F482746
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 833 | 480 | 701 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10146879|Ga0081455_101468791 |
| Length | 306 |
| Sequence | MSEELLAVVHSIGTTLLNVLPVSIALGAAFAVLSFFWACNPGRPWWRKRDLLTDLCYWFIIPLFARYLRIGLLVLGAALLFGITTPQGLVEFYDDGHGPLAQLPLWLQAAIFLVGSDVMMYWLHRAFHRHQPLWKYHAVHHSSEDLEWISAARFHPINIFLGSVATDVVLLLAGISPNVFVILGPFTVAHSAFVHANLNWTLGPFKYVIAGPVFHRWHHTMAERGGEKNFASTFPVLDLLFGTFYMPKNELPDAYGIADPGFPPGFGGQMIYPFKQAATGAPNPQLGHMVLQEQLRPSSSKGALES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 15 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 16 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 28 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 29 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 30 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 31 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 32 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 33 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 34 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 35 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 36 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 37 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 38 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 39 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 40 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 41 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 42 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 43 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 44 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 45 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 46 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 47 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 48 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 49 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 50 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 51 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 52 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 53 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 54 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 55 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 56 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 57 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 58 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 59 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 60 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 61 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 62 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 63 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 64 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 65 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 66 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 67 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 68 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 69 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 70 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 71 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 72 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 73 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 74 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 75 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 76 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 77 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 78 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 79 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 80 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 81 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 82 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 83 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 84 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 85 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 86 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 87 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 88 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 89 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 90 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 91 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 92 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 93 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 94 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 95 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 96 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 97 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 98 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 99 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 100 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 101 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 102 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 103 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 104 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 105 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 106 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 107 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 108 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 109 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 110 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 111 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 112 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 113 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 115 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 116 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 117 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 120 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 125 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 128 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 130 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 150 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 155 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 157 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 158 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 159 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 160 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 161 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 162 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 163 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 164 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 165 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 166 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 167 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 169 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 170 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 171 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 172 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 176 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 177 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 178 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 179 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 180 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 181 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 182 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 184 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 185 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 197 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 211 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 212 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 213 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 214 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 215 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 216 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 278 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 279 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 280 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 286 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 287 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 304 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 305 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 306 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 307 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 308 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 309 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 310 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 319 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 320 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 323 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 324 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 393 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 430 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 431 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 432 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 433 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 437 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 438 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 439 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 441 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 442 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 443 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 444 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 445 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 449 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 450 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 456 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 462 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 463 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 464 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 465 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 466 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 467 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 468 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 469 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 470 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 471 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 472 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 473 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 474 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 475 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 476 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 477 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 478 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 479 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 480 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.15 |
| Metatranscriptomes | 0 |
| Isolates | 15.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.24 |
| Nodule | 11.4 |
| Rhizoplane | 11.04 |
| Rhizosphere | 56.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000012 | 3300003203 | Bacteria | 102438 |
| 2 | JGI25153J46596_10007570 | 3300003215 | Bacteria | 5316 |
| 3 | JGI25153J46596_10007805 | 3300003215 | Bacteria | 5198 |
| 4 | JGI25153J46596_10007905 | 3300003215 | Bacteria | 5159 |
| 5 | JGI25153J46596_10010090 | 3300003215 | Bacteria | 4308 |
| 6 | JGI25153J46596_10011735 | 3300003215 | Bacteria | 3846 |
| 7 | JGI25160J50197_1001523 | 3300003354 | Bacteria | 11497 |
| 8 | JGI25160J50197_1004156 | 3300003354 | Bacteria | 6306 |
| 9 | Ga0055542_1014266 | 3300003762 | Bacteria | 1311 |
| 10 | Ga0055531_10017206 | 3300003794 | Bacteria | 3066 |
| 11 | Ga0055543_1001971 | 3300004625 | Bacteria | 7312 |
| 12 | Ga0065165_1000982 | 3300005262 | Bacteria | 35331 |
| 13 | Ga0070658_10051779 | 3300005327 | Bacteria | 3327 |
| 14 | Ga0070658_10355352 | 3300005327 | Bacteria | 1254 |
| 15 | Ga0070676_10124442 | 3300005328 | Bacteria | 1622 |
| 16 | Ga0070683_100023299 | 3300005329 | Bacteria | 5538 |
| 17 | Ga0070670_100073764 | 3300005331 | Bacteria | 2931 |
| 18 | Ga0068869_100277754 | 3300005334 | Bacteria | 1346 |
| 19 | Ga0070666_10018342 | 3300005335 | Bacteria | 4498 |
| 20 | Ga0070682_100203239 | 3300005337 | Bacteria | 1399 |
| 21 | Ga0070682_100351791 | 3300005337 | Bacteria | 1099 |
| 22 | Ga0068868_100054852 | 3300005338 | Bacteria | 3143 |
| 23 | Ga0070660_100023598 | 3300005339 | Bacteria | 4558 |
| 24 | Ga0070660_100165349 | 3300005339 | Bacteria | 1785 |
| 25 | Ga0070689_100023388 | 3300005340 | Bacteria | 4625 |
| 26 | Ga0070691_10023144 | 3300005341 | Bacteria | 2884 |
| 27 | Ga0070661_100014282 | 3300005344 | Bacteria | 5595 |
| 28 | Ga0070661_100019861 | 3300005344 | Bacteria | 4788 |
| 29 | Ga0070668_100022443 | 3300005347 | Bacteria | 4771 |
| 30 | Ga0070671_100010055 | 3300005355 | Bacteria | 7600 |
| 31 | Ga0070671_100052016 | 3300005355 | Bacteria | 3406 |
| 32 | Ga0070671_100071962 | 3300005355 | Bacteria | 2886 |
| 33 | Ga0070674_100050376 | 3300005356 | Unclassified | 2867 |
| 34 | Ga0070659_100527099 | 3300005366 | Bacteria | 1009 |
| 35 | Ga0070667_100054855 | 3300005367 | Bacteria | 3365 |
| 36 | Ga0070667_100072840 | 3300005367 | Bacteria | 2928 |
| 37 | Ga0070667_100081303 | 3300005367 | Plasmid | 2772 |
| 38 | Ga0070709_10002216 | 3300005434 | Bacteria | 10530 |
| 39 | Ga0070709_10018192 | 3300005434 | Bacteria | 4043 |
| 40 | Ga0070709_10172765 | 3300005434 | Bacteria | 1511 |
| 41 | Ga0070714_100060786 | 3300005435 | Bacteria | 3244 |
| 42 | Ga0070714_100074728 | 3300005435 | Plasmid | 2939 |
| 43 | Ga0070714_100365096 | 3300005435 | Bacteria | 1358 |
| 44 | Ga0070713_100005731 | 3300005436 | Bacteria | 8529 |
| 45 | Ga0070713_100013315 | 3300005436 | Bacteria | 6069 |
| 46 | Ga0070713_100056783 | 3300005436 | Bacteria | 3257 |
| 47 | Ga0070713_100251054 | 3300005436 | Unclassified | 1613 |
| 48 | Ga0070710_10002966 | 3300005437 | Bacteria | 8056 |
| 49 | Ga0070710_10004257 | 3300005437 | Bacteria | 6785 |
| 50 | Ga0070710_10209689 | 3300005437 | Unclassified | 1234 |
| 51 | Ga0070701_10333594 | 3300005438 | Bacteria | 942 |
| 52 | Ga0070711_100012216 | 3300005439 | Bacteria | 5360 |
| 53 | Ga0070711_100017604 | 3300005439 | Bacteria | 4552 |
