F482746

General Info

Members Datasets Scaffolds Average Seq Length
833 480 701 275

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10146879|Ga0081455_101468791
Length 306
Sequence MSEELLAVVHSIGTTLLNVLPVSIALGAAFAVLSFFWACNPGRPWWRKRDLLTDLCYWFIIPLFARYLRIGLLVLGAALLFGITTPQGLVEFYDDGHGPLAQLPLWLQAAIFLVGSDVMMYWLHRAFHRHQPLWKYHAVHHSSEDLEWISAARFHPINIFLGSVATDVVLLLAGISPNVFVILGPFTVAHSAFVHANLNWTLGPFKYVIAGPVFHRWHHTMAERGGEKNFASTFPVLDLLFGTFYMPKNELPDAYGIADPGFPPGFGGQMIYPFKQAATGAPNPQLGHMVLQEQLRPSSSKGALES

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
28 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
33 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
34 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
35 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
52 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
53 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
54 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
55 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
56 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
57 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
58 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
59 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
60 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
61 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
62 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
63 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
64 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
65 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
66 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
67 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
68 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
69 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
70 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
71 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
72 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
73 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
74 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
75 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
76 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
77 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
78 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
79 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
80 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
81 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
82 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
83 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
84 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
85 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
86 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
87 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
88 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
89 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
90 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
91 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
92 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
93 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
94 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
95 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
96 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
97 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
98 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
99 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
100 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
101 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
102 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
103 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
104 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
105 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
106 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
107 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
108 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
109 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
110 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
111 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
112 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
113 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
116 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
117 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
118 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
124 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
125 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
126 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
127 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
128 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
129 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
130 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
131 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
138 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
139 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
140 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
141 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
142 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
143 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
147 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
148 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
149 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
150 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
151 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
152 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
156 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
157 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
158 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
159 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
160 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
161 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
162 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
163 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
164 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
165 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
166 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
168 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
169 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
170 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
171 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
172 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
173 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
174 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
175 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
179 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
180 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
181 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
184 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
185 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
186 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
188 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
189 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
197 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
200 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
201 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
202 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
203 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
204 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
207 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
208 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
209 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
210 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
211 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
212 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
213 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
214 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
215 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
216 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
220 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
271 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
273 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
278 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
279 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
282 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
283 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
286 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
287 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
289 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
304 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
305 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
306 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
307 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
311 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
312 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
313 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
323 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
359 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
400 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
430 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
431 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
432 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
433 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
434 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
435 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
436 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
437 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
438 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
439 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
440 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
441 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
442 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
443 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
444 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
449 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
450 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
451 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
452 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
453 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
456 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
457 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
462 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
463 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
464 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
465 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
466 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
467 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
468 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
469 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
470 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
471 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
472 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
473 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
474 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
475 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
476 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
477 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
478 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
479 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
480 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.15
Metatranscriptomes 0
Isolates 15.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 11.4
Rhizoplane 11.04
Rhizosphere 56.54
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000012 3300003203 Bacteria 102438
2 JGI25153J46596_10007570 3300003215 Bacteria 5316
3 JGI25153J46596_10007805 3300003215 Bacteria 5198
4 JGI25153J46596_10007905 3300003215 Bacteria 5159
