478_8467 329
786 3300046674 Ga0495588_0018389 Ga0495588_0018389_2090_3079 329
787 3300047320 Ga0495672_0018588 Ga0495672_0018588_2731_3720 329
788 3300047472 Ga0495686_0001235 Ga0495686_0001235_4663_5652 329
789 3300047472 Ga0495686_0021785 Ga0495686_0021785_1676_2665 329
790 3300048903 Ga0496100_0034971 Ga0496100_0034971_1740_2729 329
791 3300048906 Ga0496103_0004502 Ga0496103_0004502_7016_8005 329
792 3300048909 Ga0496106_0000489 Ga0496106_0000489_21542_22531 329
793 3300048919 Ga0496116_0009375 Ga0496116_0009375_1741_2730 329
794 3300048920 Ga0496117_0001519 Ga0496117_0001519_7230_8219 329
795 3300048921 Ga0496118_0001657 Ga0496118_0001657_7265_8254 329
796 3300048922 Ga0496119_0002067 Ga0496119_0002067_19978_20967 329
797 3300048922 Ga0496119_0076731 Ga0496119_0076731_208_1197 329
798 3300048923 Ga0496120_0003006 Ga0496120_0003006_14785_15774 329
799 3300048924 Ga0496121_0001450 Ga0496121_0001450_34965_36104 329
800 3300048924 Ga0496121_0003379 Ga0496121_0003379_6969_7958 329
801 3300048924 Ga0496121_0060616 Ga0496121_0060616_724_1713 329
802 3300048925 Ga0496122_0007038 Ga0496122_0007038_4528_5517 329
803 3300048925 Ga0496122_0008330 Ga0496122_0008330_7099_8088 329
804 3300048925 Ga0496122_0026341 Ga0496122_0026341_4013_5002 329
805 3300048926 Ga0496123_0009703 Ga0496123_0009703_2210_3199 329
806 3300048926 Ga0496123_0009726 Ga0496123_0009726_7152_8141 329
807 3300048927 Ga0496124_0036039 Ga0496124_0036039_91_1080 329
808 3300048927 Ga0496124_0069370 Ga0496124_0069370_1822_2811 329
809 3300048928 Ga0496125_0010583 Ga0496125_0010583_2542_3531 329
810 3300048928 Ga0496125_0038896 Ga0496125_0038896_439_1428 329
811 3300048929 Ga0496126_0027727 Ga0496126_0027727_3892_4881 329
812 3300049569 Ga0501032_0030052 Ga0501032_0030052_1038_2027 329
813 3300049574 Ga0501038_0084326 Ga0501038_0084326_177_1166 329
814 3300050491 nmdc:mga00v17_198_c1 nmdc:mga00v17_198_c1_32200_33189 329
815 3300050491 nmdc:mga00v17_97679_c1 nmdc:mga00v17_97679_c1_821_1822 329
816 3300050492 nmdc:mga0yw44_1428_c1 nmdc:mga0yw44_1428_c1_4090_5079 329
817 3300050507 nmdc:mga05p37_43723_c1 nmdc:mga05p37_43723_c1_582_1601 329
818 3300050511 nmdc:mga08y16_71252_c1 nmdc:mga08y16_71252_c1_2585_3604 329
819 3300050513 nmdc:mga0rr50_89462_c1 nmdc:mga0rr50_89462_c1_815_1834 329
820 3300053079 Ga0500610_0002510 Ga0500610_0002510_2829_3818 329
821 3300053098 Ga0500650_0043574 Ga0500650_0043574_517_1506 329
822 3300053125 Ga0500618_005561 Ga0500618_005561_378_1367 329
823 3300053134 Ga0500658_0001395 Ga0500658_0001395_3384_4373 329
824 3300053139 Ga0500568_0001761 Ga0500568_0001761_5663_6652 329
825 3300053139 Ga0500568_0002000 Ga0500568_0002000_9496_10485 329
826 3300053142 Ga0500577_0037870 Ga0500577_0037870_114_1103 329
827 3300053146 Ga0500588_0009982 Ga0500588_0009982_1040_2029 329
828 3300053148 Ga0500590_001428 Ga0500590_001428_4439_5428 329
829 3300053153 Ga0500616_0000309 Ga0500616_0000309_59525_60556 329
830 3300053153 Ga0500616_0001260 Ga0500616_0001260_14157_15146 329
831 3300053156 Ga0500622_0000743 Ga0500622_0000743_21205_22194 329
832 3300053158 Ga0500627_0007798 Ga0500627_0007798_1515_2504 329
833 3300053158 Ga0500627_0061483 Ga0500627_0061483_612_1601 329
834 3300059508 Ga0587088_013784 Ga0587088_013784_120_1109 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

202

275

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

62

158

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

186

280

0.81

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

187

287

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r3e-assembly1.cif.gz_A the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9873 2 323
3r3e-assembly1.cif.gz_B the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9847 4 323
3r3e-assembly1.cif.gz_A the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9746 2 323
3r3e-assembly1.cif.gz_B the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9688 4 323
4fqu-assembly4.cif.gz_G glutathionyl-hydroquinone reductase pcpf of sphingobium chlorophenolicum 0.9635 2 312
ID Description Score Start End Superfamily
3r3eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9984 168 278 1.20.1050.10
3r3eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9895 168 278 1.20.1050.10
af_Q9FL98_173_337_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9867 179 329 1.20.1050.10
4ptsB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9819 179 325 1.20.1050.10
3ppuA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9797 170 277 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2V5Z1T9-F1-model_v4 Glutathione-dependent reductase 1.003 235 325 GO:0004364
GO:0005737
AF-A0A369AJB2-F1-model_v4 Glutathione S-transferase-like protein 1.001 189 312 GO:0004364
GO:0005737
AF-A0A0Q6SGZ7-F1-model_v4 Glutathionyl-hydroquinone reductase YqjG 1 1 322 GO:0004364
GO:0005737
AF-C6AT47-F1-model_v4 Glutathione transferase (EC 2.5.1.18) 1 1 322 GO:0004364
GO:0005737
AF-A0A285XI37-F1-model_v4 deleted 1 1 322

Feature Viewer

pLDDT pTM Quality
96.03 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map