| 54 | Ga0070711_100029550 | 3300005439 | Bacteria | 3618 |
| 55 | Ga0070705_100050455 | 3300005440 | Bacteria | 2421 |
| 56 | Ga0070663_100010322 | 3300005455 | Bacteria | 5820 |
| 57 | Ga0070663_100065655 | 3300005455 | Bacteria | 2627 |
| 58 | Ga0070663_100165065 | 3300005455 | Bacteria | 1707 |
| 59 | Ga0070678_100005437 | 3300005456 | Bacteria | 7363 |
| 60 | Ga0070662_100050455 | 3300005457 | Bacteria | 3001 |
| 61 | Ga0070681_10029471 | 3300005458 | Bacteria | 5512 |
| 62 | Ga0070685_10162524 | 3300005466 | Bacteria | 1424 |
| 63 | Ga0070679_100025513 | 3300005530 | Bacteria | 5801 |
| 64 | Ga0070679_100043101 | 3300005530 | Bacteria | 4495 |
| 65 | Ga0070695_100033610 | 3300005545 | Bacteria | 3209 |
| 66 | Ga0070696_100036249 | 3300005546 | Bacteria | 3400 |
| 67 | Ga0070693_100026376 | 3300005547 | Bacteria | 3137 |
| 68 | Ga0070693_100147826 | 3300005547 | Bacteria | 1485 |
| 69 | Ga0070665_100025939 | 3300005548 | Bacteria | 5902 |
| 70 | Ga0070665_100056381 | 3300005548 | Bacteria | 3939 |
| 71 | Ga0070665_100056661 | 3300005548 | Bacteria | 3929 |
| 72 | Ga0070665_100172139 | 3300005548 | Bacteria | 2166 |
| 73 | Ga0068855_100000529 | 3300005563 | Bacteria | 46748 |
| 74 | Ga0068855_100153238 | 3300005563 | Bacteria | 2619 |
| 75 | Ga0068855_100166033 | 3300005563 | Bacteria | 2502 |
| 76 | Ga0070664_100047921 | 3300005564 | Bacteria | 3611 |
| 77 | Ga0068856_100172913 | 3300005614 | Bacteria | 2172 |
| 78 | Ga0068856_100452562 | 3300005614 | Bacteria | 1305 |
| 79 | Ga0068852_100003179 | 3300005616 | Bacteria | 11467 |
| 80 | Ga0068852_100042826 | 3300005616 | Bacteria | 3835 |
| 81 | Ga0068852_100070253 | 3300005616 | Bacteria | 3071 |
| 82 | Ga0068852_100186585 | 3300005616 | Bacteria | 1953 |
| 83 | Ga0068852_100366348 | 3300005616 | Bacteria | 1411 |
| 84 | Ga0068859_100064654 | 3300005617 | Bacteria | 3691 |
| 85 | Ga0068859_100310395 | 3300005617 | Unclassified | 1671 |
| 86 | Ga0068864_100033860 | 3300005618 | Bacteria | 4343 |
| 87 | Ga0068866_10088473 | 3300005718 | Bacteria | 1681 |
| 88 | Ga0068863_100668632 | 3300005841 | Bacteria | 1031 |
| 89 | Ga0068858_100010777 | 3300005842 | Bacteria | 8644 |
| 90 | Ga0068858_100175259 | 3300005842 | Bacteria | 2023 |
| 91 | Ga0068860_100311057 | 3300005843 | Bacteria | 1545 |
| 92 | Ga0081455_10094575 | 3300005937 | Bacteria | 2413 |
| 93 | Ga0081455_10146879 | 3300005937 | Bacteria | 1823 |
| 94 | Ga0081540_1017703 | 3300005983 | Bacteria | 4399 |
| 95 | Ga0081540_1035683 | 3300005983 | Bacteria | 2663 |
| 96 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 97 | Ga0081539_10072807 | 3300005985 | Bacteria | 1835 |
| 98 | Ga0070717_10129308 | 3300006028 | Bacteria | 2171 |
| 99 | Ga0070717_10217624 | 3300006028 | Unclassified | 1678 |
| 100 | Ga0075365_10125115 | 3300006038 | Bacteria | 1776 |
| 101 | Ga0075368_10001274 | 3300006042 | Bacteria | 7977 |
| 102 | Ga0075363_100006553 | 3300006048 | Bacteria | 5301 |
| 103 | Ga0075364_10023980 | 3300006051 | Bacteria | 3868 |
| 104 | Ga0075364_10043149 | 3300006051 | Bacteria | 2931 |
| 105 | Ga0075364_10280459 | 3300006051 | Bacteria | 1134 |
| 106 | Ga0070715_10001099 | 3300006163 | Bacteria | 7676 |
| 107 | Ga0070716_100002384 | 3300006173 | Bacteria | 8648 |
| 108 | Ga0070712_100085185 | 3300006175 | Bacteria | 2300 |
| 109 | Ga0070712_100391538 | 3300006175 | Bacteria | 1146 |
| 110 | Ga0075362_10152395 | 3300006177 | Bacteria | 1110 |
| 111 | Ga0075367_10044362 | 3300006178 | Bacteria | 2606 |
| 112 | Ga0075367_10049189 | 3300006178 | Bacteria | 2484 |
| 113 | Ga0075367_10068495 | 3300006178 | Bacteria | 2129 |
| 114 | Ga0075369_10024233 | 3300006186 | Bacteria | 2513 |
| 115 | Ga0075369_10029318 | 3300006186 | Bacteria | 2311 |
| 116 | Ga0075366_10015724 | 3300006195 | Bacteria | 4343 |
| 117 | Ga0075366_10129673 | 3300006195 | Bacteria | 1521 |
| 118 | Ga0075370_10008389 | 3300006353 | Bacteria | 5316 |
| 119 | Ga0075370_10032778 | 3300006353 | Bacteria | 2906 |
| 120 | Ga0068871_100006182 | 3300006358 | Bacteria | 8439 |
| 121 | Ga0068871_100042552 | 3300006358 | Bacteria | 3647 |
| 122 | Ga0068865_100005241 | 3300006881 | Bacteria | 7838 |
| 123 | Ga0097620_100064654 | 3300006931 | Bacteria | 3691 |
| 124 | Ga0097620_100310411 | 3300006931 | Unclassified | 1671 |
| 125 | Ga0099825_1029794 | 3300006941 | Bacteria | 2489 |
| 126 | Ga0099823_1020508 | 3300006944 | Bacteria | 6241 |
| 127 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 128 | Ga0105240_10017001 | 3300009093 | Bacteria | 9826 |
| 129 | Ga0111539_10576076 | 3300009094 | Bacteria | 1311 |
| 130 | Ga0105245_10004710 | 3300009098 | Bacteria | 12058 |
| 131 | Ga0105245_10124194 | 3300009098 | Bacteria | 2414 |
| 132 | Ga0105245_10303364 | 3300009098 | Unclassified | 1568 |
| 133 | Ga0105245_10430067 | 3300009098 | Bacteria | 1325 |
| 134 | Ga0105247_10007722 | 3300009101 | Bacteria | 6583 |
| 135 | Ga0105247_10031115 | 3300009101 | Unclassified | 3237 |
| 136 | Ga0105247_10224032 | 3300009101 | Bacteria | 1274 |
| 137 | Ga0105243_10233853 | 3300009148 | Bacteria | 1632 |
| 138 | Ga0105243_10343188 | 3300009148 | Unclassified | 1369 |
| 139 | Ga0105241_10027893 | 3300009174 | Bacteria | 4204 |
| 140 | Ga0105241_10086932 | 3300009174 | Bacteria | 2459 |
| 141 | Ga0105241_10088741 | 3300009174 | Bacteria | 2435 |
| 142 | Ga0105241_10251588 | 3300009174 | Bacteria | 1498 |
| 143 | Ga0105241_10301812 | 3300009174 | Unclassified | 1375 |
| 144 | Ga0105242_10011410 | 3300009176 | Bacteria | 6830 |
| 145 | Ga0105248_10024075 | 3300009177 | Bacteria | 6766 |
| 146 | Ga0105248_10065542 | 3300009177 | Bacteria | 4078 |
| 147 | Ga0105248_10082496 | 3300009177 | Bacteria | 3615 |
| 148 | Ga0105237_10002118 | 3300009545 | Bacteria | 25049 |
| 149 | Ga0105237_10215947 | 3300009545 | Bacteria | 1918 |
| 150 | Ga0105238_10040937 | 3300009551 | Bacteria | 4694 |
| 151 | Ga0105238_10090489 | 3300009551 | Plasmid | 3047 |
| 152 | Ga0105249_10162867 | 3300009553 | Unclassified | 2157 |
| 153 | Ga0105249_10194043 | 3300009553 | Bacteria | 1984 |
| 154 | Ga0105249_10408311 | 3300009553 | Bacteria | 1390 |
| 155 | Ga0099796_10001500 | 3300010159 | Bacteria | 4728 |
| 156 | Ga0099796_10042873 | 3300010159 | Bacteria | 1539 |
| 157 | Ga0105239_10005950 | 3300010375 | Bacteria | 14194 |
| 158 | Ga0105239_10072128 | 3300010375 | Bacteria | 3795 |
| 159 | Ga0105239_10239668 | 3300010375 | Bacteria | 2036 |
| 160 | Ga0105239_10318649 | 3300010375 | Bacteria | 1753 |
| 161 | Ga0105239_10380624 | 3300010375 | Bacteria | 1595 |
| 162 | Ga0105239_10477333 | 3300010375 | Bacteria | 1416 |
| 163 | Ga0105239_10866740 | 3300010375 | Bacteria | 1036 |
| 164 | Ga0105246_10017246 | 3300011119 | Bacteria | 4588 |
| 165 | Ga0105246_10046711 | 3300011119 | Bacteria | 2955 |
| 166 | Ga0105246_10088768 | 3300011119 | Bacteria | 2222 |
| 167 | Ga0105246_10322327 | 3300011119 | Bacteria | 1256 |
| 168 | Ga0157373_10054547 | 3300013100 | Bacteria | 2840 |
| 169 | Ga0157371_10143059 | 3300013102 | Bacteria | 1704 |
| 170 | Ga0157370_10079150 | 3300013104 | Bacteria | 3095 |
| 171 | Ga0157370_10268253 | 3300013104 | Bacteria | 1577 |
| 172 | Ga0157369_10413268 | 3300013105 | Bacteria | 1399 |
| 173 | Ga0157374_10008513 | 3300013296 | Bacteria | 8775 |
| 174 | Ga0157374_10014838 | 3300013296 | Bacteria | 6826 |
| 175 | Ga0157374_10050674 | 3300013296 | Unclassified | 3860 |
| 176 | Ga0157378_10005396 | 3300013297 | Bacteria | 11209 |
| 177 | Ga0157378_10445721 | 3300013297 | Bacteria | 1284 |
| 178 | Ga0163162_10009085 | 3300013306 | Bacteria | 9663 |
| 179 | Ga0163162_10087474 | 3300013306 | Plasmid | 3195 |
| 180 | Ga0157372_10340073 | 3300013307 | Unclassified | 1748 |
| 181 | Ga0157375_10012326 | 3300013308 | Bacteria | 7581 |
| 182 | Ga0163163_10018613 | 3300014325 | Bacteria | 6506 |
| 183 | Ga0163163_10024935 | 3300014325 | Bacteria | 5695 |
| 184 | Ga0163163_10520379 | 3300014325 | Bacteria | 1252 |
| 185 | Ga0157379_10008660 | 3300014968 | Bacteria | 8860 |
| 186 | Ga0157379_10018738 | 3300014968 | Bacteria | 6104 |
| 187 | Ga0157379_10024715 | 3300014968 | Bacteria | 5332 |
| 188 | Ga0157379_10061174 | 3300014968 | Bacteria | 3368 |
| 189 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 190 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 191 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 192 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 193 | Ga0213876_10100658 | 3300021384 | Bacteria | 1532 |
| 194 | Ga0213876_10226350 | 3300021384 | Unclassified | 994 |
| 195 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 196 | Ga0209563_101805 | 3300025230 | Bacteria | 5302 |
| 197 | Ga0209677_100400 | 3300025253 | Bacteria | 26165 |
| 198 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 199 | Ga0209233_1001172 | 3300025261 | Bacteria | 10583 |
| 200 | Ga0209233_1012581 | 3300025261 | Bacteria | 2448 |
| 201 | Ga0209233_1025527 | 3300025261 | Bacteria | 1460 |
| 202 | Ga0209455_1003830 | 3300025272 | Bacteria | 5152 |
| 203 | Ga0209564_1008083 | 3300025295 | Bacteria | 5267 |
| 204 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 205 | Ga0209758_1000536 | 3300025297 | Bacteria | 60374 |
| 206 | Ga0209758_1001992 | 3300025297 | Bacteria | 22001 |
| 207 | Ga0209758_1002275 | 3300025297 | Bacteria | 19895 |
| 208 | Ga0209758_1003319 | 3300025297 | Bacteria | 14823 |
| 209 | Ga0209758_1038606 | 3300025297 | Bacteria | 1829 |
| 210 | Ga0209758_1039740 | 3300025297 | Bacteria | 1784 |
| 211 | Ga0209256_1004643 | 3300025299 | Bacteria | 8462 |
| 212 | Ga0209256_1010195 | 3300025299 | Bacteria | 3976 |
| 213 | Ga0209256_1049727 | 3300025299 | Bacteria | 1020 |
| 214 | Ga0207426_1002091 | 3300025302 | Bacteria | 13785 |
| 215 | Ga0207426_1002585 | 3300025302 | Bacteria | 11252 |
| 216 | Ga0207426_1013422 | 3300025302 | Bacteria | 3036 |
| 217 | Ga0207426_1015065 | 3300025302 | Bacteria | 2816 |
| 218 | Ga0209051_1060403 | 3300025303 | Bacteria | 1197 |
| 219 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 220 | Ga0209257_1020044 | 3300025304 | Bacteria | 2489 |
| 221 | Ga0207692_10031295 | 3300025898 | Unclassified | 2547 |
| 222 | Ga0207692_10035710 | 3300025898 | Bacteria | 2417 |
| 223 | Ga0207642_10070761 | 3300025899 | Bacteria | 1659 |
| 224 | Ga0207710_10013015 | 3300025900 | Bacteria | 3505 |
| 225 | Ga0207710_10037135 | 3300025900 | Bacteria | 2150 |
| 226 | Ga0207710_10040573 | 3300025900 | Unclassified | 2063 |
| 227 | Ga0207680_10018562 | 3300025903 | Bacteria | 3701 |
| 228 | Ga0207647_10005715 | 3300025904 | Bacteria | 9080 |
| 229 | Ga0207699_10002176 | 3300025906 | Bacteria | 9251 |
| 230 | Ga0207699_10058038 | 3300025906 | Unclassified | 2314 |
| 231 | Ga0207699_10104794 | 3300025906 | Bacteria | 1802 |
| 232 | Ga0207699_10318871 | 3300025906 | Bacteria | 1090 |
| 233 | Ga0207654_10173298 | 3300025911 | Bacteria | 1403 |
| 234 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 235 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 236 | Ga0207671_10008630 | 3300025914 | Bacteria | 8612 |
| 237 | Ga0207671_10169508 | 3300025914 | Bacteria | 1695 |
| 238 | Ga0207693_10049568 | 3300025915 | Plasmid | 3298 |
| 239 | Ga0207693_10095712 | 3300025915 | Bacteria | 2328 |
| 240 | Ga0207693_10183752 | 3300025915 | Bacteria | 1646 |
| 241 | Ga0207663_10002864 | 3300025916 | Bacteria | 8336 |
| 242 | Ga0207663_10033820 | 3300025916 | Bacteria | 3050 |
| 243 | Ga0207663_10073295 | 3300025916 | Bacteria | 2215 |
| 244 | Ga0207663_10216236 | 3300025916 | Bacteria | 1392 |
| 245 | Ga0207657_10044394 | 3300025919 | Bacteria | 3907 |
| 246 | Ga0207657_10114072 | 3300025919 | Bacteria | 2229 |
| 247 | Ga0207649_10045682 | 3300025920 | Bacteria | 2686 |
| 248 | Ga0207646_10510068 | 3300025922 | Unclassified | 1083 |
| 249 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 250 | Ga0207650_10100767 | 3300025925 | Bacteria | 2223 |
| 251 | Ga0207687_10016247 | 3300025927 | Bacteria | 4888 |
| 252 | Ga0207687_10099471 | 3300025927 | Bacteria | 2137 |
| 253 | Ga0207687_10211882 | 3300025927 | Bacteria | 1520 |
| 254 | Ga0207700_10190827 | 3300025928 | Bacteria | 1722 |
| 255 | Ga0207700_10288539 | 3300025928 | Bacteria | 1414 |
| 256 | Ga0207664_10030862 | 3300025929 | Bacteria | 4095 |
| 257 | Ga0207644_10020007 | 3300025931 | Bacteria | 4546 |
| 258 | Ga0207644_10232097 | 3300025931 | Bacteria | 1466 |
| 259 | Ga0207706_10025262 | 3300025933 | Bacteria | 5325 |
| 260 | Ga0207686_10041573 | 3300025934 | Unclassified | 2804 |
| 261 | Ga0207704_10003803 | 3300025938 | Bacteria | 6871 |
| 262 | Ga0207704_10076977 | 3300025938 | Bacteria | 2140 |
| 263 | Ga0207665_10005428 | 3300025939 | Bacteria | 8511 |
| 264 | Ga0207665_10008613 | 3300025939 | Bacteria | 6714 |
| 265 | Ga0207665_10053964 | 3300025939 | Bacteria | 2709 |
| 266 | Ga0207711_10003089 | 3300025941 | Bacteria | 14519 |
| 267 | Ga0207711_10033717 | 3300025941 | Bacteria | 4334 |
| 268 | Ga0207711_10239515 | 3300025941 | Bacteria | 1663 |
| 269 | Ga0207711_10725017 | 3300025941 | Bacteria | 927 |
| 270 | Ga0207661_10015446 | 3300025944 | Bacteria | 5618 |
| 271 | Ga0207679_10005027 | 3300025945 | Bacteria | 8261 |
| 272 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 273 | Ga0207667_10071501 | 3300025949 | Bacteria | 3607 |
| 274 | Ga0207667_10387207 | 3300025949 | Bacteria | 1424 |
| 275 | Ga0207712_10230589 | 3300025961 | Bacteria | 1486 |
| 276 | Ga0207668_10169373 | 3300025972 | Bacteria | 1711 |
| 277 | Ga0207640_10114731 | 3300025981 | Bacteria | 1917 |
| 278 | Ga0207658_10231159 | 3300025986 | Bacteria | 1561 |
| 279 | Ga0207677_10034827 | 3300026023 | Bacteria | 3264 |
| 280 | Ga0207703_10043250 | 3300026035 | Bacteria | 3615 |
| 281 | Ga0207703_10110278 | 3300026035 | Bacteria | 2347 |
| 282 | Ga0207703_10222676 | 3300026035 | Bacteria | 1688 |
| 283 | Ga0207639_10250476 | 3300026041 | Bacteria | 1544 |
| 284 | Ga0207678_10122456 | 3300026067 | Bacteria | 2219 |
| 285 | Ga0207678_10314662 | 3300026067 | Bacteria | 1346 |
| 286 | Ga0207678_10347639 | 3300026067 | Bacteria | 1279 |
| 287 | Ga0207702_10101662 | 3300026078 | Unclassified | 2539 |
| 288 | Ga0207702_10215133 | 3300026078 | Bacteria | 1788 |
| 289 | Ga0207702_10224154 | 3300026078 | Bacteria | 1753 |
| 290 | Ga0207702_10369251 | 3300026078 | Bacteria | 1377 |