5 JGI25153J46596_10010090 3300003215 Bacteria 4308
6 JGI25153J46596_10011735 3300003215 Bacteria 3846
7 JGI25160J50197_1001523 3300003354 Bacteria 11497
8 JGI25160J50197_1004156 3300003354 Bacteria 6306
9 Ga0055542_1014266 3300003762 Bacteria 1311
10 Ga0055531_10017206 3300003794 Bacteria 3066
11 Ga0055543_1001971 3300004625 Bacteria 7312
12 Ga0065165_1000982 3300005262 Bacteria 35331
13 Ga0070658_10051779 3300005327 Bacteria 3327
14 Ga0070658_10355352 3300005327 Bacteria 1254
15 Ga0070676_10124442 3300005328 Bacteria 1622
16 Ga0070683_100023299 3300005329 Bacteria 5538
17 Ga0070670_100073764 3300005331 Bacteria 2931
18 Ga0068869_100277754 3300005334 Bacteria 1346
19 Ga0070666_10018342 3300005335 Bacteria 4498
20 Ga0070682_100203239 3300005337 Bacteria 1399
21 Ga0070682_100351791 3300005337 Bacteria 1099
22 Ga0068868_100054852 3300005338 Bacteria 3143
23 Ga0070660_100023598 3300005339 Bacteria 4558
24 Ga0070660_100165349 3300005339 Bacteria 1785
25 Ga0070689_100023388 3300005340 Bacteria 4625
26 Ga0070691_10023144 3300005341 Bacteria 2884
27 Ga0070661_100014282 3300005344 Bacteria 5595
28 Ga0070661_100019861 3300005344 Bacteria 4788
29 Ga0070668_100022443 3300005347 Bacteria 4771
30 Ga0070671_100010055 3300005355 Bacteria 7600
31 Ga0070671_100052016 3300005355 Bacteria 3406
32 Ga0070671_100071962 3300005355 Bacteria 2886
33 Ga0070674_100050376 3300005356 Unclassified 2867
34 Ga0070659_100527099 3300005366 Bacteria 1009
35 Ga0070667_100054855 3300005367 Bacteria 3365
36 Ga0070667_100072840 3300005367 Bacteria 2928
37 Ga0070667_100081303 3300005367 Plasmid 2772
38 Ga0070709_10002216 3300005434 Bacteria 10530
39 Ga0070709_10018192 3300005434 Bacteria 4043
40 Ga0070709_10172765 3300005434 Bacteria 1511
41 Ga0070714_100060786 3300005435 Bacteria 3244
42 Ga0070714_100074728 3300005435 Plasmid 2939
43 Ga0070714_100365096 3300005435 Bacteria 1358
44 Ga0070713_100005731 3300005436 Bacteria 8529
45 Ga0070713_100013315 3300005436 Bacteria 6069
46 Ga0070713_100056783 3300005436 Bacteria 3257
47 Ga0070713_100251054 3300005436 Unclassified 1613
48 Ga0070710_10002966 3300005437 Bacteria 8056
49 Ga0070710_10004257 3300005437 Bacteria 6785
50 Ga0070710_10209689 3300005437 Unclassified 1234
51 Ga0070701_10333594 3300005438 Bacteria 942
52 Ga0070711_100012216 3300005439 Bacteria 5360
53 Ga0070711_100017604 3300005439 Bacteria 4552
54 Ga0070711_100029550 3300005439 Bacteria 3618
55 Ga0070705_100050455 3300005440 Bacteria 2421
56 Ga0070663_100010322 3300005455 Bacteria 5820
57 Ga0070663_100065655 3300005455 Bacteria 2627
58 Ga0070663_100165065 3300005455 Bacteria 1707
59 Ga0070678_100005437 3300005456 Bacteria 7363
60 Ga0070662_100050455 3300005457 Bacteria 3001
61 Ga0070681_10029471 3300005458 Bacteria 5512
62 Ga0070685_10162524 3300005466 Bacteria 1424
63 Ga0070679_100025513 3300005530 Bacteria 5801
64 Ga0070679_100043101 3300005530 Bacteria 4495
65 Ga0070695_100033610 3300005545 Bacteria 3209
66 Ga0070696_100036249 3300005546 Bacteria 3400
67 Ga0070693_100026376 3300005547 Bacteria 3137
68 Ga0070693_100147826 3300005547 Bacteria 1485
69 Ga0070665_100025939 3300005548 Bacteria 5902
70 Ga0070665_100056381 3300005548 Bacteria 3939
71 Ga0070665_100056661 3300005548 Bacteria 3929
72 Ga0070665_100172139 3300005548 Bacteria 2166
73 Ga0068855_100000529 3300005563 Bacteria 46748
74 Ga0068855_100153238 3300005563 Bacteria 2619
75 Ga0068855_100166033 3300005563 Bacteria 2502
76 Ga0070664_100047921 3300005564 Bacteria 3611
77 Ga0068856_100172913 3300005614 Bacteria 2172
78 Ga0068856_100452562 3300005614 Bacteria 1305
79 Ga0068852_100003179 3300005616 Bacteria 11467
80 Ga0068852_100042826 3300005616 Bacteria 3835
81 Ga0068852_100070253 3300005616 Bacteria 3071
82 Ga0068852_100186585 3300005616 Bacteria 1953
83 Ga0068852_100366348 3300005616 Bacteria 1411
84 Ga0068859_100064654 3300005617 Bacteria 3691
85 Ga0068859_100310395 3300005617 Unclassified 1671
86 Ga0068864_100033860 3300005618 Bacteria 4343
87 Ga0068866_10088473 3300005718 Bacteria 1681
88 Ga0068863_100668632 3300005841 Bacteria 1031
89 Ga0068858_100010777 3300005842 Bacteria 8644
90 Ga0068858_100175259 3300005842 Bacteria 2023
91 Ga0068860_100311057 3300005843 Bacteria 1545
92 Ga0081455_10094575 3300005937 Bacteria 2413
93 Ga0081455_10146879 3300005937 Bacteria 1823
94 Ga0081540_1017703 3300005983 Bacteria 4399
95 Ga0081540_1035683 3300005983 Bacteria 2663
96 Ga0081539_10000040 3300005985 Bacteria 292753
97 Ga0081539_10072807 3300005985 Bacteria 1835
98 Ga0070717_10129308 3300006028 Bacteria 2171
99 Ga0070717_10217624 3300006028 Unclassified 1678
100 Ga0075365_10125115 3300006038 Bacteria 1776
101 Ga0075368_10001274 3300006042 Bacteria 7977
102 Ga0075363_100006553 3300006048 Bacteria 5301
103 Ga0075364_10023980 3300006051 Bacteria 3868
104 Ga0075364_10043149 3300006051 Bacteria 2931
105 Ga0075364_10280459 3300006051 Bacteria 1134
106 Ga0070715_10001099 3300006163 Bacteria 7676
107 Ga0070716_100002384 3300006173 Bacteria 8648
108 Ga0070712_100085185 3300006175 Bacteria 2300
109 Ga0070712_100391538 3300006175 Bacteria 1146
110 Ga0075362_10152395 3300006177 Bacteria 1110
111 Ga0075367_10044362 3300006178 Bacteria 2606
112 Ga0075367_10049189 3300006178 Bacteria 2484
113 Ga0075367_10068495 3300006178 Bacteria 2129
114 Ga0075369_10024233 3300006186 Bacteria 2513
115 Ga0075369_10029318 3300006186 Bacteria 2311
116 Ga0075366_10015724 3300006195 Bacteria 4343
117 Ga0075366_10129673 3300006195 Bacteria 1521
118 Ga0075370_10008389 3300006353 Bacteria 5316
119 Ga0075370_10032778 3300006353 Bacteria 2906
120 Ga0068871_100006182 3300006358 Bacteria 8439
121 Ga0068871_100042552 3300006358 Bacteria 3647
122 Ga0068865_100005241 3300006881 Bacteria 7838
123 Ga0097620_100064654 3300006931 Bacteria 3691
124 Ga0097620_100310411 3300006931 Unclassified 1671
125 Ga0099825_1029794 3300006941 Bacteria 2489
126 Ga0099823_1020508 3300006944 Bacteria 6241
127 Ga0105240_10000055 3300009093 Bacteria 225380
128 Ga0105240_10017001 3300009093 Bacteria 9826
129 Ga0111539_10576076 3300009094 Bacteria 1311
130 Ga0105245_10004710 3300009098 Bacteria 12058
131 Ga0105245_10124194 3300009098 Bacteria 2414
132 Ga0105245_10303364 3300009098 Unclassified 1568
133 Ga0105245_10430067 3300009098 Bacteria 1325
134 Ga0105247_10007722 3300009101 Bacteria 6583
135 Ga0105247_10031115 3300009101 Unclassified 3237
136 Ga0105247_10224032 3300009101 Bacteria 1274
137 Ga0105243_10233853 3300009148 Bacteria 1632
138 Ga0105243_10343188 3300009148 Unclassified 1369
139 Ga0105241_10027893 3300009174 Bacteria 4204
140 Ga0105241_10086932 3300009174 Bacteria 2459
141 Ga0105241_10088741 3300009174 Bacteria 2435
142 Ga0105241_10251588 3300009174 Bacteria 1498
143 Ga0105241_10301812 3300009174 Unclassified 1375
144 Ga0105242_10011410 3300009176 Bacteria 6830
145 Ga0105248_10024075 3300009177 Bacteria 6766
146 Ga0105248_10065542 3300009177 Bacteria 4078
147 Ga0105248_10082496 3300009177 Bacteria 3615
148 Ga0105237_10002118 3300009545 Bacteria 25049
149 Ga0105237_10215947 3300009545 Bacteria 1918
150 Ga0105238_10040937 3300009551 Bacteria 4694
151 Ga0105238_10090489 3300009551 Plasmid 3047
152 Ga0105249_10162867 3300009553 Unclassified 2157
153 Ga0105249_10194043 3300009553 Bacteria 1984
154 Ga0105249_10408311 3300009553 Bacteria 1390
155 Ga0099796_10001500 3300010159 Bacteria 4728
156 Ga0099796_10042873 3300010159 Bacteria 1539
157 Ga0105239_10005950 3300010375 Bacteria 14194
158 Ga0105239_10072128 3300010375 Bacteria 3795
159 Ga0105239_10239668 3300010375 Bacteria 2036
160 Ga0105239_10318649 3300010375 Bacteria 1753
161 Ga0105239_10380624 3300010375 Bacteria 1595
162 Ga0105239_10477333 3300010375 Bacteria 1416
163 Ga0105239_10866740 3300010375 Bacteria 1036
164 Ga0105246_10017246 3300011119 Bacteria 4588
165 Ga0105246_10046711 3300011119 Bacteria 2955
166 Ga0105246_10088768 3300011119 Bacteria 2222
167 Ga0105246_10322327 3300011119 Bacteria 1256
168 Ga0157373_10054547 3300013100 Bacteria 2840
169 Ga0157371_10143059 3300013102 Bacteria 1704
170 Ga0157370_10079150 3300013104 Bacteria 3095
171 Ga0157370_10268253 3300013104 Bacteria 1577
172 Ga0157369_10413268 3300013105 Bacteria 1399
173 Ga0157374_10008513 3300013296 Bacteria 8775
174 Ga0157374_10014838 3300013296 Bacteria 6826
175 Ga0157374_10050674 3300013296 Unclassified 3860
176 Ga0157378_10005396 3300013297 Bacteria 11209
177 Ga0157378_10445721 3300013297 Bacteria 1284
178 Ga0163162_10009085 3300013306 Bacteria 9663
179 Ga0163162_10087474 3300013306 Plasmid 3195
180 Ga0157372_10340073 3300013307 Unclassified 1748
181 Ga0157375_10012326 3300013308 Bacteria 7581
182 Ga0163163_10018613 3300014325 Bacteria 6506
183 Ga0163163_10024935 3300014325 Bacteria 5695
184 Ga0163163_10520379 3300014325 Bacteria 1252
185 Ga0157379_10008660 3300014968 Bacteria 8860
186 Ga0157379_10018738 3300014968 Bacteria 6104
187 Ga0157379_10024715 3300014968 Bacteria 5332
188 Ga0157379_10061174 3300014968 Bacteria 3368
189 Ga0214544_1000011 3300021320 Bacteria 262952
190 Ga0214542_1000009 3300021321 Bacteria 262861
191 Ga0214545_1000007 3300021324 Bacteria 262984
192 Ga0214543_1000020 3300021327 Bacteria 262861
193 Ga0213876_10100658 3300021384 Bacteria 1532
194 Ga0213876_10226350 3300021384 Unclassified 994
195 Ga0213875_10000011 3300021388 Bacteria 332447
196 Ga0209563_101805 3300025230 Bacteria 5302
197 Ga0209677_100400 3300025253 Bacteria 26165
198 Ga0209148_1000321 3300025254 Bacteria 66604
199 Ga0209233_1001172 3300025261 Bacteria 10583
200 Ga0209233_1012581 3300025261 Bacteria 2448
201 Ga0209233_1025527 3300025261 Bacteria 1460
202 Ga0209455_1003830 3300025272 Bacteria 5152
203 Ga0209564_1008083 3300025295 Bacteria 5267
204 Ga0209758_1000206 3300025297 Bacteria 130177
205 Ga0209758_1000536 3300025297 Bacteria 60374
206 Ga0209758_1001992 3300025297 Bacteria 22001
207 Ga0209758_1002275 3300025297 Bacteria 19895
208 Ga0209758_1003319 3300025297 Bacteria 14823
209 Ga0209758_1038606 3300025297 Bacteria 1829
210 Ga0209758_1039740 3300025297 Bacteria 1784
211 Ga0209256_1004643 3300025299 Bacteria 8462
212 Ga0209256_1010195 3300025299 Bacteria 3976
213 Ga0209256_1049727 3300025299 Bacteria 1020
214 Ga0207426_1002091 3300025302 Bacteria 13785
215 Ga0207426_1002585 3300025302 Bacteria 11252
216 Ga0207426_1013422 3300025302 Bacteria 3036
217 Ga0207426_1015065 3300025302 Bacteria 2816
218 Ga0209051_1060403 3300025303 Bacteria 1197
219 Ga0209257_1000394 3300025304 Bacteria 86654
220 Ga0209257_1020044 3300025304 Bacteria 2489
221 Ga0207692_10031295 3300025898 Unclassified 2547
222 Ga0207692_10035710 3300025898 Bacteria 2417
223 Ga0207642_10070761 3300025899 Bacteria 1659
224 Ga0207710_10013015 3300025900 Bacteria 3505
225 Ga0207710_10037135 3300025900 Bacteria 2150
226 Ga0207710_10040573 3300025900 Unclassified 2063
227 Ga0207680_10018562 3300025903 Bacteria 3701
228 Ga0207647_10005715 3300025904 Bacteria 9080
229 Ga0207699_10002176 3300025906 Bacteria 9251
230 Ga0207699_10058038 3300025906 Unclassified 2314
231 Ga0207699_10104794 3300025906 Bacteria 1802
232 Ga0207699_10318871 3300025906 Bacteria 1090
233 Ga0207654_10173298 3300025911 Bacteria 1403
234 Ga0207695_10000006 3300025913 Bacteria 1135309
235 Ga0207695_10000012 3300025913 Bacteria 840961
236 Ga0207671_10008630 3300025914 Bacteria 8612
237 Ga0207671_10169508 3300025914 Bacteria 1695
238 Ga0207693_10049568 3300025915 Plasmid 3298
239 Ga0207693_10095712 3300025915 Bacteria 2328
240 Ga0207693_10183752 3300025915 Bacteria 1646
241 Ga0207663_10002864 3300025916 Bacteria 8336
242 Ga0207663_10033820 3300025916 Bacteria 3050
243 Ga0207663_10073295 3300025916 Bacteria 2215
244 Ga0207663_10216236 3300025916 Bacteria 1392
245 Ga0207657_10044394 3300025919 Bacteria 3907
246 Ga0207657_10114072 3300025919 Bacteria 2229
247 Ga0207649_10045682 3300025920 Bacteria 2686
248 Ga0207646_10510068 3300025922 Unclassified 1083
249 Ga0207694_10000006 3300025924 Bacteria 631109
250 Ga0207650_10100767 3300025925 Bacteria 2223
251 Ga0207687_10016247 3300025927 Bacteria 4888
252 Ga0207687_10099471 3300025927 Bacteria 2137
253 Ga0207687_10211882 3300025927 Bacteria 1520
254 Ga0207700_10190827 3300025928 Bacteria 1722
