F482740

General Info

Members Datasets Scaffolds Average Seq Length
832 533 596 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640490018
Length 357
Sequence SPRSAPRLKALSSRAIPCRAASVRPVEQGKAMKAVLCKSFGPPESLVVEDAPSPQIKPSEILLDVHAAGVNFPDTLMIEGKYQFKPPFPFSPGGEAAGVVAAVGEKVSHLKVGDRVMALTGWGSFAEQVAVAGSNALPIPPSMDFATAAAFSMTYGTSMHALKQRASLQPGETLLVLGASGGVGLAAVEIGKAVGARVIAAASSAEKLEVARNAGADELINYSEVSLKERLKELTGGQGVDVIYDPVGGKLFEEAFRSIAWNGRMLVVGFAAGGDIPALPANLPLLKGAALIGVFWGAFAQRQPQDNAANFRQLFAWHAEGKLKPLVSQRFTLEEAGQAIATLGQRKAVGKLVVQVR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
25 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
26 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
27 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
28 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
29 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
30 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
31 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
32 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
33 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
34 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
35 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
36 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
37 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
38 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
39 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
40 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
41 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
42 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
43 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
44 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
45 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
46 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
47 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
48 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
49 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
50 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
51 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
52 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
53 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
54 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
55 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
56 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
57 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
58 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
59 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
60 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
61 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
62 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
63 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
71 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
72 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
83 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
84 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
85 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
86 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
87 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
88 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
89 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
90 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
91 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
92 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
93 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
94 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
95 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
96 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
97 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
98 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
99 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
100 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
101 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
102 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
103 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
104 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
105 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
106 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
107 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
108 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
109 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
110 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
111 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
112 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
113 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
114 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
115 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
116 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
117 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
118 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
119 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
120 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
121 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
122 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
123 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
124 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
125 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
126 2773857670 Pseudomonas sp. 478 Isolate Unclassified
127 2773857673 Pseudomonas sp. 443 Isolate Unclassified
128 2784132063 Pseudomonas sp. 424 Isolate Unclassified
129 2784132072 Pseudomonas sp. 460 Isolate Unclassified
130 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
131 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
132 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
133 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
134 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
135 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
136 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
137 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
138 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
139 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
140 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
141 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
142 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
143 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
144 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
145 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
146 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
147 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
148 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
149 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
150 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
151 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
152 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
153 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
154 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
155 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
156 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
157 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
158 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
159 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
160 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
161 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
162 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
163 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
164 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
165 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
166 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
167 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
168 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
169 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
170 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
171 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
172 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
173 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
174 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
175 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
176 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
177 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
178 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
179 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
180 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
181 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
182 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
183 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
184 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
185 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
186 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
187 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
188 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
189 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
190 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
191 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
192 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
193 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
194 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
195 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
196 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
197 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
198 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
199 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
200 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
201 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
202 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
203 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
204 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
205 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
206 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
207 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
208 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
209 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
210 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
211 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
212 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
213 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
214 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
215 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
216 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
217 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
218 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
219 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
220 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
221 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
222 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
223 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
224 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
225 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
226 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
227 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
228 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
229 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
230 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
231 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
232 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
233 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
234 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
235 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
236 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
237 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
238 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
239 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
240 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
241 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
242 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
243 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
244 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
245 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
246 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
247 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
248 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
249 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
250 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