| 291 | Ga0207641_10229996 | 3300026088 | Bacteria | 1723 |
| 292 | Ga0207648_10049805 | 3300026089 | Bacteria | 3664 |
| 293 | Ga0207676_10162185 | 3300026095 | Bacteria | 1938 |
| 294 | Ga0207674_10055792 | 3300026116 | Bacteria | 4015 |
| 295 | Ga0207674_10070190 | 3300026116 | Bacteria | 3522 |
| 296 | Ga0207683_10032293 | 3300026121 | Bacteria | 4548 |
| 297 | Ga0207698_10005418 | 3300026142 | Bacteria | 7886 |
| 298 | Ga0207698_10009584 | 3300026142 | Bacteria | 6184 |
| 299 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 300 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 301 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 302 | Ga0209588_1014000 | 3300027671 | Bacteria | 2453 |
| 303 | Ga0268266_10004873 | 3300028379 | Bacteria | 12733 |
| 304 | Ga0268266_10021144 | 3300028379 | Bacteria | 5544 |
| 305 | Ga0268266_10069109 | 3300028379 | Bacteria | 3060 |
| 306 | Ga0268266_10227280 | 3300028379 | Bacteria | 1717 |
| 307 | Ga0268265_10233231 | 3300028380 | Bacteria | 1619 |
| 308 | Ga0268264_10249844 | 3300028381 | Bacteria | 1647 |
| 309 | Ga0307511_10067940 | 3300030521 | Bacteria | 2638 |
| 310 | Ga0265325_10000398 | 3300031241 | Bacteria | 30875 |
| 311 | Ga0265325_10025536 | 3300031241 | Bacteria | 3206 |
| 312 | Ga0265325_10041188 | 3300031241 | Bacteria | 2421 |
| 313 | Ga0265316_10054306 | 3300031344 | Bacteria | 3137 |
| 314 | Ga0265313_10011516 | 3300031595 | Bacteria | 5490 |
| 315 | Ga0265313_10029312 | 3300031595 | Bacteria | 2848 |
| 316 | Ga0265314_10000439 | 3300031711 | Bacteria | 55613 |
| 317 | Ga0265342_10000882 | 3300031712 | Bacteria | 29894 |
| 318 | Ga0307516_10007612 | 3300031730 | Bacteria | 12410 |
| 319 | Ga0307516_10008613 | 3300031730 | Bacteria | 11508 |
| 320 | Ga0307516_10021682 | 3300031730 | Bacteria | 6605 |
| 321 | Ga0307409_100503362 | 3300031995 | Unclassified | 1180 |
| 322 | Ga0307507_10154980 | 3300033179 | Bacteria | 1711 |
| 323 | Ga0307510_10024382 | 3300033180 | Bacteria | 6990 |
| 324 | Ga0307510_10028911 | 3300033180 | Bacteria | 6320 |
| 325 | Ga0373923_0020877 | 3300035111 | Unclassified | 2551 |
| 326 | Ga0373941_0000525 | 3300035115 | Bacteria | 7684 |
| 327 | Ga0373945_0066159 | 3300035116 | Bacteria | 1359 |
| 328 | Ga0373954_0002960 | 3300035118 | Bacteria | 7170 |
| 329 | Ga0373954_0084974 | 3300035118 | Bacteria | 1515 |
| 330 | Ga0373956_0011394 | 3300035119 | Bacteria | 3662 |
| 331 | Ga0373956_0050147 | 3300035119 | Bacteria | 1873 |
| 332 | Ga0373957_0011249 | 3300035120 | Plasmid | 2981 |
| 333 | Ga0373946_0073401 | 3300035171 | Bacteria | 1483 |
| 334 | Ga0373955_0004355 | 3300035172 | Bacteria | 6260 |
| 335 | Ga0373955_0007183 | 3300035172 | Bacteria | 5107 |
| 336 | Ga0373924_0011648 | 3300035410 | Bacteria | 3270 |
| 337 | Ga0373924_0075560 | 3300035410 | Bacteria | 1426 |
| 338 | Ga0373931_0145767 | 3300035691 | Bacteria | 1376 |
| 339 | Ga0373935_0273463 | 3300035692 | Bacteria | 1188 |
| 340 | Ga0373927_0065680 | 3300035695 | Bacteria | 2347 |
| 341 | Ga0373927_0352950 | 3300035695 | Bacteria | 969 |
| 342 | Ga0373933_0006532 | 3300035724 | Bacteria | 6352 |
| 343 | Ga0373933_0028937 | 3300035724 | Bacteria | 3199 |
| 344 | Ga0373933_0054315 | 3300035724 | Bacteria | 2400 |
| 345 | Ga0373933_0197899 | 3300035724 | Bacteria | 1285 |
| 346 | Ga0373947_0228352 | 3300035725 | Bacteria | 1225 |
| 347 | Ga0373937_0004592 | 3300036401 | Bacteria | 11716 |
| 348 | Ga0373937_0005159 | 3300036401 | Bacteria | 11138 |
| 349 | Ga0373937_0021587 | 3300036401 | Bacteria | 5777 |
| 350 | Ga0373937_0031801 | 3300036401 | Bacteria | 4784 |
| 351 | Ga0373937_0388096 | 3300036401 | Bacteria | 1324 |
| 352 | Ga0373925_0001273 | 3300037068 | Bacteria | 22250 |
| 353 | Ga0373925_0144421 | 3300037068 | Unclassified | 1864 |
| 354 | Ga0395899_0028090 | 3300037312 | Bacteria | 4238 |
| 355 | Ga0395900_0003044 | 3300037418 | Bacteria | 18262 |
| 356 | Ga0395900_0268887 | 3300037418 | Bacteria | 1700 |
| 357 | Ga0395898_0009793 | 3300037466 | Bacteria | 10045 |
| 358 | Ga0395898_0173849 | 3300037466 | Bacteria | 2059 |
| 359 | Ga0395905_0001273 | 3300037471 | Bacteria | 31107 |
| 360 | Ga0395905_0018089 | 3300037471 | Bacteria | 6690 |
| 361 | Ga0436364_0015606 | 3300037853 | Bacteria | 4319 |
| 362 | Ga0436364_0604898 | 3300037853 | Bacteria | 2898 |
| 363 | Ga0436364_0728139 | 3300037853 | Bacteria | 64829 |
| 364 | Ga0395901_0295504 | 3300038443 | Bacteria | 1680 |
| 365 | Ga0436365_0425385 | 3300039437 | Bacteria | 4989 |
| 366 | Ga0436365_1830792 | 3300039437 | Bacteria | 2870 |
| 367 | Ga0436360_0310474 | 3300039438 | Bacteria | 1544 |
| 368 | Ga0451793_1684190 | 3300041452 | Bacteria | 1563 |
| 369 | Ga0451797_1288970 | 3300041453 | Bacteria | 1557 |
| 370 | Ga0451802_0495993 | 3300041460 | Bacteria | 1076 |
| 371 | Ga0451853_2299509 | 3300041512 | Bacteria | 2139 |
| 372 | Ga0466972_0000053 | 3300044658 | Bacteria | 112876 |
| 373 | Ga0466972_0033341 | 3300044658 | Bacteria | 2525 |
| 374 | Ga0466972_0062459 | 3300044658 | Bacteria | 1785 |
| 375 | Ga0466966_0000322 | 3300044684 | Bacteria | 30928 |
| 376 | Ga0466961_0002390 | 3300044693 | Bacteria | 11659 |
| 377 | Ga0466961_0126373 | 3300044693 | Bacteria | 1604 |
| 378 | Ga0466963_0005897 | 3300044694 | Bacteria | 7217 |
| 379 | Ga0466964_0029672 | 3300044706 | Bacteria | 2161 |
| 380 | Ga0466964_0071745 | 3300044706 | Bacteria | 1466 |
| 381 | Ga0466970_0143407 | 3300044765 | Bacteria | 1317 |
| 382 | Ga0466957_0027315 | 3300044842 | Bacteria | 3392 |
| 383 | Ga0466960_0000619 | 3300044901 | Bacteria | 12265 |
| 384 | Ga0466959_0305499 | 3300045049 | Bacteria | 1089 |
| 385 | Ga0466967_0048518 | 3300045976 | Bacteria | 3708 |
| 386 | Ga0466967_0090301 | 3300045976 | Bacteria | 2782 |
| 387 | Ga0466967_0257769 | 3300045976 | Bacteria | 1668 |
| 388 | Ga0495638_0005066 | 3300046460 | Bacteria | 9877 |
| 389 | Ga0495651_0005183 | 3300046462 | Bacteria | 9944 |
| 390 | Ga0495651_0047894 | 3300046462 | Bacteria | 3302 |
| 391 | Ga0495651_0051595 | 3300046462 | Bacteria | 3170 |
| 392 | Ga0495651_0058218 | 3300046462 | Bacteria | 2965 |
| 393 | Ga0495653_0005744 | 3300046463 | Bacteria | 10150 |
| 394 | Ga0495605_0178657 | 3300046474 | Bacteria | 934 |
| 395 | Ga0495662_0016908 | 3300046476 | Bacteria | 3530 |
| 396 | Ga0495662_0201297 | 3300046476 | Bacteria | 981 |
| 397 | Ga0495664_0003461 | 3300046477 | Bacteria | 8590 |
| 398 | Ga0495664_0037276 | 3300046477 | Bacteria | 2869 |
| 399 | Ga0495664_0161780 | 3300046477 | Bacteria | 1358 |
| 400 | Ga0495594_0145242 | 3300046499 | Unclassified | 1346 |
| 401 | Ga0495607_0048959 | 3300046501 | Bacteria | 2468 |
| 402 | Ga0495606_0007723 | 3300046507 | Bacteria | 9526 |
| 403 | Ga0495606_0080074 | 3300046507 | Bacteria | 2033 |
| 404 | Ga0495606_0227218 | 3300046507 | Bacteria | 1048 |
| 405 | Ga0495608_0004462 | 3300046511 | Bacteria | 10003 |
| 406 | Ga0495608_0027747 | 3300046511 | Bacteria | 3850 |
| 407 | Ga0495608_0062915 | 3300046511 | Bacteria | 2437 |
| 408 | Ga0495610_0082047 | 3300046512 | Bacteria | 1478 |
| 409 | Ga0495620_0064869 | 3300046515 | Bacteria | 1509 |
| 410 | Ga0495628_0001465 | 3300046516 | Bacteria | 21652 |
| 411 | Ga0495628_0009727 | 3300046516 | Bacteria | 8202 |
| 412 | Ga0495628_0099864 | 3300046516 | Bacteria | 2241 |
| 413 | Ga0495628_0123019 | 3300046516 | Bacteria | 1989 |
| 414 | Ga0495628_0410221 | 3300046516 | Bacteria | 988 |
| 415 | Ga0495630_0185612 | 3300046517 | Unclassified | 1586 |
| 416 | Ga0495630_0382709 | 3300046517 | Bacteria | 1078 |
| 417 | Ga0495652_0002359 | 3300046529 | Bacteria | 19593 |
| 418 | Ga0495652_0114375 | 3300046529 | Bacteria | 2165 |
| 419 | Ga0495652_0342689 | 3300046529 | Bacteria | 1073 |
| 420 | Ga0495665_0091119 | 3300046531 | Unclassified | 1602 |
| 421 | Ga0495640_0013003 | 3300046533 | Bacteria | 6340 |
| 422 | Ga0495640_0014947 | 3300046533 | Bacteria | 5854 |
| 423 | Ga0495640_0049154 | 3300046533 | Bacteria | 2910 |
| 424 | Ga0495586_0006236 | 3300046535 | Bacteria | 6373 |
| 425 | Ga0495587_0007520 | 3300046536 | Bacteria | 7055 |
| 426 | Ga0495609_0063355 | 3300046538 | Bacteria | 1632 |
| 427 | Ga0495609_0190368 | 3300046538 | Bacteria | 861 |
| 428 | Ga0495645_0004750 | 3300046543 | Bacteria | 9285 |
| 429 | Ga0495645_0009901 | 3300046543 | Bacteria | 6670 |
| 430 | Ga0495645_0054130 | 3300046543 | Bacteria | 2916 |
| 431 | Ga0495622_0017584 | 3300046557 | Bacteria | 3329 |
| 432 | Ga0495667_0004513 | 3300046559 | Bacteria | 9394 |
| 433 | Ga0495667_0059836 | 3300046559 | Bacteria | 2499 |
| 434 | Ga0495667_0298367 | 3300046559 | Bacteria | 1021 |
| 435 | Ga0495668_0013172 | 3300046616 | Bacteria | 4890 |
| 436 | Ga0495668_0123871 | 3300046616 | Bacteria | 1414 |
| 437 | Ga0495634_0026468 | 3300046642 | Bacteria | 4047 |
| 438 | Ga0495634_0047344 | 3300046642 | Bacteria | 2898 |
| 439 | Ga0495625_0148643 | 3300046660 | Bacteria | 1576 |
| 440 | Ga0495635_0009985 | 3300046663 | Bacteria | 6635 |
| 441 | Ga0495635_0031347 | 3300046663 | Bacteria | 3691 |
| 442 | Ga0495635_0064254 | 3300046663 | Bacteria | 2520 |
| 443 | Ga0495635_0082487 | 3300046663 | Unclassified | 2200 |
| 444 | Ga0495635_0175425 | 3300046663 | Bacteria | 1457 |
| 445 | Ga0495588_0063353 | 3300046674 | Bacteria | 1917 |
| 446 | Ga0495657_0002195 | 3300046675 | Bacteria | 16535 |
| 447 | Ga0495657_0013992 | 3300046675 | Bacteria | 5894 |
| 448 | Ga0495657_0027589 | 3300046675 | Bacteria | 4005 |
| 449 | Ga0495657_0074532 | 3300046675 | Bacteria | 2208 |
| 450 | Ga0495599_0001128 | 3300046678 | Bacteria | 15058 |
| 451 | Ga0495599_0002972 | 3300046678 | Bacteria | 9867 |
| 452 | Ga0495623_0000278 | 3300046679 | Bacteria | 33474 |
| 453 | Ga0495623_0025668 | 3300046679 | Bacteria | 3795 |
| 454 | Ga0495623_0083070 | 3300046679 | Bacteria | 1979 |
| 455 | Ga0495646_0141134 | 3300046680 | Bacteria | 1347 |
| 456 | Ga0495658_0006315 | 3300046683 | Bacteria | 5826 |
| 457 | Ga0495658_0116962 | 3300046683 | Unclassified | 1608 |
| 458 | Ga0495671_0076426 | 3300046692 | Bacteria | 1642 |
| 459 | Ga0495649_0019620 | 3300046694 | Bacteria | 3798 |
| 460 | Ga0495649_0084200 | 3300046694 | Bacteria | 1698 |
| 461 | Ga0495649_0121082 | 3300046694 | Bacteria | 1384 |
| 462 | Ga0495600_0003758 | 3300046809 | Bacteria | 8985 |
| 463 | Ga0495600_0033460 | 3300046809 | Bacteria | 3337 |
| 464 | Ga0495600_0088082 | 3300046809 | Unclassified | 2025 |
| 465 | Ga0495660_0045805 | 3300046810 | Bacteria | 2400 |
| 466 | Ga0495581_0016603 | 3300047315 | Bacteria | 4279 |
| 467 | Ga0495581_0053288 | 3300047315 | Bacteria | 2337 |
| 468 | Ga0495604_0008664 | 3300047317 | Bacteria | 8037 |
| 469 | Ga0495604_0074582 | 3300047317 | Bacteria | 2556 |
| 470 | Ga0495674_0025112 | 3300047319 | Bacteria | 5468 |
| 471 | Ga0495674_0095754 | 3300047319 | Bacteria | 2531 |
| 472 | Ga0495674_0097700 | 3300047319 | Bacteria | 2501 |
| 473 | Ga0495674_0104609 | 3300047319 | Bacteria | 2406 |
| 474 | Ga0495676_0171043 | 3300047321 | Bacteria | 1529 |
| 475 | Ga0495676_0290184 | 3300047321 | Bacteria | 1105 |
| 476 | Ga0495680_0003741 | 3300047322 | Bacteria | 14821 |
| 477 | Ga0495680_0004174 | 3300047322 | Bacteria | 13888 |
| 478 | Ga0495680_0006328 | 3300047322 | Bacteria | 11021 |
| 479 | Ga0495680_0017299 | 3300047322 | Bacteria | 6161 |
| 480 | Ga0495683_0017557 | 3300047323 | Bacteria | 3708 |
| 481 | Ga0495683_0039989 | 3300047323 | Bacteria | 2370 |
| 482 | Ga0495687_036217 | 3300047443 | Bacteria | 2210 |
| 483 | Ga0495675_0001793 | 3300047444 | Bacteria | 12793 |
| 484 | Ga0495673_0047501 | 3300047469 | Bacteria | 1897 |
| 485 | Ga0495673_0080996 | 3300047469 | Bacteria | 1345 |
| 486 | Ga0495684_0006683 | 3300047471 | Bacteria | 8947 |
| 487 | Ga0495684_0027789 | 3300047471 | Bacteria | 4345 |
| 488 | Ga0495686_0035942 | 3300047472 | Bacteria | 3181 |
| 489 | Ga0495593_0006057 | 3300047673 | Bacteria | 7113 |
| 490 | Ga0495593_0104209 | 3300047673 | Bacteria | 1453 |
| 491 | Ga0495602_0006975 | 3300048088 | Bacteria | 11864 |
| 492 | Ga0495602_0012049 | 3300048088 | Bacteria | 8913 |
| 493 | Ga0495602_0092780 | 3300048088 | Bacteria | 2500 |
| 494 | Ga0495602_0129774 | 3300048088 | Bacteria | 2012 |
| 495 | Ga0496100_0005901 | 3300048903 | Bacteria | 6635 |
| 496 | Ga0496100_0028290 | 3300048903 | Bacteria | 3456 |
| 497 | Ga0496100_0165197 | 3300048903 | Unclassified | 1589 |
| 498 | Ga0496100_0181026 | 3300048903 | Bacteria | 1524 |
| 499 | Ga0496100_0378226 | 3300048903 | Bacteria | 1075 |
| 500 | Ga0496101_0004388 | 3300048904 | Bacteria | 8868 |
| 501 | Ga0496101_0030995 | 3300048904 | Bacteria | 3755 |
| 502 | Ga0496101_0034951 | 3300048904 | Bacteria | 3553 |
| 503 | Ga0496101_0062972 | 3300048904 | Bacteria | 2698 |
| 504 | Ga0496101_0263989 | 3300048904 | Bacteria | 1343 |
| 505 | Ga0496102_0003175 | 3300048905 | Bacteria | 13938 |
| 506 | Ga0496102_0063425 | 3300048905 | Bacteria | 3383 |
| 507 | Ga0496102_0067819 | 3300048905 | Bacteria | 3272 |
| 508 | Ga0496102_0068035 | 3300048905 | Bacteria | 3267 |
| 509 | Ga0496102_0477487 | 3300048905 | Bacteria | 1168 |
| 510 | Ga0496103_0002131 | 3300048906 | Bacteria | 12593 |
| 511 | Ga0496103_0008761 | 3300048906 | Bacteria | 6003 |
| 512 | Ga0496103_0013007 | 3300048906 | Bacteria | 4935 |
| 513 | Ga0496103_0151918 | 3300048906 | Unclassified | 1483 |
| 514 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 515 | Ga0496104_0000752 | 3300048907 | Bacteria | 27722 |
| 516 | Ga0496104_0014659 | 3300048907 | Bacteria | 7081 |
| 517 | Ga0496104_0031478 | 3300048907 | Bacteria | 4934 |
| 518 | Ga0496104_0051027 | 3300048907 | Bacteria | 3903 |
| 519 | Ga0496104_0052621 | 3300048907 | Bacteria | 3846 |
| 520 | Ga0496104_0086397 | 3300048907 | Bacteria | 2994 |
| 521 | Ga0496104_0168054 | 3300048907 | Bacteria | 2103 |
| 522 | Ga0496104_0172503 | 3300048907 | Bacteria | 2073 |
| 523 | Ga0496105_0000117 | 3300048908 | Bacteria | 54274 |
| 524 | Ga0496105_0002320 | 3300048908 | Bacteria | 13792 |
| 525 | Ga0496105_0005325 | 3300048908 | Bacteria | 9752 |
| 526 | Ga0496105_0006248 | 3300048908 | Bacteria | 9146 |
| 527 | Ga0496105_0014702 | 3300048908 | Bacteria | 6231 |
| 528 | Ga0496105_0108000 | 3300048908 | Bacteria | 2297 |
| 529 | Ga0496105_0134819 | 3300048908 | Bacteria | 2034 |
| 530 | Ga0496106_0004715 | 3300048909 | Bacteria | 10098 |