255 Ga0207700_10288539 3300025928 Bacteria 1414
256 Ga0207664_10030862 3300025929 Bacteria 4095
257 Ga0207644_10020007 3300025931 Bacteria 4546
258 Ga0207644_10232097 3300025931 Bacteria 1466
259 Ga0207706_10025262 3300025933 Bacteria 5325
260 Ga0207686_10041573 3300025934 Unclassified 2804
261 Ga0207704_10003803 3300025938 Bacteria 6871
262 Ga0207704_10076977 3300025938 Bacteria 2140
263 Ga0207665_10005428 3300025939 Bacteria 8511
264 Ga0207665_10008613 3300025939 Bacteria 6714
265 Ga0207665_10053964 3300025939 Bacteria 2709
266 Ga0207711_10003089 3300025941 Bacteria 14519
267 Ga0207711_10033717 3300025941 Bacteria 4334
268 Ga0207711_10239515 3300025941 Bacteria 1663
269 Ga0207711_10725017 3300025941 Bacteria 927
270 Ga0207661_10015446 3300025944 Bacteria 5618
271 Ga0207679_10005027 3300025945 Bacteria 8261
272 Ga0207667_10000026 3300025949 Bacteria 343713
273 Ga0207667_10071501 3300025949 Bacteria 3607
274 Ga0207667_10387207 3300025949 Bacteria 1424
275 Ga0207712_10230589 3300025961 Bacteria 1486
276 Ga0207668_10169373 3300025972 Bacteria 1711
277 Ga0207640_10114731 3300025981 Bacteria 1917
278 Ga0207658_10231159 3300025986 Bacteria 1561
279 Ga0207677_10034827 3300026023 Bacteria 3264
280 Ga0207703_10043250 3300026035 Bacteria 3615
281 Ga0207703_10110278 3300026035 Bacteria 2347
282 Ga0207703_10222676 3300026035 Bacteria 1688
283 Ga0207639_10250476 3300026041 Bacteria 1544
284 Ga0207678_10122456 3300026067 Bacteria 2219
285 Ga0207678_10314662 3300026067 Bacteria 1346
286 Ga0207678_10347639 3300026067 Bacteria 1279
287 Ga0207702_10101662 3300026078 Unclassified 2539
288 Ga0207702_10215133 3300026078 Bacteria 1788
289 Ga0207702_10224154 3300026078 Bacteria 1753
290 Ga0207702_10369251 3300026078 Bacteria 1377
291 Ga0207641_10229996 3300026088 Bacteria 1723
292 Ga0207648_10049805 3300026089 Bacteria 3664
293 Ga0207676_10162185 3300026095 Bacteria 1938
294 Ga0207674_10055792 3300026116 Bacteria 4015
295 Ga0207674_10070190 3300026116 Bacteria 3522
296 Ga0207683_10032293 3300026121 Bacteria 4548
297 Ga0207698_10005418 3300026142 Bacteria 7886
298 Ga0207698_10009584 3300026142 Bacteria 6184
299 Ga0209389_1000039 3300027296 Bacteria 124545
300 Ga0209489_100087 3300027361 Bacteria 124545
301 Ga0209700_100090 3300027363 Bacteria 124545
302 Ga0209588_1014000 3300027671 Bacteria 2453
303 Ga0268266_10004873 3300028379 Bacteria 12733
304 Ga0268266_10021144 3300028379 Bacteria 5544
305 Ga0268266_10069109 3300028379 Bacteria 3060
306 Ga0268266_10227280 3300028379 Bacteria 1717
307 Ga0268265_10233231 3300028380 Bacteria 1619
308 Ga0268264_10249844 3300028381 Bacteria 1647
309 Ga0307511_10067940 3300030521 Bacteria 2638
310 Ga0265325_10000398 3300031241 Bacteria 30875
311 Ga0265325_10025536 3300031241 Bacteria 3206
312 Ga0265325_10041188 3300031241 Bacteria 2421
313 Ga0265316_10054306 3300031344 Bacteria 3137
314 Ga0265313_10011516 3300031595 Bacteria 5490
315 Ga0265313_10029312 3300031595 Bacteria 2848
316 Ga0265314_10000439 3300031711 Bacteria 55613
317 Ga0265342_10000882 3300031712 Bacteria 29894
318 Ga0307516_10007612 3300031730 Bacteria 12410
319 Ga0307516_10008613 3300031730 Bacteria 11508
320 Ga0307516_10021682 3300031730 Bacteria 6605
321 Ga0307409_100503362 3300031995 Unclassified 1180
322 Ga0307507_10154980 3300033179 Bacteria 1711
323 Ga0307510_10024382 3300033180 Bacteria 6990
324 Ga0307510_10028911 3300033180 Bacteria 6320
325 Ga0373923_0020877 3300035111 Unclassified 2551
326 Ga0373941_0000525 3300035115 Bacteria 7684
327 Ga0373945_0066159 3300035116 Bacteria 1359
328 Ga0373954_0002960 3300035118 Bacteria 7170
329 Ga0373954_0084974 3300035118 Bacteria 1515
330 Ga0373956_0011394 3300035119 Bacteria 3662
331 Ga0373956_0050147 3300035119 Bacteria 1873
332 Ga0373957_0011249 3300035120 Plasmid 2981
333 Ga0373946_0073401 3300035171 Bacteria 1483
334 Ga0373955_0004355 3300035172 Bacteria 6260
335 Ga0373955_0007183 3300035172 Bacteria 5107
336 Ga0373924_0011648 3300035410 Bacteria 3270
337 Ga0373924_0075560 3300035410 Bacteria 1426
338 Ga0373931_0145767 3300035691 Bacteria 1376
339 Ga0373935_0273463 3300035692 Bacteria 1188
340 Ga0373927_0065680 3300035695 Bacteria 2347
341 Ga0373927_0352950 3300035695 Bacteria 969
342 Ga0373933_0006532 3300035724 Bacteria 6352
343 Ga0373933_0028937 3300035724 Bacteria 3199
344 Ga0373933_0054315 3300035724 Bacteria 2400
345 Ga0373933_0197899 3300035724 Bacteria 1285
346 Ga0373947_0228352 3300035725 Bacteria 1225
347 Ga0373937_0004592 3300036401 Bacteria 11716
348 Ga0373937_0005159 3300036401 Bacteria 11138
349 Ga0373937_0021587 3300036401 Bacteria 5777
350 Ga0373937_0031801 3300036401 Bacteria 4784
351 Ga0373937_0388096 3300036401 Bacteria 1324
352 Ga0373925_0001273 3300037068 Bacteria 22250
353 Ga0373925_0144421 3300037068 Unclassified 1864
354 Ga0395899_0028090 3300037312 Bacteria 4238
355 Ga0395900_0003044 3300037418 Bacteria 18262
356 Ga0395900_0268887 3300037418 Bacteria 1700
357 Ga0395898_0009793 3300037466 Bacteria 10045
358 Ga0395898_0173849 3300037466 Bacteria 2059
359 Ga0395905_0001273 3300037471 Bacteria 31107
360 Ga0395905_0018089 3300037471 Bacteria 6690
361 Ga0436364_0015606 3300037853 Bacteria 4319
362 Ga0436364_0604898 3300037853 Bacteria 2898
363 Ga0436364_0728139 3300037853 Bacteria 64829
364 Ga0395901_0295504 3300038443 Bacteria 1680
365 Ga0436365_0425385 3300039437 Bacteria 4989
366 Ga0436365_1830792 3300039437 Bacteria 2870
367 Ga0436360_0310474 3300039438 Bacteria 1544
368 Ga0451793_1684190 3300041452 Bacteria 1563
369 Ga0451797_1288970 3300041453 Bacteria 1557
370 Ga0451802_0495993 3300041460 Bacteria 1076
371 Ga0451853_2299509 3300041512 Bacteria 2139
372 Ga0466972_0000053 3300044658 Bacteria 112876
373 Ga0466972_0033341 3300044658 Bacteria 2525
374 Ga0466972_0062459 3300044658 Bacteria 1785
375 Ga0466966_0000322 3300044684 Bacteria 30928
376 Ga0466961_0002390 3300044693 Bacteria 11659
377 Ga0466961_0126373 3300044693 Bacteria 1604
378 Ga0466963_0005897 3300044694 Bacteria 7217
379 Ga0466964_0029672 3300044706 Bacteria 2161
380 Ga0466964_0071745 3300044706 Bacteria 1466
381 Ga0466970_0143407 3300044765 Bacteria 1317
382 Ga0466957_0027315 3300044842 Bacteria 3392
383 Ga0466960_0000619 3300044901 Bacteria 12265
384 Ga0466959_0305499 3300045049 Bacteria 1089
385 Ga0466967_0048518 3300045976 Bacteria 3708
386 Ga0466967_0090301 3300045976 Bacteria 2782
387 Ga0466967_0257769 3300045976 Bacteria 1668
388 Ga0495638_0005066 3300046460 Bacteria 9877
389 Ga0495651_0005183 3300046462 Bacteria 9944
390 Ga0495651_0047894 3300046462 Bacteria 3302
391 Ga0495651_0051595 3300046462 Bacteria 3170
392 Ga0495651_0058218 3300046462 Bacteria 2965
393 Ga0495653_0005744 3300046463 Bacteria 10150
394 Ga0495605_0178657 3300046474 Bacteria 934
395 Ga0495662_0016908 3300046476 Bacteria 3530
396 Ga0495662_0201297 3300046476 Bacteria 981
397 Ga0495664_0003461 3300046477 Bacteria 8590
398 Ga0495664_0037276 3300046477 Bacteria 2869
399 Ga0495664_0161780 3300046477 Bacteria 1358
400 Ga0495594_0145242 3300046499 Unclassified 1346
401 Ga0495607_0048959 3300046501 Bacteria 2468
402 Ga0495606_0007723 3300046507 Bacteria 9526
403 Ga0495606_0080074 3300046507 Bacteria 2033
404 Ga0495606_0227218 3300046507 Bacteria 1048
405 Ga0495608_0004462 3300046511 Bacteria 10003
406 Ga0495608_0027747 3300046511 Bacteria 3850
407 Ga0495608_0062915 3300046511 Bacteria 2437
408 Ga0495610_0082047 3300046512 Bacteria 1478
409 Ga0495620_0064869 3300046515 Bacteria 1509
410 Ga0495628_0001465 3300046516 Bacteria 21652
411 Ga0495628_0009727 3300046516 Bacteria 8202
412 Ga0495628_0099864 3300046516 Bacteria 2241
413 Ga0495628_0123019 3300046516 Bacteria 1989
414 Ga0495628_0410221 3300046516 Bacteria 988
415 Ga0495630_0185612 3300046517 Unclassified 1586
416 Ga0495630_0382709 3300046517 Bacteria 1078
417 Ga0495652_0002359 3300046529 Bacteria 19593
418 Ga0495652_0114375 3300046529 Bacteria 2165
419 Ga0495652_0342689 3300046529 Bacteria 1073
420 Ga0495665_0091119 3300046531 Unclassified 1602
421 Ga0495640_0013003 3300046533 Bacteria 6340
422 Ga0495640_0014947 3300046533 Bacteria 5854
423 Ga0495640_0049154 3300046533 Bacteria 2910
424 Ga0495586_0006236 3300046535 Bacteria 6373
425 Ga0495587_0007520 3300046536 Bacteria 7055
426 Ga0495609_0063355 3300046538 Bacteria 1632
427 Ga0495609_0190368 3300046538 Bacteria 861
428 Ga0495645_0004750 3300046543 Bacteria 9285
429 Ga0495645_0009901 3300046543 Bacteria 6670
430 Ga0495645_0054130 3300046543 Bacteria 2916
431 Ga0495622_0017584 3300046557 Bacteria 3329
432 Ga0495667_0004513 3300046559 Bacteria 9394
433 Ga0495667_0059836 3300046559 Bacteria 2499
434 Ga0495667_0298367 3300046559 Bacteria 1021
435 Ga0495668_0013172 3300046616 Bacteria 4890
436 Ga0495668_0123871 3300046616 Bacteria 1414
437 Ga0495634_0026468 3300046642 Bacteria 4047
438 Ga0495634_0047344 3300046642 Bacteria 2898
439 Ga0495625_0148643 3300046660 Bacteria 1576
440 Ga0495635_0009985 3300046663 Bacteria 6635
441 Ga0495635_0031347 3300046663 Bacteria 3691
442 Ga0495635_0064254 3300046663 Bacteria 2520
443 Ga0495635_0082487 3300046663 Unclassified 2200
444 Ga0495635_0175425 3300046663 Bacteria 1457
445 Ga0495588_0063353 3300046674 Bacteria 1917
446 Ga0495657_0002195 3300046675 Bacteria 16535
447 Ga0495657_0013992 3300046675 Bacteria 5894
448 Ga0495657_0027589 3300046675 Bacteria 4005
449 Ga0495657_0074532 3300046675 Bacteria 2208
450 Ga0495599_0001128 3300046678 Bacteria 15058
451 Ga0495599_0002972 3300046678 Bacteria 9867
452 Ga0495623_0000278 3300046679 Bacteria 33474
453 Ga0495623_0025668 3300046679 Bacteria 3795
454 Ga0495623_0083070 3300046679 Bacteria 1979
455 Ga0495646_0141134 3300046680 Bacteria 1347
456 Ga0495658_0006315 3300046683 Bacteria 5826
457 Ga0495658_0116962 3300046683 Unclassified 1608
458 Ga0495671_0076426 3300046692 Bacteria 1642
459 Ga0495649_0019620 3300046694 Bacteria 3798
460 Ga0495649_0084200 3300046694 Bacteria 1698
461 Ga0495649_0121082 3300046694 Bacteria 1384
462 Ga0495600_0003758 3300046809 Bacteria 8985
463 Ga0495600_0033460 3300046809 Bacteria 3337
464 Ga0495600_0088082 3300046809 Unclassified 2025
465 Ga0495660_0045805 3300046810 Bacteria 2400
466 Ga0495581_0016603 3300047315 Bacteria 4279
467 Ga0495581_0053288 3300047315 Bacteria 2337
468 Ga0495604_0008664 3300047317 Bacteria 8037
469 Ga0495604_0074582 3300047317 Bacteria 2556
470 Ga0495674_0025112 3300047319 Bacteria 5468
471 Ga0495674_0095754 3300047319 Bacteria 2531
472 Ga0495674_0097700 3300047319 Bacteria 2501
473 Ga0495674_0104609 3300047319 Bacteria 2406
474 Ga0495676_0171043 3300047321 Bacteria 1529
475 Ga0495676_0290184 3300047321 Bacteria 1105
476 Ga0495680_0003741 3300047322 Bacteria 14821
477 Ga0495680_0004174 3300047322 Bacteria 13888
478 Ga0495680_0006328 3300047322 Bacteria 11021
479 Ga0495680_0017299 3300047322 Bacteria 6161
480 Ga0495683_0017557 3300047323 Bacteria 3708
481 Ga0495683_0039989 3300047323 Bacteria 2370
482 Ga0495687_036217 3300047443 Bacteria 2210
483 Ga0495675_0001793 3300047444 Bacteria 12793
484 Ga0495673_0047501 3300047469 Bacteria 1897
485 Ga0495673_0080996 3300047469 Bacteria 1345
486 Ga0495684_0006683 3300047471 Bacteria 8947
487 Ga0495684_0027789 3300047471 Bacteria 4345
488 Ga0495686_0035942 3300047472 Bacteria 3181
489 Ga0495593_0006057 3300047673 Bacteria 7113
490 Ga0495593_0104209 3300047673 Bacteria 1453
491 Ga0495602_0006975 3300048088 Bacteria 11864
492 Ga0495602_0012049 3300048088 Bacteria 8913
493 Ga0495602_0092780 3300048088 Bacteria 2500
494 Ga0495602_0129774 3300048088 Bacteria 2012
495 Ga0496100_0005901 3300048903 Bacteria 6635
496 Ga0496100_0028290 3300048903 Bacteria 3456
497 Ga0496100_0165197 3300048903 Unclassified 1589
498 Ga0496100_0181026 3300048903 Bacteria 1524
499 Ga0496100_0378226 3300048903 Bacteria 1075
500 Ga0496101_0004388 3300048904 Bacteria 8868
501 Ga0496101_0030995 3300048904 Bacteria 3755
502 Ga0496101_0034951 3300048904 Bacteria 3553
503 Ga0496101_0062972 3300048904 Bacteria 2698
504 Ga0496101_0263989 3300048904 Bacteria 1343
505 Ga0496102_0003175 3300048905 Bacteria 13938
506 Ga0496102_0063425 3300048905 Bacteria 3383
507 Ga0496102_0067819 3300048905 Bacteria 3272