251 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
252 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
253 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
254 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
255 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
256 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
257 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
258 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
259 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
260 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
261 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
262 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
263 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
264 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
265 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
266 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
267 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
268 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
269 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
270 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
271 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
272 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
273 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
276 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
277 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
278 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
279 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
280 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
281 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
282 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
283 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
284 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
285 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
286 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
287 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
288 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
289 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
290 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
291 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
292 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
293 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
294 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
295 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
296 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
297 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
298 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
299 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
300 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
301 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
302 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
303 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
304 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
305 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
311 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
312 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
314 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
316 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
317 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
318 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
319 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
360 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
361 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
363 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
367 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
368 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
369 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
370 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
371 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
372 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
373 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
374 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
375 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
376 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
377 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
378 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
379 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
380 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
381 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
382 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
383 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
384 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
385 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
386 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
387 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
388 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
389 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
390 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
391 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
392 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
393 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
398 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
399 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
400 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
401 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
402 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
403 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
404 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
405 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
406 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
407 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
408 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
409 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
410 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
411 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
412 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
413 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
414 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
415 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
416 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
417 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
418 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
419 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
420 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
421 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
422 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
423 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
424 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
425 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
426 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
427 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
428 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
429 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
430 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
431 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
432 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
433 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
434 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
438 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
444 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
445 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
446 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
449 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
450 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
451 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
452 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
453 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
454 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
455 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
456 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
457 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
458 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
459 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
460 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
461 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
462 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
463 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
464 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
465 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
466 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
467 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
468 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
469 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
470 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
471 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
472 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
473 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
474 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
475 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
476 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
477 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
478 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
479 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
480 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
481 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
482 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
495 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
496 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
497 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
498 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
499 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
500 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
505 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
506 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
507 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
508 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
511 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
512 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
513 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
514 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
515 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
516 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
517 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
518 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
519 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
520 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
521 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
522 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
523 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
524 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
525 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
526 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
527 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
528 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
529 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
530 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
531 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
532 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
533 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.63
Metatranscriptomes 0
Isolates 28.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.33
Nodule 3.25
Rhizoplane 8.65
Rhizosphere 66.35
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_718 2124908027 Bacteria 55855
2 SwRhRL2b_contig_2761050 2162886007 Bacteria 4939
3 SwRhRL2b_contig_519873 2162886007 Bacteria 1223
4 JGI25162J39368_1001123 3300002737 Bacteria 16116
5 JGI25162J39368_1001366 3300002737 Bacteria 13434
6 JGI25154J39366_1009458 3300002738 Bacteria 1198
7 JGI25163J39215_1001049 3300002771 Bacteria 5909
8 JGI25163J39215_1001615 3300002771 Bacteria 3376
9 JGI25164J39214_1000593 3300002772 Bacteria 16116
10 JGI25164J39214_1000683 3300002772 Bacteria 13434
11 JGI25165J46597_1001173 3300003214 Bacteria 16116
12 JGI25165J46597_1001371 3300003214 Bacteria 13434
13 rootH1_10163451 3300003323 Bacteria 2195
14 Ga0055538_1000032 3300003751 Bacteria 199718
15 Ga0055539_1000043 3300003752 Bacteria 199718
16 Ga0055533_1000052 3300003756 Bacteria 199718
17 Ga0055532_1000047 3300003758 Bacteria 179201
18 Ga0055525_1000062 3300003759 Bacteria 199718
19 Ga0055535_1004747 3300003761 Bacteria 3194
20 Ga0055536_1001844 3300003781 Bacteria 12389
21 Ga0055536_1004928 3300003781 Bacteria 6653
22 Ga0055536_1005802 3300003781 Bacteria 5943
23 Ga0055530_10001310 3300003791 Bacteria 18721
24 Ga0055530_10001782 3300003791 Bacteria 14972
25 Ga0055530_10002801 3300003791 Bacteria 10727
26 Ga0055540_1000960 3300003792 Bacteria 18721
27 Ga0055540_1001320 3300003792 Bacteria 14972
28 Ga0055540_1002155 3300003792 Bacteria 10727
29 Ga0055531_10000404 3300003794 Bacteria 41520
30 Ga0055531_10000483 3300003794 Bacteria 36666
31 Ga0055541_1000030 3300003841 Bacteria 199616
32 Ga0065714_10002460 3300005288 Bacteria 16953
33 Ga0065714_10003917 3300005288 Bacteria 7498
34 Ga0065714_10003949 3300005288 Bacteria 6202
35 Ga0065714_10073013 3300005288 Bacteria 3259
36 Ga0065714_10075748 3300005288 Bacteria 2870
37 Ga0065714_10081276 3300005288 Bacteria 2380
38 Ga0065704_10004501 3300005289 Bacteria 3341
39 Ga0065704_10070757 3300005289 Bacteria 16643
40 Ga0065704_10075640 3300005289 Bacteria 5486
41 Ga0065704_10078835 3300005289 Bacteria 4322
42 Ga0065712_10001367 3300005290 Bacteria 6415
43 Ga0065712_10002401 3300005290 Bacteria 6922
44 Ga0065712_10067900 3300005290 Bacteria 22102
45 Ga0070683_100011524 3300005329 Bacteria 7649
46 Ga0070670_100003472 3300005331 Bacteria 13080
47 Ga0070670_100011975 3300005331 Bacteria 7420
48 Ga0068869_100096037 3300005334 Bacteria 2237
49 Ga0070666_10002542 3300005335 Bacteria 11037
50 Ga0070680_100172221 3300005336 Bacteria 1822
51 Ga0070682_100063067 3300005337 Bacteria 2349
52 Ga0070691_10026206 3300005341 Bacteria 2717
53 Ga0070691_10034404 3300005341 Bacteria 2385
54 Ga0070661_100000126 3300005344 Bacteria 63357
55 Ga0070668_100000320 3300005347 Bacteria 31649
56 Ga0070668_100056706 3300005347 Bacteria 3026
57 Ga0070668_100143744 3300005347 Bacteria 1924
58 Ga0070668_100365128 3300005347 Bacteria 1225
59 Ga0070669_100001006 3300005353 Bacteria 20540
60 Ga0070669_100012886 3300005353 Bacteria 5940
61 Ga0070669_100046952 3300005353 Bacteria 3149
62 Ga0070669_100047838 3300005353 Bacteria 3121
63 Ga0070669_100191144 3300005353 Bacteria 1606
64 Ga0070673_100214660 3300005364 Unclassified 1663
65 Ga0070667_100000100 3300005367 Bacteria 108128
66 Ga0070713_100018878 3300005436 Bacteria 5250
67 Ga0070710_10005945 3300005437 Bacteria 5826
68 Ga0070705_100034406 3300005440 Bacteria 2832
69 Ga0070662_100000101 3300005457 Bacteria 47097
70 Ga0070662_100004142 3300005457 Bacteria 9123
71 Ga0070681_10047931 3300005458 Bacteria 4270
72 Ga0070681_10212289 3300005458 Bacteria 1851
73 Ga0070679_100016449 3300005530 Bacteria 7135
74 Ga0070679_100062851 3300005530 Bacteria 3701
75 Ga0070684_100030811 3300005535 Bacteria 4562
76 Ga0070684_100035380 3300005535 Bacteria 4275
77 Ga0068853_100000372 3300005539 Bacteria 30828
78 Ga0070695_100022399 3300005545 Bacteria 3874
79 Ga0070665_100056139 3300005548 Bacteria 3949
80 Ga0070665_100175393 3300005548 Bacteria 2144
81 Ga0070665_100308603 3300005548 Bacteria 1585
82 Ga0070665_100335453 3300005548 Bacteria 1517
83 Ga0070665_100396744 3300005548 Bacteria 1387
84 Ga0070664_100001357 3300005564 Bacteria 19532
85 Ga0070664_100064535 3300005564 Bacteria 3123
86 Ga0068857_100025141 3300005577 Bacteria 5243
87 Ga0068857_100103944 3300005577 Bacteria 2550
88 Ga0068854_100021339 3300005578 Bacteria 4394
89 Ga0068856_100021703 3300005614 Bacteria 6239
90 Ga0068859_100121645 3300005617 Bacteria 2677
91 Ga0068864_100000139 3300005618 Bacteria 69907
92 Ga0068851_10000007 3300005834 Bacteria 244101
93 Ga0068863_100000075 3300005841 Bacteria 109825
94 Ga0068863_100000218 3300005841 Bacteria 61402
95 Ga0068863_100004494 3300005841 Bacteria 13760
96 Ga0068858_100000107 3300005842 Bacteria 87216
97 Ga0068860_100006006 3300005843 Bacteria 12223
98 Ga0068860_100007209 3300005843 Bacteria 11117
99 Ga0068860_100038578 3300005843 Bacteria 4570
100 Ga0068862_100001390 3300005844 Bacteria 22412
101 Ga0081540_1000048 3300005983 Bacteria 127924
102 Ga0081540_1032576 3300005983 Bacteria 2843
103 Ga0070717_10019939 3300006028 Bacteria 5266
104 Ga0075432_10001293 3300006058 Bacteria 8077
105 Ga0075432_10011785 3300006058 Bacteria 2971
106 Ga0075428_100062521 3300006844 Bacteria 4076
107 Ga0075433_10006882 3300006852 Bacteria 9010
108 Ga0075434_100002490 3300006871 Bacteria 16225
109 Ga0097620_100121652 3300006931 Bacteria 2677
110 Ga0079104_1000424 3300006946 Bacteria 48276
111 Ga0079104_1001947 3300006946 Bacteria 12253
112 Ga0105251_10000009 3300009011 Bacteria 192384
113 Ga0105251_10001765 3300009011 Bacteria 18003
114 Ga0105251_10001772 3300009011 Bacteria 17958
115 Ga0105251_10003299 3300009011 Bacteria 11806
116 Ga0105251_10004239 3300009011 Bacteria 9895
117 Ga0105251_10004948 3300009011 Bacteria 8870
118 Ga0105251_10011207 3300009011 Bacteria 5134
119 Ga0105244_10001453 3300009036 Bacteria 19179
120 Ga0105244_10012421 3300009036 Bacteria 5031
121 Ga0105244_10018147 3300009036 Bacteria 3957
122 Ga0105244_10018552 3300009036 Bacteria 3900
123 Ga0105244_10031978 3300009036 Bacteria 2790
124 Ga0105244_10033541 3300009036 Bacteria 2705
125 Ga0105244_10034075 3300009036 Bacteria 2683
126 Ga0105244_10037553 3300009036 Bacteria 2532
127 Ga0105244_10049296 3300009036 Bacteria 2153
128 Ga0105244_10072789 3300009036 Bacteria 1711
129 Ga0105244_10099476 3300009036 Bacteria 1424
130 Ga0105250_10000981 3300009092 Bacteria 16625
131 Ga0105250_10001636 3300009092 Bacteria 11944
132 Ga0105250_10012322 3300009092 Bacteria 3531
133 Ga0105250_10014586 3300009092 Bacteria 3225
134 Ga0105250_10016106 3300009092 Bacteria 3051
135 Ga0105250_10030459 3300009092 Bacteria 2169
136 Ga0105250_10071453 3300009092 Bacteria 1401
137 Ga0111539_10038874 3300009094 Bacteria 5740
138 Ga0111539_10373291 3300009094 Bacteria 1660
139 Ga0105245_10020417 3300009098 Bacteria 5810
140 Ga0105247_10005269 3300009101 Bacteria 8161
141 Ga0114129_10043509 3300009147 Bacteria 6317
142 Ga0105243_10005105 3300009148 Bacteria 10305
143 Ga0105243_10007073 3300009148 Bacteria 8627
144 Ga0105243_10010014 3300009148 Bacteria 7208
145 Ga0105243_10015686 3300009148 Bacteria 5729
146 Ga0105243_10029744 3300009148 Bacteria 4203
147 Ga0105242_10003232 3300009176 Bacteria 12701
148 Ga0105242_10050113 3300009176 Bacteria 3399
149 Ga0105248_10075012 3300009177 Bacteria 3801
150 Ga0105248_10088718 3300009177 Bacteria 3481
151 Ga0105237_10003007 3300009545 Bacteria 20351
152 Ga0105237_10075496 3300009545 Bacteria 3362
153 Ga0105249_10001100 3300009553 Bacteria 24052
154 Ga0105246_10021361 3300011119 Bacteria 4165
155 Ga0105246_10023768 3300011119 Bacteria 3969
156 Ga0105246_10057824 3300011119 Bacteria 2685
157 Ga0157345_1000367 3300012498 Bacteria 5092
158 Ga0157373_10003979 3300013100 Bacteria 11145
159 Ga0157373_10004112 3300013100 Bacteria 10971
160 Ga0157373_10036164 3300013100 Bacteria 3545
161 Ga0157373_10131153 3300013100 Bacteria 1763
162 Ga0157373_10260663 3300013100 Bacteria 1227
163 Ga0157371_10003709 3300013102 Bacteria 13694
164 Ga0157370_10000698 3300013104 Bacteria 41998
165 Ga0157370_10102117 3300013104 Bacteria 2685
166 Ga0157370_10327544 3300013104 Bacteria 1412
167 Ga0157369_10456556 3300013105 Bacteria 1323
168 Ga0163162_10138981 3300013306 Bacteria 2541
169 Ga0157372_10003012 3300013307 Bacteria 18164
170 Ga0163163_10044116 3300014325 Bacteria 4374
171 Ga0157380_10419432 3300014326 Bacteria 1276
172 Ga0182008_10002828 3300014497 Bacteria 10729
173 Ga0157376_10003731 3300014969 Bacteria 10525
174 Ga0182007_10047307 3300015262 Bacteria 1423
175 Ga0182007_10057397 3300015262 Bacteria 1278
176 Ga0182005_1009972 3300015265 Bacteria 2743
177 Ga0163161_10132377 3300017792 Bacteria 1882
178 Ga0213876_10040655 3300021384 Bacteria 2457
179 Ga0209760_100027 3300025207 Bacteria 153290
180 Ga0209760_100367 3300025207 Bacteria 12053
181 Ga0209784_100007 3300025224 Bacteria 747715
182 Ga0209566_100009 3300025225 Bacteria 554018
183 Ga0209674_100021 3300025226 Bacteria 629811
184 Ga0209147_100009 3300025229 Bacteria 747409
185 Ga0209563_100018 3300025230 Bacteria 747850
186 Ga0209563_102304 3300025230 Bacteria 4386
187 Ga0207427_100005 3300025231 Bacteria 797999
188 Ga0207427_100006 3300025231 Bacteria 785415
189 Ga0209437_100013 3300025233 Bacteria 785457
190 Ga0209437_100018 3300025233 Bacteria 694400
191 Ga0209437_104938 3300025233 Bacteria 2309
192 Ga0209258_100169 3300025242 Bacteria 145227
193 Ga0209646_1000184 3300025246 Bacteria 78423
194 Ga0209677_100012 3300025253 Bacteria 554018
195 Ga0209759_1002680 3300025256 Bacteria 7609
196 Ga0209759_1006804 3300025256 Bacteria 3784
197 Ga0209233_1000021 3300025261 Bacteria 798078
198 Ga0209233_1000022 3300025261 Bacteria 785415
199 Ga0209130_1011547 3300025284 Bacteria 2361
200 Ga0209675_1000989 3300025291 Bacteria 17959
201 Ga0209676_1000015 3300025292 Bacteria 784458
202 Ga0209676_1000030 3300025292 Bacteria 506421
203 Ga0209676_1000041 3300025292 Bacteria 424583
204 Ga0209676_1001397 3300025292 Bacteria 23348
205 Ga0209676_1019306 3300025292 Bacteria 2347
206 Ga0209050_1000024 3300025298 Bacteria 533389
207 Ga0209050_1000030 3300025298 Bacteria 463381
208 Ga0209050_1000518 3300025298 Bacteria 64332
209 Ga0209050_1002563 3300025298 Bacteria 15157
210 Ga0209051_1000012 3300025303 Bacteria 595474
211 Ga0209051_1000023 3300025303 Bacteria 437371
212 Ga0209051_1001294 3300025303 Bacteria 22056
213 Ga0209257_1002874 3300025304 Bacteria 16040
214 Ga0209257_1004425 3300025304 Bacteria 10900
215 Ga0207656_10000006 3300025321 Bacteria 395044
216 Ga0207696_1000020 3300025711 Bacteria 434998
217 Ga0207696_1000031 3300025711 Bacteria 384169
218 Ga0207696_1000050 3300025711 Bacteria 276983
219 Ga0207696_1000357 3300025711 Bacteria 46078
220 Ga0207696_1003002 3300025711 Bacteria 7882
221 Ga0207696_1008529 3300025711 Bacteria 3906
222 Ga0207696_1018984 3300025711 Bacteria 2248
223 Ga0207696_1019230 3300025711 Bacteria 2229
224 Ga0207655_1000033 3300025728 Bacteria 377066
225 Ga0207655_1000202 3300025728 Bacteria 103907
226 Ga0207655_1000388 3300025728 Bacteria 61513
227 Ga0207655_1005474 3300025728 Bacteria 8620
228 Ga0207655_1005579 3300025728 Bacteria 8526
229 Ga0207655_1008819 3300025728 Bacteria 6344
230 Ga0207655_1009052 3300025728 Bacteria 6233
231 Ga0207655_1010707 3300025728 Bacteria 5540
232 Ga0207655_1010965 3300025728 Bacteria 5445
233 Ga0207655_1012603 3300025728 Bacteria 4927
234 Ga0207655_1016443 3300025728 Bacteria 4045
235 Ga0207655_1024965 3300025728 Bacteria 2914
236 Ga0207655_1025001 3300025728 Bacteria 2911
237 Ga0207655_1038895 3300025728 Bacteria 2072
238 Ga0207713_1000032 3300025735 Bacteria 276465
239 Ga0207713_1000079 3300025735 Bacteria 172274
240 Ga0207713_1000659 3300025735 Bacteria 32880
241 Ga0207713_1000881 3300025735 Bacteria 27355
242 Ga0207713_1001352 3300025735 Bacteria 19999
243 Ga0207713_1001441 3300025735 Bacteria 18998
244 Ga0207713_1001720 3300025735 Bacteria 16886
245 Ga0207713_1002171 3300025735 Bacteria 14559
246 Ga0207713_1008846 3300025735 Bacteria 5740
247 Ga0207713_1032956 3300025735 Bacteria 2269
248 Ga0207713_1045592 3300025735 Bacteria 1789
249 Ga0207713_1052121 3300025735 Bacteria 1623
250 Ga0207692_10008666 3300025898 Bacteria 4219
251 Ga0207710_10002771 3300025900 Bacteria 8011
252 Ga0207680_10007348 3300025903 Bacteria 5363
253 Ga0207685_10014357 3300025905 Bacteria 2478
254 Ga0207707_10107652 3300025912 Bacteria 2437
255 Ga0207707_10135044 3300025912 Bacteria 2157
256 Ga0207671_10000131 3300025914 Bacteria 116866
257 Ga0207671_10284499 3300025914 Bacteria 1304
258 Ga0207663_10005895 3300025916 Bacteria 6217
259 Ga0207649_10000012 3300025920 Bacteria 265674
260 Ga0207652_10387571 3300025921 Bacteria 1261
261 Ga0207681_10000099 3300025923 Bacteria 73220
262 Ga0207681_10003495 3300025923 Bacteria 9785
263 Ga0207681_10037180 3300025923 Bacteria 3216
264 Ga0207650_10000338 3300025925 Bacteria 45436
265 Ga0207650_10000564 3300025925 Bacteria 30060
266 Ga0207687_10013217 3300025927 Bacteria 5391
267 Ga0207664_10100135 3300025929 Bacteria 2392
268 Ga0207706_10000580 3300025933 Bacteria 38973
269 Ga0207706_10001804 3300025933 Bacteria 21019
270 Ga0207686_10001491 3300025934 Bacteria 13199
271 Ga0207686_10093117 3300025934 Bacteria 1994
272 Ga0207709_10000248 3300025935 Bacteria 66465
273 Ga0207709_10002031 3300025935 Bacteria 13118
274 Ga0207709_10002118 3300025935 Bacteria 12768
275 Ga0207709_10004819 3300025935 Bacteria 7732
276 Ga0207709_10005277 3300025935 Bacteria 7348
277 Ga0207709_10010766 3300025935 Bacteria 5036
278 Ga0207711_10046333 3300025941 Bacteria 3715
279 Ga0207711_10068725 3300025941 Bacteria 3069
280 Ga0207661_10075763 3300025944 Bacteria 2761
281 Ga0207679_10000015 3300025945 Bacteria 265674
282 Ga0207651_10242508 3300025960 Unclassified 1470
283 Ga0207712_10000494 3300025961 Bacteria 32649
284 Ga0207712_10036357 3300025961 Bacteria 3353