| 531 | Ga0496106_0008815 | 3300048909 | Bacteria | 7453 |
| 532 | Ga0496106_0026081 | 3300048909 | Bacteria | 4348 |
| 533 | Ga0496106_0035073 | 3300048909 | Bacteria | 3749 |
| 534 | Ga0496106_0209791 | 3300048909 | Bacteria | 1551 |
| 535 | Ga0496106_0210161 | 3300048909 | Bacteria | 1550 |
| 536 | Ga0496107_0000720 | 3300048910 | Bacteria | 18897 |
| 537 | Ga0496107_0008852 | 3300048910 | Bacteria | 6975 |
| 538 | Ga0496107_0017184 | 3300048910 | Bacteria | 5088 |
| 539 | Ga0496107_0023923 | 3300048910 | Bacteria | 4318 |
| 540 | Ga0496108_0000891 | 3300048911 | Bacteria | 23254 |
| 541 | Ga0496108_0003501 | 3300048911 | Bacteria | 12578 |
| 542 | Ga0496108_0015288 | 3300048911 | Bacteria | 6262 |
| 543 | Ga0496108_0055899 | 3300048911 | Bacteria | 3315 |
| 544 | Ga0496108_0078044 | 3300048911 | Bacteria | 2802 |
| 545 | Ga0496108_0138171 | 3300048911 | Bacteria | 2098 |
| 546 | Ga0496108_0173282 | 3300048911 | Bacteria | 1867 |
| 547 | Ga0496108_0220907 | 3300048911 | Unclassified | 1646 |
| 548 | Ga0496109_0006120 | 3300048912 | Bacteria | 10109 |
| 549 | Ga0496109_0008433 | 3300048912 | Bacteria | 8761 |
| 550 | Ga0496109_0030269 | 3300048912 | Bacteria | 4852 |
| 551 | Ga0496109_0046584 | 3300048912 | Bacteria | 3939 |
| 552 | Ga0496109_0048466 | 3300048912 | Bacteria | 3865 |
| 553 | Ga0496109_0053713 | 3300048912 | Bacteria | 3675 |
| 554 | Ga0496110_0007317 | 3300048913 | Bacteria | 8809 |
| 555 | Ga0496110_0035722 | 3300048913 | Bacteria | 4313 |
| 556 | Ga0496110_0106175 | 3300048913 | Bacteria | 2519 |
| 557 | Ga0496110_0119747 | 3300048913 | Bacteria | 2371 |
| 558 | Ga0496110_0221156 | 3300048913 | Bacteria | 1722 |
| 559 | Ga0496110_0289123 | 3300048913 | Bacteria | 1493 |
| 560 | Ga0496110_0415687 | 3300048913 | Unclassified | 1226 |
| 561 | Ga0496111_0028921 | 3300048914 | Bacteria | 3930 |
| 562 | Ga0496111_0034708 | 3300048914 | Bacteria | 3602 |
| 563 | Ga0496111_0035491 | 3300048914 | Bacteria | 3564 |
| 564 | Ga0496111_0037809 | 3300048914 | Bacteria | 3455 |
| 565 | Ga0496111_0043022 | 3300048914 | Bacteria | 3245 |
| 566 | Ga0496111_0079856 | 3300048914 | Unclassified | 2387 |
| 567 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 568 | Ga0496112_0005389 | 3300048915 | Bacteria | 11055 |
| 569 | Ga0496112_0041726 | 3300048915 | Bacteria | 4489 |
| 570 | Ga0496112_0075456 | 3300048915 | Bacteria | 3334 |
| 571 | Ga0496112_0132695 | 3300048915 | Bacteria | 2461 |
| 572 | Ga0496112_0577319 | 3300048915 | Bacteria | 1057 |
| 573 | Ga0496113_0004051 | 3300048916 | Bacteria | 8924 |
| 574 | Ga0496113_0005750 | 3300048916 | Bacteria | 7771 |
| 575 | Ga0496113_0074246 | 3300048916 | Bacteria | 2592 |
| 576 | Ga0496114_0003448 | 3300048917 | Bacteria | 12128 |
| 577 | Ga0496114_0005405 | 3300048917 | Bacteria | 9989 |
| 578 | Ga0496115_0008004 | 3300048918 | Bacteria | 7801 |
| 579 | Ga0496115_0062789 | 3300048918 | Bacteria | 2997 |
| 580 | Ga0496115_0086780 | 3300048918 | Bacteria | 2553 |
| 581 | Ga0496115_0134294 | 3300048918 | Bacteria | 2040 |
| 582 | Ga0496115_0200779 | 3300048918 | Bacteria | 1647 |
| 583 | Ga0496115_0218905 | 3300048918 | Bacteria | 1571 |
| 584 | Ga0496118_0014568 | 3300048921 | Bacteria | 7352 |
| 585 | Ga0496118_0069456 | 3300048921 | Bacteria | 2551 |
| 586 | Ga0496119_0004887 | 3300048922 | Bacteria | 13119 |
| 587 | Ga0496120_0009660 | 3300048923 | Bacteria | 6809 |
| 588 | Ga0496120_0049508 | 3300048923 | Bacteria | 2411 |
| 589 | Ga0496122_0140989 | 3300048925 | Bacteria | 1508 |
| 590 | Ga0496123_0160392 | 3300048926 | Bacteria | 1200 |
| 591 | Ga0496124_0162654 | 3300048927 | Bacteria | 1738 |
| 592 | Ga0496125_0024010 | 3300048928 | Bacteria | 5616 |
| 593 | Ga0496126_0014981 | 3300048929 | Bacteria | 7817 |
| 594 | Ga0496126_0296208 | 3300048929 | Bacteria | 1336 |
| 595 | Ga0496126_0580731 | 3300048929 | Bacteria | 885 |
| 596 | Ga0495682_0006058 | 3300049460 | Bacteria | 4932 |
| 597 | Ga0495682_0007306 | 3300049460 | Unclassified | 4406 |
| 598 | Ga0501032_0027872 | 3300049569 | Bacteria | 3881 |
| 599 | Ga0501032_0037362 | 3300049569 | Bacteria | 3312 |
| 600 | Ga0501033_0011750 | 3300049570 | Bacteria | 6694 |
| 601 | Ga0501034_0019316 | 3300049571 | Bacteria | 6972 |
| 602 | Ga0501034_0285896 | 3300049571 | Bacteria | 1588 |
| 603 | Ga0501036_0021491 | 3300049572 | Bacteria | 5426 |
| 604 | Ga0501036_0023796 | 3300049572 | Bacteria | 5161 |
| 605 | Ga0501037_0010332 | 3300049573 | Bacteria | 6849 |
| 606 | Ga0501037_0012130 | 3300049573 | Bacteria | 6345 |
| 607 | Ga0501037_0211651 | 3300049573 | Bacteria | 1367 |
| 608 | Ga0501037_0318655 | 3300049573 | Bacteria | 1077 |
| 609 | Ga0501038_0004684 | 3300049574 | Bacteria | 12732 |
| 610 | Ga0501039_0015274 | 3300049575 | Bacteria | 5877 |
| 611 | Ga0501039_0101264 | 3300049575 | Bacteria | 2249 |
| 612 | Ga0501043_0005879 | 3300049579 | Bacteria | 9869 |
| 613 | Ga0501043_0011800 | 3300049579 | Bacteria | 6843 |
| 614 | Ga0501043_0014802 | 3300049579 | Bacteria | 6107 |
| 615 | Ga0501046_0017912 | 3300049580 | Bacteria | 5905 |
| 616 | Ga0501047_0014719 | 3300049581 | Bacteria | 7444 |
| 617 | Ga0501047_0034444 | 3300049581 | Bacteria | 4889 |
| 618 | Ga0501047_0038179 | 3300049581 | Bacteria | 4645 |
| 619 | Ga0501047_0297326 | 3300049581 | Bacteria | 1457 |
| 620 | Ga0501048_0000150 | 3300049582 | Bacteria | 42721 |
| 621 | Ga0501048_0387868 | 3300049582 | Bacteria | 998 |
| 622 | Ga0501069_0186035 | 3300049585 | Bacteria | 1201 |
| 623 | Ga0501073_0018817 | 3300049589 | Plasmid | 4991 |
| 624 | Ga0501073_0221349 | 3300049589 | Bacteria | 1307 |
| 625 | Ga0501074_0005366 | 3300049590 | Bacteria | 9220 |
| 626 | Ga0501074_0011824 | 3300049590 | Bacteria | 6345 |
| 627 | Ga0501079_0123415 | 3300049741 | Bacteria | 2014 |
| 628 | Ga0501079_0135218 | 3300049741 | Bacteria | 1919 |
| 629 | Ga0501080_0001372 | 3300049742 | Bacteria | 20366 |
| 630 | Ga0501080_0034245 | 3300049742 | Bacteria | 4740 |
| 631 | Ga0501080_0048863 | 3300049742 | Bacteria | 3936 |
| 632 | Ga0501083_0001836 | 3300049744 | Bacteria | 14565 |
| 633 | Ga0501044_0009883 | 3300049823 | Bacteria | 10367 |
| 634 | Ga0501044_0015498 | 3300049823 | Bacteria | 8209 |
| 635 | Ga0501044_0111194 | 3300049823 | Bacteria | 2747 |
| 636 | nmdc:mga03n38_24553_c1 | 3300050490 | Bacteria | 2466 |
| 637 | nmdc:mga00v17_187145_c1 | 3300050491 | Bacteria | 1336 |
| 638 | nmdc:mga00v17_40423_c1 | 3300050491 | Bacteria | 2797 |
| 639 | nmdc:mga00v17_59444_c1 | 3300050491 | Bacteria | 2345 |
| 640 | nmdc:mga0yw44_93964_c1 | 3300050492 | Bacteria | 1900 |
| 641 | nmdc:mga0k408_131123_c1 | 3300050493 | Bacteria | 1488 |
| 642 | nmdc:mga0k408_18525_c1 | 3300050493 | Bacteria | 3887 |
| 643 | nmdc:mga07m45_90422_c1 | 3300050496 | Bacteria | 1753 |
| 644 | nmdc:mga05p37_134737_c1 | 3300050507 | Bacteria | 3030 |
| 645 | nmdc:mga0sz30_29561_c1 | 3300050516 | Bacteria | 2260 |
| 646 | nmdc:mga0sz30_9181_c1 | 3300050516 | Bacteria | 3753 |
| 647 | Ga0495601_0000128 | 3300053077 | Bacteria | 42850 |
| 648 | Ga0495601_0009195 | 3300053077 | Bacteria | 5840 |
| 649 | Ga0495612_0000805 | 3300053078 | Bacteria | 12775 |
| 650 | Ga0495612_0167768 | 3300053078 | Unclassified | 960 |
| 651 | Ga0495595_0000530 | 3300053084 | Bacteria | 14567 |
| 652 | Ga0495595_0001258 | 3300053084 | Bacteria | 9871 |
| 653 | Ga0495595_0003450 | 3300053084 | Bacteria | 6271 |
| 654 | Ga0495595_0026333 | 3300053084 | Bacteria | 2583 |
| 655 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 656 | Ga0495619_0000252 | 3300053085 | Bacteria | 38976 |
| 657 | Ga0495619_0010019 | 3300053085 | Bacteria | 5966 |
| 658 | Ga0495619_0218978 | 3300053085 | Unclassified | 1318 |
| 659 | Ga0500578_0073949 | 3300053086 | Bacteria | 2171 |
| 660 | Ga0500578_0109409 | 3300053086 | Bacteria | 1743 |
| 661 | Ga0500578_0111147 | 3300053086 | Bacteria | 1727 |
| 662 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 663 | Ga0500643_010318 | 3300053087 | Bacteria | 3488 |
| 664 | Ga0500647_0028227 | 3300053091 | Bacteria | 2655 |
| 665 | Ga0500651_0073483 | 3300053093 | Bacteria | 2125 |
| 666 | Ga0500566_0001186 | 3300053094 | Bacteria | 15206 |
| 667 | Ga0500566_0050603 | 3300053094 | Bacteria | 2379 |
| 668 | Ga0500566_0087603 | 3300053094 | Bacteria | 1724 |
| 669 | Ga0500641_0001637 | 3300053096 | Bacteria | 7976 |
| 670 | Ga0500555_001537 | 3300053103 | Bacteria | 6987 |
| 671 | Ga0500556_0005901 | 3300053104 | Bacteria | 3468 |
| 672 | Ga0500557_000032 | 3300053105 | Bacteria | 74032 |
| 673 | Ga0500569_026105 | 3300053109 | Bacteria | 1597 |
| 674 | Ga0500572_004731 | 3300053111 | Bacteria | 3086 |
| 675 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 676 | Ga0500595_018269 | 3300053119 | Bacteria | 2568 |
| 677 | Ga0500607_043184 | 3300053121 | Bacteria | 2430 |
| 678 | Ga0500608_134211 | 3300053122 | Bacteria | 1106 |
| 679 | Ga0500642_0000197 | 3300053130 | Bacteria | 24598 |
| 680 | Ga0500652_008171 | 3300053131 | Bacteria | 3474 |
| 681 | Ga0500568_0005928 | 3300053139 | Bacteria | 6221 |
| 682 | Ga0500590_063181 | 3300053148 | Bacteria | 1856 |
| 683 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 684 | Ga0500616_0011058 | 3300053153 | Bacteria | 5365 |
| 685 | Ga0500622_0138946 | 3300053156 | Bacteria | 1160 |
| 686 | Ga0500633_0054663 | 3300053160 | Bacteria | 1388 |
| 687 | Ga0500634_0102332 | 3300053161 | Bacteria | 1431 |
| 688 | Ga0500638_008192 | 3300053162 | Bacteria | 4436 |
| 689 | Ga0500636_0000990 | 3300053177 | Bacteria | 15245 |
| 690 | Ga0500636_0068426 | 3300053177 | Bacteria | 2062 |
| 691 | Ga0500625_000321 | 3300053729 | Bacteria | 11953 |
| 692 | Ga0500625_057017 | 3300053729 | Bacteria | 1787 |
| 693 | Ga0500645_001000 | 3300053730 | Bacteria | 15943 |
| 694 | Ga0500645_027641 | 3300053730 | Bacteria | 1719 |
| 695 | Ga0500552_002992 | 3300053733 | Bacteria | 1686 |
| 696 | Ga0500599_000381 | 3300053736 | Bacteria | 4477 |
| 697 | Ga0500601_000352 | 3300053737 | Bacteria | 8389 |
| 698 | Ga0501084_0002310 | 3300054114 | Bacteria | 15306 |
| 699 | Ga0501084_0561228 | 3300054114 | Bacteria | 965 |
| 700 | Ga0500661_015418 | 3300055283 | Bacteria | 1370 |
| 701 | Ga0501082_0054942 | 3300060353 | Unclassified | 3432 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0123019 | Ga0495628_0123019_1222_1977 | 251 |
| 2 | 3300046660 | Ga0495625_0148643 | Ga0495625_0148643_808_1563 | 251 |
| 3 | 3300048918 | Ga0496115_0200779 | Ga0496115_0200779_870_1625 | 251 |
| 4 | iso_pu_bacteria | 8019687851 | 8019693261 | 252 |
| 5 | 3300046538 | Ga0495609_0190368 | Ga0495609_0190368_18_791 | 257 |
| 6 | 3300035692 | Ga0373935_0273463 | Ga0373935_0273463_32_814 | 260 |
| 7 | 3300046531 | Ga0495665_0091119 | Ga0495665_0091119_804_1586 | 260 |
| 8 | 3300010159 | Ga0099796_10001500 | Ga0099796_100015005 | 262 |
| 9 | 3300006175 | Ga0070712_100085185 | Ga0070712_1000851852 | 264 |
| 10 | 3300025915 | Ga0207693_10095712 | Ga0207693_100957123 | 264 |
| 11 | 3300010375 | Ga0105239_10005950 | Ga0105239_1000595011 | 265 |
| 12 | 3300049460 | Ga0495682_0007306 | Ga0495682_0007306_2899_3720 | 265 |
| 13 | iso_pu_bacteria | 2513237094 | 2513638297 | 266 |
| 14 | iso_pu_bacteria | 2885366525 | 2885367789 | 266 |
| 15 | iso_pu_bacteria | 2903727486 | 2903728368 | 266 |
| 16 | iso_pu_bacteria | 2941531003 | 2941534554 | 266 |
| 17 | 3300010159 | Ga0099796_10042873 | Ga0099796_100428732 | 269 |
| 18 | 3300046683 | Ga0495658_0006315 | Ga0495658_0006315_135_962 | 269 |
| 19 | 3300047321 | Ga0495676_0171043 | Ga0495676_0171043_610_1437 | 269 |
| 20 | 3300003215 | JGI25153J46596_10010090 | JGI25153J46596_100100905 | 270 |
| 21 | 3300003762 | Ga0055542_1014266 | Ga0055542_10142662 | 270 |
| 22 | 3300025261 | Ga0209233_1012581 | Ga0209233_10125811 | 270 |
| 23 | 3300025261 | Ga0209233_1025527 | Ga0209233_10255271 | 270 |
| 24 | 3300025272 | Ga0209455_1003830 | Ga0209455_10038306 | 270 |
| 25 | 3300025297 | Ga0209758_1003319 | Ga0209758_10033195 | 270 |
| 26 | 3300025911 | Ga0207654_10173298 | Ga0207654_101732982 | 270 |
| 27 | 3300039437 | Ga0436365_1830792 | Ga0436365_1830792_1303_2115 | 270 |
| 28 | 3300044658 | Ga0466972_0000053 | Ga0466972_0000053_31540_32352 | 270 |
| 29 | 3300044658 | Ga0466972_0033341 | Ga0466972_0033341_365_1177 | 270 |
| 30 | 3300044658 | Ga0466972_0062459 | Ga0466972_0062459_566_1378 | 270 |
| 31 | 3300044706 | Ga0466964_0029672 | Ga0466964_0029672_952_1764 | 270 |
| 32 | 3300044901 | Ga0466960_0000619 | Ga0466960_0000619_9091_9903 | 270 |
| 33 | 3300045049 | Ga0466959_0305499 | Ga0466959_0305499_137_949 | 270 |
| 34 | 3300045976 | Ga0466967_0257769 | Ga0466967_0257769_366_1178 | 270 |
| 35 | 3300046462 | Ga0495651_0051595 | Ga0495651_0051595_874_1686 | 270 |
| 36 | 3300046474 | Ga0495605_0178657 | Ga0495605_0178657_11_823 | 270 |
| 37 | 3300046476 | Ga0495662_0201297 | Ga0495662_0201297_62_874 | 270 |
| 38 | 3300046477 | Ga0495664_0161780 | Ga0495664_0161780_228_1040 | 270 |
| 39 | 3300046501 | Ga0495607_0048959 | Ga0495607_0048959_1133_1945 | 270 |
| 40 | 3300046516 | Ga0495628_0410221 | Ga0495628_0410221_129_941 | 270 |
| 41 | 3300046533 | Ga0495640_0014947 | Ga0495640_0014947_1314_2126 | 270 |
| 42 | 3300046538 | Ga0495609_0063355 | Ga0495609_0063355_387_1199 | 270 |
| 43 | 3300046557 | Ga0495622_0017584 | Ga0495622_0017584_989_1801 | 270 |
| 44 | 3300046616 | Ga0495668_0123871 | Ga0495668_0123871_407_1219 | 270 |
| 45 | 3300046642 | Ga0495634_0026468 | Ga0495634_0026468_1376_2188 | 270 |
| 46 | 3300046663 | Ga0495635_0031347 | Ga0495635_0031347_809_1621 | 270 |
| 47 | 3300046674 | Ga0495588_0063353 | Ga0495588_0063353_658_1470 | 270 |
| 48 | 3300046675 | Ga0495657_0074532 | Ga0495657_0074532_924_1736 | 270 |
| 49 | 3300046680 | Ga0495646_0141134 | Ga0495646_0141134_33_845 | 270 |
| 50 | 3300046692 | Ga0495671_0076426 | Ga0495671_0076426_219_1031 | 270 |
| 51 | 3300046694 | Ga0495649_0019620 | Ga0495649_0019620_524_1336 | 270 |
| 52 | 3300046694 | Ga0495649_0121082 | Ga0495649_0121082_470_1282 | 270 |
| 53 | 3300046809 | Ga0495600_0003758 | Ga0495600_0003758_4890_5702 | 270 |
| 54 | 3300047315 | Ga0495581_0053288 | Ga0495581_0053288_853_1665 | 270 |
| 55 | 3300047321 | Ga0495676_0290184 | Ga0495676_0290184_75_887 | 270 |
| 56 | 3300047323 | Ga0495683_0039989 | Ga0495683_0039989_631_1443 | 270 |