508 Ga0496102_0068035 3300048905 Bacteria 3267
509 Ga0496102_0477487 3300048905 Bacteria 1168
510 Ga0496103_0002131 3300048906 Bacteria 12593
511 Ga0496103_0008761 3300048906 Bacteria 6003
512 Ga0496103_0013007 3300048906 Bacteria 4935
513 Ga0496103_0151918 3300048906 Unclassified 1483
514 Ga0496104_0000126 3300048907 Bacteria 70488
515 Ga0496104_0000752 3300048907 Bacteria 27722
516 Ga0496104_0014659 3300048907 Bacteria 7081
517 Ga0496104_0031478 3300048907 Bacteria 4934
518 Ga0496104_0051027 3300048907 Bacteria 3903
519 Ga0496104_0052621 3300048907 Bacteria 3846
520 Ga0496104_0086397 3300048907 Bacteria 2994
521 Ga0496104_0168054 3300048907 Bacteria 2103
522 Ga0496104_0172503 3300048907 Bacteria 2073
523 Ga0496105_0000117 3300048908 Bacteria 54274
524 Ga0496105_0002320 3300048908 Bacteria 13792
525 Ga0496105_0005325 3300048908 Bacteria 9752
526 Ga0496105_0006248 3300048908 Bacteria 9146
527 Ga0496105_0014702 3300048908 Bacteria 6231
528 Ga0496105_0108000 3300048908 Bacteria 2297
529 Ga0496105_0134819 3300048908 Bacteria 2034
530 Ga0496106_0004715 3300048909 Bacteria 10098
531 Ga0496106_0008815 3300048909 Bacteria 7453
532 Ga0496106_0026081 3300048909 Bacteria 4348
533 Ga0496106_0035073 3300048909 Bacteria 3749
534 Ga0496106_0209791 3300048909 Bacteria 1551
535 Ga0496106_0210161 3300048909 Bacteria 1550
536 Ga0496107_0000720 3300048910 Bacteria 18897
537 Ga0496107_0008852 3300048910 Bacteria 6975
538 Ga0496107_0017184 3300048910 Bacteria 5088
539 Ga0496107_0023923 3300048910 Bacteria 4318
540 Ga0496108_0000891 3300048911 Bacteria 23254
541 Ga0496108_0003501 3300048911 Bacteria 12578
542 Ga0496108_0015288 3300048911 Bacteria 6262
543 Ga0496108_0055899 3300048911 Bacteria 3315
544 Ga0496108_0078044 3300048911 Bacteria 2802
545 Ga0496108_0138171 3300048911 Bacteria 2098
546 Ga0496108_0173282 3300048911 Bacteria 1867
547 Ga0496108_0220907 3300048911 Unclassified 1646
548 Ga0496109_0006120 3300048912 Bacteria 10109
549 Ga0496109_0008433 3300048912 Bacteria 8761
550 Ga0496109_0030269 3300048912 Bacteria 4852
551 Ga0496109_0046584 3300048912 Bacteria 3939
552 Ga0496109_0048466 3300048912 Bacteria 3865
553 Ga0496109_0053713 3300048912 Bacteria 3675
554 Ga0496110_0007317 3300048913 Bacteria 8809
555 Ga0496110_0035722 3300048913 Bacteria 4313
556 Ga0496110_0106175 3300048913 Bacteria 2519
557 Ga0496110_0119747 3300048913 Bacteria 2371
558 Ga0496110_0221156 3300048913 Bacteria 1722
559 Ga0496110_0289123 3300048913 Bacteria 1493
560 Ga0496110_0415687 3300048913 Unclassified 1226
561 Ga0496111_0028921 3300048914 Bacteria 3930
562 Ga0496111_0034708 3300048914 Bacteria 3602
563 Ga0496111_0035491 3300048914 Bacteria 3564
564 Ga0496111_0037809 3300048914 Bacteria 3455
565 Ga0496111_0043022 3300048914 Bacteria 3245
566 Ga0496111_0079856 3300048914 Unclassified 2387
567 Ga0496112_0000029 3300048915 Bacteria 122291
568 Ga0496112_0005389 3300048915 Bacteria 11055
569 Ga0496112_0041726 3300048915 Bacteria 4489
570 Ga0496112_0075456 3300048915 Bacteria 3334
571 Ga0496112_0132695 3300048915 Bacteria 2461
572 Ga0496112_0577319 3300048915 Bacteria 1057
573 Ga0496113_0004051 3300048916 Bacteria 8924
574 Ga0496113_0005750 3300048916 Bacteria 7771
575 Ga0496113_0074246 3300048916 Bacteria 2592
576 Ga0496114_0003448 3300048917 Bacteria 12128
577 Ga0496114_0005405 3300048917 Bacteria 9989
578 Ga0496115_0008004 3300048918 Bacteria 7801
579 Ga0496115_0062789 3300048918 Bacteria 2997
580 Ga0496115_0086780 3300048918 Bacteria 2553
581 Ga0496115_0134294 3300048918 Bacteria 2040
582 Ga0496115_0200779 3300048918 Bacteria 1647
583 Ga0496115_0218905 3300048918 Bacteria 1571
584 Ga0496118_0014568 3300048921 Bacteria 7352
585 Ga0496118_0069456 3300048921 Bacteria 2551
586 Ga0496119_0004887 3300048922 Bacteria 13119
587 Ga0496120_0009660 3300048923 Bacteria 6809
588 Ga0496120_0049508 3300048923 Bacteria 2411
589 Ga0496122_0140989 3300048925 Bacteria 1508
590 Ga0496123_0160392 3300048926 Bacteria 1200
591 Ga0496124_0162654 3300048927 Bacteria 1738
592 Ga0496125_0024010 3300048928 Bacteria 5616
593 Ga0496126_0014981 3300048929 Bacteria 7817
594 Ga0496126_0296208 3300048929 Bacteria 1336
595 Ga0496126_0580731 3300048929 Bacteria 885
596 Ga0495682_0006058 3300049460 Bacteria 4932
597 Ga0495682_0007306 3300049460 Unclassified 4406
598 Ga0501032_0027872 3300049569 Bacteria 3881
599 Ga0501032_0037362 3300049569 Bacteria 3312
600 Ga0501033_0011750 3300049570 Bacteria 6694
601 Ga0501034_0019316 3300049571 Bacteria 6972
602 Ga0501034_0285896 3300049571 Bacteria 1588
603 Ga0501036_0021491 3300049572 Bacteria 5426
604 Ga0501036_0023796 3300049572 Bacteria 5161
605 Ga0501037_0010332 3300049573 Bacteria 6849
606 Ga0501037_0012130 3300049573 Bacteria 6345
607 Ga0501037_0211651 3300049573 Bacteria 1367
608 Ga0501037_0318655 3300049573 Bacteria 1077
609 Ga0501038_0004684 3300049574 Bacteria 12732
610 Ga0501039_0015274 3300049575 Bacteria 5877
611 Ga0501039_0101264 3300049575 Bacteria 2249
612 Ga0501043_0005879 3300049579 Bacteria 9869
613 Ga0501043_0011800 3300049579 Bacteria 6843
614 Ga0501043_0014802 3300049579 Bacteria 6107
615 Ga0501046_0017912 3300049580 Bacteria 5905
616 Ga0501047_0014719 3300049581 Bacteria 7444
617 Ga0501047_0034444 3300049581 Bacteria 4889
618 Ga0501047_0038179 3300049581 Bacteria 4645
619 Ga0501047_0297326 3300049581 Bacteria 1457
620 Ga0501048_0000150 3300049582 Bacteria 42721
621 Ga0501048_0387868 3300049582 Bacteria 998
622 Ga0501069_0186035 3300049585 Bacteria 1201
623 Ga0501073_0018817 3300049589 Plasmid 4991
624 Ga0501073_0221349 3300049589 Bacteria 1307
625 Ga0501074_0005366 3300049590 Bacteria 9220
626 Ga0501074_0011824 3300049590 Bacteria 6345
627 Ga0501079_0123415 3300049741 Bacteria 2014
628 Ga0501079_0135218 3300049741 Bacteria 1919
629 Ga0501080_0001372 3300049742 Bacteria 20366
630 Ga0501080_0034245 3300049742 Bacteria 4740
631 Ga0501080_0048863 3300049742 Bacteria 3936
632 Ga0501083_0001836 3300049744 Bacteria 14565
633 Ga0501044_0009883 3300049823 Bacteria 10367
634 Ga0501044_0015498 3300049823 Bacteria 8209
635 Ga0501044_0111194 3300049823 Bacteria 2747
636 nmdc:mga03n38_24553_c1 3300050490 Bacteria 2466
637 nmdc:mga00v17_187145_c1 3300050491 Bacteria 1336
638 nmdc:mga00v17_40423_c1 3300050491 Bacteria 2797
639 nmdc:mga00v17_59444_c1 3300050491 Bacteria 2345
640 nmdc:mga0yw44_93964_c1 3300050492 Bacteria 1900
641 nmdc:mga0k408_131123_c1 3300050493 Bacteria 1488
642 nmdc:mga0k408_18525_c1 3300050493 Bacteria 3887
643 nmdc:mga07m45_90422_c1 3300050496 Bacteria 1753
644 nmdc:mga05p37_134737_c1 3300050507 Bacteria 3030
645 nmdc:mga0sz30_29561_c1 3300050516 Bacteria 2260
646 nmdc:mga0sz30_9181_c1 3300050516 Bacteria 3753
647 Ga0495601_0000128 3300053077 Bacteria 42850
648 Ga0495601_0009195 3300053077 Bacteria 5840
649 Ga0495612_0000805 3300053078 Bacteria 12775
650 Ga0495612_0167768 3300053078 Unclassified 960
651 Ga0495595_0000530 3300053084 Bacteria 14567
652 Ga0495595_0001258 3300053084 Bacteria 9871
653 Ga0495595_0003450 3300053084 Bacteria 6271
654 Ga0495595_0026333 3300053084 Bacteria 2583
655 Ga0495619_0000016 3300053085 Bacteria 231442
656 Ga0495619_0000252 3300053085 Bacteria 38976
657 Ga0495619_0010019 3300053085 Bacteria 5966
658 Ga0495619_0218978 3300053085 Unclassified 1318
659 Ga0500578_0073949 3300053086 Bacteria 2171
660 Ga0500578_0109409 3300053086 Bacteria 1743
661 Ga0500578_0111147 3300053086 Bacteria 1727
662 Ga0500643_000168 3300053087 Bacteria 64858
663 Ga0500643_010318 3300053087 Bacteria 3488
664 Ga0500647_0028227 3300053091 Bacteria 2655
665 Ga0500651_0073483 3300053093 Bacteria 2125
666 Ga0500566_0001186 3300053094 Bacteria 15206
667 Ga0500566_0050603 3300053094 Bacteria 2379
668 Ga0500566_0087603 3300053094 Bacteria 1724
669 Ga0500641_0001637 3300053096 Bacteria 7976
670 Ga0500555_001537 3300053103 Bacteria 6987
671 Ga0500556_0005901 3300053104 Bacteria 3468
672 Ga0500557_000032 3300053105 Bacteria 74032
673 Ga0500569_026105 3300053109 Bacteria 1597
674 Ga0500572_004731 3300053111 Bacteria 3086
675 Ga0500595_000010 3300053119 Bacteria 275806
676 Ga0500595_018269 3300053119 Bacteria 2568
677 Ga0500607_043184 3300053121 Bacteria 2430
678 Ga0500608_134211 3300053122 Bacteria 1106
679 Ga0500642_0000197 3300053130 Bacteria 24598
680 Ga0500652_008171 3300053131 Bacteria 3474
681 Ga0500568_0005928 3300053139 Bacteria 6221
682 Ga0500590_063181 3300053148 Bacteria 1856
683 Ga0500616_0000001 3300053153 Bacteria 1986011
684 Ga0500616_0011058 3300053153 Bacteria 5365
685 Ga0500622_0138946 3300053156 Bacteria 1160
686 Ga0500633_0054663 3300053160 Bacteria 1388
687 Ga0500634_0102332 3300053161 Bacteria 1431
688 Ga0500638_008192 3300053162 Bacteria 4436
689 Ga0500636_0000990 3300053177 Bacteria 15245
690 Ga0500636_0068426 3300053177 Bacteria 2062
691 Ga0500625_000321 3300053729 Bacteria 11953
692 Ga0500625_057017 3300053729 Bacteria 1787
693 Ga0500645_001000 3300053730 Bacteria 15943
694 Ga0500645_027641 3300053730 Bacteria 1719
695 Ga0500552_002992 3300053733 Bacteria 1686
696 Ga0500599_000381 3300053736 Bacteria 4477
697 Ga0500601_000352 3300053737 Bacteria 8389
698 Ga0501084_0002310 3300054114 Bacteria 15306
699 Ga0501084_0561228 3300054114 Bacteria 965
700 Ga0500661_015418 3300055283 Bacteria 1370
701 Ga0501082_0054942 3300060353 Unclassified 3432

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0123019 Ga0495628_0123019_1222_1977 251
2 3300046660 Ga0495625_0148643 Ga0495625_0148643_808_1563 251
3 3300048918 Ga0496115_0200779 Ga0496115_0200779_870_1625 251
4 iso_pu_bacteria 8019687851 8019693261 252
5 3300046538 Ga0495609_0190368 Ga0495609_0190368_18_791 257
6 3300035692 Ga0373935_0273463 Ga0373935_0273463_32_814 260
7 3300046531 Ga0495665_0091119 Ga0495665_0091119_804_1586 260
8 3300010159 Ga0099796_10001500 Ga0099796_100015005 262
9 3300006175 Ga0070712_100085185 Ga0070712_1000851852 264
10 3300025915 Ga0207693_10095712 Ga0207693_100957123 264
11 3300010375 Ga0105239_10005950 Ga0105239_1000595011 265
12 3300049460 Ga0495682_0007306 Ga0495682_0007306_2899_3720 265
13 iso_pu_bacteria 2513237094 2513638297 266
14 iso_pu_bacteria 2885366525 2885367789 266
15 iso_pu_bacteria 2903727486 2903728368 266
16 iso_pu_bacteria 2941531003 2941534554 266
17 3300010159 Ga0099796_10042873 Ga0099796_100428732 269
18 3300046683 Ga0495658_0006315 Ga0495658_0006315_135_962 269
19 3300047321 Ga0495676_0171043 Ga0495676_0171043_610_1437 269
20 3300003215 JGI25153J46596_10010090 JGI25153J46596_100100905 270
21 3300003762 Ga0055542_1014266 Ga0055542_10142662 270
22 3300025261 Ga0209233_1012581 Ga0209233_10125811 270
23 3300025261 Ga0209233_1025527 Ga0209233_10255271 270
24 3300025272 Ga0209455_1003830 Ga0209455_10038306 270
25 3300025297 Ga0209758_1003319 Ga0209758_10033195 270
26 3300025911 Ga0207654_10173298 Ga0207654_101732982 270
27 3300039437 Ga0436365_1830792 Ga0436365_1830792_1303_2115 270
28 3300044658 Ga0466972_0000053 Ga0466972_0000053_31540_32352 270
29 3300044658 Ga0466972_0033341 Ga0466972_0033341_365_1177 270
30 3300044658 Ga0466972_0062459 Ga0466972_0062459_566_1378 270
31 3300044706 Ga0466964_0029672 Ga0466964_0029672_952_1764 270
32 3300044901 Ga0466960_0000619 Ga0466960_0000619_9091_9903 270
33 3300045049 Ga0466959_0305499 Ga0466959_0305499_137_949 270
34 3300045976 Ga0466967_0257769 Ga0466967_0257769_366_1178 270
35 3300046462 Ga0495651_0051595 Ga0495651_0051595_874_1686 270
36 3300046474 Ga0495605_0178657 Ga0495605_0178657_11_823 270
37 3300046476 Ga0495662_0201297 Ga0495662_0201297_62_874 270
38 3300046477 Ga0495664_0161780 Ga0495664_0161780_228_1040 270
39 3300046501 Ga0495607_0048959 Ga0495607_0048959_1133_1945 270
40 3300046516 Ga0495628_0410221 Ga0495628_0410221_129_941 270
41 3300046533 Ga0495640_0014947 Ga0495640_0014947_1314_2126 270
42 3300046538 Ga0495609_0063355 Ga0495609_0063355_387_1199 270
43 3300046557 Ga0495622_0017584 Ga0495622_0017584_989_1801 270
44 3300046616 Ga0495668_0123871 Ga0495668_0123871_407_1219 270
45 3300046642 Ga0495634_0026468 Ga0495634_0026468_1376_2188 270
46 3300046663 Ga0495635_0031347 Ga0495635_0031347_809_1621 270
47 3300046674 Ga0495588_0063353 Ga0495588_0063353_658_1470 270