285 Ga0207668_10000381 3300025972 Bacteria 28177
286 Ga0207668_10175272 3300025972 Bacteria 1686
287 Ga0207640_10026125 3300025981 Bacteria 3542
288 Ga0207658_10000079 3300025986 Bacteria 107980
289 Ga0207703_10000146 3300026035 Bacteria 83180
290 Ga0207639_10000286 3300026041 Bacteria 36062
291 Ga0207678_10269316 3300026067 Bacteria 1460
292 Ga0207702_10041671 3300026078 Bacteria 3851
293 Ga0207641_10000019 3300026088 Bacteria 295899
294 Ga0207641_10000381 3300026088 Bacteria 52796
295 Ga0207641_10022840 3300026088 Bacteria 5151
296 Ga0207676_10000924 3300026095 Bacteria 22721
297 Ga0207676_10131736 3300026095 Bacteria 2127
298 Ga0207674_10000581 3300026116 Bacteria 48108
299 Ga0207674_10007464 3300026116 Bacteria 12743
300 Ga0207683_10452553 3300026121 Bacteria 1184
301 Ga0209281_1000016 3300027111 Bacteria 588107
302 Ga0209281_1000019 3300027111 Bacteria 576164
303 Ga0209281_1008353 3300027111 Bacteria 2521
304 Ga0209281_1017333 3300027111 Bacteria 1463
305 Ga0209389_1039397 3300027296 Bacteria 3685
306 Ga0209371_1000032 3300027312 Bacteria 392355
307 Ga0207428_10066064 3300027907 Bacteria 2851
308 Ga0207428_10164592 3300027907 Unclassified 1683
309 Ga0268266_10017876 3300028379 Bacteria 6041
310 Ga0268266_10416636 3300028379 Bacteria 1272
311 Ga0268265_10001778 3300028380 Bacteria 17286
312 Ga0268264_10001534 3300028381 Bacteria 21510
313 Ga0268264_10004836 3300028381 Bacteria 11414
314 Ga0268264_10027626 3300028381 Bacteria 4639
315 Ga0265337_1001036 3300028556 Bacteria 14438
316 Ga0265334_10014029 3300028573 Bacteria 3345
317 Ga0307517_10144273 3300028786 Bacteria 1658
318 Ga0268256_1000232 3300030500 Bacteria 59133
319 Ga0316179_1074380 3300030734 Bacteria 3589
320 Ga0316183_1004754 3300030742 Bacteria 7110
321 Ga0316181_1248978 3300030744 Bacteria 3890
322 Ga0265320_10000743 3300031240 Bacteria 24985
323 Ga0265327_10000225 3300031251 Bacteria 115061
324 Ga0307509_10209874 3300031507 Bacteria 1773
325 Ga0307408_100000002 3300031548 Bacteria 827227
326 Ga0307408_100005271 3300031548 Bacteria 8663
327 Ga0307408_100008555 3300031548 Bacteria 6759
328 Ga0307516_10000019 3300031730 Bacteria 196679
329 Ga0307516_10048628 3300031730 Bacteria 4173
330 Ga0307405_10003779 3300031731 Bacteria 7033
331 Ga0307405_10215665 3300031731 Bacteria 1404
332 Ga0307407_10027385 3300031903 Bacteria 3032
333 Ga0307412_10003115 3300031911 Bacteria 9212
334 Ga0307412_10006197 3300031911 Bacteria 6744
335 Ga0307412_10008593 3300031911 Bacteria 5836
336 Ga0307416_100040568 3300032002 Bacteria 3618
337 Ga0307411_10007691 3300032005 Bacteria 5516
338 Ga0373930_0011861 3300034816 Bacteria 1580
339 Ga0373928_0035363 3300035084 Bacteria 1125
340 Ga0373951_0020439 3300035091 Bacteria 1515
341 Ga0373939_0003102 3300035114 Bacteria 3904
342 Ga0373941_0003895 3300035115 Bacteria 3418
343 Ga0373962_0002569 3300035242 Bacteria 4309
344 Ga0373931_0000508 3300035691 Bacteria 15931
345 Ga0373931_0000910 3300035691 Bacteria 12471
346 Ga0373937_0000755 3300036401 Bacteria 27949
347 Ga0373937_0488303 3300036401 Bacteria 1170
348 Ga0395900_0000021 3300037418 Bacteria 351144
349 Ga0395900_0018240 3300037418 Bacteria 7159
350 Ga0395898_0001941 3300037466 Bacteria 26241
351 Ga0395905_0006642 3300037471 Bacteria 11599
352 Ga0395905_0009143 3300037471 Bacteria 9708
353 Ga0395901_0021168 3300038443 Bacteria 6660
354 Ga0395901_0131608 3300038443 Bacteria 2628
355 Ga0395901_0558773 3300038443 Bacteria 1159
356 Ga0237819_01191 3300038705 Bacteria 7310
357 Ga0436365_0703236 3300039437 Bacteria 1206
358 Ga0436365_1488395 3300039437 Bacteria 4243
359 Ga0439436_0000130 3300041404 Bacteria 17330
360 Ga0439438_005440 3300041405 Bacteria 4684
361 Ga0439438_013062 3300041405 Bacteria 2519
362 Ga0439438_055098 3300041405 Bacteria 1003
363 Ga0439453_0000335 3300041408 Bacteria 4932
364 Ga0439461_0037012 3300041410 Bacteria 1041
365 Ga0439466_0001538 3300041411 Bacteria 9009
366 Ga0439466_0016276 3300041411 Bacteria 2690
367 Ga0439466_0029187 3300041411 Bacteria 1899
368 Ga0439466_0035683 3300041411 Bacteria 1681
369 Ga0439437_000827 3300042000 Bacteria 3190
370 Ga0439441_017284 3300042001 Bacteria 1293
371 Ga0439443_001325 3300042003 Bacteria 2681
372 Ga0439432_000624 3300042006 Bacteria 13327
373 Ga0439432_003130 3300042006 Bacteria 6157
374 Ga0439432_035327 3300042006 Bacteria 1601
375 Ga0439451_013932 3300042009 Bacteria 1622
376 Ga0439451_019669 3300042009 Bacteria 1360
377 Ga0439452_001777 3300042010 Bacteria 8410
378 Ga0439452_015680 3300042010 Bacteria 2072
379 Ga0439456_000058 3300042013 Bacteria 39602
380 Ga0439456_007379 3300042013 Bacteria 2256
381 Ga0439456_015014 3300042013 Bacteria 1615
382 Ga0439463_003592 3300042016 Bacteria 3912
383 Ga0439463_017897 3300042016 Bacteria 1760
384 Ga0450911_000024 3300042115 Bacteria 84076
385 Ga0450911_006235 3300042115 Bacteria 1787
386 Ga0450923_000807 3300042125 Bacteria 3765
387 Ga0450891_006657 3300042129 Bacteria 1062
388 Ga0450902_000025 3300042137 Bacteria 13254
389 Ga0450904_000070 3300042139 Bacteria 22975
390 Ga0450905_000013 3300042142 Bacteria 16288
391 Ga0450907_004917 3300042146 Bacteria 2276
392 Ga0439446_0000025 3300042156 Bacteria 25767
393 Ga0439446_0001438 3300042156 Bacteria 5422
394 Ga0439434_0001044 3300042435 Bacteria 8032
395 Ga0439435_0008188 3300042436 Bacteria 2419
396 Ga0439464_0002389 3300042439 Bacteria 4614
397 Ga0439464_0003144 3300042439 Bacteria 4141
398 Ga0439460_0016567 3300042461 Bacteria 1964
399 Ga0450901_000048 3300042533 Bacteria 11693
400 Ga0451576_0464713 3300045051 Bacteria 1329
401 Ga0495627_000240 3300046453 Bacteria 57483
402 Ga0495627_002764 3300046453 Bacteria 8147
403 Ga0495627_019160 3300046453 Bacteria 2299
404 Ga0495591_000113 3300046458 Bacteria 93452
405 Ga0495591_003234 3300046458 Bacteria 8567
406 Ga0495591_003979 3300046458 Bacteria 7406
407 Ga0495591_004557 3300046458 Bacteria 6721
408 Ga0495591_004920 3300046458 Bacteria 6345
409 Ga0495591_012617 3300046458 Bacteria 3135
410 Ga0495629_0026617 3300046459 Bacteria 4108
411 Ga0495638_0000415 3300046460 Bacteria 51819
412 Ga0495638_0014331 3300046460 Bacteria 5365
413 Ga0495638_0016717 3300046460 Bacteria 4905
414 Ga0495650_0001251 3300046471 Bacteria 26248
415 Ga0495650_0004070 3300046471 Bacteria 10227
416 Ga0495605_0000100 3300046474 Bacteria 109002
417 Ga0495605_0000122 3300046474 Bacteria 101994
418 Ga0495605_0000720 3300046474 Bacteria 24370
419 Ga0495605_0008842 3300046474 Bacteria 5679
420 Ga0495605_0009980 3300046474 Bacteria 5321
421 Ga0495585_0011234 3300046492 Bacteria 5304
422 Ga0495594_0024774 3300046499 Bacteria 3224
423 Ga0495607_0000478 3300046501 Bacteria 40040
424 Ga0495607_0000778 3300046501 Bacteria 30559
425 Ga0495607_0001277 3300046501 Bacteria 22527
426 Ga0495607_0002257 3300046501 Bacteria 15915
427 Ga0495607_0002708 3300046501 Bacteria 14140
428 Ga0495607_0008693 3300046501 Bacteria 6923
429 Ga0495607_0010888 3300046501 Bacteria 6086
430 Ga0495607_0038030 3300046501 Bacteria 2885
431 Ga0495607_0044473 3300046501 Bacteria 2618
432 Ga0495583_0000174 3300046506 Bacteria 109079
433 Ga0495583_0001423 3300046506 Bacteria 24377
434 Ga0495583_0003451 3300046506 Bacteria 12018
435 Ga0495583_0006082 3300046506 Bacteria 7977
436 Ga0495583_0006222 3300046506 Bacteria 7858
437 Ga0495583_0007528 3300046506 Bacteria 6815
438 Ga0495583_0010507 3300046506 Bacteria 5394
439 Ga0495606_0002133 3300046507 Bacteria 23878
440 Ga0495606_0007809 3300046507 Bacteria 9459
441 Ga0495606_0016882 3300046507 Bacteria 5543
442 Ga0495606_0052618 3300046507 Bacteria 2646
443 Ga0495610_0005204 3300046512 Bacteria 9316
444 Ga0495610_0005689 3300046512 Bacteria 8789
445 Ga0495610_0019337 3300046512 Bacteria 3816
446 Ga0495616_0057426 3300046513 Bacteria 1918
447 Ga0495620_0000229 3300046515 Bacteria 41859
448 Ga0495620_0000416 3300046515 Bacteria 28487
449 Ga0495620_0003579 3300046515 Bacteria 8876
450 Ga0495620_0009573 3300046515 Bacteria 5144
451 Ga0495620_0013003 3300046515 Bacteria 4273
452 Ga0495620_0031796 3300046515 Bacteria 2412
453 Ga0495631_0017707 3300046518 Bacteria 3364
454 Ga0495632_0000593 3300046519 Bacteria 33650
455 Ga0495632_0000855 3300046519 Bacteria 26752
456 Ga0495632_0020643 3300046519 Bacteria 3562
457 Ga0495632_0085917 3300046519 Bacteria 1496
458 Ga0495637_0000045 3300046520 Bacteria 108215
459 Ga0495637_0003284 3300046520 Bacteria 8603
460 Ga0495637_0010872 3300046520 Bacteria 4385
461 Ga0495643_0000811 3300046522 Bacteria 34205
462 Ga0495643_0007601 3300046522 Bacteria 6966
463 Ga0495648_0004597 3300046524 Bacteria 11754
464 Ga0495648_0010440 3300046524 Bacteria 7074
465 Ga0495654_0002898 3300046530 Bacteria 10753
466 Ga0495654_0005992 3300046530 Bacteria 6983
467 Ga0495654_0013219 3300046530 Bacteria 4420
468 Ga0495654_0020328 3300046530 Bacteria 3460
469 Ga0495609_0000023 3300046538 Bacteria 269702
470 Ga0495609_0000088 3300046538 Bacteria 109269
471 Ga0495597_0000240 3300046542 Bacteria 49641
472 Ga0495633_0000777 3300046558 Bacteria 28543
473 Ga0495633_0018993 3300046558 Bacteria 3480
474 Ga0495633_0124537 3300046558 Bacteria 1193
475 Ga0495668_0015169 3300046616 Bacteria 4504
476 Ga0495668_0031787 3300046616 Bacteria 2973
477 Ga0495668_0062748 3300046616 Bacteria 2047
478 Ga0495611_0055613 3300046648 Bacteria 1790
479 Ga0495625_0000061 3300046660 Bacteria 179140
480 Ga0495625_0060668 3300046660 Bacteria 2679
481 Ga0495625_0278636 3300046660 Bacteria 1076
482 Ga0495659_0002272 3300046664 Bacteria 6233
483 Ga0495661_0000072 3300046665 Bacteria 120743
484 Ga0495661_0000841 3300046665 Bacteria 28595
485 Ga0495661_0004540 3300046665 Bacteria 9999
486 Ga0495661_0019472 3300046665 Bacteria 4447
487 Ga0495661_0036893 3300046665 Bacteria 3055
488 Ga0495657_0102393 3300046675 Bacteria 1823
489 Ga0495599_0047983 3300046678 Bacteria 2677
490 Ga0495658_0209403 3300046683 Bacteria 1218
491 Ga0495670_0105866 3300046691 Bacteria 1452
492 Ga0495671_0004440 3300046692 Bacteria 8390
493 Ga0495671_0013286 3300046692 Bacteria 4466
494 Ga0495671_0034409 3300046692 Bacteria 2576
495 Ga0495671_0047935 3300046692 Bacteria 2132
496 Ga0495589_0058198 3300046794 Bacteria 1900
497 Ga0495660_0004806 3300046810 Bacteria 8152
498 Ga0495660_0020931 3300046810 Bacteria 3748
499 Ga0495660_0065991 3300046810 Bacteria 1930
500 Ga0495660_0094192 3300046810 Bacteria 1551
501 Ga0495672_0004169 3300047320 Bacteria 11998
502 Ga0495672_0014093 3300047320 Bacteria 5487
503 Ga0495672_0021543 3300047320 Bacteria 4202
504 Ga0495672_0033583 3300047320 Bacteria 3177
505 Ga0495672_0135331 3300047320 Bacteria 1292
506 Ga0495680_0004392 3300047322 Bacteria 13496
507 Ga0495683_0000070 3300047323 Bacteria 108186
508 Ga0495679_000814 3300047446 Bacteria 19816
509 Ga0495679_005870 3300047446 Bacteria 5385
510 Ga0495673_0002493 3300047469 Bacteria 12887
511 Ga0495673_0002965 3300047469 Bacteria 11438
512 Ga0495673_0011343 3300047469 Bacteria 4798
513 Ga0495673_0037789 3300047469 Bacteria 2202
514 Ga0495681_0009957 3300047470 Bacteria 5798
515 Ga0495681_0041937 3300047470 Bacteria 2218
516 Ga0495681_0066142 3300047470 Bacteria 1650
517 Ga0495686_0028959 3300047472 Bacteria 3604
518 Ga0496100_0336875 3300048903 Unclassified 1137
519 Ga0496102_0133813 3300048905 Bacteria 2322
520 Ga0496102_0379705 3300048905 Bacteria 1330
521 Ga0496112_0074343 3300048915 Bacteria 3360
522 Ga0496114_0021519 3300048917 Bacteria 5247
523 Ga0496116_0004519 3300048919 Bacteria 13237
524 Ga0496117_0001364 3300048920 Bacteria 35606
525 Ga0496117_0002208 3300048920 Bacteria 25268
526 Ga0496117_0005978 3300048920 Bacteria 12544
527 Ga0496117_0008162 3300048920 Bacteria 9999
528 Ga0496118_0001739 3300048921 Bacteria 31629
529 Ga0496118_0005323 3300048921 Bacteria 14664
530 Ga0496118_0016641 3300048921 Bacteria 6738
531 Ga0496118_0066284 3300048921 Bacteria 2636
532 Ga0496118_0158082 3300048921 Bacteria 1406
533 Ga0496119_0001575 3300048922 Bacteria 27130
534 Ga0496119_0044221 3300048922 Bacteria 2806
535 Ga0496120_0002964 3300048923 Bacteria 16148
536 Ga0496120_0035323 3300048923 Bacteria 2986
537 Ga0496121_0000272 3300048924 Bacteria 108051
538 Ga0496121_0002538 3300048924 Bacteria 27667
539 Ga0496121_0006595 3300048924 Bacteria 14318
540 Ga0496121_0007491 3300048924 Bacteria 13180
541 Ga0496121_0155520 3300048924 Bacteria 1678
542 Ga0496122_0000398 3300048925 Bacteria 92491
543 Ga0496122_0052728 3300048925 Bacteria 3075
544 Ga0496122_0080144 3300048925 Bacteria 2278
545 Ga0496122_0173015 3300048925 Bacteria 1298
546 Ga0496123_0000302 3300048926 Bacteria 95750
547 Ga0496123_0071453 3300048926 Bacteria 2164
548 Ga0496124_0000073 3300048927 Bacteria 219306
549 Ga0496124_0006941 3300048927 Bacteria 12169
550 Ga0496124_0009601 3300048927 Bacteria 9919
551 Ga0496124_0022223 3300048927 Bacteria 5821
552 Ga0496124_0030005 3300048927 Bacteria 4835
553 Ga0496124_0043665 3300048927 Bacteria 3852
554 Ga0496124_0050920 3300048927 Bacteria 3526
555 Ga0496124_0058758 3300048927 Bacteria 3233
556 Ga0496124_0115208 3300048927 Bacteria 2157
557 Ga0496125_0001425 3300048928 Bacteria 34838
558 Ga0496125_0009053 3300048928 Bacteria 10308
559 Ga0496125_0011937 3300048928 Bacteria 8655
560 Ga0496125_0251532 3300048928 Bacteria 1114
561 Ga0496126_0209387 3300048929 Bacteria 1642
562 Ga0495678_000325 3300049459 Bacteria 50656
563 Ga0495678_000692 3300049459 Bacteria 30773
564 Ga0495678_011303 3300049459 Bacteria 4280
565 Ga0495678_030399 3300049459 Bacteria 2260
566 Ga0495682_0000090 3300049460 Bacteria 79463
567 Ga0495682_0000607 3300049460 Bacteria 24172
568 Ga0495682_0079633 3300049460 Bacteria 1178
569 Ga0501031_0050673 3300049568 Bacteria 2704
570 Ga0501034_0050549 3300049571 Bacteria 4192
571 Ga0501034_0204659 3300049571 Bacteria 1930
572 Ga0501036_0062080 3300049572 Bacteria 3165
573 Ga0501037_0250570 3300049573 Bacteria 1239
574 Ga0501038_0072695 3300049574 Bacteria 2914
575 Ga0501040_0005851 3300049576 Bacteria 7959
576 Ga0501041_0001880 3300049577 Bacteria 11769
577 Ga0501043_0050587 3300049579 Bacteria 3266
578 Ga0501046_0223131 3300049580 Bacteria 1394
579 Ga0501047_0245212 3300049581 Bacteria 1641
580 Ga0501048_0077292 3300049582 Bacteria 2349
581 Ga0501069_0025984 3300049585 Bacteria 3205
582 Ga0501073_0060700 3300049589 Bacteria 2639
583 Ga0501074_0113396 3300049590 Bacteria 1939
584 Ga0501075_0012099 3300049591 Bacteria 6125
585 Ga0501076_0035194 3300049592 Bacteria 3918
586 Ga0501081_0090278 3300049743 Bacteria 2153
587 Ga0501035_0015708 3300049822 Bacteria 6988
588 Ga0501226_000001 3300049853 Bacteria 432595
589 nmdc:mga08y16_84946_c1 3300050511 Unclassified 3299
590 nmdc:mga0n895_6835_c1 3300050512 Bacteria 9742
591 nmdc:mga0a205_110_c1 3300050515 Bacteria 47857
592 Ga0495619_0224293 3300053085 Bacteria 1302
593 Ga0500643_008570 3300053087 Bacteria 4008
594 Ga0500645_007042 3300053730 Bacteria 3950
595 Ga0501084_0074010 3300054114 Bacteria 2852
596 Ga0530510_0001837 3300061734 Bacteria 14507

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0250570 Ga0501037_0250570_407_1222 271
2 3300009092 Ga0105250_10016106 Ga0105250_100161062 273
3 3300048905 Ga0496102_0379705 Ga0496102_0379705_437_1312 275
4 3300009177 Ga0105248_10088718 Ga0105248_100887183 281
5 3300042137 Ga0450902_000025 Ga0450902_000025_8527_9504 284
6 3300042142 Ga0450905_000013 Ga0450905_000013_2460_3437 284
7 3300042533 Ga0450901_000048 Ga0450901_000048_10650_11627 284
8 3300014326 Ga0157380_10419432 Ga0157380_104194322 285
9 3300041405 Ga0439438_055098 Ga0439438_055098_11_874 287
10 3300042013 Ga0439456_015014 Ga0439456_015014_742_1605 287
11 3300014325 Ga0163163_10044116 Ga0163163_100441162 291
12 3300048903 Ga0496100_0336875 Ga0496100_0336875_133_1008 291
13 3300048921 Ga0496118_0005323 Ga0496118_0005323_4052_4987 293
14 3300048924 Ga0496121_0000272 Ga0496121_0000272_97452_98387 293
15 3300005841 Ga0068863_100004494 Ga0068863_1000044946 296
16 3300026088 Ga0207641_10022840 Ga0207641_100228403 296
17 3300048927 Ga0496124_0030005 Ga0496124_0030005_2102_3079 299
18 3300009101 Ga0105247_10005269 Ga0105247_100052694 301
19 3300009553 Ga0105249_10001100 Ga0105249_1000110013 301
20 3300025900 Ga0207710_10002771 Ga0207710_100027714 301
21 3300025961 Ga0207712_10000494 Ga0207712_1000049413 301
22 3300005843 Ga0068860_100006006 Ga0068860_1000060063 302
23 3300005844 Ga0068862_100001390 Ga0068862_10000139013 302
24 3300028380 Ga0268265_10001778 Ga0268265_100017783 302
25 3300028381 Ga0268264_10001534 Ga0268264_100015346 302
26 3300005618 Ga0068864_100000139 Ga0068864_10000013930 304
27 3300005841 Ga0068863_100000218 Ga0068863_1000002185 304
28 3300026088 Ga0207641_10000019 Ga0207641_10000019157 304
29 3300026095 Ga0207676_10000924 Ga0207676_100009246 304
30 3300049571 Ga0501034_0050549 Ga0501034_0050549_1372_2340 305
31 3300049581 Ga0501047_0245212 Ga0501047_0245212_254_1222 305
32 3300013307 Ga0157372_10003012 Ga0157372_100030125 306
33 3300031730 Ga0307516_10000019 Ga0307516_100000197 306
34 3300039437 Ga0436365_0703236 Ga0436365_0703236_30_965 311
35 3300039437 Ga0436365_1488395 Ga0436365_1488395_1039_1974 311
36 3300005288 Ga0065714_10081276 Ga0065714_100812762 312
37 3300005353 Ga0070669_100001006 Ga0070669_10000100610 312
38 3300005539 Ga0068853_100000372 Ga0068853_1000003728 312
39 3300005564 Ga0070664_100064535 Ga0070664_1000645351 312
40 3300005578 Ga0068854_100021339 Ga0068854_1000213393 312
41 3300005834 Ga0068851_10000007 Ga0068851_1000000770 312
42 3300009011 Ga0105251_10004239 Ga0105251_1000423910 312
43 3300009011 Ga0105251_10004948 Ga0105251_100049488 312
44 3300009177 Ga0105248_10075012 Ga0105248_100750123 312
45 3300013100 Ga0157373_10260663 Ga0157373_102606631 312
46 3300013105 Ga0157369_10456556 Ga0157369_104565562 312
47 3300025321 Ga0207656_10000006 Ga0207656_1000000632 312
48 3300025735 Ga0207713_1001441 Ga0207713_10014419 312
49 3300025735 Ga0207713_1002171 Ga0207713_10021713 312
50 3300025914 Ga0207671_10284499 Ga0207671_102844992 312
51 3300025923 Ga0207681_10000099 Ga0207681_100000994 312
52 3300025941 Ga0207711_10046333 Ga0207711_100463334 312
53 3300025941 Ga0207711_10068725 Ga0207711_100687252 312
54 3300025981 Ga0207640_10026125 Ga0207640_100261253 312
55 3300026041 Ga0207639_10000286 Ga0207639_1000028621 312
56 3300042006 Ga0439432_000624 Ga0439432_000624_5330_6307 312
57 3300046460 Ga0495638_0000415 Ga0495638_0000415_39808_40797 312
58 3300048927 Ga0496124_0043665 Ga0496124_0043665_2876_3829 312
59 3300048927 Ga0496124_0058758 Ga0496124_0058758_210_1187 312
60 3300002738 JGI25154J39366_1009458 JGI25154J39366_10094581 313
61 3300003751 Ga0055538_1000032 Ga0055538_1000032164 313
62 3300003752 Ga0055539_1000043 Ga0055539_1000043164 313
63 3300003756 Ga0055533_1000052 Ga0055533_1000052164 313
64 3300003758 Ga0055532_1000047 Ga0055532_1000047144 313
65 3300003759 Ga0055525_1000062 Ga0055525_1000062164 313
66 3300003761 Ga0055535_1004747 Ga0055535_10047473 313
67 3300003841 Ga0055541_1000030 Ga0055541_1000030164 313
68 3300005289 Ga0065704_10004501 Ga0065704_100045012 313
69 3300005344 Ga0070661_100000126 Ga0070661_10000012640 313
70 3300005564 Ga0070664_100001357 Ga0070664_1000013579 313
71 3300009092 Ga0105250_10000981 Ga0105250_1000098110 313
72 3300009092 Ga0105250_10012322 Ga0105250_100123224 313
73 3300009148 Ga0105243_10029744 Ga0105243_100297444 313
74 3300009176 Ga0105242_10003232 Ga0105242_100032323 313
75 3300009545 Ga0105237_10003007 Ga0105237_1000300710 313
76 3300011119 Ga0105246_10021361 Ga0105246_100213615 313
77 3300013306 Ga0163162_10138981 Ga0163162_101389813 313
78 3300017792 Ga0163161_10132377 Ga0163161_101323772 313
79 3300025224 Ga0209784_100007 Ga0209784_100007352 313
80 3300025225 Ga0209566_100009 Ga0209566_100009352 313
81 3300025226 Ga0209674_100021 Ga0209674_100021352 313
82 3300025229 Ga0209147_100009 Ga0209147_100009352 313
83 3300025230 Ga0209563_100018 Ga0209563_100018352 313
84 3300025233 Ga0209437_104938 Ga0209437_1049383 313
85 3300025242 Ga0209258_100169 Ga0209258_100169131 313
86 3300025246 Ga0209646_1000184 Ga0209646_100018447 313
87 3300025253 Ga0209677_100012 Ga0209677_100012352 313
88 3300025256 Ga0209759_1006804 Ga0209759_10068041 313
89 3300025711 Ga0207696_1000357 Ga0207696_10003578 313
90 3300025728 Ga0207655_1000388 Ga0207655_10003889 313
91 3300025914 Ga0207671_10000131 Ga0207671_1000013172 313
92 3300025920 Ga0207649_10000012 Ga0207649_10000012137 313
93 3300025934 Ga0207686_10001491 Ga0207686_1000149113 313
94 3300025945 Ga0207679_10000015 Ga0207679_10000015137 313
95 3300036401 Ga0373937_0000755 Ga0373937_0000755_22744_23718 313
96 3300046453 Ga0495627_002764 Ga0495627_002764_1311_2288 313
97 3300046458 Ga0495591_004920 Ga0495591_004920_4287_5264 313
98 3300046501 Ga0495607_0038030 Ga0495607_0038030_1397_2374 313
99 3300046506 Ga0495583_0007528 Ga0495583_0007528_33_1010 313
100 3300046507 Ga0495606_0007809 Ga0495606_0007809_929_1906 313
101 3300046515 Ga0495620_0013003 Ga0495620_0013003_946_1923 313
102 3300046519 Ga0495632_0020643 Ga0495632_0020643_1762_2739 313
103 3300046530 Ga0495654_0002898 Ga0495654_0002898_631_1608 313
104 3300046665 Ga0495661_0004540 Ga0495661_0004540_7620_8597 313
105 3300047470 Ga0495681_0041937 Ga0495681_0041937_469_1446 313
106 3300048920 Ga0496117_0008162 Ga0496117_0008162_7644_8621 313
107 3300048921 Ga0496118_0066284 Ga0496118_0066284_1596_2573 313
108 3300048921 Ga0496118_0158082 Ga0496118_0158082_142_1119 313
109 3300048922 Ga0496119_0044221 Ga0496119_0044221_636_1613 313
110 3300048923 Ga0496120_0035323 Ga0496120_0035323_874_1851 313
111 3300048925 Ga0496122_0173015 Ga0496122_0173015_70_1047 313
112 3300048927 Ga0496124_0009601 Ga0496124_0009601_1324_2301 313
113 3300048928 Ga0496125_0009053 Ga0496125_0009053_1706_2683 313
114 3300048928 Ga0496125_0251532 Ga0496125_0251532_115_1092 313
115 3300005290 Ga0065712_10001367 Ga0065712_100013672 314
116 3300005548 Ga0070665_100396744 Ga0070665_1003967441 314
117 3300009011 Ga0105251_10011207 Ga0105251_100112072 314
118 3300015262 Ga0182007_10047307 Ga0182007_100473071 314
119 3300025735 Ga0207713_1008846 Ga0207713_10088462 314
120 3300027111 Ga0209281_1017333 Ga0209281_10173331 314
121 3300031731 Ga0307405_10215665 Ga0307405_102156651 314
122 3300002737 JGI25162J39368_1001123 JGI25162J39368_10011239 315
123 3300002771 JGI25163J39215_1001049 JGI25163J39215_10010497 315
124 3300002772 JGI25164J39214_1000593 JGI25164J39214_10005938 315
125 3300003214 JGI25165J46597_1001173 JGI25165J46597_10011738 315
126 3300025207 Ga0209760_100027 Ga0209760_10002780 315
127 3300025231 Ga0207427_100006 Ga0207427_100006412 315
128 3300025233 Ga0209437_100013 Ga0209437_100013412 315
129 3300025261 Ga0209233_1000022 Ga0209233_1000022412 315
130 3300025292 Ga0209676_1019306 Ga0209676_10193062 316
131 3300026067 Ga0207678_10269316 Ga0207678_102693162 316
132 3300034816 Ga0373930_0011861 Ga0373930_0011861_60_1055 316
133 3300035084 Ga0373928_0035363 Ga0373928_0035363_72_1067 316
134 3300035242 Ga0373962_0002569 Ga0373962_0002569_987_1982 316
135 3300035691 Ga0373931_0000910 Ga0373931_0000910_1402_2397 316
136 3300047446 Ga0495679_005870 Ga0495679_005870_318_1295 316
137 3300005288 Ga0065714_10073013 Ga0065714_100730131 317
138 3300005331 Ga0070670_100003472 Ga0070670_1000034727 317
139 3300005331 Ga0070670_100011975 Ga0070670_1000119756 317
140 3300005457 Ga0070662_100000101 Ga0070662_1000001018 317
141 3300009011 Ga0105251_10000009 Ga0105251_10000009121 317
142 3300009092 Ga0105250_10001636 Ga0105250_100016368 317
143 3300009092 Ga0105250_10014586 Ga0105250_100145863 317
144 3300009148 Ga0105243_10010014 Ga0105243_100100143 317
145 3300013100 Ga0157373_10036164 Ga0157373_100361641 317
146 3300025711 Ga0207696_1000020 Ga0207696_1000020236 317
147 3300025711 Ga0207696_1003002 Ga0207696_10030025 317
148 3300025711 Ga0207696_1019230 Ga0207696_10192302 317
149 3300025728 Ga0207655_1008819 Ga0207655_10088194 317
150 3300025735 Ga0207713_1000032 Ga0207713_1000032140 317
151 3300025925 Ga0207650_10000338 Ga0207650_100003386 317
152 3300025925 Ga0207650_10000564 Ga0207650_1000056419 317
153 3300025933 Ga0207706_10000580 Ga0207706_100005801 317
154 3300025935 Ga0207709_10005277 Ga0207709_100052774 317
155 3300028786 Ga0307517_10144273 Ga0307517_101442732 317
156 3300031507 Ga0307509_10209874 Ga0307509_102098742 317
157 3300046512 Ga0495610_0005204 Ga0495610_0005204_269_1246 317
158 3300048928 Ga0496125_0011937 Ga0496125_0011937_492_1469 317
159 iso_pu_bacteria 2643221541 2643728712 317
160 iso_pu_bacteria 2643221606 2644044727 317
161 iso_pu_bacteria 2643221671 2644390900 317
162 3300013104 Ga0157370_10000698 Ga0157370_1000069835 318
163 3300042013 Ga0439456_000058 Ga0439456_000058_37022_37999 318
164 3300046507 Ga0495606_0016882 Ga0495606_0016882_2148_3104 318
165 3300046522 Ga0495643_0007601 Ga0495643_0007601_4211_5188 318
166 3300046810 Ga0495660_0094192 Ga0495660_0094192_50_1027 318
167 3300048917 Ga0496114_0021519 Ga0496114_0021519_2016_2993 318
168 3300006946 Ga0079104_1001947 Ga0079104_10019477 319
169 3300027111 Ga0209281_1000019 Ga0209281_1000019195 319
170 3300027111 Ga0209281_1008353 Ga0209281_10083531 319
171 3300030734 Ga0316179_1074380 Ga0316179_10743802 319
172 3300042006 Ga0439432_035327 Ga0439432_035327_68_1045 319
173 3300042010 Ga0439452_015680 Ga0439452_015680_1001_1978 319
174 3300042115 Ga0450911_006235 Ga0450911_006235_755_1732 319
175 3300046507 Ga0495606_0052618 Ga0495606_0052618_1610_2587 319
176 3300046515 Ga0495620_0031796 Ga0495620_0031796_564_1541 319
177 3300046794 Ga0495589_0058198 Ga0495589_0058198_47_1024 319
178 3300048927 Ga0496124_0006941 Ga0496124_0006941_2954_3934 319
179 2162886007 SwRhRL2b_contig_2761050 SwRhRL2b_0606.00003170 320
180 3300005289 Ga0065704_10075640 Ga0065704_100756403 320
181 3300005289 Ga0065704_10078835 Ga0065704_100788351 320
182 3300005347 Ga0070668_100056706 Ga0070668_1000567061 320
183 3300005548 Ga0070665_100308603 Ga0070665_1003086032 320
184 3300009036 Ga0105244_10012421 Ga0105244_100124214 320
185 3300009036 Ga0105244_10034075 Ga0105244_100340752 320
186 3300009148 Ga0105243_10015686 Ga0105243_100156867 320
187 3300025292 Ga0209676_1001397 Ga0209676_10013974 320
188 3300025711 Ga0207696_1000050 Ga0207696_100005069 320
189 3300025728 Ga0207655_1009052 Ga0207655_10090523 320
190 3300025728 Ga0207655_1024965 Ga0207655_10249651 320
191 3300025728 Ga0207655_1038895 Ga0207655_10388952 320
192 3300025735 Ga0207713_1045592 Ga0207713_10455921 320
193 3300025935 Ga0207709_10002031 Ga0207709_100020317 320
194 3300025935 Ga0207709_10010766 Ga0207709_100107664 320
195 3300027296 Ga0209389_1039397 Ga0209389_10393973 320
196 3300042129 Ga0450891_006657 Ga0450891_006657_17_982 320
197 3300046515 Ga0495620_0000229 Ga0495620_0000229_4146_5123 320
198 3300046519 Ga0495632_0000593 Ga0495632_0000593_28794_29771 320
199 3300046522 Ga0495643_0000811 Ga0495643_0000811_29025_30002 320
200 3300046524 Ga0495648_0004597 Ga0495648_0004597_2026_3003 320
201 3300048920 Ga0496117_0001364 Ga0496117_0001364_8447_9424 320
202 3300048920 Ga0496117_0002208 Ga0496117_0002208_3630_4607 320
203 3300048921 Ga0496118_0001739 Ga0496118_0001739_28377_29354 320
204 3300048924 Ga0496121_0155520 Ga0496121_0155520_627_1604 320
205 3300048925 Ga0496122_0080144 Ga0496122_0080144_1081_2058 320
206 3300048928 Ga0496125_0001425 Ga0496125_0001425_4760_5737 320
207 3300048929 Ga0496126_0209387 Ga0496126_0209387_41_1018 320
208 iso_pu_bacteria 2511231004 2511254823 321
209 iso_pu_bacteria 2511231006 2511266037 321
210 iso_pu_bacteria 2511231007 2511273350 321
211 iso_pu_bacteria 2511231008 2511275062 321
212 iso_pu_bacteria 2511231010 2511288490 321
213 iso_pu_bacteria 2511231011 2511297985 321
214 iso_pu_bacteria 2511231012 2511304002 321
215 iso_pu_bacteria 2511231014 2511311972 321
216 iso_pu_bacteria 2511231015 2511323417 321
217 iso_pu_bacteria 2511231016 2511327979 321
218 iso_pu_bacteria 2511231017 2511329702 321
219 iso_pu_bacteria 2511231018 2511335872 321
220 iso_pu_bacteria 2511231019 2511344764 321
221 iso_pu_bacteria 2511231020 2511349527 321
222 iso_pu_bacteria 2511231021 2511354102 321
223 iso_pu_bacteria 2511231022 2511365973 321
224 iso_pu_bacteria 2511231023 2511369007 321
225 iso_pu_bacteria 2511231024 2511376419 321
226 iso_pu_bacteria 2511231031 2511412145 321
227 iso_pu_bacteria 2511231156 2511827672 321
228 iso_pu_bacteria 2512047018 2512326640 321
229 iso_pu_bacteria 2554235341 2555672878 321
230 iso_pu_bacteria 2582580891 2583795691 321
231 iso_pu_bacteria 2597489887 2597860915 321
232 iso_pu_bacteria 2597489888 2597866659 321
233 iso_pu_bacteria 2597489889 2597872517 321
234 iso_pu_bacteria 2599185155 2599327537 321
235 iso_pu_bacteria 2599185160 2599355916 321
236 iso_pu_bacteria 2599185161 2599362682 321
237 iso_pu_bacteria 2599185162 2599369012 321
238 iso_pu_bacteria 2599185163 2599375791 321
239 iso_pu_bacteria 2599185164 2599381022 321
240 iso_pu_bacteria 2599185165 2599387462 321
241 iso_pu_bacteria 2599185166 2599394649 321
242 iso_pu_bacteria 2599185167 2599400508 321
243 iso_pu_bacteria 2599185168 2599406414 321
244 iso_pu_bacteria 2599185179 2599449832 321
245 iso_pu_bacteria 2599185181 2599462750 321
246 iso_pu_bacteria 2599185182 2599467827 321
247 iso_pu_bacteria 2599185185 2599485850 321
248 iso_pu_bacteria 2599185186 2599491767 321
249 iso_pu_bacteria 2599185188 2599500294 321
250 iso_pu_bacteria 2599185189 2599505779 321
251 iso_pu_bacteria 2599185190 2599511906 321
252 iso_pu_bacteria 2599185191 2599516890 321
253 iso_pu_bacteria 2599185212 2599614462 321
254 iso_pu_bacteria 2599185248 2599768114 321
255 iso_pu_bacteria 2599185257 2599804631 321
256 iso_pu_bacteria 2599185288 2599879068 321
257 iso_pu_bacteria 2599185289 2599885550 321
258 iso_pu_bacteria 2599185290 2599892732 321
259 iso_pu_bacteria 2599185291 2599897264 321
260 iso_pu_bacteria 2599185300 2599930683 321
261 iso_pu_bacteria 2599185302 2599942321 321
262 iso_pu_bacteria 2599185303 2599951482 321
263 iso_pu_bacteria 2599185304 2599954266 321
264 iso_pu_bacteria 2599185305 2599961949 321
265 iso_pu_bacteria 2599185306 2599965972 321
266 iso_pu_bacteria 2599185307 2599972337 321
267 iso_pu_bacteria 2599185308 2599977978 321
268 iso_pu_bacteria 2599185309 2599982891 321
269 iso_pu_bacteria 2599185311 2599994020 321
270 iso_pu_bacteria 2599185312 2599999154 321
271 iso_pu_bacteria 2599185313 2600004277 321
272 iso_pu_bacteria 2599185314 2600012145 321
273 iso_pu_bacteria 2599185315 2600020433 321
274 iso_pu_bacteria 2599185316 2600026312 321
275 iso_pu_bacteria 2599185317 2600032058 321
276 iso_pu_bacteria 2599185318 2600036005 321
277 iso_pu_bacteria 2599185319 2600042370 321
278 iso_pu_bacteria 2599185320 2600046685 321
279 iso_pu_bacteria 2599185321 2600054889 321
280 iso_pu_bacteria 2599185322 2600061080 321
281 iso_pu_bacteria 2599185323 2600066336 321
282 iso_pu_bacteria 2599185324 2600071900 321
283 iso_pu_bacteria 2599185325 2600076510 321
284 iso_pu_bacteria 2599185356 2600215376 321
285 iso_pu_bacteria 2600254930 2600358961 321
286 iso_pu_bacteria 2600254931 2600363516 321
287 iso_pu_bacteria 2600254954 2600444120 321
288 iso_pu_bacteria 2600255283 2601627437 321
289 iso_pu_bacteria 2600255296 2601693416 321
290 iso_pu_bacteria 2600255313 2601775542 321
291 iso_pu_bacteria 2600255318 2601798532 321
292 iso_pu_bacteria 2600255389 2602008395 321
293 iso_pu_bacteria 2603880185 2606077426 321
294 iso_pu_bacteria 2603880199 2606129328 321
295 iso_pu_bacteria 2619619299 2621296815 321
296 iso_pu_bacteria 2623620443 2624483439 321
297 iso_pu_bacteria 2623620446 2624494965 321
298 iso_pu_bacteria 2643221565 2643842992 321
299 iso_pu_bacteria 2643221571 2643872295 321
300 iso_pu_bacteria 2643221589 2643955603 321
301 iso_pu_bacteria 2643221602 2644020397 321
302 iso_pu_bacteria 2643221633 2644184450 321
303 iso_pu_bacteria 2643221650 2644283196 321
304 iso_pu_bacteria 2643221713 2644620196 321
305 iso_pu_bacteria 2651869719 2652547401 321
306 iso_pu_bacteria 2667528170 2671089586 321
307 iso_pu_bacteria 2667528171 2671099322 321
308 iso_pu_bacteria 2667528176 2671128556 321
309 iso_pu_bacteria 2671180172 2671771638 321
310 iso_pu_bacteria 2675903420 2677897161 321
311 iso_pu_bacteria 2675903515 2678266178 321
312 iso_pu_bacteria 2713897148 2715749802 321
313 iso_pu_bacteria 2713897149 2715754820 321
314 iso_pu_bacteria 2721755607 2723251395 321
315 iso_pu_bacteria 2728369097 2729146761 321
316 iso_pu_bacteria 2738541265 2738671635 321
317 iso_pu_bacteria 2738541271 2738690379 321
318 iso_pu_bacteria 2738541282 2738750029 321
319 iso_pu_bacteria 2738541294 2738807284 321
320 iso_pu_bacteria 2738541303 2738859069 321
321 iso_pu_bacteria 2738541309 2738894644 321
322 iso_pu_bacteria 2738543004 2739199088 321
323 iso_pu_bacteria 2738543015 2739259030 321
324 iso_pu_bacteria 2738543016 2739266153 321
325 iso_pu_bacteria 2738543025 2739312477 321
326 iso_pu_bacteria 2740892503 2743740455 321
327 iso_pu_bacteria 2744054620 2745007410 321
328 iso_pu_bacteria 2773857670 2774118345 321
329 iso_pu_bacteria 2773857673 2774135537 321
330 iso_pu_bacteria 2784132063 2784261787 321
331 iso_pu_bacteria 2784132072 2784313606 321
332 iso_pu_bacteria 2791355520 2794593808 321
333 iso_pu_bacteria 2808606361 2808855668 321
334 iso_pu_bacteria 2808606373 2808905695 321
335 iso_pu_bacteria 2808606376 2808926537 321
336 iso_pu_bacteria 2808606377 2808928412 321
337 iso_pu_bacteria 2808606378 2808935495 321
338 iso_pu_bacteria 2808606380 2808948698 321
339 iso_pu_bacteria 2808606381 2808950405 321
340 iso_pu_bacteria 2808606382 2808959810 321
341 iso_pu_bacteria 2808606383 2808964103 321
342 iso_pu_bacteria 2808606385 2808976179 321
343 iso_pu_bacteria 2808606388 2808994357 321
344 iso_pu_bacteria 2808606389 2808999061 321
345 iso_pu_bacteria 2808606445 2809217216 321
346 iso_pu_bacteria 2811994881 2812369522 321
347 iso_pu_bacteria 2816332298 2817494072 321
348 iso_pu_bacteria 2818991456 2819655161 321
349 iso_pu_bacteria 2818991464 2819704444 321
350 iso_pu_bacteria 2823421272 2823425749 321
351 iso_pu_bacteria 2825651385 2825655064 321
352 iso_pu_bacteria 2826581358 2826581872 321
353 iso_pu_bacteria 2834028612 2834030983 321
354 iso_pu_bacteria 2842815866 2842816873 321
355 iso_pu_bacteria 2842826826 2842831258 321
356 iso_pu_bacteria 2842832357 2842833487 321
357 iso_pu_bacteria 2842837860 2842837928 321
358 iso_pu_bacteria 2842843487 2842845717 321
359 iso_pu_bacteria 2842849001 2842854140 321
360 iso_pu_bacteria 2842854478 2842855653 321
361 iso_pu_bacteria 2844665904 2844667132 321
362 iso_pu_bacteria 2852612431 2852616382 321
363 iso_pu_bacteria 2852657418 2852659707 321
364 iso_pu_bacteria 2852667396 2852671350 321
365 iso_pu_bacteria 2860339153 2860341748 321
366 iso_pu_bacteria 2860867994 2860873057 321
367 iso_pu_bacteria 2878029506 2878035381 321
368 iso_pu_bacteria 2880230671 2880236025 321
369 iso_pu_bacteria 2897803580 2897808294 321
370 iso_pu_bacteria 2904518522 2904518928 321
371 iso_pu_bacteria 2904550169 2904551393 321
372 iso_pu_bacteria 2908446538 2908452615 321
373 iso_pu_bacteria 2913036834 2913042561 321
374 iso_pu_bacteria 2917070673 2917076776 321
375 iso_pu_bacteria 2919063839 2919065489 321
376 iso_pu_bacteria 2919155634 2919155932 321
377 iso_pu_bacteria 2919385768 2919389162 321
378 iso_pu_bacteria 2919456309 2919457580 321
379 iso_pu_bacteria 2919481497 2919485688 321
380 iso_pu_bacteria 2919487758 2919488139 321
381 iso_pu_bacteria 2919501602 2919502495 321
382 iso_pu_bacteria 2919697872 2919700543 321
383 iso_pu_bacteria 2922361189 2922364885 321
384 iso_pu_bacteria 2923153595 2923159548 321
385 iso_pu_bacteria 2923519811 2923523608 321
386 iso_pu_bacteria 2923586266 2923589031 321
387 iso_pu_bacteria 2926063275 2926064168 321
388 iso_pu_bacteria 2929144301 2929149948 321
389 iso_pu_bacteria 2929189879 2929195181 321
390 iso_pu_bacteria 2931369376 2931372608 321
391 iso_pu_bacteria 2931396565 2931398112 321
392 iso_pu_bacteria 2935353572 2935358257 321
393 iso_pu_bacteria 2939636861 2939640776 321
394 iso_pu_bacteria 2939651529 2939656669 321
395 iso_pu_bacteria 2945928738 2945930883 321
396 iso_pu_bacteria 2945961074 2945966889 321
397 iso_pu_bacteria 2946006987 2946013252 321
398 iso_pu_bacteria 2946027586 2946027932 321
399 iso_pu_bacteria 2947233263 2947234456 321
400 iso_pu_bacteria 2969304461 2969310201 321
401 iso_pu_bacteria 2974289157 2974294052 321
402 iso_pu_bacteria 2984286254 2984286566 321
403 iso_pu_bacteria 2988728565 2988731488 321
404 iso_pu_bacteria 2990196909 2990197179 321
405 iso_pu_bacteria 2998139840 2998145425 321
406 iso_pu_bacteria 3007252601 3007255399 321
407 iso_pu_bacteria 3007315729 3007315797 321
408 iso_pu_bacteria 3007395558 3007399367 321
409 iso_pu_bacteria 3007419365 3007425757 321
410 iso_pu_bacteria 3007511990 3007517210 321
411 iso_pu_bacteria 3007614139 3007618877 321
412 iso_pu_bacteria 3007619802 3007620712 321
413 iso_pu_bacteria 3007718800 3007721785 321
414 iso_pu_bacteria 3007855910 3007859220 321
415 iso_pu_bacteria 3007861166 3007865076 321
416 iso_pu_bacteria 3007866637 3007866752 321
417 iso_pu_bacteria 637000220 637323312 321
418 iso_pu_bacteria 651053060 651178100 321
419 iso_pu_bacteria 8011350971 8011351047 321
420 iso_pu_bacteria 8015687852 8015693646 321
421 iso_pu_bacteria 8019769354 8019769726 321
422 iso_pu_bacteria 8019775933 8019777650 321
423 iso_pu_bacteria 8029995093 8029995477 321
424 iso_pu_bacteria 8034962539 8034965074 321
425 iso_pu_bacteria 8054347763 8054349555 321
426 iso_pu_bacteria 8054503363 8054508966 321
427 iso_pu_bacteria 8055770955 8055776893 321
428 iso_pu_bacteria 8055817908 8055823937 321
429 iso_pu_bacteria 8056125926 8056131636 321
430 iso_pu_bacteria 8056131705 8056137342 321
431 iso_pu_bacteria 8056143049 8056148802 321
432 iso_pu_bacteria 8056148874 8056151463 321
433 iso_pu_bacteria 8056155041 8056159733 321
434 iso_pu_bacteria 8056161164 8056163660 321
435 iso_pu_bacteria 8056166840 8056171280 321
436 iso_pu_bacteria 8056172158 8056177380 321
437 iso_pu_bacteria 8056177738 8056182028 321
438 iso_pu_bacteria 8056569372 8056570495 321
439 iso_pu_bacteria 8057798959 8057801984 321
440 3300005548 Ga0070665_100335453 Ga0070665_1003354532 322
441 3300005842 Ga0068858_100000107 Ga0068858_10000010730 322
442 3300026035 Ga0207703_10000146 Ga0207703_1000014659 322
443 3300028379 Ga0268266_10416636 Ga0268266_104166362 322
444 3300049571 Ga0501034_0204659 Ga0501034_0204659_874_1851 322
445 3300005347 Ga0070668_100365128 Ga0070668_1003651281 323
446 3300037418 Ga0395900_0000021 Ga0395900_0000021_125934_126911 323
447 3300037466 Ga0395898_0001941 Ga0395898_0001941_10372_11349 323
448 3300037471 Ga0395905_0006642 Ga0395905_0006642_5438_6415 323
449 3300038443 Ga0395901_0131608 Ga0395901_0131608_961_1938 323
450 3300049568 Ga0501031_0050673 Ga0501031_0050673_70_1041 323
451 3300049572 Ga0501036_0062080 Ga0501036_0062080_1059_2030 323
452 3300049574 Ga0501038_0072695 Ga0501038_0072695_419_1390 323
453 3300049576 Ga0501040_0005851 Ga0501040_0005851_4854_5825 323
454 3300049577 Ga0501041_0001880 Ga0501041_0001880_1608_2579 323
455 3300049579 Ga0501043_0050587 Ga0501043_0050587_1438_2409 323
456 3300049580 Ga0501046_0223131 Ga0501046_0223131_20_991 323
457 3300049582 Ga0501048_0077292 Ga0501048_0077292_955_1926 323
458 3300049585 Ga0501069_0025984 Ga0501069_0025984_1241_2212 323
459 3300049589 Ga0501073_0060700 Ga0501073_0060700_642_1613 323
460 3300049590 Ga0501074_0113396 Ga0501074_0113396_325_1296 323
461 3300049591 Ga0501075_0012099 Ga0501075_0012099_3723_4694 323
462 3300049592 Ga0501076_0035194 Ga0501076_0035194_1925_2896 323
463 3300049743 Ga0501081_0090278 Ga0501081_0090278_160_1131 323
464 3300049822 Ga0501035_0015708 Ga0501035_0015708_15_986 323
465 3300053730 Ga0500645_007042 Ga0500645_007042_1702_2703 323
466 3300054114 Ga0501084_0074010 Ga0501084_0074010_1023_1994 323
467 3300061734 Ga0530510_0001837 Ga0530510_0001837_2276_3247 323
468 3300005329 Ga0070683_100011524 Ga0070683_1000115243 324
469 3300005334 Ga0068869_100096037 Ga0068869_1000960372 324
470 3300005335 Ga0070666_10002542 Ga0070666_100025427 324
471 3300005336 Ga0070680_100172221 Ga0070680_1001722211 324
472 3300005337 Ga0070682_100063067 Ga0070682_1000630674 324
473 3300005341 Ga0070691_10026206 Ga0070691_100262062 324
474 3300005341 Ga0070691_10034404 Ga0070691_100344042 324
475 3300005347 Ga0070668_100000320 Ga0070668_1000003208 324
476 3300005347 Ga0070668_100143744 Ga0070668_1001437442 324
477 3300005353 Ga0070669_100046952 Ga0070669_1000469522 324
478 3300005367 Ga0070667_100000100 Ga0070667_10000010071 324
479 3300005440 Ga0070705_100034406 Ga0070705_1000344061 324
480 3300005458 Ga0070681_10047931 Ga0070681_100479314 324
481 3300005458 Ga0070681_10212289 Ga0070681_102122892 324
482 3300005530 Ga0070679_100016449 Ga0070679_1000164495 324
483 3300005530 Ga0070679_100062851 Ga0070679_1000628514 324
484 3300005535 Ga0070684_100030811 Ga0070684_1000308113 324
485 3300005535 Ga0070684_100035380 Ga0070684_1000353805 324
486 3300005545 Ga0070695_100022399 Ga0070695_1000223993 324
487 3300005577 Ga0068857_100025141 Ga0068857_1000251417 324
488 3300005577 Ga0068857_100103944 Ga0068857_1001039442 324
489 3300005614 Ga0068856_100021703 Ga0068856_1000217032 324
490 3300005841 Ga0068863_100000075 Ga0068863_10000007579 324
491 3300005843 Ga0068860_100007209 Ga0068860_1000072092 324
492 3300005983 Ga0081540_1000048 Ga0081540_100004861 324
493 3300005983 Ga0081540_1032576 Ga0081540_10325762 324
494 3300006844 Ga0075428_100062521 Ga0075428_1000625212 324
495 3300006852 Ga0075433_10006882 Ga0075433_100068824 324
496 3300006871 Ga0075434_100002490 Ga0075434_1000024906 324
497 3300009094 Ga0111539_10038874 Ga0111539_100388742 324
498 3300009094 Ga0111539_10373291 Ga0111539_103732912 324
499 3300009098 Ga0105245_10020417 Ga0105245_100204176 324
500 3300009147 Ga0114129_10043509 Ga0114129_100435095 324
501 3300009545 Ga0105237_10075496 Ga0105237_100754965 324
502 3300014969 Ga0157376_10003731 Ga0157376_100037314 324
503 3300025903 Ga0207680_10007348 Ga0207680_100073483 324
504 3300025912 Ga0207707_10107652 Ga0207707_101076522 324
505 3300025921 Ga0207652_10387571 Ga0207652_103875712 324
506 3300025923 Ga0207681_10037180 Ga0207681_100371803 324
507 3300025927 Ga0207687_10013217 Ga0207687_100132176 324
508 3300025929 Ga0207664_10100135 Ga0207664_101001352 324
509 3300025944 Ga0207661_10075763 Ga0207661_100757631 324
510 3300025972 Ga0207668_10000381 Ga0207668_1000038122 324
511 3300025972 Ga0207668_10175272 Ga0207668_101752721 324
512 3300025986 Ga0207658_10000079 Ga0207658_1000007971 324
513 3300026078 Ga0207702_10041671 Ga0207702_100416712 324
514 3300026088 Ga0207641_10000381 Ga0207641_1000038122 324
515 3300026116 Ga0207674_10000581 Ga0207674_1000058123 324
516 3300026116 Ga0207674_10007464 Ga0207674_100074647 324
517 3300027907 Ga0207428_10164592 Ga0207428_101645921 324
518 3300028381 Ga0268264_10004836 Ga0268264_100048366 324
519 3300028556 Ga0265337_1001036 Ga0265337_100103610 324
520 3300031240 Ga0265320_10000743 Ga0265320_1000074313 324
521 3300035091 Ga0373951_0020439 Ga0373951_0020439_508_1503 324
522 3300035114 Ga0373939_0003102 Ga0373939_0003102_1624_2619 324
523 3300035115 Ga0373941_0003895 Ga0373941_0003895_1292_2287 324
524 3300035691 Ga0373931_0000508 Ga0373931_0000508_13468_14463 324
525 3300036401 Ga0373937_0488303 Ga0373937_0488303_71_1045 324
526 3300037418 Ga0395900_0018240 Ga0395900_0018240_2862_3836 324
527 3300037471 Ga0395905_0009143 Ga0395905_0009143_7279_8358 324
528 3300038443 Ga0395901_0021168 Ga0395901_0021168_71_1045 324
529 3300038443 Ga0395901_0558773 Ga0395901_0558773_118_1092 324
530 3300045051 Ga0451576_0464713 Ga0451576_0464713_284_1297 324
531 3300046471 Ga0495650_0001251 Ga0495650_0001251_11458_12456 324
532 3300046501 Ga0495607_0001277 Ga0495607_0001277_652_1626 324
533 3300046675 Ga0495657_0102393 Ga0495657_0102393_61_1074 324
534 3300046678 Ga0495599_0047983 Ga0495599_0047983_1518_2531 324
535 3300048915 Ga0496112_0074343 Ga0496112_0074343_1332_2306 324
536 3300050511 nmdc:mga08y16_84946_c1 nmdc:mga08y16_84946_c1_2099_3094 324
537 3300050512 nmdc:mga0n895_6835_c1 nmdc:mga0n895_6835_c1_5072_6067 324
538 3300050515 nmdc:mga0a205_110_c1 nmdc:mga0a205_110_c1_13531_14526 324
539 3300053085 Ga0495619_0224293 Ga0495619_0224293_189_1202 324
540 3300053087 Ga0500643_008570 Ga0500643_008570_1655_2665 324
541 2124908027 MRS2a_Contig_718 MRS2a_00573900 325
542 2162886007 SwRhRL2b_contig_519873 SwRhRL2b_0505.00004780 325
543 3300002737 JGI25162J39368_1001366 JGI25162J39368_10013665 325
544 3300002771 JGI25163J39215_1001615 JGI25163J39215_10016154 325
545 3300002772 JGI25164J39214_1000683 JGI25164J39214_10006835 325
546 3300003214 JGI25165J46597_1001371 JGI25165J46597_10013715 325
547 3300003323 rootH1_10163451 rootH1_101634512 325
548 3300003781 Ga0055536_1001844 Ga0055536_10018449 325
549 3300003781 Ga0055536_1004928 Ga0055536_10049284 325
550 3300003781 Ga0055536_1005802 Ga0055536_10058026 325
551 3300003791 Ga0055530_10001310 Ga0055530_100013109 325
552 3300003791 Ga0055530_10001782 Ga0055530_100017829 325
553 3300003791 Ga0055530_10002801 Ga0055530_100028017 325
554 3300003792 Ga0055540_1000960 Ga0055540_10009609 325
555 3300003792 Ga0055540_1001320 Ga0055540_10013206 325
556 3300003792 Ga0055540_1002155 Ga0055540_10021557 325
557 3300003794 Ga0055531_10000404 Ga0055531_1000040438 325
558 3300003794 Ga0055531_10000483 Ga0055531_1000048336 325
559 3300005288 Ga0065714_10002460 Ga0065714_100024607 325
560 3300005288 Ga0065714_10003917 Ga0065714_100039178 325
561 3300005288 Ga0065714_10003949 Ga0065714_100039492 325
562 3300005288 Ga0065714_10075748 Ga0065714_100757482 325
563 3300005289 Ga0065704_10070757 Ga0065704_100707579 325
564 3300005290 Ga0065712_10002401 Ga0065712_100024013 325
565 3300005290 Ga0065712_10067900 Ga0065712_1006790016 325
566 3300005353 Ga0070669_100012886 Ga0070669_1000128863 325
567 3300005353 Ga0070669_100047838 Ga0070669_1000478383 325
568 3300005353 Ga0070669_100191144 Ga0070669_1001911442 325
569 3300005364 Ga0070673_100214660 Ga0070673_1002146602 325
570 3300005436 Ga0070713_100018878 Ga0070713_1000188784 325
571 3300005437 Ga0070710_10005945 Ga0070710_100059454 325
572 3300005457 Ga0070662_100004142 Ga0070662_1000041429 325
573 3300005548 Ga0070665_100056139 Ga0070665_1000561394 325
574 3300005548 Ga0070665_100175393 Ga0070665_1001753932 325
575 3300005617 Ga0068859_100121645 Ga0068859_1001216451 325
576 3300005843 Ga0068860_100038578 Ga0068860_1000385785 325
577 3300006028 Ga0070717_10019939 Ga0070717_100199391 325
578 3300006058 Ga0075432_10001293 Ga0075432_100012937 325
579 3300006058 Ga0075432_10011785 Ga0075432_100117853 325
580 3300006931 Ga0097620_100121652 Ga0097620_1001216523 325
581 3300006946 Ga0079104_1000424 Ga0079104_10004248 325
582 3300009011 Ga0105251_10001765 Ga0105251_100017658 325
583 3300009011 Ga0105251_10001772 Ga0105251_1000177214 325
584 3300009011 Ga0105251_10003299 Ga0105251_100032998 325
585 3300009036 Ga0105244_10001453 Ga0105244_1000145317 325
586 3300009036 Ga0105244_10018147 Ga0105244_100181473 325
587 3300009036 Ga0105244_10018552 Ga0105244_100185524 325
588 3300009036 Ga0105244_10031978 Ga0105244_100319781 325
589 3300009036 Ga0105244_10033541 Ga0105244_100335413 325
590 3300009036 Ga0105244_10037553 Ga0105244_100375533 325
591 3300009036 Ga0105244_10049296 Ga0105244_100492961 325
592 3300009036 Ga0105244_10072789 Ga0105244_100727892 325
593 3300009036 Ga0105244_10099476 Ga0105244_100994762 325
594 3300009092 Ga0105250_10030459 Ga0105250_100304592 325
595 3300009092 Ga0105250_10071453 Ga0105250_100714532 325
596 3300009148 Ga0105243_10005105 Ga0105243_1000510510 325
597 3300009148 Ga0105243_10007073 Ga0105243_100070735 325
598 3300009176 Ga0105242_10050113 Ga0105242_100501135 325
599 3300011119 Ga0105246_10023768 Ga0105246_100237683 325
600 3300011119 Ga0105246_10057824 Ga0105246_100578243 325
601 3300012498 Ga0157345_1000367 Ga0157345_10003675 325
602 3300013100 Ga0157373_10003979 Ga0157373_1000397911 325
603 3300013100 Ga0157373_10004112 Ga0157373_100041127 325
604 3300013100 Ga0157373_10131153 Ga0157373_101311532 325
605 3300013102 Ga0157371_10003709 Ga0157371_1000370910 325
606 3300013104 Ga0157370_10102117 Ga0157370_101021173 325
607 3300013104 Ga0157370_10327544 Ga0157370_103275441 325
608 3300014497 Ga0182008_10002828 Ga0182008_100028284 325
609 3300015262 Ga0182007_10057397 Ga0182007_100573971 325
610 3300015265 Ga0182005_1009972 Ga0182005_10099722 325
611 3300021384 Ga0213876_10040655 Ga0213876_100406552 325
612 3300025207 Ga0209760_100367 Ga0209760_1003678 325
613 3300025230 Ga0209563_102304 Ga0209563_1023043 325
614 3300025231 Ga0207427_100005 Ga0207427_100005372 325
615 3300025233 Ga0209437_100018 Ga0209437_100018282 325
616 3300025256 Ga0209759_1002680 Ga0209759_10026805 325
617 3300025261 Ga0209233_1000021 Ga0209233_1000021372 325
618 3300025284 Ga0209130_1011547 Ga0209130_10115471 325
619 3300025291 Ga0209675_1000989 Ga0209675_100098912 325
620 3300025292 Ga0209676_1000015 Ga0209676_1000015383 325
621 3300025292 Ga0209676_1000030 Ga0209676_1000030302 325
622 3300025292 Ga0209676_1000041 Ga0209676_1000041146 325
623 3300025298 Ga0209050_1000024 Ga0209050_1000024141 325
624 3300025298 Ga0209050_1000030 Ga0209050_100003055 325
625 3300025298 Ga0209050_1000518 Ga0209050_10005186 325
626 3300025298 Ga0209050_1002563 Ga0209050_100256310 325
627 3300025303 Ga0209051_1000012 Ga0209051_1000012296 325
628 3300025303 Ga0209051_1000023 Ga0209051_100002357 325
629 3300025303 Ga0209051_1001294 Ga0209051_100129410 325
630 3300025304 Ga0209257_1002874 Ga0209257_10028745 325
631 3300025304 Ga0209257_1004425 Ga0209257_10044257 325
632 3300025711 Ga0207696_1000031 Ga0207696_1000031262 325
633 3300025711 Ga0207696_1008529 Ga0207696_10085291 325
634 3300025711 Ga0207696_1018984 Ga0207696_10189842 325
635 3300025728 Ga0207655_1000033 Ga0207655_100003386 325
636 3300025728 Ga0207655_1000202 Ga0207655_100020211 325
637 3300025728 Ga0207655_1005474 Ga0207655_10054743 325
638 3300025728 Ga0207655_1005579 Ga0207655_10055798 325
639 3300025728 Ga0207655_1010707 Ga0207655_10107075 325
640 3300025728 Ga0207655_1010965 Ga0207655_10109656 325
641 3300025728 Ga0207655_1012603 Ga0207655_10126035 325
642 3300025728 Ga0207655_1016443 Ga0207655_10164432 325
643 3300025728 Ga0207655_1025001 Ga0207655_10250013 325
644 3300025735 Ga0207713_1000079 Ga0207713_1000079123 325
645 3300025735 Ga0207713_1000659 Ga0207713_100065914 325
646 3300025735 Ga0207713_1000881 Ga0207713_10008817 325
647 3300025735 Ga0207713_1001352 Ga0207713_10013526 325
648 3300025735 Ga0207713_1001720 Ga0207713_100172019 325
649 3300025735 Ga0207713_1032956 Ga0207713_10329562 325
650 3300025735 Ga0207713_1052121 Ga0207713_10521212 325
651 3300025898 Ga0207692_10008666 Ga0207692_100086662 325
652 3300025905 Ga0207685_10014357 Ga0207685_100143572 325
653 3300025912 Ga0207707_10135044 Ga0207707_101350442 325
654 3300025916 Ga0207663_10005895 Ga0207663_100058954 325
655 3300025923 Ga0207681_10003495 Ga0207681_100034958 325
656 3300025933 Ga0207706_10001804 Ga0207706_100018043 325
657 3300025934 Ga0207686_10093117 Ga0207686_100931172 325
658 3300025935 Ga0207709_10000248 Ga0207709_100002489 325
659 3300025935 Ga0207709_10002118 Ga0207709_100021187 325
660 3300025935 Ga0207709_10004819 Ga0207709_100048195 325
661 3300025960 Ga0207651_10242508 Ga0207651_102425081 325
662 3300025961 Ga0207712_10036357 Ga0207712_100363573 325
663 3300026095 Ga0207676_10131736 Ga0207676_101317362 325
664 3300026121 Ga0207683_10452553 Ga0207683_104525532 325
665 3300027111 Ga0209281_1000016 Ga0209281_1000016342 325
666 3300027312 Ga0209371_1000032 Ga0209371_100003265 325
667 3300027907 Ga0207428_10066064 Ga0207428_100660643 325
668 3300028379 Ga0268266_10017876 Ga0268266_100178764 325
669 3300028381 Ga0268264_10027626 Ga0268264_100276265 325
670 3300028573 Ga0265334_10014029 Ga0265334_100140292 325
671 3300030500 Ga0268256_1000232 Ga0268256_100023214 325
672 3300030742 Ga0316183_1004754 Ga0316183_10047546 325
673 3300030744 Ga0316181_1248978 Ga0316181_12489782 325
674 3300031251 Ga0265327_10000225 Ga0265327_1000022534 325
675 3300031548 Ga0307408_100000002 Ga0307408_100000002433 325
676 3300031548 Ga0307408_100005271 Ga0307408_1000052712 325
677 3300031548 Ga0307408_100008555 Ga0307408_1000085554 325
678 3300031730 Ga0307516_10048628 Ga0307516_100486284 325
679 3300031731 Ga0307405_10003779 Ga0307405_100037794 325
680 3300031903 Ga0307407_10027385 Ga0307407_100273853 325
681 3300031911 Ga0307412_10003115 Ga0307412_100031154 325
682 3300031911 Ga0307412_10006197 Ga0307412_100061975 325
683 3300031911 Ga0307412_10008593 Ga0307412_100085935 325
684 3300032002 Ga0307416_100040568 Ga0307416_1000405682 325
685 3300032005 Ga0307411_10007691 Ga0307411_100076915 325
686 3300038705 Ga0237819_01191 Ga0237819_01191_2674_3651 325
687 3300041404 Ga0439436_0000130 Ga0439436_0000130_14062_15039 325
688 3300041405 Ga0439438_005440 Ga0439438_005440_2542_3519 325
689 3300041405 Ga0439438_013062 Ga0439438_013062_292_1269 325
690 3300041408 Ga0439453_0000335 Ga0439453_0000335_2615_3592 325
691 3300041410 Ga0439461_0037012 Ga0439461_0037012_50_1030 325
692 3300041411 Ga0439466_0001538 Ga0439466_0001538_7031_8008 325
693 3300041411 Ga0439466_0016276 Ga0439466_0016276_396_1373 325
694 3300041411 Ga0439466_0029187 Ga0439466_0029187_249_1226 325
695 3300041411 Ga0439466_0035683 Ga0439466_0035683_17_994 325
696 3300042000 Ga0439437_000827 Ga0439437_000827_1944_2924 325
697 3300042001 Ga0439441_017284 Ga0439441_017284_86_1063 325
698 3300042003 Ga0439443_001325 Ga0439443_001325_189_1166 325
699 3300042006 Ga0439432_003130 Ga0439432_003130_4336_5313 325
700 3300042009 Ga0439451_013932 Ga0439451_013932_278_1255 325
701 3300042009 Ga0439451_019669 Ga0439451_019669_328_1305 325
702 3300042010 Ga0439452_001777 Ga0439452_001777_1851_2828 325
703 3300042013 Ga0439456_007379 Ga0439456_007379_1108_2088 325
704 3300042016 Ga0439463_003592 Ga0439463_003592_2057_3034 325
705 3300042016 Ga0439463_017897 Ga0439463_017897_96_1073 325
706 3300042115 Ga0450911_000024 Ga0450911_000024_58022_59002 325
707 3300042125 Ga0450923_000807 Ga0450923_000807_290_1267 325
708 3300042139 Ga0450904_000070 Ga0450904_000070_2017_2997 325
709 3300042146 Ga0450907_004917 Ga0450907_004917_934_1911 325
710 3300042156 Ga0439446_0000025 Ga0439446_0000025_10693_11673 325
711 3300042156 Ga0439446_0001438 Ga0439446_0001438_3139_4116 325
712 3300042435 Ga0439434_0001044 Ga0439434_0001044_1914_2891 325
713 3300042436 Ga0439435_0008188 Ga0439435_0008188_252_1229 325
714 3300042439 Ga0439464_0002389 Ga0439464_0002389_1205_2185 325
715 3300042439 Ga0439464_0003144 Ga0439464_0003144_2418_3407 325
716 3300042461 Ga0439460_0016567 Ga0439460_0016567_975_1952 325
717 3300046453 Ga0495627_000240 Ga0495627_000240_14631_15674 325
718 3300046453 Ga0495627_019160 Ga0495627_019160_818_1795 325
719 3300046458 Ga0495591_000113 Ga0495591_000113_36174_37217 325
720 3300046458 Ga0495591_003234 Ga0495591_003234_4837_5814 325
721 3300046458 Ga0495591_003979 Ga0495591_003979_659_1636 325
722 3300046458 Ga0495591_004557 Ga0495591_004557_2481_3458 325
723 3300046458 Ga0495591_012617 Ga0495591_012617_1283_2260 325
724 3300046459 Ga0495629_0026617 Ga0495629_0026617_1442_2422 325
725 3300046460 Ga0495638_0014331 Ga0495638_0014331_2293_3270 325
726 3300046460 Ga0495638_0016717 Ga0495638_0016717_2742_3719 325
727 3300046471 Ga0495650_0004070 Ga0495650_0004070_8677_9654 325
728 3300046474 Ga0495605_0000100 Ga0495605_0000100_89114_90091 325
729 3300046474 Ga0495605_0000122 Ga0495605_0000122_84116_85093 325
730 3300046474 Ga0495605_0000720 Ga0495605_0000720_3007_3984 325
731 3300046474 Ga0495605_0008842 Ga0495605_0008842_2248_3225 325
732 3300046474 Ga0495605_0009980 Ga0495605_0009980_2044_3087 325
733 3300046492 Ga0495585_0011234 Ga0495585_0011234_2629_3606 325
734 3300046499 Ga0495594_0024774 Ga0495594_0024774_1537_2514 325
735 3300046501 Ga0495607_0000478 Ga0495607_0000478_2867_3910 325
736 3300046501 Ga0495607_0000778 Ga0495607_0000778_29143_30186 325
737 3300046501 Ga0495607_0002257 Ga0495607_0002257_11876_12853 325
738 3300046501 Ga0495607_0002708 Ga0495607_0002708_174_1151 325
739 3300046501 Ga0495607_0008693 Ga0495607_0008693_2470_3447 325
740 3300046501 Ga0495607_0010888 Ga0495607_0010888_4286_5263 325
741 3300046501 Ga0495607_0044473 Ga0495607_0044473_772_1749 325
742 3300046506 Ga0495583_0000174 Ga0495583_0000174_18942_19919 325
743 3300046506 Ga0495583_0001423 Ga0495583_0001423_18114_19091 325
744 3300046506 Ga0495583_0003451 Ga0495583_0003451_2358_3335 325
745 3300046506 Ga0495583_0006082 Ga0495583_0006082_2398_3375 325
746 3300046506 Ga0495583_0006222 Ga0495583_0006222_2212_3189 325
747 3300046506 Ga0495583_0010507 Ga0495583_0010507_1746_2723 325
748 3300046507 Ga0495606_0002133 Ga0495606_0002133_2530_3507 325
749 3300046512 Ga0495610_0005689 Ga0495610_0005689_1402_2379 325
750 3300046512 Ga0495610_0019337 Ga0495610_0019337_2478_3455 325
751 3300046513 Ga0495616_0057426 Ga0495616_0057426_52_1029 325
752 3300046515 Ga0495620_0000416 Ga0495620_0000416_18947_19924 325
753 3300046515 Ga0495620_0003579 Ga0495620_0003579_5236_6213 325
754 3300046515 Ga0495620_0009573 Ga0495620_0009573_3062_4039 325
755 3300046518 Ga0495631_0017707 Ga0495631_0017707_113_1090 325
756 3300046519 Ga0495632_0000855 Ga0495632_0000855_13553_14530 325
757 3300046519 Ga0495632_0085917 Ga0495632_0085917_72_1049 325
758 3300046520 Ga0495637_0000045 Ga0495637_0000045_9235_10212 325
759 3300046520 Ga0495637_0003284 Ga0495637_0003284_2427_3404 325
760 3300046520 Ga0495637_0010872 Ga0495637_0010872_3169_4146 325
761 3300046524 Ga0495648_0010440 Ga0495648_0010440_1451_2428 325
762 3300046530 Ga0495654_0005992 Ga0495654_0005992_712_1689 325
763 3300046530 Ga0495654_0013219 Ga0495654_0013219_2702_3679 325
764 3300046530 Ga0495654_0020328 Ga0495654_0020328_1210_2187 325
765 3300046538 Ga0495609_0000023 Ga0495609_0000023_81209_82186 325
766 3300046538 Ga0495609_0000088 Ga0495609_0000088_19033_20010 325
767 3300046542 Ga0495597_0000240 Ga0495597_0000240_12715_13764 325
768 3300046558 Ga0495633_0000777 Ga0495633_0000777_19031_20008 325
769 3300046558 Ga0495633_0018993 Ga0495633_0018993_55_1032 325
770 3300046558 Ga0495633_0124537 Ga0495633_0124537_166_1143 325
771 3300046616 Ga0495668_0015169 Ga0495668_0015169_2329_3306 325
772 3300046616 Ga0495668_0031787 Ga0495668_0031787_899_1876 325
773 3300046616 Ga0495668_0062748 Ga0495668_0062748_37_1014 325
774 3300046648 Ga0495611_0055613 Ga0495611_0055613_93_1136 325
775 3300046660 Ga0495625_0000061 Ga0495625_0000061_87954_88931 325
776 3300046660 Ga0495625_0060668 Ga0495625_0060668_870_1913 325
777 3300046660 Ga0495625_0278636 Ga0495625_0278636_26_1003 325
778 3300046664 Ga0495659_0002272 Ga0495659_0002272_4000_4977 325
779 3300046665 Ga0495661_0000072 Ga0495661_0000072_9933_10910 325
780 3300046665 Ga0495661_0000841 Ga0495661_0000841_19033_20010 325
781 3300046665 Ga0495661_0019472 Ga0495661_0019472_1438_2415 325
782 3300046665 Ga0495661_0036893 Ga0495661_0036893_190_1167 325
783 3300046683 Ga0495658_0209403 Ga0495658_0209403_186_1166 325
784 3300046691 Ga0495670_0105866 Ga0495670_0105866_84_1061 325
785 3300046692 Ga0495671_0004440 Ga0495671_0004440_2369_3346 325
786 3300046692 Ga0495671_0013286 Ga0495671_0013286_3477_4454 325
787 3300046692 Ga0495671_0034409 Ga0495671_0034409_278_1294 325
788 3300046692 Ga0495671_0047935 Ga0495671_0047935_795_1772 325
789 3300046810 Ga0495660_0004806 Ga0495660_0004806_5734_6777 325
790 3300046810 Ga0495660_0020931 Ga0495660_0020931_1889_2866 325
791 3300046810 Ga0495660_0065991 Ga0495660_0065991_885_1862 325
792 3300047320 Ga0495672_0004169 Ga0495672_0004169_7701_8678 325
793 3300047320 Ga0495672_0014093 Ga0495672_0014093_493_1470 325
794 3300047320 Ga0495672_0021543 Ga0495672_0021543_808_1851 325
795 3300047320 Ga0495672_0033583 Ga0495672_0033583_1930_2907 325
796 3300047320 Ga0495672_0135331 Ga0495672_0135331_73_1050 325
797 3300047322 Ga0495680_0004392 Ga0495680_0004392_425_1402 325
798 3300047323 Ga0495683_0000070 Ga0495683_0000070_18138_19115 325
799 3300047446 Ga0495679_000814 Ga0495679_000814_990_2033 325
800 3300047469 Ga0495673_0002493 Ga0495673_0002493_4010_5053 325
801 3300047469 Ga0495673_0002965 Ga0495673_0002965_7274_8251 325
802 3300047469 Ga0495673_0011343 Ga0495673_0011343_1415_2392 325
803 3300047469 Ga0495673_0037789 Ga0495673_0037789_152_1129 325
804 3300047470 Ga0495681_0009957 Ga0495681_0009957_645_1622 325
805 3300047470 Ga0495681_0066142 Ga0495681_0066142_485_1462 325
806 3300047472 Ga0495686_0028959 Ga0495686_0028959_2581_3558 325
807 3300048905 Ga0496102_0133813 Ga0496102_0133813_443_1420 325
808 3300048919 Ga0496116_0004519 Ga0496116_0004519_7694_8671 325
809 3300048920 Ga0496117_0005978 Ga0496117_0005978_7686_8663 325
810 3300048921 Ga0496118_0016641 Ga0496118_0016641_602_1579 325
811 3300048922 Ga0496119_0001575 Ga0496119_0001575_11777_12760 325
812 3300048923 Ga0496120_0002964 Ga0496120_0002964_5319_6302 325
813 3300048924 Ga0496121_0002538 Ga0496121_0002538_5841_6818 325
814 3300048924 Ga0496121_0006595 Ga0496121_0006595_12719_13696 325
815 3300048924 Ga0496121_0007491 Ga0496121_0007491_4532_5509 325
816 3300048925 Ga0496122_0000398 Ga0496122_0000398_5660_6637 325
817 3300048925 Ga0496122_0052728 Ga0496122_0052728_14_991 325
818 3300048926 Ga0496123_0000302 Ga0496123_0000302_5554_6531 325
819 3300048926 Ga0496123_0071453 Ga0496123_0071453_244_1221 325
820 3300048927 Ga0496124_0000073 Ga0496124_0000073_130245_131222 325
821 3300048927 Ga0496124_0022223 Ga0496124_0022223_45_1022 325
822 3300048927 Ga0496124_0050920 Ga0496124_0050920_2173_3216 325
823 3300048927 Ga0496124_0115208 Ga0496124_0115208_45_1022 325
824 3300049459 Ga0495678_000325 Ga0495678_000325_37242_38219 325
825 3300049459 Ga0495678_000692 Ga0495678_000692_8597_9574 325
826 3300049459 Ga0495678_011303 Ga0495678_011303_3233_4210 325
827 3300049459 Ga0495678_030399 Ga0495678_030399_271_1248 325
828 3300049460 Ga0495682_0000090 Ga0495682_0000090_3153_4130 325
829 3300049460 Ga0495682_0000607 Ga0495682_0000607_14187_15164 325
830 3300049460 Ga0495682_0079633 Ga0495682_0079633_71_1048 325
831 3300049853 Ga0501226_000001 Ga0501226_000001_262582_263562 325
832 iso_pu_bacteria 640427133 640490018 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

57

141

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

317

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

214

354

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9475 1 322
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9402 1 322
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9389 1 323
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9366 1 323
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9336 1 323
ID Description Score Start End Superfamily
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.987 134 257 3.40.50.720
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9752 3 118 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9706 2 130 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9704 1 118 3.90.180.10
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9682 2 114 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A2A4AT29-F1-model_v4 deleted 0.9942 1 324
AF-A0A7X5WVL9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9936 21 114 GO:0016491
AF-A0A2A4AT29-F1-model_v4 deleted 0.9911 1 324
AF-A0A6H9HTU4-F1-model_v4 NADPH:quinone oxidoreductase family protein 0.9863 1 324 GO:0008270
GO:0016491
AF-A0A522AWD5-F1-model_v4 NADPH:quinone oxidoreductase family protein 0.9847 1 226 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map