| 57 | 3300047469 | Ga0495673_0047501 | Ga0495673_0047501_72_884 | 270 |
| 58 | 3300048088 | Ga0495602_0092780 | Ga0495602_0092780_1498_2310 | 270 |
| 59 | 3300048905 | Ga0496102_0477487 | Ga0496102_0477487_95_928 | 270 |
| 60 | 3300048908 | Ga0496105_0006248 | Ga0496105_0006248_6139_6951 | 270 |
| 61 | 3300048909 | Ga0496106_0026081 | Ga0496106_0026081_1970_2803 | 270 |
| 62 | 3300048910 | Ga0496107_0000720 | Ga0496107_0000720_380_1213 | 270 |
| 63 | 3300048911 | Ga0496108_0000891 | Ga0496108_0000891_10437_11270 | 270 |
| 64 | 3300048912 | Ga0496109_0006120 | Ga0496109_0006120_8781_9614 | 270 |
| 65 | 3300048913 | Ga0496110_0035722 | Ga0496110_0035722_1888_2721 | 270 |
| 66 | 3300048914 | Ga0496111_0035491 | Ga0496111_0035491_157_990 | 270 |
| 67 | 3300048921 | Ga0496118_0069456 | Ga0496118_0069456_943_1755 | 270 |
| 68 | 3300048922 | Ga0496119_0004887 | Ga0496119_0004887_934_1746 | 270 |
| 69 | 3300048923 | Ga0496120_0009660 | Ga0496120_0009660_2483_3295 | 270 |
| 70 | 3300048929 | Ga0496126_0014981 | Ga0496126_0014981_757_1569 | 270 |
| 71 | 3300049460 | Ga0495682_0006058 | Ga0495682_0006058_884_1696 | 270 |
| 72 | 3300050491 | nmdc:mga00v17_40423_c1 | nmdc:mga00v17_40423_c1_722_1534 | 270 |
| 73 | 3300050496 | nmdc:mga07m45_90422_c1 | nmdc:mga07m45_90422_c1_193_1008 | 270 |
| 74 | 3300050507 | nmdc:mga05p37_134737_c1 | nmdc:mga05p37_134737_c1_1193_2005 | 270 |
| 75 | 3300050516 | nmdc:mga0sz30_29561_c1 | nmdc:mga0sz30_29561_c1_93_905 | 270 |
| 76 | 3300053086 | Ga0500578_0073949 | Ga0500578_0073949_707_1519 | 270 |
| 77 | 3300053086 | Ga0500578_0109409 | Ga0500578_0109409_511_1323 | 270 |
| 78 | 3300053094 | Ga0500566_0001186 | Ga0500566_0001186_8452_9264 | 270 |
| 79 | 3300053161 | Ga0500634_0102332 | Ga0500634_0102332_274_1086 | 270 |
| 80 | 3300053733 | Ga0500552_002992 | Ga0500552_002992_472_1284 | 270 |
| 81 | 3300005344 | Ga0070661_100014282 | Ga0070661_1000142826 | 271 |
| 82 | 3300005563 | Ga0068855_100000529 | Ga0068855_1000005299 | 271 |
| 83 | 3300005616 | Ga0068852_100003179 | Ga0068852_1000031794 | 271 |
| 84 | 3300009093 | Ga0105240_10000055 | Ga0105240_10000055202 | 271 |
| 85 | 3300009101 | Ga0105247_10031115 | Ga0105247_100311152 | 271 |
| 86 | 3300025900 | Ga0207710_10040573 | Ga0207710_100405731 | 271 |
| 87 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012135 | 271 |
| 88 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006530 | 271 |
| 89 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026259 | 271 |
| 90 | 3300026142 | Ga0207698_10009584 | Ga0207698_100095843 | 271 |
| 91 | 3300035116 | Ga0373945_0066159 | Ga0373945_0066159_167_982 | 271 |
| 92 | 3300035118 | Ga0373954_0084974 | Ga0373954_0084974_610_1425 | 271 |
| 93 | 3300037068 | Ga0373925_0001273 | Ga0373925_0001273_21037_21852 | 271 |
| 94 | 3300048088 | Ga0495602_0006975 | Ga0495602_0006975_10911_11726 | 271 |
| 95 | 3300054114 | Ga0501084_0002310 | Ga0501084_0002310_1486_2307 | 271 |
| 96 | iso_pu_bacteria | 2507262055 | 2507505958 | 271 |
| 97 | iso_pu_bacteria | 2508501009 | 2508540147 | 271 |
| 98 | iso_pu_bacteria | 2508501042 | 2508696221 | 271 |
| 99 | iso_pu_bacteria | 2511231028 | 2511394590 | 271 |
| 100 | iso_pu_bacteria | 2513237092 | 2513624866 | 271 |
| 101 | iso_pu_bacteria | 2513237095 | 2513649136 | 271 |
| 102 | iso_pu_bacteria | 2513237102 | 2513700202 | 271 |
| 103 | iso_pu_bacteria | 2513237139 | 2513877212 | 271 |
| 104 | iso_pu_bacteria | 2513237161 | 2514014581 | 271 |
| 105 | iso_pu_bacteria | 2517093001 | 2517103144 | 271 |
| 106 | iso_pu_bacteria | 2524023205 | 2524440803 | 271 |
| 107 | iso_pu_bacteria | 2617270735 | 2617347841 | 271 |
| 108 | iso_pu_bacteria | 2617270741 | 2617374763 | 271 |
| 109 | iso_pu_bacteria | 2643221547 | 2643758745 | 271 |
| 110 | iso_pu_bacteria | 2744054633 | 2745076044 | 271 |
| 111 | iso_pu_bacteria | 2791355196 | 2793061508 | 271 |
| 112 | iso_pu_bacteria | 2802429603 | 2805916188 | 271 |
| 113 | iso_pu_bacteria | 2816332527 | 2818240527 | 271 |
| 114 | iso_pu_bacteria | 2824600985 | 2824603662 | 271 |
| 115 | iso_pu_bacteria | 2824609381 | 2824610752 | 271 |
| 116 | iso_pu_bacteria | 2824617872 | 2824626200 | 271 |
| 117 | iso_pu_bacteria | 2824626560 | 2824632170 | 271 |
| 118 | iso_pu_bacteria | 2824635225 | 2824643427 | 271 |
| 119 | iso_pu_bacteria | 2824644064 | 2824651400 | 271 |
| 120 | iso_pu_bacteria | 2824671348 | 2824674042 | 271 |
| 121 | iso_pu_bacteria | 2824679649 | 2824686864 | 271 |
| 122 | iso_pu_bacteria | 2824687955 | 2824690708 | 271 |
| 123 | iso_pu_bacteria | 2824696289 | 2824699955 | 271 |
| 124 | iso_pu_bacteria | 2824704595 | 2824712787 | 271 |
| 125 | iso_pu_bacteria | 2824714736 | 2824721910 | 271 |
| 126 | iso_pu_bacteria | 2824723954 | 2824731731 | 271 |
| 127 | iso_pu_bacteria | 2824732956 | 2824739655 | 271 |
| 128 | iso_pu_bacteria | 2824746037 | 2824753467 | 271 |
| 129 | iso_pu_bacteria | 2824753945 | 2824763301 | 271 |
| 130 | iso_pu_bacteria | 2824763712 | 2824773172 | 271 |
| 131 | iso_pu_bacteria | 2824773399 | 2824776385 | 271 |
| 132 | iso_pu_bacteria | 2838122688 | 2838125051 | 271 |
| 133 | iso_pu_bacteria | 2841941048 | 2841945790 | 271 |
| 134 | iso_pu_bacteria | 2841949485 | 2841956889 | 271 |
| 135 | iso_pu_bacteria | 2841957949 | 2841963987 | 271 |
| 136 | iso_pu_bacteria | 2841966195 | 2841973551 | 271 |
| 137 | iso_pu_bacteria | 2841974524 | 2841981971 | 271 |
| 138 | iso_pu_bacteria | 2841983080 | 2841989439 | 271 |
| 139 | iso_pu_bacteria | 2842038055 | 2842044424 | 271 |
| 140 | iso_pu_bacteria | 2842045827 | 2842051587 | 271 |
| 141 | iso_pu_bacteria | 2844315083 | 2844316297 | 271 |
| 142 | iso_pu_bacteria | 2847930680 | 2847939400 | 271 |
| 143 | iso_pu_bacteria | 2847939898 | 2847941159 | 271 |
| 144 | iso_pu_bacteria | 2849076700 | 2849082148 | 271 |
| 145 | iso_pu_bacteria | 2874590934 | 2874596306 | 271 |
| 146 | iso_pu_bacteria | 2874612657 | 2874616493 | 271 |
| 147 | iso_pu_bacteria | 2874620515 | 2874622511 | 271 |
| 148 | iso_pu_bacteria | 2874628541 | 2874633419 | 271 |
| 149 | iso_pu_bacteria | 2874645413 | 2874650293 | 271 |
| 150 | iso_pu_bacteria | 2876761206 | 2876763702 | 271 |
| 151 | iso_pu_bacteria | 2876771140 | 2876776771 | 271 |
| 152 | iso_pu_bacteria | 2876818435 | 2876824561 | 271 |
| 153 | iso_pu_bacteria | 2879074833 | 2879080908 | 271 |
| 154 | iso_pu_bacteria | 2879083081 | 2879087073 | 271 |
| 155 | iso_pu_bacteria | 2879127579 | 2879133753 | 271 |
| 156 | iso_pu_bacteria | 2879142872 | 2879148255 | 271 |
| 157 | iso_pu_bacteria | 2881364244 | 2881369564 | 271 |
| 158 | iso_pu_bacteria | 2881665667 | 2881669719 | 271 |
| 159 | iso_pu_bacteria | 2885409591 | 2885418858 | 271 |
| 160 | iso_pu_bacteria | 2888378607 | 2888387204 | 271 |
| 161 | iso_pu_bacteria | 2888388044 | 2888389896 | 271 |
| 162 | iso_pu_bacteria | 2888419890 | 2888421214 | 271 |
| 163 | iso_pu_bacteria | 2904666416 | 2904671482 | 271 |
| 164 | iso_pu_bacteria | 2904711408 | 2904719778 | 271 |
| 165 | iso_pu_bacteria | 2906602504 | 2906606508 | 271 |
| 166 | iso_pu_bacteria | 2906626472 | 2906631398 | 271 |
| 167 | iso_pu_bacteria | 2906643746 | 2906646745 | 271 |
| 168 | iso_pu_bacteria | 2908775508 | 2908777244 | 271 |
| 169 | iso_pu_bacteria | 2922393267 | 2922398474 | 271 |
| 170 | iso_pu_bacteria | 2935608549 | 2935614383 | 271 |
| 171 | iso_pu_bacteria | 2935648319 | 2935649412 | 271 |
| 172 | iso_pu_bacteria | 2935656913 | 2935657816 | 271 |
| 173 | iso_pu_bacteria | 2935769743 | 2935770248 | 271 |
| 174 | iso_pu_bacteria | 2935777560 | 2935777724 | 271 |
| 175 | iso_pu_bacteria | 2935785616 | 2935786699 | 271 |
| 176 | iso_pu_bacteria | 2935793552 | 2935794753 | 271 |
| 177 | iso_pu_bacteria | 2935819856 | 2935826601 | 271 |
| 178 | iso_pu_bacteria | 2935847175 | 2935851105 | 271 |
| 179 | iso_pu_bacteria | 2935908558 | 2935913155 | 271 |
| 180 | iso_pu_bacteria | 2935916978 | 2935922577 | 271 |
| 181 | iso_pu_bacteria | 2935926038 | 2935930920 | 271 |
| 182 | iso_pu_bacteria | 2935934488 | 2935939746 | 271 |
| 183 | iso_pu_bacteria | 2935942939 | 2935946695 | 271 |
| 184 | iso_pu_bacteria | 2935951376 | 2935956104 | 271 |
| 185 | iso_pu_bacteria | 2935959822 | 2935965009 | 271 |
| 186 | iso_pu_bacteria | 2935967501 | 2935972897 | 271 |
| 187 | iso_pu_bacteria | 2935975950 | 2935978188 | 271 |
| 188 | iso_pu_bacteria | 2935984226 | 2935985688 | 271 |
| 189 | iso_pu_bacteria | 2936011229 | 2936012035 | 271 |
| 190 | iso_pu_bacteria | 2936019824 | 2936020884 | 271 |
| 191 | iso_pu_bacteria | 2936028420 | 2936029328 | 271 |
| 192 | iso_pu_bacteria | 2936046547 | 2936048348 | 271 |
| 193 | iso_pu_bacteria | 2936055302 | 2936056541 | 271 |
| 194 | iso_pu_bacteria | 3005483717 | 3005491106 | 271 |
| 195 | iso_pu_bacteria | 3005587118 | 3005592139 | 271 |
| 196 | iso_pu_bacteria | 3005710791 | 3005711846 | 271 |
| 197 | iso_pu_bacteria | 3005718088 | 3005719103 | 271 |
| 198 | iso_pu_bacteria | 8006926726 | 8006929746 | 271 |
| 199 | iso_pu_bacteria | 8016630954 | 8016634850 | 271 |
| 200 | iso_pu_bacteria | 8019538911 | 8019539620 | 271 |
| 201 | iso_pu_bacteria | 8019619141 | 8019621927 | 271 |
| 202 | iso_pu_bacteria | 8019638758 | 8019639219 | 271 |
| 203 | iso_pu_bacteria | 8019659431 | 8019668203 | 271 |
| 204 | iso_pu_bacteria | 8019668869 | 8019677663 | 271 |
| 205 | iso_pu_bacteria | 8019678201 | 8019687281 | 271 |
| 206 | 3300049573 | Ga0501037_0211651 | Ga0501037_0211651_448_1272 | 272 |
| 207 | 3300049581 | Ga0501047_0034444 | Ga0501047_0034444_1826_2650 | 272 |
| 208 | 3300049585 | Ga0501069_0186035 | Ga0501069_0186035_305_1129 | 272 |
| 209 | 3300049589 | Ga0501073_0018817 | Ga0501073_0018817_2046_2870 | 272 |
| 210 | 3300049590 | Ga0501074_0011824 | Ga0501074_0011824_2434_3258 | 272 |
| 211 | 3300049741 | Ga0501079_0135218 | Ga0501079_0135218_12_836 | 272 |
| 212 | 3300049742 | Ga0501080_0048863 | Ga0501080_0048863_2905_3729 | 272 |
| 213 | iso_pu_bacteria | 2932794094 | 2932796011 | 272 |
| 214 | iso_pu_bacteria | 2932801729 | 2932807589 | 272 |
| 215 | iso_pu_bacteria | 2935883170 | 2935887281 | 272 |
| 216 | iso_pu_bacteria | 3005506211 | 3005510947 | 272 |
| 217 | iso_pu_bacteria | 3005594810 | 3005595910 | 272 |
| 218 | iso_pu_bacteria | 8016522445 | 8016527017 | 272 |
| 219 | iso_pu_bacteria | 8016539877 | 8016545308 | 272 |
| 220 | iso_pu_bacteria | 8016548790 | 8016556781 | 272 |
| 221 | iso_pu_bacteria | 8016557553 | 8016565135 | 272 |
| 222 | iso_pu_bacteria | 8016566248 | 8016570391 | 272 |
| 223 | iso_pu_bacteria | 8016575299 | 8016582929 | 272 |
| 224 | iso_pu_bacteria | 8016595262 | 8016602782 | 272 |
| 225 | iso_pu_bacteria | 8016622563 | 8016624013 | 272 |
| 226 | iso_pu_bacteria | 8019530166 | 8019531914 | 272 |
| 227 | iso_pu_bacteria | 8019547302 | 8019551038 | 272 |
| 228 | iso_pu_bacteria | 8056967851 | 8056974118 | 272 |
| 229 | 3300005547 | Ga0070693_100147826 | Ga0070693_1001478262 | 273 |
| 230 | 3300049582 | Ga0501048_0387868 | Ga0501048_0387868_118_939 | 273 |
| 231 | 3300060353 | Ga0501082_0054942 | Ga0501082_0054942_955_1782 | 273 |
| 232 | 3300005548 | Ga0070665_100025939 | Ga0070665_1000259396 | 274 |
| 233 | 3300021384 | Ga0213876_10226350 | Ga0213876_102263502 | 274 |
| 234 | 3300028379 | Ga0268266_10227280 | Ga0268266_102272801 | 274 |
| 235 | 3300039437 | Ga0436365_0425385 | Ga0436365_0425385_959_1801 | 274 |
| 236 | 3300003203 | JGI25406J46586_10000012 | JGI25406J46586_1000001272 | 275 |
| 237 | 3300003215 | JGI25153J46596_10007570 | JGI25153J46596_100075706 | 275 |
| 238 | 3300003215 | JGI25153J46596_10007805 | JGI25153J46596_100078054 | 275 |
| 239 | 3300003215 | JGI25153J46596_10007905 | JGI25153J46596_100079056 | 275 |
| 240 | 3300003215 | JGI25153J46596_10011735 | JGI25153J46596_100117356 | 275 |
| 241 | 3300003354 | JGI25160J50197_1001523 | JGI25160J50197_10015238 | 275 |
| 242 | 3300003354 | JGI25160J50197_1004156 | JGI25160J50197_10041566 | 275 |
| 243 | 3300003794 | Ga0055531_10017206 | Ga0055531_100172062 | 275 |
| 244 | 3300004625 | Ga0055543_1001971 | Ga0055543_10019717 | 275 |
| 245 | 3300005262 | Ga0065165_1000982 | Ga0065165_100098229 | 275 |
| 246 | 3300005327 | Ga0070658_10051779 | Ga0070658_100517794 | 275 |
| 247 | 3300005327 | Ga0070658_10355352 | Ga0070658_103553521 | 275 |
| 248 | 3300005328 | Ga0070676_10124442 | Ga0070676_101244421 | 275 |
| 249 | 3300005329 | Ga0070683_100023299 | Ga0070683_1000232994 | 275 |
| 250 | 3300005331 | Ga0070670_100073764 | Ga0070670_1000737642 | 275 |
| 251 | 3300005334 | Ga0068869_100277754 | Ga0068869_1002777541 | 275 |
| 252 | 3300005335 | Ga0070666_10018342 | Ga0070666_100183423 | 275 |
| 253 | 3300005337 | Ga0070682_100203239 | Ga0070682_1002032391 | 275 |
| 254 | 3300005337 | Ga0070682_100351791 | Ga0070682_1003517911 | 275 |
| 255 | 3300005338 | Ga0068868_100054852 | Ga0068868_1000548521 | 275 |
| 256 | 3300005339 | Ga0070660_100023598 | Ga0070660_1000235984 | 275 |
| 257 | 3300005339 | Ga0070660_100165349 | Ga0070660_1001653492 | 275 |
| 258 | 3300005340 | Ga0070689_100023388 | Ga0070689_1000233884 | 275 |
| 259 | 3300005341 | Ga0070691_10023144 | Ga0070691_100231442 | 275 |
| 260 | 3300005344 | Ga0070661_100019861 | Ga0070661_1000198615 | 275 |
| 261 | 3300005347 | Ga0070668_100022443 | Ga0070668_1000224431 | 275 |
| 262 | 3300005355 | Ga0070671_100010055 | Ga0070671_1000100554 | 275 |
| 263 | 3300005355 | Ga0070671_100052016 | Ga0070671_1000520162 | 275 |
| 264 | 3300005355 | Ga0070671_100071962 | Ga0070671_1000719622 | 275 |
| 265 | 3300005356 | Ga0070674_100050376 | Ga0070674_1000503763 | 275 |
| 266 | 3300005366 | Ga0070659_100527099 | Ga0070659_1005270991 | 275 |
| 267 | 3300005367 | Ga0070667_100054855 | Ga0070667_1000548554 | 275 |
| 268 | 3300005367 | Ga0070667_100072840 | Ga0070667_1000728404 | 275 |
| 269 | 3300005367 | Ga0070667_100081303 | Ga0070667_1000813033 | 275 |
| 270 | 3300005434 | Ga0070709_10002216 | Ga0070709_100022164 | 275 |
| 271 | 3300005434 | Ga0070709_10018192 | Ga0070709_100181923 | 275 |
| 272 | 3300005434 | Ga0070709_10172765 | Ga0070709_101727651 | 275 |
| 273 | 3300005435 | Ga0070714_100060786 | Ga0070714_1000607863 | 275 |
| 274 | 3300005435 | Ga0070714_100074728 | Ga0070714_1000747285 | 275 |
| 275 | 3300005435 | Ga0070714_100365096 | Ga0070714_1003650962 | 275 |
| 276 | 3300005436 | Ga0070713_100005731 | Ga0070713_1000057313 | 275 |