48 3300046675 Ga0495657_0074532 Ga0495657_0074532_924_1736 270
49 3300046680 Ga0495646_0141134 Ga0495646_0141134_33_845 270
50 3300046692 Ga0495671_0076426 Ga0495671_0076426_219_1031 270
51 3300046694 Ga0495649_0019620 Ga0495649_0019620_524_1336 270
52 3300046694 Ga0495649_0121082 Ga0495649_0121082_470_1282 270
53 3300046809 Ga0495600_0003758 Ga0495600_0003758_4890_5702 270
54 3300047315 Ga0495581_0053288 Ga0495581_0053288_853_1665 270
55 3300047321 Ga0495676_0290184 Ga0495676_0290184_75_887 270
56 3300047323 Ga0495683_0039989 Ga0495683_0039989_631_1443 270
57 3300047469 Ga0495673_0047501 Ga0495673_0047501_72_884 270
58 3300048088 Ga0495602_0092780 Ga0495602_0092780_1498_2310 270
59 3300048905 Ga0496102_0477487 Ga0496102_0477487_95_928 270
60 3300048908 Ga0496105_0006248 Ga0496105_0006248_6139_6951 270
61 3300048909 Ga0496106_0026081 Ga0496106_0026081_1970_2803 270
62 3300048910 Ga0496107_0000720 Ga0496107_0000720_380_1213 270
63 3300048911 Ga0496108_0000891 Ga0496108_0000891_10437_11270 270
64 3300048912 Ga0496109_0006120 Ga0496109_0006120_8781_9614 270
65 3300048913 Ga0496110_0035722 Ga0496110_0035722_1888_2721 270
66 3300048914 Ga0496111_0035491 Ga0496111_0035491_157_990 270
67 3300048921 Ga0496118_0069456 Ga0496118_0069456_943_1755 270
68 3300048922 Ga0496119_0004887 Ga0496119_0004887_934_1746 270
69 3300048923 Ga0496120_0009660 Ga0496120_0009660_2483_3295 270
70 3300048929 Ga0496126_0014981 Ga0496126_0014981_757_1569 270
71 3300049460 Ga0495682_0006058 Ga0495682_0006058_884_1696 270
72 3300050491 nmdc:mga00v17_40423_c1 nmdc:mga00v17_40423_c1_722_1534 270
73 3300050496 nmdc:mga07m45_90422_c1 nmdc:mga07m45_90422_c1_193_1008 270
74 3300050507 nmdc:mga05p37_134737_c1 nmdc:mga05p37_134737_c1_1193_2005 270
75 3300050516 nmdc:mga0sz30_29561_c1 nmdc:mga0sz30_29561_c1_93_905 270
76 3300053086 Ga0500578_0073949 Ga0500578_0073949_707_1519 270
77 3300053086 Ga0500578_0109409 Ga0500578_0109409_511_1323 270
78 3300053094 Ga0500566_0001186 Ga0500566_0001186_8452_9264 270
79 3300053161 Ga0500634_0102332 Ga0500634_0102332_274_1086 270
80 3300053733 Ga0500552_002992 Ga0500552_002992_472_1284 270
81 3300005344 Ga0070661_100014282 Ga0070661_1000142826 271
82 3300005563 Ga0068855_100000529 Ga0068855_1000005299 271
83 3300005616 Ga0068852_100003179 Ga0068852_1000031794 271
84 3300009093 Ga0105240_10000055 Ga0105240_10000055202 271
85 3300009101 Ga0105247_10031115 Ga0105247_100311152 271
86 3300025900 Ga0207710_10040573 Ga0207710_100405731 271
87 3300025913 Ga0207695_10000012 Ga0207695_10000012135 271
88 3300025924 Ga0207694_10000006 Ga0207694_10000006530 271
89 3300025949 Ga0207667_10000026 Ga0207667_10000026259 271
90 3300026142 Ga0207698_10009584 Ga0207698_100095843 271
91 3300035116 Ga0373945_0066159 Ga0373945_0066159_167_982 271
92 3300035118 Ga0373954_0084974 Ga0373954_0084974_610_1425 271
93 3300037068 Ga0373925_0001273 Ga0373925_0001273_21037_21852 271
94 3300048088 Ga0495602_0006975 Ga0495602_0006975_10911_11726 271
95 3300054114 Ga0501084_0002310 Ga0501084_0002310_1486_2307 271
96 iso_pu_bacteria 2507262055 2507505958 271
97 iso_pu_bacteria 2508501009 2508540147 271
98 iso_pu_bacteria 2508501042 2508696221 271
99 iso_pu_bacteria 2511231028 2511394590 271
100 iso_pu_bacteria 2513237092 2513624866 271
101 iso_pu_bacteria 2513237095 2513649136 271
102 iso_pu_bacteria 2513237102 2513700202 271
103 iso_pu_bacteria 2513237139 2513877212 271
104 iso_pu_bacteria 2513237161 2514014581 271
105 iso_pu_bacteria 2517093001 2517103144 271
106 iso_pu_bacteria 2524023205 2524440803 271
107 iso_pu_bacteria 2617270735 2617347841 271
108 iso_pu_bacteria 2617270741 2617374763 271
109 iso_pu_bacteria 2643221547 2643758745 271
110 iso_pu_bacteria 2744054633 2745076044 271
111 iso_pu_bacteria 2791355196 2793061508 271
112 iso_pu_bacteria 2802429603 2805916188 271
113 iso_pu_bacteria 2816332527 2818240527 271
114 iso_pu_bacteria 2824600985 2824603662 271
115 iso_pu_bacteria 2824609381 2824610752 271
116 iso_pu_bacteria 2824617872 2824626200 271
117 iso_pu_bacteria 2824626560 2824632170 271
118 iso_pu_bacteria 2824635225 2824643427 271
119 iso_pu_bacteria 2824644064 2824651400 271
120 iso_pu_bacteria 2824671348 2824674042 271
121 iso_pu_bacteria 2824679649 2824686864 271
122 iso_pu_bacteria 2824687955 2824690708 271
123 iso_pu_bacteria 2824696289 2824699955 271
124 iso_pu_bacteria 2824704595 2824712787 271
125 iso_pu_bacteria 2824714736 2824721910 271
126 iso_pu_bacteria 2824723954 2824731731 271
127 iso_pu_bacteria 2824732956 2824739655 271
128 iso_pu_bacteria 2824746037 2824753467 271
129 iso_pu_bacteria 2824753945 2824763301 271
130 iso_pu_bacteria 2824763712 2824773172 271
131 iso_pu_bacteria 2824773399 2824776385 271
132 iso_pu_bacteria 2838122688 2838125051 271
133 iso_pu_bacteria 2841941048 2841945790 271
134 iso_pu_bacteria 2841949485 2841956889 271
135 iso_pu_bacteria 2841957949 2841963987 271
136 iso_pu_bacteria 2841966195 2841973551 271
137 iso_pu_bacteria 2841974524 2841981971 271
138 iso_pu_bacteria 2841983080 2841989439 271
139 iso_pu_bacteria 2842038055 2842044424 271
140 iso_pu_bacteria 2842045827 2842051587 271
141 iso_pu_bacteria 2844315083 2844316297 271
142 iso_pu_bacteria 2847930680 2847939400 271
143 iso_pu_bacteria 2847939898 2847941159 271
144 iso_pu_bacteria 2849076700 2849082148 271
145 iso_pu_bacteria 2874590934 2874596306 271
146 iso_pu_bacteria 2874612657 2874616493 271
147 iso_pu_bacteria 2874620515 2874622511 271
148 iso_pu_bacteria 2874628541 2874633419 271
149 iso_pu_bacteria 2874645413 2874650293 271
150 iso_pu_bacteria 2876761206 2876763702 271
151 iso_pu_bacteria 2876771140 2876776771 271
152 iso_pu_bacteria 2876818435 2876824561 271
153 iso_pu_bacteria 2879074833 2879080908 271
154 iso_pu_bacteria 2879083081 2879087073 271
155 iso_pu_bacteria 2879127579 2879133753 271
156 iso_pu_bacteria 2879142872 2879148255 271
157 iso_pu_bacteria 2881364244 2881369564 271
158 iso_pu_bacteria 2881665667 2881669719 271
159 iso_pu_bacteria 2885409591 2885418858 271
160 iso_pu_bacteria 2888378607 2888387204 271
161 iso_pu_bacteria 2888388044 2888389896 271
162 iso_pu_bacteria 2888419890 2888421214 271
163 iso_pu_bacteria 2904666416 2904671482 271
164 iso_pu_bacteria 2904711408 2904719778 271
165 iso_pu_bacteria 2906602504 2906606508 271
166 iso_pu_bacteria 2906626472 2906631398 271
167 iso_pu_bacteria 2906643746 2906646745 271
168 iso_pu_bacteria 2908775508 2908777244 271
169 iso_pu_bacteria 2922393267 2922398474 271
170 iso_pu_bacteria 2935608549 2935614383 271
171 iso_pu_bacteria 2935648319 2935649412 271
172 iso_pu_bacteria 2935656913 2935657816 271
173 iso_pu_bacteria 2935769743 2935770248 271
174 iso_pu_bacteria 2935777560 2935777724 271
175 iso_pu_bacteria 2935785616 2935786699 271
176 iso_pu_bacteria 2935793552 2935794753 271
177 iso_pu_bacteria 2935819856 2935826601 271
178 iso_pu_bacteria 2935847175 2935851105 271
179 iso_pu_bacteria 2935908558 2935913155 271
180 iso_pu_bacteria 2935916978 2935922577 271
181 iso_pu_bacteria 2935926038 2935930920 271
182 iso_pu_bacteria 2935934488 2935939746 271
183 iso_pu_bacteria 2935942939 2935946695 271
184 iso_pu_bacteria 2935951376 2935956104 271
185 iso_pu_bacteria 2935959822 2935965009 271
186 iso_pu_bacteria 2935967501 2935972897 271
187 iso_pu_bacteria 2935975950 2935978188 271
188 iso_pu_bacteria 2935984226 2935985688 271
189 iso_pu_bacteria 2936011229 2936012035 271
190 iso_pu_bacteria 2936019824 2936020884 271
191 iso_pu_bacteria 2936028420 2936029328 271
192 iso_pu_bacteria 2936046547 2936048348 271
193 iso_pu_bacteria 2936055302 2936056541 271
194 iso_pu_bacteria 3005483717 3005491106 271
195 iso_pu_bacteria 3005587118 3005592139 271
196 iso_pu_bacteria 3005710791 3005711846 271
197 iso_pu_bacteria 3005718088 3005719103 271
198 iso_pu_bacteria 8006926726 8006929746 271
199 iso_pu_bacteria 8016630954 8016634850 271
200 iso_pu_bacteria 8019538911 8019539620 271
201 iso_pu_bacteria 8019619141 8019621927 271
202 iso_pu_bacteria 8019638758 8019639219 271
203 iso_pu_bacteria 8019659431 8019668203 271
204 iso_pu_bacteria 8019668869 8019677663 271
205 iso_pu_bacteria 8019678201 8019687281 271
206 3300049573 Ga0501037_0211651 Ga0501037_0211651_448_1272 272
207 3300049581 Ga0501047_0034444 Ga0501047_0034444_1826_2650 272
208 3300049585 Ga0501069_0186035 Ga0501069_0186035_305_1129 272
209 3300049589 Ga0501073_0018817 Ga0501073_0018817_2046_2870 272
210 3300049590 Ga0501074_0011824 Ga0501074_0011824_2434_3258 272
211 3300049741 Ga0501079_0135218 Ga0501079_0135218_12_836 272
212 3300049742 Ga0501080_0048863 Ga0501080_0048863_2905_3729 272
213 iso_pu_bacteria 2932794094 2932796011 272
214 iso_pu_bacteria 2932801729 2932807589 272
215 iso_pu_bacteria 2935883170 2935887281 272
216 iso_pu_bacteria 3005506211 3005510947 272
217 iso_pu_bacteria 3005594810 3005595910 272
218 iso_pu_bacteria 8016522445 8016527017 272
219 iso_pu_bacteria 8016539877 8016545308 272
220 iso_pu_bacteria 8016548790 8016556781 272
221 iso_pu_bacteria 8016557553 8016565135 272
222 iso_pu_bacteria 8016566248 8016570391 272
223 iso_pu_bacteria 8016575299 8016582929 272
224 iso_pu_bacteria 8016595262 8016602782 272
225 iso_pu_bacteria 8016622563 8016624013 272
226 iso_pu_bacteria 8019530166 8019531914 272
227 iso_pu_bacteria 8019547302 8019551038 272
228 iso_pu_bacteria 8056967851 8056974118 272
229 3300005547 Ga0070693_100147826 Ga0070693_1001478262 273
230 3300049582 Ga0501048_0387868 Ga0501048_0387868_118_939 273
231 3300060353 Ga0501082_0054942 Ga0501082_0054942_955_1782 273
232 3300005548 Ga0070665_100025939 Ga0070665_1000259396 274
233 3300021384 Ga0213876_10226350 Ga0213876_102263502 274
234 3300028379 Ga0268266_10227280 Ga0268266_102272801 274
235 3300039437 Ga0436365_0425385 Ga0436365_0425385_959_1801 274
236 3300003203 JGI25406J46586_10000012 JGI25406J46586_1000001272 275
237 3300003215 JGI25153J46596_10007570 JGI25153J46596_100075706 275
238 3300003215 JGI25153J46596_10007805 JGI25153J46596_100078054 275
239 3300003215 JGI25153J46596_10007905 JGI25153J46596_100079056 275
240 3300003215 JGI25153J46596_10011735 JGI25153J46596_100117356 275
241 3300003354 JGI25160J50197_1001523 JGI25160J50197_10015238 275
242 3300003354 JGI25160J50197_1004156 JGI25160J50197_10041566 275
243 3300003794 Ga0055531_10017206 Ga0055531_100172062 275
244 3300004625 Ga0055543_1001971 Ga0055543_10019717 275
245 3300005262 Ga0065165_1000982 Ga0065165_100098229 275
246 3300005327 Ga0070658_10051779 Ga0070658_100517794 275
247 3300005327 Ga0070658_10355352 Ga0070658_103553521 275
248 3300005328 Ga0070676_10124442 Ga0070676_101244421 275
249 3300005329 Ga0070683_100023299 Ga0070683_1000232994 275
250 3300005331 Ga0070670_100073764 Ga0070670_1000737642 275
251 3300005334 Ga0068869_100277754 Ga0068869_1002777541 275
252 3300005335 Ga0070666_10018342 Ga0070666_100183423 275
253 3300005337 Ga0070682_100203239 Ga0070682_1002032391 275
254 3300005337 Ga0070682_100351791 Ga0070682_1003517911 275
255 3300005338 Ga0068868_100054852 Ga0068868_1000548521 275
256 3300005339 Ga0070660_100023598 Ga0070660_1000235984 275
257 3300005339 Ga0070660_100165349 Ga0070660_1001653492 275
258 3300005340 Ga0070689_100023388 Ga0070689_1000233884 275
259 3300005341 Ga0070691_10023144 Ga0070691_100231442 275
260 3300005344 Ga0070661_100019861 Ga0070661_1000198615 275
261 3300005347 Ga0070668_100022443 Ga0070668_1000224431 275
262 3300005355 Ga0070671_100010055 Ga0070671_1000100554 275
263 3300005355 Ga0070671_100052016 Ga0070671_1000520162 275
264 3300005355 Ga0070671_100071962 Ga0070671_1000719622 275
265 3300005356 Ga0070674_100050376 Ga0070674_1000503763 275
266 3300005366 Ga0070659_100527099 Ga0070659_1005270991 275
267 3300005367 Ga0070667_100054855 Ga0070667_1000548554 275
268 3300005367 Ga0070667_100072840 Ga0070667_1000728404 275
269 3300005367 Ga0070667_100081303 Ga0070667_1000813033 275
270 3300005434 Ga0070709_10002216 Ga0070709_100022164 275
271 3300005434 Ga0070709_10018192 Ga0070709_100181923 275
272 3300005434 Ga0070709_10172765 Ga0070709_101727651 275
273 3300005435 Ga0070714_100060786 Ga0070714_1000607863 275
274 3300005435 Ga0070714_100074728 Ga0070714_1000747285 275
275 3300005435 Ga0070714_100365096 Ga0070714_1003650962 275
276 3300005436 Ga0070713_100005731 Ga0070713_1000057313 275
277 3300005436 Ga0070713_100013315 Ga0070713_1000133151 275
278 3300005436 Ga0070713_100056783 Ga0070713_1000567832 275
279 3300005436 Ga0070713_100251054 Ga0070713_1002510542 275
280 3300005437 Ga0070710_10002966 Ga0070710_100029666 275
281 3300005437 Ga0070710_10004257 Ga0070710_100042572 275
282 3300005437 Ga0070710_10209689 Ga0070710_102096891 275
283 3300005438 Ga0070701_10333594 Ga0070701_103335941 275
284 3300005439 Ga0070711_100012216 Ga0070711_1000122164 275
285 3300005439 Ga0070711_100017604 Ga0070711_1000176045 275
286 3300005439 Ga0070711_100029550 Ga0070711_1000295504 275
287 3300005440 Ga0070705_100050455 Ga0070705_1000504552 275
288 3300005455 Ga0070663_100010322 Ga0070663_1000103221 275
289 3300005455 Ga0070663_100065655 Ga0070663_1000656551 275
290 3300005455 Ga0070663_100165065 Ga0070663_1001650652 275
291 3300005456 Ga0070678_100005437 Ga0070678_1000054375 275
292 3300005457 Ga0070662_100050455 Ga0070662_1000504554 275
293 3300005458 Ga0070681_10029471 Ga0070681_100294715 275
294 3300005466 Ga0070685_10162524 Ga0070685_101625241 275
295 3300005530 Ga0070679_100025513 Ga0070679_1000255136 275
296 3300005530 Ga0070679_100043101 Ga0070679_1000431012 275
297 3300005545 Ga0070695_100033610 Ga0070695_1000336103 275
298 3300005546 Ga0070696_100036249 Ga0070696_1000362495 275
299 3300005547 Ga0070693_100026376 Ga0070693_1000263764 275
300 3300005548 Ga0070665_100056381 Ga0070665_1000563816 275
301 3300005548 Ga0070665_100056661 Ga0070665_1000566614 275
302 3300005548 Ga0070665_100172139 Ga0070665_1001721391 275
303 3300005563 Ga0068855_100153238 Ga0068855_1001532384 275
304 3300005563 Ga0068855_100166033 Ga0068855_1001660333 275
305 3300005564 Ga0070664_100047921 Ga0070664_1000479214 275
306 3300005614 Ga0068856_100172913 Ga0068856_1001729132 275
307 3300005614 Ga0068856_100452562 Ga0068856_1004525622 275
308 3300005616 Ga0068852_100042826 Ga0068852_1000428264 275
309 3300005616 Ga0068852_100070253 Ga0068852_1000702534 275
310 3300005616 Ga0068852_100186585 Ga0068852_1001865851 275
311 3300005616 Ga0068852_100366348 Ga0068852_1003663483 275
312 3300005617 Ga0068859_100064654 Ga0068859_1000646541 275
313 3300005617 Ga0068859_100310395 Ga0068859_1003103952 275
314 3300005618 Ga0068864_100033860 Ga0068864_1000338602 275
315 3300005718 Ga0068866_10088473 Ga0068866_100884732 275
316 3300005841 Ga0068863_100668632 Ga0068863_1006686321 275
317 3300005842 Ga0068858_100010777 Ga0068858_1000107775 275
318 3300005842 Ga0068858_100175259 Ga0068858_1001752593 275
319 3300005843 Ga0068860_100311057 Ga0068860_1003110572 275
320 3300005937 Ga0081455_10094575 Ga0081455_100945754 275
321 3300005937 Ga0081455_10146879 Ga0081455_101468791 275
322 3300005983 Ga0081540_1017703 Ga0081540_10177031 275
323 3300005983 Ga0081540_1035683 Ga0081540_10356833 275
324 3300005985 Ga0081539_10000040 Ga0081539_10000040237 275
325 3300005985 Ga0081539_10072807 Ga0081539_100728072 275
326 3300006028 Ga0070717_10129308 Ga0070717_101293083 275
327 3300006028 Ga0070717_10217624 Ga0070717_102176241 275
328 3300006038 Ga0075365_10125115 Ga0075365_101251152 275
329 3300006042 Ga0075368_10001274 Ga0075368_100012748 275
330 3300006048 Ga0075363_100006553 Ga0075363_1000065536 275
331 3300006051 Ga0075364_10023980 Ga0075364_100239802 275
332 3300006051 Ga0075364_10043149 Ga0075364_100431494 275
333 3300006051 Ga0075364_10280459 Ga0075364_102804591 275
334 3300006163 Ga0070715_10001099 Ga0070715_100010996 275
335 3300006173 Ga0070716_100002384 Ga0070716_1000023845 275
336 3300006175 Ga0070712_100391538 Ga0070712_1003915381 275
337 3300006177 Ga0075362_10152395 Ga0075362_101523952 275
338 3300006178 Ga0075367_10044362 Ga0075367_100443623 275
339 3300006178 Ga0075367_10049189 Ga0075367_100491892 275
340 3300006178 Ga0075367_10068495 Ga0075367_100684953 275
341 3300006186 Ga0075369_10024233 Ga0075369_100242333 275
342 3300006186 Ga0075369_10029318 Ga0075369_100293184 275
343 3300006195 Ga0075366_10015724 Ga0075366_100157246 275
344 3300006195 Ga0075366_10129673 Ga0075366_101296732 275
345 3300006353 Ga0075370_10008389 Ga0075370_100083893 275
346 3300006353 Ga0075370_10032778 Ga0075370_100327782 275
347 3300006358 Ga0068871_100006182 Ga0068871_1000061825 275
348 3300006358 Ga0068871_100042552 Ga0068871_1000425525 275
349 3300006881 Ga0068865_100005241 Ga0068865_1000052417 275
350 3300006931 Ga0097620_100064654 Ga0097620_1000646541 275
351 3300006931 Ga0097620_100310411 Ga0097620_1003104112 275
352 3300006941 Ga0099825_1029794 Ga0099825_10297941 275
353 3300006944 Ga0099823_1020508 Ga0099823_10205086 275
354 3300009093 Ga0105240_10017001 Ga0105240_100170018 275
355 3300009094 Ga0111539_10576076 Ga0111539_105760761 275
356 3300009098 Ga0105245_10004710 Ga0105245_100047106 275
357 3300009098 Ga0105245_10124194 Ga0105245_101241941 275
358 3300009098 Ga0105245_10303364 Ga0105245_103033641 275
359 3300009098 Ga0105245_10430067 Ga0105245_104300672 275
360 3300009101 Ga0105247_10007722 Ga0105247_100077226 275
361 3300009101 Ga0105247_10224032 Ga0105247_102240322 275
362 3300009148 Ga0105243_10233853 Ga0105243_102338532 275
363 3300009148 Ga0105243_10343188 Ga0105243_103431882 275
364 3300009174 Ga0105241_10027893 Ga0105241_100278935 275
365 3300009174 Ga0105241_10086932 Ga0105241_100869323 275
366 3300009174 Ga0105241_10088741 Ga0105241_100887412 275
367 3300009174 Ga0105241_10251588 Ga0105241_102515881 275
368 3300009174 Ga0105241_10301812 Ga0105241_103018121 275
369 3300009176 Ga0105242_10011410 Ga0105242_100114105 275
370 3300009177 Ga0105248_10024075 Ga0105248_100240753 275
371 3300009177 Ga0105248_10065542 Ga0105248_100655424 275
372 3300009177 Ga0105248_10082496 Ga0105248_100824961 275
373 3300009545 Ga0105237_10002118 Ga0105237_1000211822 275
374 3300009545 Ga0105237_10215947 Ga0105237_102159474 275
375 3300009551 Ga0105238_10040937 Ga0105238_100409373 275
376 3300009551 Ga0105238_10090489 Ga0105238_100904895 275
377 3300009553 Ga0105249_10162867 Ga0105249_101628673 275
378 3300009553 Ga0105249_10194043 Ga0105249_101940432 275
379 3300009553 Ga0105249_10408311 Ga0105249_104083111 275
380 3300010375 Ga0105239_10072128 Ga0105239_100721285 275
381 3300010375 Ga0105239_10239668 Ga0105239_102396682 275
382 3300010375 Ga0105239_10318649 Ga0105239_103186492 275
383 3300010375 Ga0105239_10380624 Ga0105239_103806243 275
384 3300010375 Ga0105239_10477333 Ga0105239_104773331 275
385 3300010375 Ga0105239_10866740 Ga0105239_108667401 275
386 3300011119 Ga0105246_10017246 Ga0105246_100172463 275
387 3300011119 Ga0105246_10046711 Ga0105246_100467112 275
388 3300011119 Ga0105246_10088768 Ga0105246_100887682 275
389 3300011119 Ga0105246_10322327 Ga0105246_103223271 275
390 3300013100 Ga0157373_10054547 Ga0157373_100545472 275
391 3300013102 Ga0157371_10143059 Ga0157371_101430593 275
392 3300013104 Ga0157370_10079150 Ga0157370_100791503 275
393 3300013104 Ga0157370_10268253 Ga0157370_102682533 275
394 3300013105 Ga0157369_10413268 Ga0157369_104132682 275
395 3300013296 Ga0157374_10008513 Ga0157374_100085136 275
396 3300013296 Ga0157374_10014838 Ga0157374_100148384 275
397 3300013296 Ga0157374_10050674 Ga0157374_100506745 275
398 3300013297 Ga0157378_10005396 Ga0157378_100053968 275
399 3300013297 Ga0157378_10445721 Ga0157378_104457211 275
400 3300013306 Ga0163162_10009085 Ga0163162_1000908510 275
401 3300013306 Ga0163162_10087474 Ga0163162_100874743 275
402 3300013307 Ga0157372_10340073 Ga0157372_103400731 275
403 3300013308 Ga0157375_10012326 Ga0157375_100123264 275
404 3300014325 Ga0163163_10018613 Ga0163163_100186135 275
405 3300014325 Ga0163163_10024935 Ga0163163_100249352 275
406 3300014325 Ga0163163_10520379 Ga0163163_105203791 275
407 3300014968 Ga0157379_10008660 Ga0157379_100086604 275
408 3300014968 Ga0157379_10018738 Ga0157379_100187383 275
409 3300014968 Ga0157379_10024715 Ga0157379_100247156 275
410 3300014968 Ga0157379_10061174 Ga0157379_100611745 275
411 3300021320 Ga0214544_1000011 Ga0214544_1000011143 275
412 3300021321 Ga0214542_1000009 Ga0214542_100000999 275
413 3300021324 Ga0214545_1000007 Ga0214545_1000007143 275
414 3300021327 Ga0214543_1000020 Ga0214543_100002099 275
415 3300021384 Ga0213876_10100658 Ga0213876_101006582 275
416 3300021388 Ga0213875_10000011 Ga0213875_10000011199 275
417 3300025230 Ga0209563_101805 Ga0209563_1018056 275
418 3300025253 Ga0209677_100400 Ga0209677_10040014 275
419 3300025254 Ga0209148_1000321 Ga0209148_100032146 275
420 3300025261 Ga0209233_1001172 Ga0209233_10011727 275
421 3300025295 Ga0209564_1008083 Ga0209564_10080834 275
422 3300025297 Ga0209758_1000206 Ga0209758_100020632 275
423 3300025297 Ga0209758_1000536 Ga0209758_100053630 275
424 3300025297 Ga0209758_1001992 Ga0209758_100199219 275
425 3300025297 Ga0209758_1002275 Ga0209758_10022757 275
426 3300025297 Ga0209758_1038606 Ga0209758_10386062 275
427 3300025297 Ga0209758_1039740 Ga0209758_10397403 275
428 3300025299 Ga0209256_1004643 Ga0209256_10046438 275
429 3300025299 Ga0209256_1010195 Ga0209256_10101955 275
430 3300025299 Ga0209256_1049727 Ga0209256_10497271 275
431 3300025302 Ga0207426_1002091 Ga0207426_10020917 275
432 3300025302 Ga0207426_1002585 Ga0207426_10025858 275
433 3300025302 Ga0207426_1013422 Ga0207426_10134224 275
434 3300025302 Ga0207426_1015065 Ga0207426_10150655 275
435 3300025303 Ga0209051_1060403 Ga0209051_10604032 275
436 3300025304 Ga0209257_1000394 Ga0209257_100039432 275
437 3300025304 Ga0209257_1020044 Ga0209257_10200444 275
438 3300025898 Ga0207692_10031295 Ga0207692_100312953 275
439 3300025898 Ga0207692_10035710 Ga0207692_100357102 275
440 3300025899 Ga0207642_10070761 Ga0207642_100707612 275
441 3300025900 Ga0207710_10013015 Ga0207710_100130151 275
442 3300025900 Ga0207710_10037135 Ga0207710_100371352 275
443 3300025903 Ga0207680_10018562 Ga0207680_100185623 275
444 3300025904 Ga0207647_10005715 Ga0207647_100057156 275
445 3300025906 Ga0207699_10002176 Ga0207699_100021762 275
446 3300025906 Ga0207699_10058038 Ga0207699_100580381 275
447 3300025906 Ga0207699_10104794 Ga0207699_101047942 275
448 3300025906 Ga0207699_10318871 Ga0207699_103188711 275
449 3300025913 Ga0207695_10000006 Ga0207695_10000006610 275
450 3300025914 Ga0207671_10008630 Ga0207671_100086302 275
451 3300025914 Ga0207671_10169508 Ga0207671_101695082 275
452 3300025915 Ga0207693_10049568 Ga0207693_100495683 275
453 3300025915 Ga0207693_10183752 Ga0207693_101837521 275
454 3300025916 Ga0207663_10002864 Ga0207663_100028646 275
455 3300025916 Ga0207663_10033820 Ga0207663_100338202 275
456 3300025916 Ga0207663_10073295 Ga0207663_100732952 275
457 3300025916 Ga0207663_10216236 Ga0207663_102162361 275
458 3300025919 Ga0207657_10044394 Ga0207657_100443944 275
459 3300025919 Ga0207657_10114072 Ga0207657_101140724 275
460 3300025920 Ga0207649_10045682 Ga0207649_100456822 275
461 3300025922 Ga0207646_10510068 Ga0207646_105100681 275
462 3300025925 Ga0207650_10100767 Ga0207650_101007671 275
463 3300025927 Ga0207687_10016247 Ga0207687_100162474 275
464 3300025927 Ga0207687_10099471 Ga0207687_100994711 275
465 3300025927 Ga0207687_10211882 Ga0207687_102118822 275
466 3300025928 Ga0207700_10190827 Ga0207700_101908271 275
467 3300025928 Ga0207700_10288539 Ga0207700_102885392 275
468 3300025929 Ga0207664_10030862 Ga0207664_100308622 275
469 3300025931 Ga0207644_10020007 Ga0207644_100200074 275
470 3300025931 Ga0207644_10232097 Ga0207644_102320971 275
471 3300025933 Ga0207706_10025262 Ga0207706_100252622 275
472 3300025934 Ga0207686_10041573 Ga0207686_100415733 275
473 3300025938 Ga0207704_10003803 Ga0207704_100038036 275
474 3300025938 Ga0207704_10076977 Ga0207704_100769772 275
475 3300025939 Ga0207665_10005428 Ga0207665_100054285 275
476 3300025939 Ga0207665_10008613 Ga0207665_100086137 275
477 3300025939 Ga0207665_10053964 Ga0207665_100539642 275
478 3300025941 Ga0207711_10003089 Ga0207711_1000308911 275
479 3300025941 Ga0207711_10033717 Ga0207711_100337172 275
480 3300025941 Ga0207711_10239515 Ga0207711_102395151 275
481 3300025941 Ga0207711_10725017 Ga0207711_107250171 275
482 3300025944 Ga0207661_10015446 Ga0207661_100154464 275
483 3300025945 Ga0207679_10005027 Ga0207679_1000502710 275
484 3300025949 Ga0207667_10071501 Ga0207667_100715015 275
485 3300025949 Ga0207667_10387207 Ga0207667_103872071 275
486 3300025961 Ga0207712_10230589 Ga0207712_102305892 275
487 3300025972 Ga0207668_10169373 Ga0207668_101693732 275
488 3300025981 Ga0207640_10114731 Ga0207640_101147311 275
489 3300025986 Ga0207658_10231159 Ga0207658_102311591 275
490 3300026023 Ga0207677_10034827 Ga0207677_100348274 275
491 3300026035 Ga0207703_10043250 Ga0207703_100432502 275
492 3300026035 Ga0207703_10110278 Ga0207703_101102782 275
493 3300026035 Ga0207703_10222676 Ga0207703_102226762 275
494 3300026041 Ga0207639_10250476 Ga0207639_102504761 275
495 3300026067 Ga0207678_10122456 Ga0207678_101224562 275
496 3300026067 Ga0207678_10314662 Ga0207678_103146621 275
497 3300026067 Ga0207678_10347639 Ga0207678_103476392 275
498 3300026078 Ga0207702_10101662 Ga0207702_101016622 275
499 3300026078 Ga0207702_10215133 Ga0207702_102151332 275
500 3300026078 Ga0207702_10224154 Ga0207702_102241542 275
501 3300026078 Ga0207702_10369251 Ga0207702_103692511 275
502 3300026088 Ga0207641_10229996 Ga0207641_102299962 275
503 3300026089 Ga0207648_10049805 Ga0207648_100498053 275
504 3300026095 Ga0207676_10162185 Ga0207676_101621851 275
505 3300026116 Ga0207674_10055792 Ga0207674_100557922 275
506 3300026116 Ga0207674_10070190 Ga0207674_100701904 275
507 3300026121 Ga0207683_10032293 Ga0207683_100322935 275
508 3300026142 Ga0207698_10005418 Ga0207698_100054186 275
509 3300027296 Ga0209389_1000039 Ga0209389_100003988 275
510 3300027361 Ga0209489_100087 Ga0209489_10008788 275
511 3300027363 Ga0209700_100090 Ga0209700_10009028 275
512 3300027671 Ga0209588_1014000 Ga0209588_10140004 275
513 3300028379 Ga0268266_10004873 Ga0268266_1000487310 275
514 3300028379 Ga0268266_10021144 Ga0268266_100211446 275
515 3300028379 Ga0268266_10069109 Ga0268266_100691092 275
516 3300028380 Ga0268265_10233231 Ga0268265_102332312 275
517 3300028381 Ga0268264_10249844 Ga0268264_102498442 275
518 3300030521 Ga0307511_10067940 Ga0307511_100679402 275
519 3300031241 Ga0265325_10000398 Ga0265325_100003987 275
520 3300031241 Ga0265325_10025536 Ga0265325_100255366 275
521 3300031241 Ga0265325_10041188 Ga0265325_100411884 275
522 3300031344 Ga0265316_10054306 Ga0265316_100543061 275
523 3300031595 Ga0265313_10011516 Ga0265313_100115167 275
524 3300031595 Ga0265313_10029312 Ga0265313_100293121 275
525 3300031711 Ga0265314_10000439 Ga0265314_100004399 275
526 3300031712 Ga0265342_10000882 Ga0265342_1000088227 275
527 3300031730 Ga0307516_10007612 Ga0307516_100076128 275
528 3300031730 Ga0307516_10008613 Ga0307516_100086132 275
529 3300031730 Ga0307516_10021682 Ga0307516_100216821 275
530 3300031995 Ga0307409_100503362 Ga0307409_1005033621 275
531 3300033179 Ga0307507_10154980 Ga0307507_101549802 275
532 3300033180 Ga0307510_10024382 Ga0307510_100243827 275
533 3300033180 Ga0307510_10028911 Ga0307510_100289116 275
534 3300035111 Ga0373923_0020877 Ga0373923_0020877_1108_1935 275
535 3300035115 Ga0373941_0000525 Ga0373941_0000525_3369_4196 275
536 3300035118 Ga0373954_0002960 Ga0373954_0002960_1734_2561 275
537 3300035119 Ga0373956_0011394 Ga0373956_0011394_1825_2652 275
538 3300035119 Ga0373956_0050147 Ga0373956_0050147_490_1317 275
539 3300035120 Ga0373957_0011249 Ga0373957_0011249_812_1639 275
540 3300035171 Ga0373946_0073401 Ga0373946_0073401_426_1253 275
541 3300035172 Ga0373955_0004355 Ga0373955_0004355_2783_3610 275
542 3300035172 Ga0373955_0007183 Ga0373955_0007183_1038_1865 275
543 3300035410 Ga0373924_0011648 Ga0373924_0011648_2380_3207 275
544 3300035410 Ga0373924_0075560 Ga0373924_0075560_22_858 275
545 3300035691 Ga0373931_0145767 Ga0373931_0145767_464_1291 275
546 3300035695 Ga0373927_0065680 Ga0373927_0065680_933_1760 275
547 3300035695 Ga0373927_0352950 Ga0373927_0352950_110_937 275
548 3300035724 Ga0373933_0006532 Ga0373933_0006532_1560_2387 275
549 3300035724 Ga0373933_0028937 Ga0373933_0028937_224_1051 275
550 3300035724 Ga0373933_0054315 Ga0373933_0054315_1518_2345 275
551 3300035724 Ga0373933_0197899 Ga0373933_0197899_195_1022 275
552 3300035725 Ga0373947_0228352 Ga0373947_0228352_296_1123 275
553 3300036401 Ga0373937_0004592 Ga0373937_0004592_10286_11113 275
554 3300036401 Ga0373937_0005159 Ga0373937_0005159_9025_9852 275
555 3300036401 Ga0373937_0021587 Ga0373937_0021587_3108_3935 275
556 3300036401 Ga0373937_0031801 Ga0373937_0031801_3307_4134 275
557 3300036401 Ga0373937_0388096 Ga0373937_0388096_120_947 275
558 3300037068 Ga0373925_0144421 Ga0373925_0144421_896_1723 275
559 3300037312 Ga0395899_0028090 Ga0395899_0028090_2744_3574 275
560 3300037418 Ga0395900_0003044 Ga0395900_0003044_13119_13949 275
561 3300037418 Ga0395900_0268887 Ga0395900_0268887_136_963 275
562 3300037466 Ga0395898_0009793 Ga0395898_0009793_5305_6135 275
563 3300037466 Ga0395898_0173849 Ga0395898_0173849_1152_1979 275
564 3300037471 Ga0395905_0001273 Ga0395905_0001273_19866_20693 275
565 3300037471 Ga0395905_0018089 Ga0395905_0018089_1756_2583 275
566 3300037853 Ga0436364_0015606 Ga0436364_0015606_1419_2249 275
567 3300037853 Ga0436364_0604898 Ga0436364_0604898_547_1389 275
568 3300037853 Ga0436364_0728139 Ga0436364_0728139_57261_58091 275
569 3300038443 Ga0395901_0295504 Ga0395901_0295504_280_1110 275
570 3300039438 Ga0436360_0310474 Ga0436360_0310474_542_1375 275
571 3300041452 Ga0451793_1684190 Ga0451793_1684190_237_1064 275
572 3300041453 Ga0451797_1288970 Ga0451797_1288970_482_1309 275
573 3300041460 Ga0451802_0495993 Ga0451802_0495993_30_857 275
574 3300041512 Ga0451853_2299509 Ga0451853_2299509_100_927 275
575 3300044684 Ga0466966_0000322 Ga0466966_0000322_4349_5179 275
576 3300044693 Ga0466961_0002390 Ga0466961_0002390_6046_6876 275
577 3300044693 Ga0466961_0126373 Ga0466961_0126373_249_1079 275
578 3300044694 Ga0466963_0005897 Ga0466963_0005897_3054_3884 275
579 3300044706 Ga0466964_0071745 Ga0466964_0071745_71_901 275
580 3300044765 Ga0466970_0143407 Ga0466970_0143407_130_960 275
581 3300044842 Ga0466957_0027315 Ga0466957_0027315_2071_2901 275
582 3300045976 Ga0466967_0048518 Ga0466967_0048518_599_1435 275
583 3300045976 Ga0466967_0090301 Ga0466967_0090301_1290_2120 275
584 3300046460 Ga0495638_0005066 Ga0495638_0005066_3312_4139 275
585 3300046462 Ga0495651_0005183 Ga0495651_0005183_6817_7644 275
586 3300046462 Ga0495651_0047894 Ga0495651_0047894_1311_2141 275
587 3300046462 Ga0495651_0058218 Ga0495651_0058218_236_1063 275
588 3300046463 Ga0495653_0005744 Ga0495653_0005744_9073_9900 275
589 3300046476 Ga0495662_0016908 Ga0495662_0016908_2014_2841 275
590 3300046477 Ga0495664_0003461 Ga0495664_0003461_2032_2859 275
591 3300046477 Ga0495664_0037276 Ga0495664_0037276_609_1439 275
592 3300046499 Ga0495594_0145242 Ga0495594_0145242_56_883 275
593 3300046507 Ga0495606_0007723 Ga0495606_0007723_2623_3450 275
594 3300046507 Ga0495606_0080074 Ga0495606_0080074_214_1041 275
595 3300046507 Ga0495606_0227218 Ga0495606_0227218_147_974 275
596 3300046511 Ga0495608_0004462 Ga0495608_0004462_204_1031 275
597 3300046511 Ga0495608_0027747 Ga0495608_0027747_1772_2599 275
598 3300046511 Ga0495608_0062915 Ga0495608_0062915_78_905 275
599 3300046512 Ga0495610_0082047 Ga0495610_0082047_284_1111 275
600 3300046515 Ga0495620_0064869 Ga0495620_0064869_445_1272 275
601 3300046516 Ga0495628_0001465 Ga0495628_0001465_5161_5988 275
602 3300046516 Ga0495628_0009727 Ga0495628_0009727_2534_3361 275
603 3300046516 Ga0495628_0099864 Ga0495628_0099864_127_954 275
604 3300046517 Ga0495630_0185612 Ga0495630_0185612_41_868 275
605 3300046517 Ga0495630_0382709 Ga0495630_0382709_107_934 275
606 3300046529 Ga0495652_0002359 Ga0495652_0002359_3214_4041 275
607 3300046529 Ga0495652_0114375 Ga0495652_0114375_515_1342 275
608 3300046529 Ga0495652_0342689 Ga0495652_0342689_180_1007 275
609 3300046533 Ga0495640_0013003 Ga0495640_0013003_741_1568 275
610 3300046533 Ga0495640_0049154 Ga0495640_0049154_1216_2046 275
611 3300046535 Ga0495586_0006236 Ga0495586_0006236_3618_4445 275
612 3300046536 Ga0495587_0007520 Ga0495587_0007520_886_1713 275
613 3300046543 Ga0495645_0004750 Ga0495645_0004750_8255_9082 275
614 3300046543 Ga0495645_0009901 Ga0495645_0009901_4152_4979 275
615 3300046543 Ga0495645_0054130 Ga0495645_0054130_146_976 275
616 3300046559 Ga0495667_0004513 Ga0495667_0004513_7258_8088 275
617 3300046559 Ga0495667_0059836 Ga0495667_0059836_322_1149 275
618 3300046559 Ga0495667_0298367 Ga0495667_0298367_11_838 275
619 3300046616 Ga0495668_0013172 Ga0495668_0013172_666_1493 275
620 3300046642 Ga0495634_0047344 Ga0495634_0047344_1869_2696 275
621 3300046663 Ga0495635_0009985 Ga0495635_0009985_777_1604 275
622 3300046663 Ga0495635_0064254 Ga0495635_0064254_1604_2431 275
623 3300046663 Ga0495635_0082487 Ga0495635_0082487_1201_2028 275
624 3300046663 Ga0495635_0175425 Ga0495635_0175425_425_1252 275
625 3300046675 Ga0495657_0002195 Ga0495657_0002195_613_1440 275
626 3300046675 Ga0495657_0013992 Ga0495657_0013992_732_1562 275
627 3300046675 Ga0495657_0027589 Ga0495657_0027589_2842_3669 275
628 3300046678 Ga0495599_0001128 Ga0495599_0001128_8648_9475 275
629 3300046678 Ga0495599_0002972 Ga0495599_0002972_8437_9264 275
630 3300046679 Ga0495623_0000278 Ga0495623_0000278_12861_13688 275
631 3300046679 Ga0495623_0025668 Ga0495623_0025668_1660_2487 275
632 3300046679 Ga0495623_0083070 Ga0495623_0083070_704_1531 275
633 3300046683 Ga0495658_0116962 Ga0495658_0116962_411_1238 275
634 3300046694 Ga0495649_0084200 Ga0495649_0084200_16_843 275
635 3300046809 Ga0495600_0033460 Ga0495600_0033460_1175_2005 275
636 3300046809 Ga0495600_0088082 Ga0495600_0088082_143_970 275
637 3300046810 Ga0495660_0045805 Ga0495660_0045805_774_1601 275
638 3300047315 Ga0495581_0016603 Ga0495581_0016603_1886_2713 275
639 3300047317 Ga0495604_0008664 Ga0495604_0008664_4843_5670 275
640 3300047317 Ga0495604_0074582 Ga0495604_0074582_1411_2241 275
641 3300047319 Ga0495674_0025112 Ga0495674_0025112_1833_2663 275
642 3300047319 Ga0495674_0095754 Ga0495674_0095754_1320_2147 275
643 3300047319 Ga0495674_0097700 Ga0495674_0097700_1345_2172 275
644 3300047319 Ga0495674_0104609 Ga0495674_0104609_136_963 275
645 3300047322 Ga0495680_0003741 Ga0495680_0003741_11920_12747 275
646 3300047322 Ga0495680_0004174 Ga0495680_0004174_8767_9594 275
647 3300047322 Ga0495680_0006328 Ga0495680_0006328_5578_6408 275
648 3300047322 Ga0495680_0017299 Ga0495680_0017299_3596_4423 275
649 3300047323 Ga0495683_0017557 Ga0495683_0017557_1345_2172 275
650 3300047443 Ga0495687_036217 Ga0495687_036217_378_1205 275
651 3300047444 Ga0495675_0001793 Ga0495675_0001793_8441_9268 275
652 3300047469 Ga0495673_0080996 Ga0495673_0080996_127_954 275
653 3300047471 Ga0495684_0006683 Ga0495684_0006683_3617_4444 275
654 3300047471 Ga0495684_0027789 Ga0495684_0027789_1927_2757 275
655 3300047472 Ga0495686_0035942 Ga0495686_0035942_473_1300 275
656 3300047673 Ga0495593_0006057 Ga0495593_0006057_760_1587 275
657 3300047673 Ga0495593_0104209 Ga0495593_0104209_580_1410 275
658 3300048088 Ga0495602_0012049 Ga0495602_0012049_7421_8248 275
659 3300048088 Ga0495602_0129774 Ga0495602_0129774_1139_1969 275
660 3300048903 Ga0496100_0005901 Ga0496100_0005901_1421_2248 275
661 3300048903 Ga0496100_0028290 Ga0496100_0028290_2199_3026 275
662 3300048903 Ga0496100_0165197 Ga0496100_0165197_729_1556 275
663 3300048903 Ga0496100_0181026 Ga0496100_0181026_88_915 275
664 3300048903 Ga0496100_0378226 Ga0496100_0378226_32_859 275
665 3300048904 Ga0496101_0004388 Ga0496101_0004388_2646_3473 275
666 3300048904 Ga0496101_0030995 Ga0496101_0030995_273_1100 275
667 3300048904 Ga0496101_0034951 Ga0496101_0034951_1392_2219 275
668 3300048904 Ga0496101_0062972 Ga0496101_0062972_1483_2310 275
669 3300048904 Ga0496101_0263989 Ga0496101_0263989_413_1240 275
670 3300048905 Ga0496102_0003175 Ga0496102_0003175_7560_8387 275
671 3300048905 Ga0496102_0063425 Ga0496102_0063425_824_1651 275
672 3300048905 Ga0496102_0067819 Ga0496102_0067819_154_981 275
673 3300048905 Ga0496102_0068035 Ga0496102_0068035_1411_2238 275
674 3300048906 Ga0496103_0002131 Ga0496103_0002131_6386_7213 275
675 3300048906 Ga0496103_0008761 Ga0496103_0008761_519_1346 275
676 3300048906 Ga0496103_0013007 Ga0496103_0013007_1009_1836 275
677 3300048906 Ga0496103_0151918 Ga0496103_0151918_287_1114 275
678 3300048907 Ga0496104_0000126 Ga0496104_0000126_45357_46184 275
679 3300048907 Ga0496104_0000752 Ga0496104_0000752_3180_4007 275
680 3300048907 Ga0496104_0014659 Ga0496104_0014659_4970_5797 275
681 3300048907 Ga0496104_0031478 Ga0496104_0031478_2188_3015 275
682 3300048907 Ga0496104_0051027 Ga0496104_0051027_203_1030 275
683 3300048907 Ga0496104_0052621 Ga0496104_0052621_1152_1979 275
684 3300048907 Ga0496104_0086397 Ga0496104_0086397_1646_2473 275
685 3300048907 Ga0496104_0168054 Ga0496104_0168054_771_1598 275
686 3300048907 Ga0496104_0172503 Ga0496104_0172503_1024_1851 275
687 3300048908 Ga0496105_0000117 Ga0496105_0000117_13341_14168 275
688 3300048908 Ga0496105_0002320 Ga0496105_0002320_1345_2172 275
689 3300048908 Ga0496105_0005325 Ga0496105_0005325_8085_8912 275
690 3300048908 Ga0496105_0014702 Ga0496105_0014702_2150_2977 275
691 3300048908 Ga0496105_0108000 Ga0496105_0108000_1227_2054 275
692 3300048908 Ga0496105_0134819 Ga0496105_0134819_404_1231 275
693 3300048909 Ga0496106_0004715 Ga0496106_0004715_6868_7695 275
694 3300048909 Ga0496106_0008815 Ga0496106_0008815_6454_7281 275
695 3300048909 Ga0496106_0035073 Ga0496106_0035073_2483_3310 275
696 3300048909 Ga0496106_0209791 Ga0496106_0209791_678_1505 275
697 3300048909 Ga0496106_0210161 Ga0496106_0210161_422_1249 275
698 3300048910 Ga0496107_0008852 Ga0496107_0008852_3644_4471 275
699 3300048910 Ga0496107_0017184 Ga0496107_0017184_3092_3919 275
700 3300048910 Ga0496107_0023923 Ga0496107_0023923_3289_4116 275
701 3300048911 Ga0496108_0003501 Ga0496108_0003501_2632_3459 275
702 3300048911 Ga0496108_0015288 Ga0496108_0015288_4995_5822 275
703 3300048911 Ga0496108_0055899 Ga0496108_0055899_1526_2353 275
704 3300048911 Ga0496108_0078044 Ga0496108_0078044_698_1525 275
705 3300048911 Ga0496108_0138171 Ga0496108_0138171_16_843 275
706 3300048911 Ga0496108_0173282 Ga0496108_0173282_625_1452 275
707 3300048911 Ga0496108_0220907 Ga0496108_0220907_457_1284 275
708 3300048912 Ga0496109_0008433 Ga0496109_0008433_6840_7667 275
709 3300048912 Ga0496109_0030269 Ga0496109_0030269_411_1238 275
710 3300048912 Ga0496109_0046584 Ga0496109_0046584_1368_2195 275
711 3300048912 Ga0496109_0048466 Ga0496109_0048466_42_869 275
712 3300048912 Ga0496109_0053713 Ga0496109_0053713_2337_3164 275
713 3300048913 Ga0496110_0007317 Ga0496110_0007317_1723_2550 275
714 3300048913 Ga0496110_0106175 Ga0496110_0106175_790_1617 275
715 3300048913 Ga0496110_0119747 Ga0496110_0119747_1481_2308 275
716 3300048913 Ga0496110_0221156 Ga0496110_0221156_31_858 275
717 3300048913 Ga0496110_0289123 Ga0496110_0289123_437_1264 275
718 3300048913 Ga0496110_0415687 Ga0496110_0415687_218_1045 275
719 3300048914 Ga0496111_0028921 Ga0496111_0028921_970_1797 275
720 3300048914 Ga0496111_0034708 Ga0496111_0034708_921_1748 275
721 3300048914 Ga0496111_0037809 Ga0496111_0037809_1246_2073 275
722 3300048914 Ga0496111_0043022 Ga0496111_0043022_2375_3202 275
723 3300048914 Ga0496111_0079856 Ga0496111_0079856_57_884 275
724 3300048915 Ga0496112_0000029 Ga0496112_0000029_39533_40360 275
725 3300048915 Ga0496112_0005389 Ga0496112_0005389_1365_2192 275
726 3300048915 Ga0496112_0041726 Ga0496112_0041726_167_994 275
727 3300048915 Ga0496112_0075456 Ga0496112_0075456_1366_2193 275
728 3300048915 Ga0496112_0132695 Ga0496112_0132695_1534_2361 275
729 3300048915 Ga0496112_0577319 Ga0496112_0577319_124_951 275
730 3300048916 Ga0496113_0004051 Ga0496113_0004051_6364_7191 275
731 3300048916 Ga0496113_0005750 Ga0496113_0005750_2097_2924 275
732 3300048916 Ga0496113_0074246 Ga0496113_0074246_1139_1966 275
733 3300048917 Ga0496114_0003448 Ga0496114_0003448_9418_10245 275
734 3300048917 Ga0496114_0005405 Ga0496114_0005405_5727_6554 275
735 3300048918 Ga0496115_0008004 Ga0496115_0008004_390_1217 275
736 3300048918 Ga0496115_0062789 Ga0496115_0062789_230_1102 275
737 3300048918 Ga0496115_0086780 Ga0496115_0086780_1567_2394 275
738 3300048918 Ga0496115_0134294 Ga0496115_0134294_220_1047 275
739 3300048918 Ga0496115_0218905 Ga0496115_0218905_152_979 275
740 3300048921 Ga0496118_0014568 Ga0496118_0014568_5176_6003 275
741 3300048923 Ga0496120_0049508 Ga0496120_0049508_202_1029 275
742 3300048925 Ga0496122_0140989 Ga0496122_0140989_47_874 275
743 3300048926 Ga0496123_0160392 Ga0496123_0160392_210_1037 275
744 3300048927 Ga0496124_0162654 Ga0496124_0162654_519_1346 275
745 3300048928 Ga0496125_0024010 Ga0496125_0024010_2400_3227 275
746 3300048929 Ga0496126_0296208 Ga0496126_0296208_301_1173 275
747 3300048929 Ga0496126_0580731 Ga0496126_0580731_37_864 275
748 3300049569 Ga0501032_0027872 Ga0501032_0027872_801_1628 275
749 3300049569 Ga0501032_0037362 Ga0501032_0037362_135_962 275
750 3300049570 Ga0501033_0011750 Ga0501033_0011750_3227_4054 275
751 3300049571 Ga0501034_0019316 Ga0501034_0019316_5952_6779 275
752 3300049571 Ga0501034_0285896 Ga0501034_0285896_99_1034 275
753 3300049572 Ga0501036_0021491 Ga0501036_0021491_2699_3526 275
754 3300049572 Ga0501036_0023796 Ga0501036_0023796_2200_3027 275
755 3300049573 Ga0501037_0010332 Ga0501037_0010332_2751_3578 275
756 3300049573 Ga0501037_0012130 Ga0501037_0012130_2826_3653 275
757 3300049573 Ga0501037_0318655 Ga0501037_0318655_139_966 275
758 3300049574 Ga0501038_0004684 Ga0501038_0004684_9613_10440 275
759 3300049575 Ga0501039_0015274 Ga0501039_0015274_2055_2882 275
760 3300049575 Ga0501039_0101264 Ga0501039_0101264_256_1083 275
761 3300049579 Ga0501043_0005879 Ga0501043_0005879_6160_6987 275
762 3300049579 Ga0501043_0011800 Ga0501043_0011800_3286_4113 275
763 3300049579 Ga0501043_0014802 Ga0501043_0014802_3285_4112 275
764 3300049580 Ga0501046_0017912 Ga0501046_0017912_172_999 275
765 3300049581 Ga0501047_0014719 Ga0501047_0014719_1225_2052 275
766 3300049581 Ga0501047_0038179 Ga0501047_0038179_3398_4225 275
767 3300049581 Ga0501047_0297326 Ga0501047_0297326_132_959 275
768 3300049582 Ga0501048_0000150 Ga0501048_0000150_7212_8039 275
769 3300049589 Ga0501073_0221349 Ga0501073_0221349_65_892 275
770 3300049590 Ga0501074_0005366 Ga0501074_0005366_2266_3093 275
771 3300049741 Ga0501079_0123415 Ga0501079_0123415_568_1395 275
772 3300049742 Ga0501080_0001372 Ga0501080_0001372_2017_2844 275
773 3300049742 Ga0501080_0034245 Ga0501080_0034245_3377_4204 275
774 3300049744 Ga0501083_0001836 Ga0501083_0001836_7397_8224 275
775 3300049823 Ga0501044_0009883 Ga0501044_0009883_6320_7147 275
776 3300049823 Ga0501044_0015498 Ga0501044_0015498_247_1074 275
777 3300049823 Ga0501044_0111194 Ga0501044_0111194_1387_2214 275
778 3300050490 nmdc:mga03n38_24553_c1 nmdc:mga03n38_24553_c1_507_1334 275
779 3300050491 nmdc:mga00v17_187145_c1 nmdc:mga00v17_187145_c1_177_1004 275
780 3300050491 nmdc:mga00v17_59444_c1 nmdc:mga00v17_59444_c1_578_1405 275
781 3300050492 nmdc:mga0yw44_93964_c1 nmdc:mga0yw44_93964_c1_785_1612 275
782 3300050493 nmdc:mga0k408_131123_c1 nmdc:mga0k408_131123_c1_139_966 275
783 3300050493 nmdc:mga0k408_18525_c1 nmdc:mga0k408_18525_c1_364_1191 275
784 3300050516 nmdc:mga0sz30_9181_c1 nmdc:mga0sz30_9181_c1_1364_2191 275
785 3300053077 Ga0495601_0000128 Ga0495601_0000128_41168_41995 275
786 3300053077 Ga0495601_0009195 Ga0495601_0009195_3599_4426 275
787 3300053078 Ga0495612_0000805 Ga0495612_0000805_620_1447 275
788 3300053078 Ga0495612_0167768 Ga0495612_0167768_123_950 275
789 3300053084 Ga0495595_0000530 Ga0495595_0000530_11641_12468 275
790 3300053084 Ga0495595_0001258 Ga0495595_0001258_5697_6524 275
791 3300053084 Ga0495595_0003450 Ga0495595_0003450_4005_4832 275
792 3300053084 Ga0495595_0026333 Ga0495595_0026333_973_1800 275
793 3300053085 Ga0495619_0000016 Ga0495619_0000016_170237_171064 275
794 3300053085 Ga0495619_0000252 Ga0495619_0000252_14327_15154 275
795 3300053085 Ga0495619_0010019 Ga0495619_0010019_1373_2200 275
796 3300053085 Ga0495619_0218978 Ga0495619_0218978_152_979 275
797 3300053086 Ga0500578_0111147 Ga0500578_0111147_708_1535 275
798 3300053087 Ga0500643_000168 Ga0500643_000168_36627_37454 275
799 3300053087 Ga0500643_010318 Ga0500643_010318_190_1077 275
800 3300053091 Ga0500647_0028227 Ga0500647_0028227_147_977 275
801 3300053093 Ga0500651_0073483 Ga0500651_0073483_393_1220 275
802 3300053094 Ga0500566_0050603 Ga0500566_0050603_1024_1851 275
803 3300053094 Ga0500566_0087603 Ga0500566_0087603_11_898 275
804 3300053096 Ga0500641_0001637 Ga0500641_0001637_2720_3547 275
805 3300053103 Ga0500555_001537 Ga0500555_001537_4055_4882 275
806 3300053104 Ga0500556_0005901 Ga0500556_0005901_1695_2522 275
807 3300053105 Ga0500557_000032 Ga0500557_000032_25794_26624 275
808 3300053109 Ga0500569_026105 Ga0500569_026105_378_1205 275
809 3300053111 Ga0500572_004731 Ga0500572_004731_675_1502 275
810 3300053119 Ga0500595_000010 Ga0500595_000010_221861_222748 275
811 3300053119 Ga0500595_018269 Ga0500595_018269_518_1345 275
812 3300053121 Ga0500607_043184 Ga0500607_043184_422_1249 275
813 3300053122 Ga0500608_134211 Ga0500608_134211_255_1082 275
814 3300053130 Ga0500642_0000197 Ga0500642_0000197_13830_14660 275
815 3300053131 Ga0500652_008171 Ga0500652_008171_83_979 275
816 3300053139 Ga0500568_0005928 Ga0500568_0005928_2063_2890 275
817 3300053148 Ga0500590_063181 Ga0500590_063181_827_1654 275
818 3300053153 Ga0500616_0000001 Ga0500616_0000001_605206_606102 275
819 3300053153 Ga0500616_0011058 Ga0500616_0011058_3254_4081 275
820 3300053156 Ga0500622_0138946 Ga0500622_0138946_229_1056 275
821 3300053160 Ga0500633_0054663 Ga0500633_0054663_331_1158 275
822 3300053162 Ga0500638_008192 Ga0500638_008192_2173_3000 275
823 3300053177 Ga0500636_0000990 Ga0500636_0000990_10289_11116 275
824 3300053177 Ga0500636_0068426 Ga0500636_0068426_378_1205 275
825 3300053729 Ga0500625_000321 Ga0500625_000321_6044_6874 275
826 3300053729 Ga0500625_057017 Ga0500625_057017_770_1597 275
827 3300053730 Ga0500645_001000 Ga0500645_001000_6439_7335 275
828 3300053730 Ga0500645_027641 Ga0500645_027641_578_1405 275
829 3300053736 Ga0500599_000381 Ga0500599_000381_1989_2816 275
830 3300053737 Ga0500601_000352 Ga0500601_000352_5400_6227 275
831 3300054114 Ga0501084_0561228 Ga0501084_0561228_10_837 275
832 3300055283 Ga0500661_015418 Ga0500661_015418_145_972 275
833 iso_pu_bacteria 2513237104 2513716127 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

109

243

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vvl-assembly1.cif.gz_R pth-bound human pth1r in complex with gs (class2) 0.2288 7 193
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.2072 1 191
7awq-assembly1.cif.gz_A structure of the thermostabilized eaat1 cryst-e386q mutant in complex with l-asp, sodium ions and the allosteric inhibitor ucph101 0.2058 18 196
7d3s-assembly1.cif.gz_R human secr in complex with an engineered gs heterotrimer 0.2029 1 194
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.1821 1 191
ID Description Score Start End Superfamily
af_A0A1P8B7A0_67_343_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.2778 10 194 1.50.40.10
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2751 105 193 1.20.1250.20
af_D3ZG94_8_239_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.2719 13 191 1.50.40.10
af_K7M2B0_284_447_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2638 17 193 1.20.1250.20
af_K7M2B0_284_447_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2523 17 193 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6N7H1F3-F1-model_v4 Sterol desaturase family protein 0.9817 32 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A533IPT2-F1-model_v4 deleted 0.9807 96 275
AF-A0A0E4BMH1-F1-model_v4 Uncharacterized protein 0.9798 1 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A849ICG2-F1-model_v4 Sterol desaturase family protein 0.9767 3 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A6N7H1F3-F1-model_v4 Sterol desaturase family protein 0.9738 32 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479

Feature Viewer

pLDDT pTM Quality
91.02 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map