| 277 | 3300005436 | Ga0070713_100013315 | Ga0070713_1000133151 | 275 |
| 278 | 3300005436 | Ga0070713_100056783 | Ga0070713_1000567832 | 275 |
| 279 | 3300005436 | Ga0070713_100251054 | Ga0070713_1002510542 | 275 |
| 280 | 3300005437 | Ga0070710_10002966 | Ga0070710_100029666 | 275 |
| 281 | 3300005437 | Ga0070710_10004257 | Ga0070710_100042572 | 275 |
| 282 | 3300005437 | Ga0070710_10209689 | Ga0070710_102096891 | 275 |
| 283 | 3300005438 | Ga0070701_10333594 | Ga0070701_103335941 | 275 |
| 284 | 3300005439 | Ga0070711_100012216 | Ga0070711_1000122164 | 275 |
| 285 | 3300005439 | Ga0070711_100017604 | Ga0070711_1000176045 | 275 |
| 286 | 3300005439 | Ga0070711_100029550 | Ga0070711_1000295504 | 275 |
| 287 | 3300005440 | Ga0070705_100050455 | Ga0070705_1000504552 | 275 |
| 288 | 3300005455 | Ga0070663_100010322 | Ga0070663_1000103221 | 275 |
| 289 | 3300005455 | Ga0070663_100065655 | Ga0070663_1000656551 | 275 |
| 290 | 3300005455 | Ga0070663_100165065 | Ga0070663_1001650652 | 275 |
| 291 | 3300005456 | Ga0070678_100005437 | Ga0070678_1000054375 | 275 |
| 292 | 3300005457 | Ga0070662_100050455 | Ga0070662_1000504554 | 275 |
| 293 | 3300005458 | Ga0070681_10029471 | Ga0070681_100294715 | 275 |
| 294 | 3300005466 | Ga0070685_10162524 | Ga0070685_101625241 | 275 |
| 295 | 3300005530 | Ga0070679_100025513 | Ga0070679_1000255136 | 275 |
| 296 | 3300005530 | Ga0070679_100043101 | Ga0070679_1000431012 | 275 |
| 297 | 3300005545 | Ga0070695_100033610 | Ga0070695_1000336103 | 275 |
| 298 | 3300005546 | Ga0070696_100036249 | Ga0070696_1000362495 | 275 |
| 299 | 3300005547 | Ga0070693_100026376 | Ga0070693_1000263764 | 275 |
| 300 | 3300005548 | Ga0070665_100056381 | Ga0070665_1000563816 | 275 |
| 301 | 3300005548 | Ga0070665_100056661 | Ga0070665_1000566614 | 275 |
| 302 | 3300005548 | Ga0070665_100172139 | Ga0070665_1001721391 | 275 |
| 303 | 3300005563 | Ga0068855_100153238 | Ga0068855_1001532384 | 275 |
| 304 | 3300005563 | Ga0068855_100166033 | Ga0068855_1001660333 | 275 |
| 305 | 3300005564 | Ga0070664_100047921 | Ga0070664_1000479214 | 275 |
| 306 | 3300005614 | Ga0068856_100172913 | Ga0068856_1001729132 | 275 |
| 307 | 3300005614 | Ga0068856_100452562 | Ga0068856_1004525622 | 275 |
| 308 | 3300005616 | Ga0068852_100042826 | Ga0068852_1000428264 | 275 |
| 309 | 3300005616 | Ga0068852_100070253 | Ga0068852_1000702534 | 275 |
| 310 | 3300005616 | Ga0068852_100186585 | Ga0068852_1001865851 | 275 |
| 311 | 3300005616 | Ga0068852_100366348 | Ga0068852_1003663483 | 275 |
| 312 | 3300005617 | Ga0068859_100064654 | Ga0068859_1000646541 | 275 |
| 313 | 3300005617 | Ga0068859_100310395 | Ga0068859_1003103952 | 275 |
| 314 | 3300005618 | Ga0068864_100033860 | Ga0068864_1000338602 | 275 |
| 315 | 3300005718 | Ga0068866_10088473 | Ga0068866_100884732 | 275 |
| 316 | 3300005841 | Ga0068863_100668632 | Ga0068863_1006686321 | 275 |
| 317 | 3300005842 | Ga0068858_100010777 | Ga0068858_1000107775 | 275 |
| 318 | 3300005842 | Ga0068858_100175259 | Ga0068858_1001752593 | 275 |
| 319 | 3300005843 | Ga0068860_100311057 | Ga0068860_1003110572 | 275 |
| 320 | 3300005937 | Ga0081455_10094575 | Ga0081455_100945754 | 275 |
| 321 | 3300005937 | Ga0081455_10146879 | Ga0081455_101468791 | 275 |
| 322 | 3300005983 | Ga0081540_1017703 | Ga0081540_10177031 | 275 |
| 323 | 3300005983 | Ga0081540_1035683 | Ga0081540_10356833 | 275 |
| 324 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040237 | 275 |
| 325 | 3300005985 | Ga0081539_10072807 | Ga0081539_100728072 | 275 |
| 326 | 3300006028 | Ga0070717_10129308 | Ga0070717_101293083 | 275 |
| 327 | 3300006028 | Ga0070717_10217624 | Ga0070717_102176241 | 275 |
| 328 | 3300006038 | Ga0075365_10125115 | Ga0075365_101251152 | 275 |
| 329 | 3300006042 | Ga0075368_10001274 | Ga0075368_100012748 | 275 |
| 330 | 3300006048 | Ga0075363_100006553 | Ga0075363_1000065536 | 275 |
| 331 | 3300006051 | Ga0075364_10023980 | Ga0075364_100239802 | 275 |
| 332 | 3300006051 | Ga0075364_10043149 | Ga0075364_100431494 | 275 |
| 333 | 3300006051 | Ga0075364_10280459 | Ga0075364_102804591 | 275 |
| 334 | 3300006163 | Ga0070715_10001099 | Ga0070715_100010996 | 275 |
| 335 | 3300006173 | Ga0070716_100002384 | Ga0070716_1000023845 | 275 |
| 336 | 3300006175 | Ga0070712_100391538 | Ga0070712_1003915381 | 275 |
| 337 | 3300006177 | Ga0075362_10152395 | Ga0075362_101523952 | 275 |
| 338 | 3300006178 | Ga0075367_10044362 | Ga0075367_100443623 | 275 |
| 339 | 3300006178 | Ga0075367_10049189 | Ga0075367_100491892 | 275 |
| 340 | 3300006178 | Ga0075367_10068495 | Ga0075367_100684953 | 275 |
| 341 | 3300006186 | Ga0075369_10024233 | Ga0075369_100242333 | 275 |
| 342 | 3300006186 | Ga0075369_10029318 | Ga0075369_100293184 | 275 |
| 343 | 3300006195 | Ga0075366_10015724 | Ga0075366_100157246 | 275 |
| 344 | 3300006195 | Ga0075366_10129673 | Ga0075366_101296732 | 275 |
| 345 | 3300006353 | Ga0075370_10008389 | Ga0075370_100083893 | 275 |
| 346 | 3300006353 | Ga0075370_10032778 | Ga0075370_100327782 | 275 |
| 347 | 3300006358 | Ga0068871_100006182 | Ga0068871_1000061825 | 275 |
| 348 | 3300006358 | Ga0068871_100042552 | Ga0068871_1000425525 | 275 |
| 349 | 3300006881 | Ga0068865_100005241 | Ga0068865_1000052417 | 275 |
| 350 | 3300006931 | Ga0097620_100064654 | Ga0097620_1000646541 | 275 |
| 351 | 3300006931 | Ga0097620_100310411 | Ga0097620_1003104112 | 275 |
| 352 | 3300006941 | Ga0099825_1029794 | Ga0099825_10297941 | 275 |
| 353 | 3300006944 | Ga0099823_1020508 | Ga0099823_10205086 | 275 |
| 354 | 3300009093 | Ga0105240_10017001 | Ga0105240_100170018 | 275 |
| 355 | 3300009094 | Ga0111539_10576076 | Ga0111539_105760761 | 275 |
| 356 | 3300009098 | Ga0105245_10004710 | Ga0105245_100047106 | 275 |
| 357 | 3300009098 | Ga0105245_10124194 | Ga0105245_101241941 | 275 |
| 358 | 3300009098 | Ga0105245_10303364 | Ga0105245_103033641 | 275 |
| 359 | 3300009098 | Ga0105245_10430067 | Ga0105245_104300672 | 275 |
| 360 | 3300009101 | Ga0105247_10007722 | Ga0105247_100077226 | 275 |
| 361 | 3300009101 | Ga0105247_10224032 | Ga0105247_102240322 | 275 |
| 362 | 3300009148 | Ga0105243_10233853 | Ga0105243_102338532 | 275 |
| 363 | 3300009148 | Ga0105243_10343188 | Ga0105243_103431882 | 275 |
| 364 | 3300009174 | Ga0105241_10027893 | Ga0105241_100278935 | 275 |
| 365 | 3300009174 | Ga0105241_10086932 | Ga0105241_100869323 | 275 |
| 366 | 3300009174 | Ga0105241_10088741 | Ga0105241_100887412 | 275 |
| 367 | 3300009174 | Ga0105241_10251588 | Ga0105241_102515881 | 275 |
| 368 | 3300009174 | Ga0105241_10301812 | Ga0105241_103018121 | 275 |
| 369 | 3300009176 | Ga0105242_10011410 | Ga0105242_100114105 | 275 |
| 370 | 3300009177 | Ga0105248_10024075 | Ga0105248_100240753 | 275 |
| 371 | 3300009177 | Ga0105248_10065542 | Ga0105248_100655424 | 275 |
| 372 | 3300009177 | Ga0105248_10082496 | Ga0105248_100824961 | 275 |
| 373 | 3300009545 | Ga0105237_10002118 | Ga0105237_1000211822 | 275 |
| 374 | 3300009545 | Ga0105237_10215947 | Ga0105237_102159474 | 275 |
| 375 | 3300009551 | Ga0105238_10040937 | Ga0105238_100409373 | 275 |
| 376 | 3300009551 | Ga0105238_10090489 | Ga0105238_100904895 | 275 |
| 377 | 3300009553 | Ga0105249_10162867 | Ga0105249_101628673 | 275 |
| 378 | 3300009553 | Ga0105249_10194043 | Ga0105249_101940432 | 275 |
| 379 | 3300009553 | Ga0105249_10408311 | Ga0105249_104083111 | 275 |
| 380 | 3300010375 | Ga0105239_10072128 | Ga0105239_100721285 | 275 |
| 381 | 3300010375 | Ga0105239_10239668 | Ga0105239_102396682 | 275 |
| 382 | 3300010375 | Ga0105239_10318649 | Ga0105239_103186492 | 275 |
| 383 | 3300010375 | Ga0105239_10380624 | Ga0105239_103806243 | 275 |
| 384 | 3300010375 | Ga0105239_10477333 | Ga0105239_104773331 | 275 |
| 385 | 3300010375 | Ga0105239_10866740 | Ga0105239_108667401 | 275 |
| 386 | 3300011119 | Ga0105246_10017246 | Ga0105246_100172463 | 275 |
| 387 | 3300011119 | Ga0105246_10046711 | Ga0105246_100467112 | 275 |
| 388 | 3300011119 | Ga0105246_10088768 | Ga0105246_100887682 | 275 |
| 389 | 3300011119 | Ga0105246_10322327 | Ga0105246_103223271 | 275 |
| 390 | 3300013100 | Ga0157373_10054547 | Ga0157373_100545472 | 275 |
| 391 | 3300013102 | Ga0157371_10143059 | Ga0157371_101430593 | 275 |
| 392 | 3300013104 | Ga0157370_10079150 | Ga0157370_100791503 | 275 |
| 393 | 3300013104 | Ga0157370_10268253 | Ga0157370_102682533 | 275 |
| 394 | 3300013105 | Ga0157369_10413268 | Ga0157369_104132682 | 275 |
| 395 | 3300013296 | Ga0157374_10008513 | Ga0157374_100085136 | 275 |
| 396 | 3300013296 | Ga0157374_10014838 | Ga0157374_100148384 | 275 |
| 397 | 3300013296 | Ga0157374_10050674 | Ga0157374_100506745 | 275 |
| 398 | 3300013297 | Ga0157378_10005396 | Ga0157378_100053968 | 275 |
| 399 | 3300013297 | Ga0157378_10445721 | Ga0157378_104457211 | 275 |
| 400 | 3300013306 | Ga0163162_10009085 | Ga0163162_1000908510 | 275 |
| 401 | 3300013306 | Ga0163162_10087474 | Ga0163162_100874743 | 275 |
| 402 | 3300013307 | Ga0157372_10340073 | Ga0157372_103400731 | 275 |
| 403 | 3300013308 | Ga0157375_10012326 | Ga0157375_100123264 | 275 |
| 404 | 3300014325 | Ga0163163_10018613 | Ga0163163_100186135 | 275 |
| 405 | 3300014325 | Ga0163163_10024935 | Ga0163163_100249352 | 275 |
| 406 | 3300014325 | Ga0163163_10520379 | Ga0163163_105203791 | 275 |
| 407 | 3300014968 | Ga0157379_10008660 | Ga0157379_100086604 | 275 |
| 408 | 3300014968 | Ga0157379_10018738 | Ga0157379_100187383 | 275 |
| 409 | 3300014968 | Ga0157379_10024715 | Ga0157379_100247156 | 275 |
| 410 | 3300014968 | Ga0157379_10061174 | Ga0157379_100611745 | 275 |
| 411 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011143 | 275 |
| 412 | 3300021321 | Ga0214542_1000009 | Ga0214542_100000999 | 275 |
| 413 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007143 | 275 |
| 414 | 3300021327 | Ga0214543_1000020 | Ga0214543_100002099 | 275 |
| 415 | 3300021384 | Ga0213876_10100658 | Ga0213876_101006582 | 275 |
| 416 | 3300021388 | Ga0213875_10000011 | Ga0213875_10000011199 | 275 |
| 417 | 3300025230 | Ga0209563_101805 | Ga0209563_1018056 | 275 |
| 418 | 3300025253 | Ga0209677_100400 | Ga0209677_10040014 | 275 |
| 419 | 3300025254 | Ga0209148_1000321 | Ga0209148_100032146 | 275 |
| 420 | 3300025261 | Ga0209233_1001172 | Ga0209233_10011727 | 275 |
| 421 | 3300025295 | Ga0209564_1008083 | Ga0209564_10080834 | 275 |
| 422 | 3300025297 | Ga0209758_1000206 | Ga0209758_100020632 | 275 |
| 423 | 3300025297 | Ga0209758_1000536 | Ga0209758_100053630 | 275 |
| 424 | 3300025297 | Ga0209758_1001992 | Ga0209758_100199219 | 275 |
| 425 | 3300025297 | Ga0209758_1002275 | Ga0209758_10022757 | 275 |
| 426 | 3300025297 | Ga0209758_1038606 | Ga0209758_10386062 | 275 |
| 427 | 3300025297 | Ga0209758_1039740 | Ga0209758_10397403 | 275 |
| 428 | 3300025299 | Ga0209256_1004643 | Ga0209256_10046438 | 275 |
| 429 | 3300025299 | Ga0209256_1010195 | Ga0209256_10101955 | 275 |
| 430 | 3300025299 | Ga0209256_1049727 | Ga0209256_10497271 | 275 |
| 431 | 3300025302 | Ga0207426_1002091 | Ga0207426_10020917 | 275 |
| 432 | 3300025302 | Ga0207426_1002585 | Ga0207426_10025858 | 275 |
| 433 | 3300025302 | Ga0207426_1013422 | Ga0207426_10134224 | 275 |
| 434 | 3300025302 | Ga0207426_1015065 | Ga0207426_10150655 | 275 |
| 435 | 3300025303 | Ga0209051_1060403 | Ga0209051_10604032 | 275 |
| 436 | 3300025304 | Ga0209257_1000394 | Ga0209257_100039432 | 275 |
| 437 | 3300025304 | Ga0209257_1020044 | Ga0209257_10200444 | 275 |
| 438 | 3300025898 | Ga0207692_10031295 | Ga0207692_100312953 | 275 |
| 439 | 3300025898 | Ga0207692_10035710 | Ga0207692_100357102 | 275 |
| 440 | 3300025899 | Ga0207642_10070761 | Ga0207642_100707612 | 275 |
| 441 | 3300025900 | Ga0207710_10013015 | Ga0207710_100130151 | 275 |
| 442 | 3300025900 | Ga0207710_10037135 | Ga0207710_100371352 | 275 |
| 443 | 3300025903 | Ga0207680_10018562 | Ga0207680_100185623 | 275 |
| 444 | 3300025904 | Ga0207647_10005715 | Ga0207647_100057156 | 275 |
| 445 | 3300025906 | Ga0207699_10002176 | Ga0207699_100021762 | 275 |
| 446 | 3300025906 | Ga0207699_10058038 | Ga0207699_100580381 | 275 |
| 447 | 3300025906 | Ga0207699_10104794 | Ga0207699_101047942 | 275 |
| 448 | 3300025906 | Ga0207699_10318871 | Ga0207699_103188711 | 275 |
| 449 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006610 | 275 |
| 450 | 3300025914 | Ga0207671_10008630 | Ga0207671_100086302 | 275 |
| 451 | 3300025914 | Ga0207671_10169508 | Ga0207671_101695082 | 275 |
| 452 | 3300025915 | Ga0207693_10049568 | Ga0207693_100495683 | 275 |
| 453 | 3300025915 | Ga0207693_10183752 | Ga0207693_101837521 | 275 |
| 454 | 3300025916 | Ga0207663_10002864 | Ga0207663_100028646 | 275 |
| 455 | 3300025916 | Ga0207663_10033820 | Ga0207663_100338202 | 275 |
| 456 | 3300025916 | Ga0207663_10073295 | Ga0207663_100732952 | 275 |
| 457 | 3300025916 | Ga0207663_10216236 | Ga0207663_102162361 | 275 |
| 458 | 3300025919 | Ga0207657_10044394 | Ga0207657_100443944 | 275 |
| 459 | 3300025919 | Ga0207657_10114072 | Ga0207657_101140724 | 275 |
| 460 | 3300025920 | Ga0207649_10045682 | Ga0207649_100456822 | 275 |
| 461 | 3300025922 | Ga0207646_10510068 | Ga0207646_105100681 | 275 |
| 462 | 3300025925 | Ga0207650_10100767 | Ga0207650_101007671 | 275 |
| 463 | 3300025927 | Ga0207687_10016247 | Ga0207687_100162474 | 275 |
| 464 | 3300025927 | Ga0207687_10099471 | Ga0207687_100994711 | 275 |
| 465 | 3300025927 | Ga0207687_10211882 | Ga0207687_102118822 | 275 |
| 466 | 3300025928 | Ga0207700_10190827 | Ga0207700_101908271 | 275 |
| 467 | 3300025928 | Ga0207700_10288539 | Ga0207700_102885392 | 275 |
| 468 | 3300025929 | Ga0207664_10030862 | Ga0207664_100308622 | 275 |
| 469 | 3300025931 | Ga0207644_10020007 | Ga0207644_100200074 | 275 |
| 470 | 3300025931 | Ga0207644_10232097 | Ga0207644_102320971 | 275 |
| 471 | 3300025933 | Ga0207706_10025262 | Ga0207706_100252622 | 275 |
| 472 | 3300025934 | Ga0207686_10041573 | Ga0207686_100415733 | 275 |
| 473 | 3300025938 | Ga0207704_10003803 | Ga0207704_100038036 | 275 |
| 474 | 3300025938 | Ga0207704_10076977 | Ga0207704_100769772 | 275 |
| 475 | 3300025939 | Ga0207665_10005428 | Ga0207665_100054285 | 275 |
| 476 | 3300025939 | Ga0207665_10008613 | Ga0207665_100086137 | 275 |
| 477 | 3300025939 | Ga0207665_10053964 | Ga0207665_100539642 | 275 |
| 478 | 3300025941 | Ga0207711_10003089 | Ga0207711_1000308911 | 275 |
| 479 | 3300025941 | Ga0207711_10033717 | Ga0207711_100337172 | 275 |
| 480 | 3300025941 | Ga0207711_10239515 | Ga0207711_102395151 | 275 |
| 481 | 3300025941 | Ga0207711_10725017 | Ga0207711_107250171 | 275 |
| 482 | 3300025944 | Ga0207661_10015446 | Ga0207661_100154464 | 275 |
| 483 | 3300025945 | Ga0207679_10005027 | Ga0207679_1000502710 | 275 |
| 484 | 3300025949 | Ga0207667_10071501 | Ga0207667_100715015 | 275 |
| 485 | 3300025949 | Ga0207667_10387207 | Ga0207667_103872071 | 275 |
| 486 | 3300025961 | Ga0207712_10230589 | Ga0207712_102305892 | 275 |
| 487 | 3300025972 | Ga0207668_10169373 | Ga0207668_101693732 | 275 |
| 488 | 3300025981 | Ga0207640_10114731 | Ga0207640_101147311 | 275 |
| 489 | 3300025986 | Ga0207658_10231159 | Ga0207658_102311591 | 275 |
| 490 | 3300026023 | Ga0207677_10034827 | Ga0207677_100348274 | 275 |
| 491 | 3300026035 | Ga0207703_10043250 | Ga0207703_100432502 | 275 |
| 492 | 3300026035 | Ga0207703_10110278 | Ga0207703_101102782 | 275 |
| 493 | 3300026035 | Ga0207703_10222676 | Ga0207703_102226762 | 275 |
| 494 | 3300026041 | Ga0207639_10250476 | Ga0207639_102504761 | 275 |
| 495 | 3300026067 | Ga0207678_10122456 | Ga0207678_101224562 | 275 |
| 496 | 3300026067 | Ga0207678_10314662 | Ga0207678_103146621 | 275 |
| 497 | 3300026067 | Ga0207678_10347639 | Ga0207678_103476392 | 275 |
| 498 | 3300026078 | Ga0207702_10101662 | Ga0207702_101016622 | 275 |
| 499 | 3300026078 | Ga0207702_10215133 | Ga0207702_102151332 | 275 |
| 500 | 3300026078 | Ga0207702_10224154 | Ga0207702_102241542 | 275 |
| 501 | 3300026078 | Ga0207702_10369251 | Ga0207702_103692511 | 275 |
| 502 | 3300026088 | Ga0207641_10229996 | Ga0207641_102299962 | 275 |
| 503 | 3300026089 | Ga0207648_10049805 | Ga0207648_100498053 | 275 |
| 504 | 3300026095 | Ga0207676_10162185 | Ga0207676_101621851 | 275 |
| 505 | 3300026116 | Ga0207674_10055792 | Ga0207674_100557922 | 275 |
| 506 | 3300026116 | Ga0207674_10070190 | Ga0207674_100701904 | 275 |
| 507 | 3300026121 | Ga0207683_10032293 | Ga0207683_100322935 | 275 |
| 508 | 3300026142 | Ga0207698_10005418 | Ga0207698_100054186 | 275 |
| 509 | 3300027296 | Ga0209389_1000039 | Ga0209389_100003988 | 275 |
| 510 | 3300027361 | Ga0209489_100087 | Ga0209489_10008788 | 275 |
| 511 | 3300027363 | Ga0209700_100090 | Ga0209700_10009028 | 275 |
| 512 | 3300027671 | Ga0209588_1014000 | Ga0209588_10140004 | 275 |
| 513 | 3300028379 | Ga0268266_10004873 | Ga0268266_1000487310 | 275 |
| 514 | 3300028379 | Ga0268266_10021144 | Ga0268266_100211446 | 275 |
| 515 | 3300028379 | Ga0268266_10069109 | Ga0268266_100691092 | 275 |
| 516 | 3300028380 | Ga0268265_10233231 | Ga0268265_102332312 | 275 |
| 517 | 3300028381 | Ga0268264_10249844 | Ga0268264_102498442 | 275 |
| 518 | 3300030521 | Ga0307511_10067940 | Ga0307511_100679402 | 275 |
| 519 | 3300031241 | Ga0265325_10000398 | Ga0265325_100003987 | 275 |
| 520 | 3300031241 | Ga0265325_10025536 | Ga0265325_100255366 | 275 |
| 521 | 3300031241 | Ga0265325_10041188 | Ga0265325_100411884 | 275 |
| 522 | 3300031344 | Ga0265316_10054306 | Ga0265316_100543061 | 275 |
| 523 | 3300031595 | Ga0265313_10011516 | Ga0265313_100115167 | 275 |
| 524 | 3300031595 | Ga0265313_10029312 | Ga0265313_100293121 | 275 |
| 525 | 3300031711 | Ga0265314_10000439 | Ga0265314_100004399 | 275 |
| 526 | 3300031712 | Ga0265342_10000882 | Ga0265342_1000088227 | 275 |
| 527 | 3300031730 | Ga0307516_10007612 | Ga0307516_100076128 | 275 |
| 528 | 3300031730 | Ga0307516_10008613 | Ga0307516_100086132 | 275 |
| 529 | 3300031730 | Ga0307516_10021682 | Ga0307516_100216821 | 275 |
| 530 | 3300031995 | Ga0307409_100503362 | Ga0307409_1005033621 | 275 |
| 531 | 3300033179 | Ga0307507_10154980 | Ga0307507_101549802 | 275 |
| 532 | 3300033180 | Ga0307510_10024382 | Ga0307510_100243827 | 275 |
| 533 | 3300033180 | Ga0307510_10028911 | Ga0307510_100289116 | 275 |
| 534 | 3300035111 | Ga0373923_0020877 | Ga0373923_0020877_1108_1935 | 275 |
| 535 | 3300035115 | Ga0373941_0000525 | Ga0373941_0000525_3369_4196 | 275 |
| 536 | 3300035118 | Ga0373954_0002960 | Ga0373954_0002960_1734_2561 | 275 |
| 537 | 3300035119 | Ga0373956_0011394 | Ga0373956_0011394_1825_2652 | 275 |
| 538 | 3300035119 | Ga0373956_0050147 | Ga0373956_0050147_490_1317 | 275 |
| 539 | 3300035120 | Ga0373957_0011249 | Ga0373957_0011249_812_1639 | 275 |
| 540 | 3300035171 | Ga0373946_0073401 | Ga0373946_0073401_426_1253 | 275 |
| 541 | 3300035172 | Ga0373955_0004355 | Ga0373955_0004355_2783_3610 | 275 |
| 542 | 3300035172 | Ga0373955_0007183 | Ga0373955_0007183_1038_1865 | 275 |
| 543 | 3300035410 | Ga0373924_0011648 | Ga0373924_0011648_2380_3207 | 275 |
| 544 | 3300035410 | Ga0373924_0075560 | Ga0373924_0075560_22_858 | 275 |
| 545 | 3300035691 | Ga0373931_0145767 | Ga0373931_0145767_464_1291 | 275 |
| 546 | 3300035695 | Ga0373927_0065680 | Ga0373927_0065680_933_1760 | 275 |
| 547 | 3300035695 | Ga0373927_0352950 | Ga0373927_0352950_110_937 | 275 |
| 548 | 3300035724 | Ga0373933_0006532 | Ga0373933_0006532_1560_2387 | 275 |
| 549 | 3300035724 | Ga0373933_0028937 | Ga0373933_0028937_224_1051 | 275 |
| 550 | 3300035724 | Ga0373933_0054315 | Ga0373933_0054315_1518_2345 | 275 |
| 551 | 3300035724 | Ga0373933_0197899 | Ga0373933_0197899_195_1022 | 275 |
| 552 | 3300035725 | Ga0373947_0228352 | Ga0373947_0228352_296_1123 | 275 |
| 553 | 3300036401 | Ga0373937_0004592 | Ga0373937_0004592_10286_11113 | 275 |
| 554 | 3300036401 | Ga0373937_0005159 | Ga0373937_0005159_9025_9852 | 275 |
| 555 | 3300036401 | Ga0373937_0021587 | Ga0373937_0021587_3108_3935 | 275 |
| 556 | 3300036401 | Ga0373937_0031801 | Ga0373937_0031801_3307_4134 | 275 |
| 557 | 3300036401 | Ga0373937_0388096 | Ga0373937_0388096_120_947 | 275 |
| 558 | 3300037068 | Ga0373925_0144421 | Ga0373925_0144421_896_1723 | 275 |
| 559 | 3300037312 | Ga0395899_0028090 | Ga0395899_0028090_2744_3574 | 275 |
| 560 | 3300037418 | Ga0395900_0003044 | Ga0395900_0003044_13119_13949 | 275 |
| 561 | 3300037418 | Ga0395900_0268887 | Ga0395900_0268887_136_963 | 275 |
| 562 | 3300037466 | Ga0395898_0009793 | Ga0395898_0009793_5305_6135 | 275 |
| 563 | 3300037466 | Ga0395898_0173849 | Ga0395898_0173849_1152_1979 | 275 |
| 564 | 3300037471 | Ga0395905_0001273 | Ga0395905_0001273_19866_20693 | 275 |
| 565 | 3300037471 | Ga0395905_0018089 | Ga0395905_0018089_1756_2583 | 275 |
| 566 | 3300037853 | Ga0436364_0015606 | Ga0436364_0015606_1419_2249 | 275 |
| 567 | 3300037853 | Ga0436364_0604898 | Ga0436364_0604898_547_1389 | 275 |
| 568 | 3300037853 | Ga0436364_0728139 | Ga0436364_0728139_57261_58091 | 275 |
| 569 | 3300038443 | Ga0395901_0295504 | Ga0395901_0295504_280_1110 | 275 |
| 570 | 3300039438 | Ga0436360_0310474 | Ga0436360_0310474_542_1375 | 275 |
| 571 | 3300041452 | Ga0451793_1684190 | Ga0451793_1684190_237_1064 | 275 |
| 572 | 3300041453 | Ga0451797_1288970 | Ga0451797_1288970_482_1309 | 275 |
| 573 | 3300041460 | Ga0451802_0495993 | Ga0451802_0495993_30_857 | 275 |
| 574 | 3300041512 | Ga0451853_2299509 | Ga0451853_2299509_100_927 | 275 |
| 575 | 3300044684 | Ga0466966_0000322 | Ga0466966_0000322_4349_5179 | 275 |
| 576 | 3300044693 | Ga0466961_0002390 | Ga0466961_0002390_6046_6876 | 275 |
| 577 | 3300044693 | Ga0466961_0126373 | Ga0466961_0126373_249_1079 | 275 |
| 578 | 3300044694 | Ga0466963_0005897 | Ga0466963_0005897_3054_3884 | 275 |
| 579 | 3300044706 | Ga0466964_0071745 | Ga0466964_0071745_71_901 | 275 |
| 580 | 3300044765 | Ga0466970_0143407 | Ga0466970_0143407_130_960 | 275 |
| 581 | 3300044842 | Ga0466957_0027315 | Ga0466957_0027315_2071_2901 | 275 |
| 582 | 3300045976 | Ga0466967_0048518 | Ga0466967_0048518_599_1435 | 275 |
| 583 | 3300045976 | Ga0466967_0090301 | Ga0466967_0090301_1290_2120 | 275 |
| 584 | 3300046460 | Ga0495638_0005066 | Ga0495638_0005066_3312_4139 | 275 |
| 585 | 3300046462 | Ga0495651_0005183 | Ga0495651_0005183_6817_7644 | 275 |
| 586 | 3300046462 | Ga0495651_0047894 | Ga0495651_0047894_1311_2141 | 275 |
| 587 | 3300046462 | Ga0495651_0058218 | Ga0495651_0058218_236_1063 | 275 |
| 588 | 3300046463 | Ga0495653_0005744 | Ga0495653_0005744_9073_9900 | 275 |
| 589 | 3300046476 | Ga0495662_0016908 | Ga0495662_0016908_2014_2841 | 275 |
| 590 | 3300046477 | Ga0495664_0003461 | Ga0495664_0003461_2032_2859 | 275 |
| 591 | 3300046477 | Ga0495664_0037276 | Ga0495664_0037276_609_1439 | 275 |
| 592 | 3300046499 | Ga0495594_0145242 | Ga0495594_0145242_56_883 | 275 |
| 593 | 3300046507 | Ga0495606_0007723 | Ga0495606_0007723_2623_3450 | 275 |
| 594 | 3300046507 | Ga0495606_0080074 | Ga0495606_0080074_214_1041 | 275 |
| 595 | 3300046507 | Ga0495606_0227218 | Ga0495606_0227218_147_974 | 275 |
| 596 | 3300046511 | Ga0495608_0004462 | Ga0495608_0004462_204_1031 | 275 |
| 597 | 3300046511 | Ga0495608_0027747 | Ga0495608_0027747_1772_2599 | 275 |
| 598 | 3300046511 | Ga0495608_0062915 | Ga0495608_0062915_78_905 | 275 |
| 599 | 3300046512 | Ga0495610_0082047 | Ga0495610_0082047_284_1111 | 275 |
| 600 | 3300046515 | Ga0495620_0064869 | Ga0495620_0064869_445_1272 | 275 |
| 601 | 3300046516 | Ga0495628_0001465 | Ga0495628_0001465_5161_5988 | 275 |
| 602 | 3300046516 | Ga0495628_0009727 | Ga0495628_0009727_2534_3361 | 275 |
| 603 | 3300046516 | Ga0495628_0099864 | Ga0495628_0099864_127_954 | 275 |
| 604 | 3300046517 | Ga0495630_0185612 | Ga0495630_0185612_41_868 | 275 |
| 605 | 3300046517 | Ga0495630_0382709 | Ga0495630_0382709_107_934 | 275 |
| 606 | 3300046529 | Ga0495652_0002359 | Ga0495652_0002359_3214_4041 | 275 |
| 607 | 3300046529 | Ga0495652_0114375 | Ga0495652_0114375_515_1342 | 275 |
| 608 | 3300046529 | Ga0495652_0342689 | Ga0495652_0342689_180_1007 | 275 |
| 609 | 3300046533 | Ga0495640_0013003 | Ga0495640_0013003_741_1568 | 275 |
| 610 | 3300046533 | Ga0495640_0049154 | Ga0495640_0049154_1216_2046 | 275 |
| 611 | 3300046535 | Ga0495586_0006236 | Ga0495586_0006236_3618_4445 | 275 |
| 612 | 3300046536 | Ga0495587_0007520 | Ga0495587_0007520_886_1713 | 275 |
| 613 | 3300046543 | Ga0495645_0004750 | Ga0495645_0004750_8255_9082 | 275 |
| 614 | 3300046543 | Ga0495645_0009901 | Ga0495645_0009901_4152_4979 | 275 |
| 615 | 3300046543 | Ga0495645_0054130 | Ga0495645_0054130_146_976 | 275 |
| 616 | 3300046559 | Ga0495667_0004513 | Ga0495667_0004513_7258_8088 | 275 |
| 617 | 3300046559 | Ga0495667_0059836 | Ga0495667_0059836_322_1149 | 275 |
| 618 | 3300046559 | Ga0495667_0298367 | Ga0495667_0298367_11_838 | 275 |
| 619 | 3300046616 | Ga0495668_0013172 | Ga0495668_0013172_666_1493 | 275 |
| 620 | 3300046642 | Ga0495634_0047344 | Ga0495634_0047344_1869_2696 | 275 |
| 621 | 3300046663 | Ga0495635_0009985 | Ga0495635_0009985_777_1604 | 275 |
| 622 | 3300046663 | Ga0495635_0064254 | Ga0495635_0064254_1604_2431 | 275 |
| 623 | 3300046663 | Ga0495635_0082487 | Ga0495635_0082487_1201_2028 | 275 |
| 624 | 3300046663 | Ga0495635_0175425 | Ga0495635_0175425_425_1252 | 275 |
| 625 | 3300046675 | Ga0495657_0002195 | Ga0495657_0002195_613_1440 | 275 |
| 626 | 3300046675 | Ga0495657_0013992 | Ga0495657_0013992_732_1562 | 275 |
| 627 | 3300046675 | Ga0495657_0027589 | Ga0495657_0027589_2842_3669 | 275 |
| 628 | 3300046678 | Ga0495599_0001128 | Ga0495599_0001128_8648_9475 | 275 |
| 629 | 3300046678 | Ga0495599_0002972 | Ga0495599_0002972_8437_9264 | 275 |
| 630 | 3300046679 | Ga0495623_0000278 | Ga0495623_0000278_12861_13688 | 275 |
| 631 | 3300046679 | Ga0495623_0025668 | Ga0495623_0025668_1660_2487 | 275 |
| 632 | 3300046679 | Ga0495623_0083070 | Ga0495623_0083070_704_1531 | 275 |
| 633 | 3300046683 | Ga0495658_0116962 | Ga0495658_0116962_411_1238 | 275 |
| 634 | 3300046694 | Ga0495649_0084200 | Ga0495649_0084200_16_843 | 275 |
| 635 | 3300046809 | Ga0495600_0033460 | Ga0495600_0033460_1175_2005 | 275 |
| 636 | 3300046809 | Ga0495600_0088082 | Ga0495600_0088082_143_970 | 275 |
| 637 | 3300046810 | Ga0495660_0045805 | Ga0495660_0045805_774_1601 | 275 |
| 638 | 3300047315 | Ga0495581_0016603 | Ga0495581_0016603_1886_2713 | 275 |
| 639 | 3300047317 | Ga0495604_0008664 | Ga0495604_0008664_4843_5670 | 275 |
| 640 | 3300047317 | Ga0495604_0074582 | Ga0495604_0074582_1411_2241 | 275 |
| 641 | 3300047319 | Ga0495674_0025112 | Ga0495674_0025112_1833_2663 | 275 |
| 642 | 3300047319 | Ga0495674_0095754 | Ga0495674_0095754_1320_2147 | 275 |
| 643 | 3300047319 | Ga0495674_0097700 | Ga0495674_0097700_1345_2172 | 275 |
| 644 | 3300047319 | Ga0495674_0104609 | Ga0495674_0104609_136_963 | 275 |
| 645 | 3300047322 | Ga0495680_0003741 | Ga0495680_0003741_11920_12747 | 275 |
| 646 | 3300047322 | Ga0495680_0004174 | Ga0495680_0004174_8767_9594 | 275 |
| 647 | 3300047322 | Ga0495680_0006328 | Ga0495680_0006328_5578_6408 | 275 |
| 648 | 3300047322 | Ga0495680_0017299 | Ga0495680_0017299_3596_4423 | 275 |
| 649 | 3300047323 | Ga0495683_0017557 | Ga0495683_0017557_1345_2172 | 275 |
| 650 | 3300047443 | Ga0495687_036217 | Ga0495687_036217_378_1205 | 275 |
| 651 | 3300047444 | Ga0495675_0001793 | Ga0495675_0001793_8441_9268 | 275 |
| 652 | 3300047469 | Ga0495673_0080996 | Ga0495673_0080996_127_954 | 275 |
| 653 | 3300047471 | Ga0495684_0006683 | Ga0495684_0006683_3617_4444 | 275 |
| 654 | 3300047471 | Ga0495684_0027789 | Ga0495684_0027789_1927_2757 | 275 |
| 655 | 3300047472 | Ga0495686_0035942 | Ga0495686_0035942_473_1300 | 275 |
| 656 | 3300047673 | Ga0495593_0006057 | Ga0495593_0006057_760_1587 | 275 |
| 657 | 3300047673 | Ga0495593_0104209 | Ga0495593_0104209_580_1410 | 275 |
| 658 | 3300048088 | Ga0495602_0012049 | Ga0495602_0012049_7421_8248 | 275 |
| 659 | 3300048088 | Ga0495602_0129774 | Ga0495602_0129774_1139_1969 | 275 |
| 660 | 3300048903 | Ga0496100_0005901 | Ga0496100_0005901_1421_2248 | 275 |
| 661 | 3300048903 | Ga0496100_0028290 | Ga0496100_0028290_2199_3026 | 275 |
| 662 | 3300048903 | Ga0496100_0165197 | Ga0496100_0165197_729_1556 | 275 |
| 663 | 3300048903 | Ga0496100_0181026 | Ga0496100_0181026_88_915 | 275 |
| 664 | 3300048903 | Ga0496100_0378226 | Ga0496100_0378226_32_859 | 275 |
| 665 | 3300048904 | Ga0496101_0004388 | Ga0496101_0004388_2646_3473 | 275 |
| 666 | 3300048904 | Ga0496101_0030995 | Ga0496101_0030995_273_1100 | 275 |
| 667 | 3300048904 | Ga0496101_0034951 | Ga0496101_0034951_1392_2219 | 275 |
| 668 | 3300048904 | Ga0496101_0062972 | Ga0496101_0062972_1483_2310 | 275 |
| 669 | 3300048904 | Ga0496101_0263989 | Ga0496101_0263989_413_1240 | 275 |
| 670 | 3300048905 | Ga0496102_0003175 | Ga0496102_0003175_7560_8387 | 275 |
| 671 | 3300048905 | Ga0496102_0063425 | Ga0496102_0063425_824_1651 | 275 |
| 672 | 3300048905 | Ga0496102_0067819 | Ga0496102_0067819_154_981 | 275 |
| 673 | 3300048905 | Ga0496102_0068035 | Ga0496102_0068035_1411_2238 | 275 |
| 674 | 3300048906 | Ga0496103_0002131 | Ga0496103_0002131_6386_7213 | 275 |
| 675 | 3300048906 | Ga0496103_0008761 | Ga0496103_0008761_519_1346 | 275 |
| 676 | 3300048906 | Ga0496103_0013007 | Ga0496103_0013007_1009_1836 | 275 |
| 677 | 3300048906 | Ga0496103_0151918 | Ga0496103_0151918_287_1114 | 275 |
| 678 | 3300048907 | Ga0496104_0000126 | Ga0496104_0000126_45357_46184 | 275 |
| 679 | 3300048907 | Ga0496104_0000752 | Ga0496104_0000752_3180_4007 | 275 |
| 680 | 3300048907 | Ga0496104_0014659 | Ga0496104_0014659_4970_5797 | 275 |
| 681 | 3300048907 | Ga0496104_0031478 | Ga0496104_0031478_2188_3015 | 275 |
| 682 | 3300048907 | Ga0496104_0051027 | Ga0496104_0051027_203_1030 | 275 |
| 683 | 3300048907 | Ga0496104_0052621 | Ga0496104_0052621_1152_1979 | 275 |
| 684 | 3300048907 | Ga0496104_0086397 | Ga0496104_0086397_1646_2473 | 275 |
| 685 | 3300048907 | Ga0496104_0168054 | Ga0496104_0168054_771_1598 | 275 |
| 686 | 3300048907 | Ga0496104_0172503 | Ga0496104_0172503_1024_1851 | 275 |
| 687 | 3300048908 | Ga0496105_0000117 | Ga0496105_0000117_13341_14168 | 275 |
| 688 | 3300048908 | Ga0496105_0002320 | Ga0496105_0002320_1345_2172 | 275 |
| 689 | 3300048908 | Ga0496105_0005325 | Ga0496105_0005325_8085_8912 | 275 |
| 690 | 3300048908 | Ga0496105_0014702 | Ga0496105_0014702_2150_2977 | 275 |
| 691 | 3300048908 | Ga0496105_0108000 | Ga0496105_0108000_1227_2054 | 275 |
| 692 | 3300048908 | Ga0496105_0134819 | Ga0496105_0134819_404_1231 | 275 |
| 693 | 3300048909 | Ga0496106_0004715 | Ga0496106_0004715_6868_7695 | 275 |
| 694 | 3300048909 | Ga0496106_0008815 | Ga0496106_0008815_6454_7281 | 275 |
| 695 | 3300048909 | Ga0496106_0035073 | Ga0496106_0035073_2483_3310 | 275 |
| 696 | 3300048909 | Ga0496106_0209791 | Ga0496106_0209791_678_1505 | 275 |
| 697 | 3300048909 | Ga0496106_0210161 | Ga0496106_0210161_422_1249 | 275 |
| 698 | 3300048910 | Ga0496107_0008852 | Ga0496107_0008852_3644_4471 | 275 |
| 699 | 3300048910 | Ga0496107_0017184 | Ga0496107_0017184_3092_3919 | 275 |
| 700 | 3300048910 | Ga0496107_0023923 | Ga0496107_0023923_3289_4116 | 275 |
| 701 | 3300048911 | Ga0496108_0003501 | Ga0496108_0003501_2632_3459 | 275 |
| 702 | 3300048911 | Ga0496108_0015288 | Ga0496108_0015288_4995_5822 | 275 |
| 703 | 3300048911 | Ga0496108_0055899 | Ga0496108_0055899_1526_2353 | 275 |
| 704 | 3300048911 | Ga0496108_0078044 | Ga0496108_0078044_698_1525 | 275 |
| 705 | 3300048911 | Ga0496108_0138171 | Ga0496108_0138171_16_843 | 275 |
| 706 | 3300048911 | Ga0496108_0173282 | Ga0496108_0173282_625_1452 | 275 |
| 707 | 3300048911 | Ga0496108_0220907 | Ga0496108_0220907_457_1284 | 275 |
| 708 | 3300048912 | Ga0496109_0008433 | Ga0496109_0008433_6840_7667 | 275 |
| 709 | 3300048912 | Ga0496109_0030269 | Ga0496109_0030269_411_1238 | 275 |
| 710 | 3300048912 | Ga0496109_0046584 | Ga0496109_0046584_1368_2195 | 275 |
| 711 | 3300048912 | Ga0496109_0048466 | Ga0496109_0048466_42_869 | 275 |
| 712 | 3300048912 | Ga0496109_0053713 | Ga0496109_0053713_2337_3164 | 275 |
| 713 | 3300048913 | Ga0496110_0007317 | Ga0496110_0007317_1723_2550 | 275 |
| 714 | 3300048913 | Ga0496110_0106175 | Ga0496110_0106175_790_1617 | 275 |
| 715 | 3300048913 | Ga0496110_0119747 | Ga0496110_0119747_1481_2308 | 275 |
| 716 | 3300048913 | Ga0496110_0221156 | Ga0496110_0221156_31_858 | 275 |
| 717 | 3300048913 | Ga0496110_0289123 | Ga0496110_0289123_437_1264 | 275 |
| 718 | 3300048913 | Ga0496110_0415687 | Ga0496110_0415687_218_1045 | 275 |
| 719 | 3300048914 | Ga0496111_0028921 | Ga0496111_0028921_970_1797 | 275 |
| 720 | 3300048914 | Ga0496111_0034708 | Ga0496111_0034708_921_1748 | 275 |
| 721 | 3300048914 | Ga0496111_0037809 | Ga0496111_0037809_1246_2073 | 275 |
| 722 | 3300048914 | Ga0496111_0043022 | Ga0496111_0043022_2375_3202 | 275 |
| 723 | 3300048914 | Ga0496111_0079856 | Ga0496111_0079856_57_884 | 275 |
| 724 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_39533_40360 | 275 |
| 725 | 3300048915 | Ga0496112_0005389 | Ga0496112_0005389_1365_2192 | 275 |
| 726 | 3300048915 | Ga0496112_0041726 | Ga0496112_0041726_167_994 | 275 |
| 727 | 3300048915 | Ga0496112_0075456 | Ga0496112_0075456_1366_2193 | 275 |
| 728 | 3300048915 | Ga0496112_0132695 | Ga0496112_0132695_1534_2361 | 275 |
| 729 | 3300048915 | Ga0496112_0577319 | Ga0496112_0577319_124_951 | 275 |
| 730 | 3300048916 | Ga0496113_0004051 | Ga0496113_0004051_6364_7191 | 275 |
| 731 | 3300048916 | Ga0496113_0005750 | Ga0496113_0005750_2097_2924 | 275 |
| 732 | 3300048916 | Ga0496113_0074246 | Ga0496113_0074246_1139_1966 | 275 |
| 733 | 3300048917 | Ga0496114_0003448 | Ga0496114_0003448_9418_10245 | 275 |
| 734 | 3300048917 | Ga0496114_0005405 | Ga0496114_0005405_5727_6554 | 275 |
| 735 | 3300048918 | Ga0496115_0008004 | Ga0496115_0008004_390_1217 | 275 |
| 736 | 3300048918 | Ga0496115_0062789 | Ga0496115_0062789_230_1102 | 275 |
| 737 | 3300048918 | Ga0496115_0086780 | Ga0496115_0086780_1567_2394 | 275 |
| 738 | 3300048918 | Ga0496115_0134294 | Ga0496115_0134294_220_1047 | 275 |
| 739 | 3300048918 | Ga0496115_0218905 | Ga0496115_0218905_152_979 | 275 |
| 740 | 3300048921 | Ga0496118_0014568 | Ga0496118_0014568_5176_6003 | 275 |
| 741 | 3300048923 | Ga0496120_0049508 | Ga0496120_0049508_202_1029 | 275 |
| 742 | 3300048925 | Ga0496122_0140989 | Ga0496122_0140989_47_874 | 275 |
| 743 | 3300048926 | Ga0496123_0160392 | Ga0496123_0160392_210_1037 | 275 |
| 744 | 3300048927 | Ga0496124_0162654 | Ga0496124_0162654_519_1346 | 275 |
| 745 | 3300048928 | Ga0496125_0024010 | Ga0496125_0024010_2400_3227 | 275 |
| 746 | 3300048929 | Ga0496126_0296208 | Ga0496126_0296208_301_1173 | 275 |
| 747 | 3300048929 | Ga0496126_0580731 | Ga0496126_0580731_37_864 | 275 |
| 748 | 3300049569 | Ga0501032_0027872 | Ga0501032_0027872_801_1628 | 275 |
| 749 | 3300049569 | Ga0501032_0037362 | Ga0501032_0037362_135_962 | 275 |
| 750 | 3300049570 | Ga0501033_0011750 | Ga0501033_0011750_3227_4054 | 275 |
| 751 | 3300049571 | Ga0501034_0019316 | Ga0501034_0019316_5952_6779 | 275 |
| 752 | 3300049571 | Ga0501034_0285896 | Ga0501034_0285896_99_1034 | 275 |
| 753 | 3300049572 | Ga0501036_0021491 | Ga0501036_0021491_2699_3526 | 275 |
| 754 | 3300049572 | Ga0501036_0023796 | Ga0501036_0023796_2200_3027 | 275 |
| 755 | 3300049573 | Ga0501037_0010332 | Ga0501037_0010332_2751_3578 | 275 |
| 756 | 3300049573 | Ga0501037_0012130 | Ga0501037_0012130_2826_3653 | 275 |
| 757 | 3300049573 | Ga0501037_0318655 | Ga0501037_0318655_139_966 | 275 |
| 758 | 3300049574 | Ga0501038_0004684 | Ga0501038_0004684_9613_10440 | 275 |
| 759 | 3300049575 | Ga0501039_0015274 | Ga0501039_0015274_2055_2882 | 275 |
| 760 | 3300049575 | Ga0501039_0101264 | Ga0501039_0101264_256_1083 | 275 |
| 761 | 3300049579 | Ga0501043_0005879 | Ga0501043_0005879_6160_6987 | 275 |
| 762 | 3300049579 | Ga0501043_0011800 | Ga0501043_0011800_3286_4113 | 275 |
| 763 | 3300049579 | Ga0501043_0014802 | Ga0501043_0014802_3285_4112 | 275 |
| 764 | 3300049580 | Ga0501046_0017912 | Ga0501046_0017912_172_999 | 275 |
| 765 | 3300049581 | Ga0501047_0014719 | Ga0501047_0014719_1225_2052 | 275 |
| 766 | 3300049581 | Ga0501047_0038179 | Ga0501047_0038179_3398_4225 | 275 |
| 767 | 3300049581 | Ga0501047_0297326 | Ga0501047_0297326_132_959 | 275 |
| 768 | 3300049582 | Ga0501048_0000150 | Ga0501048_0000150_7212_8039 | 275 |
| 769 | 3300049589 | Ga0501073_0221349 | Ga0501073_0221349_65_892 | 275 |
| 770 | 3300049590 | Ga0501074_0005366 | Ga0501074_0005366_2266_3093 | 275 |
| 771 | 3300049741 | Ga0501079_0123415 | Ga0501079_0123415_568_1395 | 275 |
| 772 | 3300049742 | Ga0501080_0001372 | Ga0501080_0001372_2017_2844 | 275 |
| 773 | 3300049742 | Ga0501080_0034245 | Ga0501080_0034245_3377_4204 | 275 |
| 774 | 3300049744 | Ga0501083_0001836 | Ga0501083_0001836_7397_8224 | 275 |
| 775 | 3300049823 | Ga0501044_0009883 | Ga0501044_0009883_6320_7147 | 275 |
| 776 | 3300049823 | Ga0501044_0015498 | Ga0501044_0015498_247_1074 | 275 |
| 777 | 3300049823 | Ga0501044_0111194 | Ga0501044_0111194_1387_2214 | 275 |
| 778 | 3300050490 | nmdc:mga03n38_24553_c1 | nmdc:mga03n38_24553_c1_507_1334 | 275 |
| 779 | 3300050491 | nmdc:mga00v17_187145_c1 | nmdc:mga00v17_187145_c1_177_1004 | 275 |
| 780 | 3300050491 | nmdc:mga00v17_59444_c1 | nmdc:mga00v17_59444_c1_578_1405 | 275 |
| 781 | 3300050492 | nmdc:mga0yw44_93964_c1 | nmdc:mga0yw44_93964_c1_785_1612 | 275 |
| 782 | 3300050493 | nmdc:mga0k408_131123_c1 | nmdc:mga0k408_131123_c1_139_966 | 275 |
| 783 | 3300050493 | nmdc:mga0k408_18525_c1 | nmdc:mga0k408_18525_c1_364_1191 | 275 |
| 784 | 3300050516 | nmdc:mga0sz30_9181_c1 | nmdc:mga0sz30_9181_c1_1364_2191 | 275 |
| 785 | 3300053077 | Ga0495601_0000128 | Ga0495601_0000128_41168_41995 | 275 |
| 786 | 3300053077 | Ga0495601_0009195 | Ga0495601_0009195_3599_4426 | 275 |
| 787 | 3300053078 | Ga0495612_0000805 | Ga0495612_0000805_620_1447 | 275 |
| 788 | 3300053078 | Ga0495612_0167768 | Ga0495612_0167768_123_950 | 275 |
| 789 | 3300053084 | Ga0495595_0000530 | Ga0495595_0000530_11641_12468 | 275 |
| 790 | 3300053084 | Ga0495595_0001258 | Ga0495595_0001258_5697_6524 | 275 |
| 791 | 3300053084 | Ga0495595_0003450 | Ga0495595_0003450_4005_4832 | 275 |
| 792 | 3300053084 | Ga0495595_0026333 | Ga0495595_0026333_973_1800 | 275 |
| 793 | 3300053085 | Ga0495619_0000016 | Ga0495619_0000016_170237_171064 | 275 |
| 794 | 3300053085 | Ga0495619_0000252 | Ga0495619_0000252_14327_15154 | 275 |
| 795 | 3300053085 | Ga0495619_0010019 | Ga0495619_0010019_1373_2200 | 275 |
| 796 | 3300053085 | Ga0495619_0218978 | Ga0495619_0218978_152_979 | 275 |
| 797 | 3300053086 | Ga0500578_0111147 | Ga0500578_0111147_708_1535 | 275 |
| 798 | 3300053087 | Ga0500643_000168 | Ga0500643_000168_36627_37454 | 275 |
| 799 | 3300053087 | Ga0500643_010318 | Ga0500643_010318_190_1077 | 275 |
| 800 | 3300053091 | Ga0500647_0028227 | Ga0500647_0028227_147_977 | 275 |
| 801 | 3300053093 | Ga0500651_0073483 | Ga0500651_0073483_393_1220 | 275 |
| 802 | 3300053094 | Ga0500566_0050603 | Ga0500566_0050603_1024_1851 | 275 |
| 803 | 3300053094 | Ga0500566_0087603 | Ga0500566_0087603_11_898 | 275 |
| 804 | 3300053096 | Ga0500641_0001637 | Ga0500641_0001637_2720_3547 | 275 |
| 805 | 3300053103 | Ga0500555_001537 | Ga0500555_001537_4055_4882 | 275 |
| 806 | 3300053104 | Ga0500556_0005901 | Ga0500556_0005901_1695_2522 | 275 |
| 807 | 3300053105 | Ga0500557_000032 | Ga0500557_000032_25794_26624 | 275 |
| 808 | 3300053109 | Ga0500569_026105 | Ga0500569_026105_378_1205 | 275 |
| 809 | 3300053111 | Ga0500572_004731 | Ga0500572_004731_675_1502 | 275 |
| 810 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_221861_222748 | 275 |
| 811 | 3300053119 | Ga0500595_018269 | Ga0500595_018269_518_1345 | 275 |
| 812 | 3300053121 | Ga0500607_043184 | Ga0500607_043184_422_1249 | 275 |
| 813 | 3300053122 | Ga0500608_134211 | Ga0500608_134211_255_1082 | 275 |
| 814 | 3300053130 | Ga0500642_0000197 | Ga0500642_0000197_13830_14660 | 275 |
| 815 | 3300053131 | Ga0500652_008171 | Ga0500652_008171_83_979 | 275 |
| 816 | 3300053139 | Ga0500568_0005928 | Ga0500568_0005928_2063_2890 | 275 |
| 817 | 3300053148 | Ga0500590_063181 | Ga0500590_063181_827_1654 | 275 |
| 818 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_605206_606102 | 275 |
| 819 | 3300053153 | Ga0500616_0011058 | Ga0500616_0011058_3254_4081 | 275 |
| 820 | 3300053156 | Ga0500622_0138946 | Ga0500622_0138946_229_1056 | 275 |
| 821 | 3300053160 | Ga0500633_0054663 | Ga0500633_0054663_331_1158 | 275 |
| 822 | 3300053162 | Ga0500638_008192 | Ga0500638_008192_2173_3000 | 275 |
| 823 | 3300053177 | Ga0500636_0000990 | Ga0500636_0000990_10289_11116 | 275 |
| 824 | 3300053177 | Ga0500636_0068426 | Ga0500636_0068426_378_1205 | 275 |
| 825 | 3300053729 | Ga0500625_000321 | Ga0500625_000321_6044_6874 | 275 |
| 826 | 3300053729 | Ga0500625_057017 | Ga0500625_057017_770_1597 | 275 |
| 827 | 3300053730 | Ga0500645_001000 | Ga0500645_001000_6439_7335 | 275 |
| 828 | 3300053730 | Ga0500645_027641 | Ga0500645_027641_578_1405 | 275 |
| 829 | 3300053736 | Ga0500599_000381 | Ga0500599_000381_1989_2816 | 275 |
| 830 | 3300053737 | Ga0500601_000352 | Ga0500601_000352_5400_6227 | 275 |
| 831 | 3300054114 | Ga0501084_0561228 | Ga0501084_0561228_10_837 | 275 |
| 832 | 3300055283 | Ga0500661_015418 | Ga0500661_015418_145_972 | 275 |
| 833 | iso_pu_bacteria | 2513237104 | 2513716127 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vvl-assembly1.cif.gz_R | pth-bound human pth1r in complex with gs (class2) | 0.2288 | 7 | 193 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.2072 | 1 | 191 |
| 7awq-assembly1.cif.gz_A | structure of the thermostabilized eaat1 cryst-e386q mutant in complex with l-asp, sodium ions and the allosteric inhibitor ucph101 | 0.2058 | 18 | 196 |
| 7d3s-assembly1.cif.gz_R | human secr in complex with an engineered gs heterotrimer | 0.2029 | 1 | 194 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.1821 | 1 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1P8B7A0_67_343_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.2778 | 10 | 194 | 1.50.40.10 |
| af_A0A0P0YBY4_33_209_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2751 | 105 | 193 | 1.20.1250.20 |
| af_D3ZG94_8_239_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.2719 | 13 | 191 | 1.50.40.10 |
| af_K7M2B0_284_447_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2638 | 17 | 193 | 1.20.1250.20 |
| af_K7M2B0_284_447_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2523 | 17 | 193 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N7H1F3-F1-model_v4 | Sterol desaturase family protein | 0.9817 | 32 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A533IPT2-F1-model_v4 | deleted | 0.9807 | 96 | 275 |
|
| AF-A0A0E4BMH1-F1-model_v4 | Uncharacterized protein | 0.9798 | 1 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A849ICG2-F1-model_v4 | Sterol desaturase family protein | 0.9767 | 3 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A6N7H1F3-F1-model_v4 | Sterol desaturase family protein | 0.9738 | 32 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar