F482740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 533 | 596 | 322 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|640427133|640490018 |
| Length | 357 |
| Sequence | SPRSAPRLKALSSRAIPCRAASVRPVEQGKAMKAVLCKSFGPPESLVVEDAPSPQIKPSEILLDVHAAGVNFPDTLMIEGKYQFKPPFPFSPGGEAAGVVAAVGEKVSHLKVGDRVMALTGWGSFAEQVAVAGSNALPIPPSMDFATAAAFSMTYGTSMHALKQRASLQPGETLLVLGASGGVGLAAVEIGKAVGARVIAAASSAEKLEVARNAGADELINYSEVSLKERLKELTGGQGVDVIYDPVGGKLFEEAFRSIAWNGRMLVVGFAAGGDIPALPANLPLLKGAALIGVFWGAFAQRQPQDNAANFRQLFAWHAEGKLKPLVSQRFTLEEAGQAIATLGQRKAVGKLVVQVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 25 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 26 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 27 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 28 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 29 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 30 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 31 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 32 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 33 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 34 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 35 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 36 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 37 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 38 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 39 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 40 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 41 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 42 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 43 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 44 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 45 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 46 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 47 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 48 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 49 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 50 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 51 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 52 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 53 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 54 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 55 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 56 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 57 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 58 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 59 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 60 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 61 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 62 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 63 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 64 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 65 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 66 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 67 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 68 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 69 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 70 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 71 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 72 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 73 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 74 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 75 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 76 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 77 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 78 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 79 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 80 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 81 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 82 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 83 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 84 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 85 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 86 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 87 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 88 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 89 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 90 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 91 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 92 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 93 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 94 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 95 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 96 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 97 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 98 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 99 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 100 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 101 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 102 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 103 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 104 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 105 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 106 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 107 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 108 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 109 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 110 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 111 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 112 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 113 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 114 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 115 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 116 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 117 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 118 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 119 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 120 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 121 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 122 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 123 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 124 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 125 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 126 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 127 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 128 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 129 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 130 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 131 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 132 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 133 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 134 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 135 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 136 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 137 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 138 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 139 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 140 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 141 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 142 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 143 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 144 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 145 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 146 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 147 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 148 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 149 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 150 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 151 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 152 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 153 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 154 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 155 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 156 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 157 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 158 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 159 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 160 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 161 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 162 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 163 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 164 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 165 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 166 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 167 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 168 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 169 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 170 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 171 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 172 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 173 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 174 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 175 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 176 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 177 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 178 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 179 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 180 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 181 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 182 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 183 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 184 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 185 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 186 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 187 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 188 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 189 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 190 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 191 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 192 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 193 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 194 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 195 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 196 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 197 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 198 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 199 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 200 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 201 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 202 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 203 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 204 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 205 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 206 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 207 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 208 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 209 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 210 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 211 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 212 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 213 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 214 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 215 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 216 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 217 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 218 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 219 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 220 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 221 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 222 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 223 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 224 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 225 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 226 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 227 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 228 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 229 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 230 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 231 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 232 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 233 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 234 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 235 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 238 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 240 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 241 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 249 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 252 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 253 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 254 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 255 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 259 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 260 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 261 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 262 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 263 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 264 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 265 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 266 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 267 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 268 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 269 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 271 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 272 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 273 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 276 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 290 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 299 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 301 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 302 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 304 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 314 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 316 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 319 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 360 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 361 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 363 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 367 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 368 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 369 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 370 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 371 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 372 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 373 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 374 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 375 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 376 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 377 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 378 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 379 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 380 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 381 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 382 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 383 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 384 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 385 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 386 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 387 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 388 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 389 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 390 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 391 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 392 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 393 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 394 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 395 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 396 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 397 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 398 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 399 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 400 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 401 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 402 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 403 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 404 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 405 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 406 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 407 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 408 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 409 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 410 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 411 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 412 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 413 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 414 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 415 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 416 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 417 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 418 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 419 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 420 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 421 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 422 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 423 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 424 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 468 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 469 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 470 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 471 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 472 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 473 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 474 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 475 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 476 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 477 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 478 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 479 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 480 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 481 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 507 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 508 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 510 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 511 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 512 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 513 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 514 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 515 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 516 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 517 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 518 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 519 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 520 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 521 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 522 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 523 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 524 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 525 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 526 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 527 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 528 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 529 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 530 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 531 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 532 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 533 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.63 |
| Metatranscriptomes | 0 |
| Isolates | 28.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.33 |
| Nodule | 3.25 |
| Rhizoplane | 8.65 |
| Rhizosphere | 66.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_718 | 2124908027 | Bacteria | 55855 |
| 2 | SwRhRL2b_contig_2761050 | 2162886007 | Bacteria | 4939 |
| 3 | SwRhRL2b_contig_519873 | 2162886007 | Bacteria | 1223 |
| 4 | JGI25162J39368_1001123 | 3300002737 | Bacteria | 16116 |
| 5 | JGI25162J39368_1001366 | 3300002737 | Bacteria | 13434 |
| 6 | JGI25154J39366_1009458 | 3300002738 | Bacteria | 1198 |
| 7 | JGI25163J39215_1001049 | 3300002771 | Bacteria | 5909 |
| 8 | JGI25163J39215_1001615 | 3300002771 | Bacteria | 3376 |
| 9 | JGI25164J39214_1000593 | 3300002772 | Bacteria | 16116 |
| 10 | JGI25164J39214_1000683 | 3300002772 | Bacteria | 13434 |
| 11 | JGI25165J46597_1001173 | 3300003214 | Bacteria | 16116 |
| 12 | JGI25165J46597_1001371 | 3300003214 | Bacteria | 13434 |
| 13 | rootH1_10163451 | 3300003323 | Bacteria | 2195 |
| 14 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 15 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 16 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 17 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 18 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 19 | Ga0055535_1004747 | 3300003761 | Bacteria | 3194 |
| 20 | Ga0055536_1001844 | 3300003781 | Bacteria | 12389 |
| 21 | Ga0055536_1004928 | 3300003781 | Bacteria | 6653 |
| 22 | Ga0055536_1005802 | 3300003781 | Bacteria | 5943 |
| 23 | Ga0055530_10001310 | 3300003791 | Bacteria | 18721 |
| 24 | Ga0055530_10001782 | 3300003791 | Bacteria | 14972 |
| 25 | Ga0055530_10002801 | 3300003791 | Bacteria | 10727 |
| 26 | Ga0055540_1000960 | 3300003792 | Bacteria | 18721 |
| 27 | Ga0055540_1001320 | 3300003792 | Bacteria | 14972 |
| 28 | Ga0055540_1002155 | 3300003792 | Bacteria | 10727 |
| 29 | Ga0055531_10000404 | 3300003794 | Bacteria | 41520 |
| 30 | Ga0055531_10000483 | 3300003794 | Bacteria | 36666 |
| 31 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 32 | Ga0065714_10002460 | 3300005288 | Bacteria | 16953 |
| 33 | Ga0065714_10003917 | 3300005288 | Bacteria | 7498 |
| 34 | Ga0065714_10003949 | 3300005288 | Bacteria | 6202 |
| 35 | Ga0065714_10073013 | 3300005288 | Bacteria | 3259 |
| 36 | Ga0065714_10075748 | 3300005288 | Bacteria | 2870 |
| 37 | Ga0065714_10081276 | 3300005288 | Bacteria | 2380 |
| 38 | Ga0065704_10004501 | 3300005289 | Bacteria | 3341 |
| 39 | Ga0065704_10070757 | 3300005289 | Bacteria | 16643 |
| 40 | Ga0065704_10075640 | 3300005289 | Bacteria | 5486 |
| 41 | Ga0065704_10078835 | 3300005289 | Bacteria | 4322 |
| 42 | Ga0065712_10001367 | 3300005290 | Bacteria | 6415 |
| 43 | Ga0065712_10002401 | 3300005290 | Bacteria | 6922 |
| 44 | Ga0065712_10067900 | 3300005290 | Bacteria | 22102 |
| 45 | Ga0070683_100011524 | 3300005329 | Bacteria | 7649 |
| 46 | Ga0070670_100003472 | 3300005331 | Bacteria | 13080 |
| 47 | Ga0070670_100011975 | 3300005331 | Bacteria | 7420 |
| 48 | Ga0068869_100096037 | 3300005334 | Bacteria | 2237 |
| 49 | Ga0070666_10002542 | 3300005335 | Bacteria | 11037 |
| 50 | Ga0070680_100172221 | 3300005336 | Bacteria | 1822 |
| 51 | Ga0070682_100063067 | 3300005337 | Bacteria | 2349 |
| 52 | Ga0070691_10026206 | 3300005341 | Bacteria | 2717 |
| 53 | Ga0070691_10034404 | 3300005341 | Bacteria | 2385 |
| 54 | Ga0070661_100000126 | 3300005344 | Bacteria | 63357 |
| 55 | Ga0070668_100000320 | 3300005347 | Bacteria | 31649 |
| 56 | Ga0070668_100056706 | 3300005347 | Bacteria | 3026 |
| 57 | Ga0070668_100143744 | 3300005347 | Bacteria | 1924 |
| 58 | Ga0070668_100365128 | 3300005347 | Bacteria | 1225 |
| 59 | Ga0070669_100001006 | 3300005353 | Bacteria | 20540 |
| 60 | Ga0070669_100012886 | 3300005353 | Bacteria | 5940 |
| 61 | Ga0070669_100046952 | 3300005353 | Bacteria | 3149 |
| 62 | Ga0070669_100047838 | 3300005353 | Bacteria | 3121 |
| 63 | Ga0070669_100191144 | 3300005353 | Bacteria | 1606 |
| 64 | Ga0070673_100214660 | 3300005364 | Unclassified | 1663 |
| 65 | Ga0070667_100000100 | 3300005367 | Bacteria | 108128 |
| 66 | Ga0070713_100018878 | 3300005436 | Bacteria | 5250 |
| 67 | Ga0070710_10005945 | 3300005437 | Bacteria | 5826 |
| 68 | Ga0070705_100034406 | 3300005440 | Bacteria | 2832 |
| 69 | Ga0070662_100000101 | 3300005457 | Bacteria | 47097 |
| 70 | Ga0070662_100004142 | 3300005457 | Bacteria | 9123 |
| 71 | Ga0070681_10047931 | 3300005458 | Bacteria | 4270 |
| 72 | Ga0070681_10212289 | 3300005458 | Bacteria | 1851 |
| 73 | Ga0070679_100016449 | 3300005530 | Bacteria | 7135 |
| 74 | Ga0070679_100062851 | 3300005530 | Bacteria | 3701 |
| 75 | Ga0070684_100030811 | 3300005535 | Bacteria | 4562 |
| 76 | Ga0070684_100035380 | 3300005535 | Bacteria | 4275 |
| 77 | Ga0068853_100000372 | 3300005539 | Bacteria | 30828 |
| 78 | Ga0070695_100022399 | 3300005545 | Bacteria | 3874 |
| 79 | Ga0070665_100056139 | 3300005548 | Bacteria | 3949 |
| 80 | Ga0070665_100175393 | 3300005548 | Bacteria | 2144 |
| 81 | Ga0070665_100308603 | 3300005548 | Bacteria | 1585 |
| 82 | Ga0070665_100335453 | 3300005548 | Bacteria | 1517 |
| 83 | Ga0070665_100396744 | 3300005548 | Bacteria | 1387 |
| 84 | Ga0070664_100001357 | 3300005564 | Bacteria | 19532 |
| 85 | Ga0070664_100064535 | 3300005564 | Bacteria | 3123 |
| 86 | Ga0068857_100025141 | 3300005577 | Bacteria | 5243 |
| 87 | Ga0068857_100103944 | 3300005577 | Bacteria | 2550 |
| 88 | Ga0068854_100021339 | 3300005578 | Bacteria | 4394 |
| 89 | Ga0068856_100021703 | 3300005614 | Bacteria | 6239 |
| 90 | Ga0068859_100121645 | 3300005617 | Bacteria | 2677 |
| 91 | Ga0068864_100000139 | 3300005618 | Bacteria | 69907 |
| 92 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 93 | Ga0068863_100000075 | 3300005841 | Bacteria | 109825 |
| 94 | Ga0068863_100000218 | 3300005841 | Bacteria | 61402 |
| 95 | Ga0068863_100004494 | 3300005841 | Bacteria | 13760 |
| 96 | Ga0068858_100000107 | 3300005842 | Bacteria | 87216 |
| 97 | Ga0068860_100006006 | 3300005843 | Bacteria | 12223 |
| 98 | Ga0068860_100007209 | 3300005843 | Bacteria | 11117 |
| 99 | Ga0068860_100038578 | 3300005843 | Bacteria | 4570 |
| 100 | Ga0068862_100001390 | 3300005844 | Bacteria | 22412 |
| 101 | Ga0081540_1000048 | 3300005983 | Bacteria | 127924 |
| 102 | Ga0081540_1032576 | 3300005983 | Bacteria | 2843 |
| 103 | Ga0070717_10019939 | 3300006028 | Bacteria | 5266 |
| 104 | Ga0075432_10001293 | 3300006058 | Bacteria | 8077 |
| 105 | Ga0075432_10011785 | 3300006058 | Bacteria | 2971 |
| 106 | Ga0075428_100062521 | 3300006844 | Bacteria | 4076 |
| 107 | Ga0075433_10006882 | 3300006852 | Bacteria | 9010 |
| 108 | Ga0075434_100002490 | 3300006871 | Bacteria | 16225 |
| 109 | Ga0097620_100121652 | 3300006931 | Bacteria | 2677 |
| 110 | Ga0079104_1000424 | 3300006946 | Bacteria | 48276 |
| 111 | Ga0079104_1001947 | 3300006946 | Bacteria | 12253 |
| 112 | Ga0105251_10000009 | 3300009011 | Bacteria | 192384 |
| 113 | Ga0105251_10001765 | 3300009011 | Bacteria | 18003 |
| 114 | Ga0105251_10001772 | 3300009011 | Bacteria | 17958 |
| 115 | Ga0105251_10003299 | 3300009011 | Bacteria | 11806 |
| 116 | Ga0105251_10004239 | 3300009011 | Bacteria | 9895 |
| 117 | Ga0105251_10004948 | 3300009011 | Bacteria | 8870 |
| 118 | Ga0105251_10011207 | 3300009011 | Bacteria | 5134 |
| 119 | Ga0105244_10001453 | 3300009036 | Bacteria | 19179 |
| 120 | Ga0105244_10012421 | 3300009036 | Bacteria | 5031 |
| 121 | Ga0105244_10018147 | 3300009036 | Bacteria | 3957 |
| 122 | Ga0105244_10018552 | 3300009036 | Bacteria | 3900 |
| 123 | Ga0105244_10031978 | 3300009036 | Bacteria | 2790 |
| 124 | Ga0105244_10033541 | 3300009036 | Bacteria | 2705 |
| 125 | Ga0105244_10034075 | 3300009036 | Bacteria | 2683 |
| 126 | Ga0105244_10037553 | 3300009036 | Bacteria | 2532 |
| 127 | Ga0105244_10049296 | 3300009036 | Bacteria | 2153 |
| 128 | Ga0105244_10072789 | 3300009036 | Bacteria | 1711 |
| 129 | Ga0105244_10099476 | 3300009036 | Bacteria | 1424 |
| 130 | Ga0105250_10000981 | 3300009092 | Bacteria | 16625 |
| 131 | Ga0105250_10001636 | 3300009092 | Bacteria | 11944 |
| 132 | Ga0105250_10012322 | 3300009092 | Bacteria | 3531 |
| 133 | Ga0105250_10014586 | 3300009092 | Bacteria | 3225 |
| 134 | Ga0105250_10016106 | 3300009092 | Bacteria | 3051 |
| 135 | Ga0105250_10030459 | 3300009092 | Bacteria | 2169 |
| 136 | Ga0105250_10071453 | 3300009092 | Bacteria | 1401 |
| 137 | Ga0111539_10038874 | 3300009094 | Bacteria | 5740 |
| 138 | Ga0111539_10373291 | 3300009094 | Bacteria | 1660 |
| 139 | Ga0105245_10020417 | 3300009098 | Bacteria | 5810 |
| 140 | Ga0105247_10005269 | 3300009101 | Bacteria | 8161 |
| 141 | Ga0114129_10043509 | 3300009147 | Bacteria | 6317 |
| 142 | Ga0105243_10005105 | 3300009148 | Bacteria | 10305 |
| 143 | Ga0105243_10007073 | 3300009148 | Bacteria | 8627 |
| 144 | Ga0105243_10010014 | 3300009148 | Bacteria | 7208 |
| 145 | Ga0105243_10015686 | 3300009148 | Bacteria | 5729 |
| 146 | Ga0105243_10029744 | 3300009148 | Bacteria | 4203 |
| 147 | Ga0105242_10003232 | 3300009176 | Bacteria | 12701 |
| 148 | Ga0105242_10050113 | 3300009176 | Bacteria | 3399 |
| 149 | Ga0105248_10075012 | 3300009177 | Bacteria | 3801 |
| 150 | Ga0105248_10088718 | 3300009177 | Bacteria | 3481 |
| 151 | Ga0105237_10003007 | 3300009545 | Bacteria | 20351 |
| 152 | Ga0105237_10075496 | 3300009545 | Bacteria | 3362 |
| 153 | Ga0105249_10001100 | 3300009553 | Bacteria | 24052 |
| 154 | Ga0105246_10021361 | 3300011119 | Bacteria | 4165 |
| 155 | Ga0105246_10023768 | 3300011119 | Bacteria | 3969 |
| 156 | Ga0105246_10057824 | 3300011119 | Bacteria | 2685 |
| 157 | Ga0157345_1000367 | 3300012498 | Bacteria | 5092 |
| 158 | Ga0157373_10003979 | 3300013100 | Bacteria | 11145 |
| 159 | Ga0157373_10004112 | 3300013100 | Bacteria | 10971 |
| 160 | Ga0157373_10036164 | 3300013100 | Bacteria | 3545 |
| 161 | Ga0157373_10131153 | 3300013100 | Bacteria | 1763 |
| 162 | Ga0157373_10260663 | 3300013100 | Bacteria | 1227 |
| 163 | Ga0157371_10003709 | 3300013102 | Bacteria | 13694 |
| 164 | Ga0157370_10000698 | 3300013104 | Bacteria | 41998 |
| 165 | Ga0157370_10102117 | 3300013104 | Bacteria | 2685 |
| 166 | Ga0157370_10327544 | 3300013104 | Bacteria | 1412 |
| 167 | Ga0157369_10456556 | 3300013105 | Bacteria | 1323 |
| 168 | Ga0163162_10138981 | 3300013306 | Bacteria | 2541 |
| 169 | Ga0157372_10003012 | 3300013307 | Bacteria | 18164 |
| 170 | Ga0163163_10044116 | 3300014325 | Bacteria | 4374 |
| 171 | Ga0157380_10419432 | 3300014326 | Bacteria | 1276 |
| 172 | Ga0182008_10002828 | 3300014497 | Bacteria | 10729 |
| 173 | Ga0157376_10003731 | 3300014969 | Bacteria | 10525 |
| 174 | Ga0182007_10047307 | 3300015262 | Bacteria | 1423 |
| 175 | Ga0182007_10057397 | 3300015262 | Bacteria | 1278 |
| 176 | Ga0182005_1009972 | 3300015265 | Bacteria | 2743 |
| 177 | Ga0163161_10132377 | 3300017792 | Bacteria | 1882 |
| 178 | Ga0213876_10040655 | 3300021384 | Bacteria | 2457 |
| 179 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 180 | Ga0209760_100367 | 3300025207 | Bacteria | 12053 |
| 181 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 182 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 183 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 184 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 185 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 186 | Ga0209563_102304 | 3300025230 | Bacteria | 4386 |
| 187 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 188 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 189 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 190 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 191 | Ga0209437_104938 | 3300025233 | Bacteria | 2309 |
| 192 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 193 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 194 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 195 | Ga0209759_1002680 | 3300025256 | Bacteria | 7609 |
| 196 | Ga0209759_1006804 | 3300025256 | Bacteria | 3784 |
| 197 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 198 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 199 | Ga0209130_1011547 | 3300025284 | Bacteria | 2361 |
| 200 | Ga0209675_1000989 | 3300025291 | Bacteria | 17959 |
| 201 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 202 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 203 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 204 | Ga0209676_1001397 | 3300025292 | Bacteria | 23348 |
| 205 | Ga0209676_1019306 | 3300025292 | Bacteria | 2347 |
| 206 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 207 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 208 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 209 | Ga0209050_1002563 | 3300025298 | Bacteria | 15157 |
| 210 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 211 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 212 | Ga0209051_1001294 | 3300025303 | Bacteria | 22056 |
| 213 | Ga0209257_1002874 | 3300025304 | Bacteria | 16040 |
| 214 | Ga0209257_1004425 | 3300025304 | Bacteria | 10900 |
| 215 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 216 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 217 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 218 | Ga0207696_1000050 | 3300025711 | Bacteria | 276983 |
| 219 | Ga0207696_1000357 | 3300025711 | Bacteria | 46078 |
| 220 | Ga0207696_1003002 | 3300025711 | Bacteria | 7882 |
| 221 | Ga0207696_1008529 | 3300025711 | Bacteria | 3906 |
| 222 | Ga0207696_1018984 | 3300025711 | Bacteria | 2248 |
| 223 | Ga0207696_1019230 | 3300025711 | Bacteria | 2229 |
| 224 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 225 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 226 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 227 | Ga0207655_1005474 | 3300025728 | Bacteria | 8620 |
| 228 | Ga0207655_1005579 | 3300025728 | Bacteria | 8526 |
| 229 | Ga0207655_1008819 | 3300025728 | Bacteria | 6344 |
| 230 | Ga0207655_1009052 | 3300025728 | Bacteria | 6233 |
| 231 | Ga0207655_1010707 | 3300025728 | Bacteria | 5540 |
| 232 | Ga0207655_1010965 | 3300025728 | Bacteria | 5445 |
| 233 | Ga0207655_1012603 | 3300025728 | Bacteria | 4927 |
| 234 | Ga0207655_1016443 | 3300025728 | Bacteria | 4045 |
| 235 | Ga0207655_1024965 | 3300025728 | Bacteria | 2914 |
| 236 | Ga0207655_1025001 | 3300025728 | Bacteria | 2911 |
| 237 | Ga0207655_1038895 | 3300025728 | Bacteria | 2072 |
| 238 | Ga0207713_1000032 | 3300025735 | Bacteria | 276465 |
| 239 | Ga0207713_1000079 | 3300025735 | Bacteria | 172274 |
| 240 | Ga0207713_1000659 | 3300025735 | Bacteria | 32880 |
| 241 | Ga0207713_1000881 | 3300025735 | Bacteria | 27355 |
| 242 | Ga0207713_1001352 | 3300025735 | Bacteria | 19999 |
| 243 | Ga0207713_1001441 | 3300025735 | Bacteria | 18998 |
| 244 | Ga0207713_1001720 | 3300025735 | Bacteria | 16886 |
| 245 | Ga0207713_1002171 | 3300025735 | Bacteria | 14559 |
| 246 | Ga0207713_1008846 | 3300025735 | Bacteria | 5740 |
| 247 | Ga0207713_1032956 | 3300025735 | Bacteria | 2269 |
| 248 | Ga0207713_1045592 | 3300025735 | Bacteria | 1789 |
| 249 | Ga0207713_1052121 | 3300025735 | Bacteria | 1623 |
| 250 | Ga0207692_10008666 | 3300025898 | Bacteria | 4219 |
| 251 | Ga0207710_10002771 | 3300025900 | Bacteria | 8011 |
| 252 | Ga0207680_10007348 | 3300025903 | Bacteria | 5363 |
| 253 | Ga0207685_10014357 | 3300025905 | Bacteria | 2478 |
| 254 | Ga0207707_10107652 | 3300025912 | Bacteria | 2437 |
| 255 | Ga0207707_10135044 | 3300025912 | Bacteria | 2157 |
| 256 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 257 | Ga0207671_10284499 | 3300025914 | Bacteria | 1304 |
| 258 | Ga0207663_10005895 | 3300025916 | Bacteria | 6217 |
| 259 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 260 | Ga0207652_10387571 | 3300025921 | Bacteria | 1261 |
| 261 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 262 | Ga0207681_10003495 | 3300025923 | Bacteria | 9785 |
| 263 | Ga0207681_10037180 | 3300025923 | Bacteria | 3216 |
| 264 | Ga0207650_10000338 | 3300025925 | Bacteria | 45436 |
| 265 | Ga0207650_10000564 | 3300025925 | Bacteria | 30060 |
| 266 | Ga0207687_10013217 | 3300025927 | Bacteria | 5391 |
| 267 | Ga0207664_10100135 | 3300025929 | Bacteria | 2392 |
| 268 | Ga0207706_10000580 | 3300025933 | Bacteria | 38973 |
| 269 | Ga0207706_10001804 | 3300025933 | Bacteria | 21019 |
| 270 | Ga0207686_10001491 | 3300025934 | Bacteria | 13199 |
| 271 | Ga0207686_10093117 | 3300025934 | Bacteria | 1994 |
| 272 | Ga0207709_10000248 | 3300025935 | Bacteria | 66465 |
| 273 | Ga0207709_10002031 | 3300025935 | Bacteria | 13118 |
| 274 | Ga0207709_10002118 | 3300025935 | Bacteria | 12768 |
| 275 | Ga0207709_10004819 | 3300025935 | Bacteria | 7732 |
| 276 | Ga0207709_10005277 | 3300025935 | Bacteria | 7348 |
| 277 | Ga0207709_10010766 | 3300025935 | Bacteria | 5036 |
| 278 | Ga0207711_10046333 | 3300025941 | Bacteria | 3715 |
| 279 | Ga0207711_10068725 | 3300025941 | Bacteria | 3069 |
| 280 | Ga0207661_10075763 | 3300025944 | Bacteria | 2761 |
| 281 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 282 | Ga0207651_10242508 | 3300025960 | Unclassified | 1470 |
| 283 | Ga0207712_10000494 | 3300025961 | Bacteria | 32649 |
| 284 | Ga0207712_10036357 | 3300025961 | Bacteria | 3353 |
| 285 | Ga0207668_10000381 | 3300025972 | Bacteria | 28177 |
| 286 | Ga0207668_10175272 | 3300025972 | Bacteria | 1686 |
| 287 | Ga0207640_10026125 | 3300025981 | Bacteria | 3542 |
| 288 | Ga0207658_10000079 | 3300025986 | Bacteria | 107980 |
| 289 | Ga0207703_10000146 | 3300026035 | Bacteria | 83180 |
| 290 | Ga0207639_10000286 | 3300026041 | Bacteria | 36062 |
| 291 | Ga0207678_10269316 | 3300026067 | Bacteria | 1460 |
| 292 | Ga0207702_10041671 | 3300026078 | Bacteria | 3851 |
| 293 | Ga0207641_10000019 | 3300026088 | Bacteria | 295899 |
| 294 | Ga0207641_10000381 | 3300026088 | Bacteria | 52796 |
| 295 | Ga0207641_10022840 | 3300026088 | Bacteria | 5151 |
| 296 | Ga0207676_10000924 | 3300026095 | Bacteria | 22721 |
| 297 | Ga0207676_10131736 | 3300026095 | Bacteria | 2127 |
| 298 | Ga0207674_10000581 | 3300026116 | Bacteria | 48108 |
| 299 | Ga0207674_10007464 | 3300026116 | Bacteria | 12743 |
| 300 | Ga0207683_10452553 | 3300026121 | Bacteria | 1184 |
| 301 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 302 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 303 | Ga0209281_1008353 | 3300027111 | Bacteria | 2521 |
| 304 | Ga0209281_1017333 | 3300027111 | Bacteria | 1463 |
| 305 | Ga0209389_1039397 | 3300027296 | Bacteria | 3685 |
| 306 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 307 | Ga0207428_10066064 | 3300027907 | Bacteria | 2851 |
| 308 | Ga0207428_10164592 | 3300027907 | Unclassified | 1683 |
| 309 | Ga0268266_10017876 | 3300028379 | Bacteria | 6041 |
| 310 | Ga0268266_10416636 | 3300028379 | Bacteria | 1272 |
| 311 | Ga0268265_10001778 | 3300028380 | Bacteria | 17286 |
| 312 | Ga0268264_10001534 | 3300028381 | Bacteria | 21510 |
| 313 | Ga0268264_10004836 | 3300028381 | Bacteria | 11414 |
| 314 | Ga0268264_10027626 | 3300028381 | Bacteria | 4639 |
| 315 | Ga0265337_1001036 | 3300028556 | Bacteria | 14438 |
| 316 | Ga0265334_10014029 | 3300028573 | Bacteria | 3345 |
| 317 | Ga0307517_10144273 | 3300028786 | Bacteria | 1658 |
| 318 | Ga0268256_1000232 | 3300030500 | Bacteria | 59133 |
| 319 | Ga0316179_1074380 | 3300030734 | Bacteria | 3589 |
| 320 | Ga0316183_1004754 | 3300030742 | Bacteria | 7110 |
| 321 | Ga0316181_1248978 | 3300030744 | Bacteria | 3890 |
| 322 | Ga0265320_10000743 | 3300031240 | Bacteria | 24985 |
| 323 | Ga0265327_10000225 | 3300031251 | Bacteria | 115061 |
| 324 | Ga0307509_10209874 | 3300031507 | Bacteria | 1773 |
| 325 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 326 | Ga0307408_100005271 | 3300031548 | Bacteria | 8663 |
| 327 | Ga0307408_100008555 | 3300031548 | Bacteria | 6759 |
| 328 | Ga0307516_10000019 | 3300031730 | Bacteria | 196679 |
| 329 | Ga0307516_10048628 | 3300031730 | Bacteria | 4173 |
| 330 | Ga0307405_10003779 | 3300031731 | Bacteria | 7033 |
| 331 | Ga0307405_10215665 | 3300031731 | Bacteria | 1404 |
| 332 | Ga0307407_10027385 | 3300031903 | Bacteria | 3032 |
| 333 | Ga0307412_10003115 | 3300031911 | Bacteria | 9212 |
| 334 | Ga0307412_10006197 | 3300031911 | Bacteria | 6744 |
| 335 | Ga0307412_10008593 | 3300031911 | Bacteria | 5836 |
| 336 | Ga0307416_100040568 | 3300032002 | Bacteria | 3618 |
| 337 | Ga0307411_10007691 | 3300032005 | Bacteria | 5516 |
| 338 | Ga0373930_0011861 | 3300034816 | Bacteria | 1580 |
| 339 | Ga0373928_0035363 | 3300035084 | Bacteria | 1125 |
| 340 | Ga0373951_0020439 | 3300035091 | Bacteria | 1515 |
| 341 | Ga0373939_0003102 | 3300035114 | Bacteria | 3904 |
| 342 | Ga0373941_0003895 | 3300035115 | Bacteria | 3418 |
| 343 | Ga0373962_0002569 | 3300035242 | Bacteria | 4309 |
| 344 | Ga0373931_0000508 | 3300035691 | Bacteria | 15931 |
| 345 | Ga0373931_0000910 | 3300035691 | Bacteria | 12471 |
| 346 | Ga0373937_0000755 | 3300036401 | Bacteria | 27949 |
| 347 | Ga0373937_0488303 | 3300036401 | Bacteria | 1170 |
| 348 | Ga0395900_0000021 | 3300037418 | Bacteria | 351144 |
| 349 | Ga0395900_0018240 | 3300037418 | Bacteria | 7159 |
| 350 | Ga0395898_0001941 | 3300037466 | Bacteria | 26241 |
| 351 | Ga0395905_0006642 | 3300037471 | Bacteria | 11599 |
| 352 | Ga0395905_0009143 | 3300037471 | Bacteria | 9708 |
| 353 | Ga0395901_0021168 | 3300038443 | Bacteria | 6660 |
| 354 | Ga0395901_0131608 | 3300038443 | Bacteria | 2628 |
| 355 | Ga0395901_0558773 | 3300038443 | Bacteria | 1159 |
| 356 | Ga0237819_01191 | 3300038705 | Bacteria | 7310 |
| 357 | Ga0436365_0703236 | 3300039437 | Bacteria | 1206 |
| 358 | Ga0436365_1488395 | 3300039437 | Bacteria | 4243 |
| 359 | Ga0439436_0000130 | 3300041404 | Bacteria | 17330 |
| 360 | Ga0439438_005440 | 3300041405 | Bacteria | 4684 |
| 361 | Ga0439438_013062 | 3300041405 | Bacteria | 2519 |
| 362 | Ga0439438_055098 | 3300041405 | Bacteria | 1003 |
| 363 | Ga0439453_0000335 | 3300041408 | Bacteria | 4932 |
| 364 | Ga0439461_0037012 | 3300041410 | Bacteria | 1041 |
| 365 | Ga0439466_0001538 | 3300041411 | Bacteria | 9009 |
| 366 | Ga0439466_0016276 | 3300041411 | Bacteria | 2690 |
| 367 | Ga0439466_0029187 | 3300041411 | Bacteria | 1899 |
| 368 | Ga0439466_0035683 | 3300041411 | Bacteria | 1681 |
| 369 | Ga0439437_000827 | 3300042000 | Bacteria | 3190 |
| 370 | Ga0439441_017284 | 3300042001 | Bacteria | 1293 |
| 371 | Ga0439443_001325 | 3300042003 | Bacteria | 2681 |
| 372 | Ga0439432_000624 | 3300042006 | Bacteria | 13327 |
| 373 | Ga0439432_003130 | 3300042006 | Bacteria | 6157 |
| 374 | Ga0439432_035327 | 3300042006 | Bacteria | 1601 |
| 375 | Ga0439451_013932 | 3300042009 | Bacteria | 1622 |
| 376 | Ga0439451_019669 | 3300042009 | Bacteria | 1360 |
| 377 | Ga0439452_001777 | 3300042010 | Bacteria | 8410 |
| 378 | Ga0439452_015680 | 3300042010 | Bacteria | 2072 |
| 379 | Ga0439456_000058 | 3300042013 | Bacteria | 39602 |
| 380 | Ga0439456_007379 | 3300042013 | Bacteria | 2256 |
| 381 | Ga0439456_015014 | 3300042013 | Bacteria | 1615 |
| 382 | Ga0439463_003592 | 3300042016 | Bacteria | 3912 |
| 383 | Ga0439463_017897 | 3300042016 | Bacteria | 1760 |
| 384 | Ga0450911_000024 | 3300042115 | Bacteria | 84076 |
| 385 | Ga0450911_006235 | 3300042115 | Bacteria | 1787 |
| 386 | Ga0450923_000807 | 3300042125 | Bacteria | 3765 |
| 387 | Ga0450891_006657 | 3300042129 | Bacteria | 1062 |
| 388 | Ga0450902_000025 | 3300042137 | Bacteria | 13254 |
| 389 | Ga0450904_000070 | 3300042139 | Bacteria | 22975 |
| 390 | Ga0450905_000013 | 3300042142 | Bacteria | 16288 |
| 391 | Ga0450907_004917 | 3300042146 | Bacteria | 2276 |
| 392 | Ga0439446_0000025 | 3300042156 | Bacteria | 25767 |
| 393 | Ga0439446_0001438 | 3300042156 | Bacteria | 5422 |
| 394 | Ga0439434_0001044 | 3300042435 | Bacteria | 8032 |
| 395 | Ga0439435_0008188 | 3300042436 | Bacteria | 2419 |
| 396 | Ga0439464_0002389 | 3300042439 | Bacteria | 4614 |
| 397 | Ga0439464_0003144 | 3300042439 | Bacteria | 4141 |
| 398 | Ga0439460_0016567 | 3300042461 | Bacteria | 1964 |
| 399 | Ga0450901_000048 | 3300042533 | Bacteria | 11693 |
| 400 | Ga0451576_0464713 | 3300045051 | Bacteria | 1329 |
| 401 | Ga0495627_000240 | 3300046453 | Bacteria | 57483 |
| 402 | Ga0495627_002764 | 3300046453 | Bacteria | 8147 |
| 403 | Ga0495627_019160 | 3300046453 | Bacteria | 2299 |
| 404 | Ga0495591_000113 | 3300046458 | Bacteria | 93452 |
| 405 | Ga0495591_003234 | 3300046458 | Bacteria | 8567 |
| 406 | Ga0495591_003979 | 3300046458 | Bacteria | 7406 |
| 407 | Ga0495591_004557 | 3300046458 | Bacteria | 6721 |
| 408 | Ga0495591_004920 | 3300046458 | Bacteria | 6345 |
| 409 | Ga0495591_012617 | 3300046458 | Bacteria | 3135 |
| 410 | Ga0495629_0026617 | 3300046459 | Bacteria | 4108 |
| 411 | Ga0495638_0000415 | 3300046460 | Bacteria | 51819 |
| 412 | Ga0495638_0014331 | 3300046460 | Bacteria | 5365 |
| 413 | Ga0495638_0016717 | 3300046460 | Bacteria | 4905 |
| 414 | Ga0495650_0001251 | 3300046471 | Bacteria | 26248 |
| 415 | Ga0495650_0004070 | 3300046471 | Bacteria | 10227 |
| 416 | Ga0495605_0000100 | 3300046474 | Bacteria | 109002 |
| 417 | Ga0495605_0000122 | 3300046474 | Bacteria | 101994 |
| 418 | Ga0495605_0000720 | 3300046474 | Bacteria | 24370 |
| 419 | Ga0495605_0008842 | 3300046474 | Bacteria | 5679 |
| 420 | Ga0495605_0009980 | 3300046474 | Bacteria | 5321 |
| 421 | Ga0495585_0011234 | 3300046492 | Bacteria | 5304 |
| 422 | Ga0495594_0024774 | 3300046499 | Bacteria | 3224 |
| 423 | Ga0495607_0000478 | 3300046501 | Bacteria | 40040 |
| 424 | Ga0495607_0000778 | 3300046501 | Bacteria | 30559 |
| 425 | Ga0495607_0001277 | 3300046501 | Bacteria | 22527 |
| 426 | Ga0495607_0002257 | 3300046501 | Bacteria | 15915 |
| 427 | Ga0495607_0002708 | 3300046501 | Bacteria | 14140 |
| 428 | Ga0495607_0008693 | 3300046501 | Bacteria | 6923 |
| 429 | Ga0495607_0010888 | 3300046501 | Bacteria | 6086 |
| 430 | Ga0495607_0038030 | 3300046501 | Bacteria | 2885 |
| 431 | Ga0495607_0044473 | 3300046501 | Bacteria | 2618 |
| 432 | Ga0495583_0000174 | 3300046506 | Bacteria | 109079 |
| 433 | Ga0495583_0001423 | 3300046506 | Bacteria | 24377 |
| 434 | Ga0495583_0003451 | 3300046506 | Bacteria | 12018 |
| 435 | Ga0495583_0006082 | 3300046506 | Bacteria | 7977 |
| 436 | Ga0495583_0006222 | 3300046506 | Bacteria | 7858 |
| 437 | Ga0495583_0007528 | 3300046506 | Bacteria | 6815 |
| 438 | Ga0495583_0010507 | 3300046506 | Bacteria | 5394 |
| 439 | Ga0495606_0002133 | 3300046507 | Bacteria | 23878 |
| 440 | Ga0495606_0007809 | 3300046507 | Bacteria | 9459 |
| 441 | Ga0495606_0016882 | 3300046507 | Bacteria | 5543 |
| 442 | Ga0495606_0052618 | 3300046507 | Bacteria | 2646 |
| 443 | Ga0495610_0005204 | 3300046512 | Bacteria | 9316 |
| 444 | Ga0495610_0005689 | 3300046512 | Bacteria | 8789 |
| 445 | Ga0495610_0019337 | 3300046512 | Bacteria | 3816 |
| 446 | Ga0495616_0057426 | 3300046513 | Bacteria | 1918 |
| 447 | Ga0495620_0000229 | 3300046515 | Bacteria | 41859 |
| 448 | Ga0495620_0000416 | 3300046515 | Bacteria | 28487 |
| 449 | Ga0495620_0003579 | 3300046515 | Bacteria | 8876 |
| 450 | Ga0495620_0009573 | 3300046515 | Bacteria | 5144 |
| 451 | Ga0495620_0013003 | 3300046515 | Bacteria | 4273 |
| 452 | Ga0495620_0031796 | 3300046515 | Bacteria | 2412 |
| 453 | Ga0495631_0017707 | 3300046518 | Bacteria | 3364 |
| 454 | Ga0495632_0000593 | 3300046519 | Bacteria | 33650 |
| 455 | Ga0495632_0000855 | 3300046519 | Bacteria | 26752 |
| 456 | Ga0495632_0020643 | 3300046519 | Bacteria | 3562 |
| 457 | Ga0495632_0085917 | 3300046519 | Bacteria | 1496 |
| 458 | Ga0495637_0000045 | 3300046520 | Bacteria | 108215 |
| 459 | Ga0495637_0003284 | 3300046520 | Bacteria | 8603 |
| 460 | Ga0495637_0010872 | 3300046520 | Bacteria | 4385 |
| 461 | Ga0495643_0000811 | 3300046522 | Bacteria | 34205 |
| 462 | Ga0495643_0007601 | 3300046522 | Bacteria | 6966 |
| 463 | Ga0495648_0004597 | 3300046524 | Bacteria | 11754 |
| 464 | Ga0495648_0010440 | 3300046524 | Bacteria | 7074 |
| 465 | Ga0495654_0002898 | 3300046530 | Bacteria | 10753 |
| 466 | Ga0495654_0005992 | 3300046530 | Bacteria | 6983 |
| 467 | Ga0495654_0013219 | 3300046530 | Bacteria | 4420 |
| 468 | Ga0495654_0020328 | 3300046530 | Bacteria | 3460 |
| 469 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 470 | Ga0495609_0000088 | 3300046538 | Bacteria | 109269 |
| 471 | Ga0495597_0000240 | 3300046542 | Bacteria | 49641 |
| 472 | Ga0495633_0000777 | 3300046558 | Bacteria | 28543 |
| 473 | Ga0495633_0018993 | 3300046558 | Bacteria | 3480 |
| 474 | Ga0495633_0124537 | 3300046558 | Bacteria | 1193 |
| 475 | Ga0495668_0015169 | 3300046616 | Bacteria | 4504 |
| 476 | Ga0495668_0031787 | 3300046616 | Bacteria | 2973 |
| 477 | Ga0495668_0062748 | 3300046616 | Bacteria | 2047 |
| 478 | Ga0495611_0055613 | 3300046648 | Bacteria | 1790 |
| 479 | Ga0495625_0000061 | 3300046660 | Bacteria | 179140 |
| 480 | Ga0495625_0060668 | 3300046660 | Bacteria | 2679 |
| 481 | Ga0495625_0278636 | 3300046660 | Bacteria | 1076 |
| 482 | Ga0495659_0002272 | 3300046664 | Bacteria | 6233 |
| 483 | Ga0495661_0000072 | 3300046665 | Bacteria | 120743 |
| 484 | Ga0495661_0000841 | 3300046665 | Bacteria | 28595 |
| 485 | Ga0495661_0004540 | 3300046665 | Bacteria | 9999 |
| 486 | Ga0495661_0019472 | 3300046665 | Bacteria | 4447 |
| 487 | Ga0495661_0036893 | 3300046665 | Bacteria | 3055 |
| 488 | Ga0495657_0102393 | 3300046675 | Bacteria | 1823 |
| 489 | Ga0495599_0047983 | 3300046678 | Bacteria | 2677 |
| 490 | Ga0495658_0209403 | 3300046683 | Bacteria | 1218 |
| 491 | Ga0495670_0105866 | 3300046691 | Bacteria | 1452 |
| 492 | Ga0495671_0004440 | 3300046692 | Bacteria | 8390 |
| 493 | Ga0495671_0013286 | 3300046692 | Bacteria | 4466 |
| 494 | Ga0495671_0034409 | 3300046692 | Bacteria | 2576 |
| 495 | Ga0495671_0047935 | 3300046692 | Bacteria | 2132 |
| 496 | Ga0495589_0058198 | 3300046794 | Bacteria | 1900 |
| 497 | Ga0495660_0004806 | 3300046810 | Bacteria | 8152 |
| 498 | Ga0495660_0020931 | 3300046810 | Bacteria | 3748 |
| 499 | Ga0495660_0065991 | 3300046810 | Bacteria | 1930 |
| 500 | Ga0495660_0094192 | 3300046810 | Bacteria | 1551 |
| 501 | Ga0495672_0004169 | 3300047320 | Bacteria | 11998 |
| 502 | Ga0495672_0014093 | 3300047320 | Bacteria | 5487 |
| 503 | Ga0495672_0021543 | 3300047320 | Bacteria | 4202 |
| 504 | Ga0495672_0033583 | 3300047320 | Bacteria | 3177 |
| 505 | Ga0495672_0135331 | 3300047320 | Bacteria | 1292 |
| 506 | Ga0495680_0004392 | 3300047322 | Bacteria | 13496 |
| 507 | Ga0495683_0000070 | 3300047323 | Bacteria | 108186 |
| 508 | Ga0495679_000814 | 3300047446 | Bacteria | 19816 |
| 509 | Ga0495679_005870 | 3300047446 | Bacteria | 5385 |
| 510 | Ga0495673_0002493 | 3300047469 | Bacteria | 12887 |
| 511 | Ga0495673_0002965 | 3300047469 | Bacteria | 11438 |
| 512 | Ga0495673_0011343 | 3300047469 | Bacteria | 4798 |
| 513 | Ga0495673_0037789 | 3300047469 | Bacteria | 2202 |
| 514 | Ga0495681_0009957 | 3300047470 | Bacteria | 5798 |
| 515 | Ga0495681_0041937 | 3300047470 | Bacteria | 2218 |
| 516 | Ga0495681_0066142 | 3300047470 | Bacteria | 1650 |
| 517 | Ga0495686_0028959 | 3300047472 | Bacteria | 3604 |
| 518 | Ga0496100_0336875 | 3300048903 | Unclassified | 1137 |
| 519 | Ga0496102_0133813 | 3300048905 | Bacteria | 2322 |
| 520 | Ga0496102_0379705 | 3300048905 | Bacteria | 1330 |
| 521 | Ga0496112_0074343 | 3300048915 | Bacteria | 3360 |
| 522 | Ga0496114_0021519 | 3300048917 | Bacteria | 5247 |
| 523 | Ga0496116_0004519 | 3300048919 | Bacteria | 13237 |
| 524 | Ga0496117_0001364 | 3300048920 | Bacteria | 35606 |
| 525 | Ga0496117_0002208 | 3300048920 | Bacteria | 25268 |
| 526 | Ga0496117_0005978 | 3300048920 | Bacteria | 12544 |
| 527 | Ga0496117_0008162 | 3300048920 | Bacteria | 9999 |
| 528 | Ga0496118_0001739 | 3300048921 | Bacteria | 31629 |
| 529 | Ga0496118_0005323 | 3300048921 | Bacteria | 14664 |
| 530 | Ga0496118_0016641 | 3300048921 | Bacteria | 6738 |
| 531 | Ga0496118_0066284 | 3300048921 | Bacteria | 2636 |
| 532 | Ga0496118_0158082 | 3300048921 | Bacteria | 1406 |
| 533 | Ga0496119_0001575 | 3300048922 | Bacteria | 27130 |
| 534 | Ga0496119_0044221 | 3300048922 | Bacteria | 2806 |
| 535 | Ga0496120_0002964 | 3300048923 | Bacteria | 16148 |
| 536 | Ga0496120_0035323 | 3300048923 | Bacteria | 2986 |
| 537 | Ga0496121_0000272 | 3300048924 | Bacteria | 108051 |
| 538 | Ga0496121_0002538 | 3300048924 | Bacteria | 27667 |
| 539 | Ga0496121_0006595 | 3300048924 | Bacteria | 14318 |
| 540 | Ga0496121_0007491 | 3300048924 | Bacteria | 13180 |
| 541 | Ga0496121_0155520 | 3300048924 | Bacteria | 1678 |
| 542 | Ga0496122_0000398 | 3300048925 | Bacteria | 92491 |
| 543 | Ga0496122_0052728 | 3300048925 | Bacteria | 3075 |
| 544 | Ga0496122_0080144 | 3300048925 | Bacteria | 2278 |
| 545 | Ga0496122_0173015 | 3300048925 | Bacteria | 1298 |
| 546 | Ga0496123_0000302 | 3300048926 | Bacteria | 95750 |
| 547 | Ga0496123_0071453 | 3300048926 | Bacteria | 2164 |
| 548 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 549 | Ga0496124_0006941 | 3300048927 | Bacteria | 12169 |
| 550 | Ga0496124_0009601 | 3300048927 | Bacteria | 9919 |
| 551 | Ga0496124_0022223 | 3300048927 | Bacteria | 5821 |
| 552 | Ga0496124_0030005 | 3300048927 | Bacteria | 4835 |
| 553 | Ga0496124_0043665 | 3300048927 | Bacteria | 3852 |
| 554 | Ga0496124_0050920 | 3300048927 | Bacteria | 3526 |
| 555 | Ga0496124_0058758 | 3300048927 | Bacteria | 3233 |
| 556 | Ga0496124_0115208 | 3300048927 | Bacteria | 2157 |
| 557 | Ga0496125_0001425 | 3300048928 | Bacteria | 34838 |
| 558 | Ga0496125_0009053 | 3300048928 | Bacteria | 10308 |
| 559 | Ga0496125_0011937 | 3300048928 | Bacteria | 8655 |
| 560 | Ga0496125_0251532 | 3300048928 | Bacteria | 1114 |
| 561 | Ga0496126_0209387 | 3300048929 | Bacteria | 1642 |
| 562 | Ga0495678_000325 | 3300049459 | Bacteria | 50656 |
| 563 | Ga0495678_000692 | 3300049459 | Bacteria | 30773 |
| 564 | Ga0495678_011303 | 3300049459 | Bacteria | 4280 |
| 565 | Ga0495678_030399 | 3300049459 | Bacteria | 2260 |
| 566 | Ga0495682_0000090 | 3300049460 | Bacteria | 79463 |
| 567 | Ga0495682_0000607 | 3300049460 | Bacteria | 24172 |
| 568 | Ga0495682_0079633 | 3300049460 | Bacteria | 1178 |
| 569 | Ga0501031_0050673 | 3300049568 | Bacteria | 2704 |
| 570 | Ga0501034_0050549 | 3300049571 | Bacteria | 4192 |
| 571 | Ga0501034_0204659 | 3300049571 | Bacteria | 1930 |
| 572 | Ga0501036_0062080 | 3300049572 | Bacteria | 3165 |
| 573 | Ga0501037_0250570 | 3300049573 | Bacteria | 1239 |
| 574 | Ga0501038_0072695 | 3300049574 | Bacteria | 2914 |
| 575 | Ga0501040_0005851 | 3300049576 | Bacteria | 7959 |
| 576 | Ga0501041_0001880 | 3300049577 | Bacteria | 11769 |
| 577 | Ga0501043_0050587 | 3300049579 | Bacteria | 3266 |
| 578 | Ga0501046_0223131 | 3300049580 | Bacteria | 1394 |
| 579 | Ga0501047_0245212 | 3300049581 | Bacteria | 1641 |
| 580 | Ga0501048_0077292 | 3300049582 | Bacteria | 2349 |
| 581 | Ga0501069_0025984 | 3300049585 | Bacteria | 3205 |
| 582 | Ga0501073_0060700 | 3300049589 | Bacteria | 2639 |
| 583 | Ga0501074_0113396 | 3300049590 | Bacteria | 1939 |
| 584 | Ga0501075_0012099 | 3300049591 | Bacteria | 6125 |
| 585 | Ga0501076_0035194 | 3300049592 | Bacteria | 3918 |
| 586 | Ga0501081_0090278 | 3300049743 | Bacteria | 2153 |
| 587 | Ga0501035_0015708 | 3300049822 | Bacteria | 6988 |
| 588 | Ga0501226_000001 | 3300049853 | Bacteria | 432595 |
| 589 | nmdc:mga08y16_84946_c1 | 3300050511 | Unclassified | 3299 |
| 590 | nmdc:mga0n895_6835_c1 | 3300050512 | Bacteria | 9742 |
| 591 | nmdc:mga0a205_110_c1 | 3300050515 | Bacteria | 47857 |
| 592 | Ga0495619_0224293 | 3300053085 | Bacteria | 1302 |
| 593 | Ga0500643_008570 | 3300053087 | Bacteria | 4008 |
| 594 | Ga0500645_007042 | 3300053730 | Bacteria | 3950 |
| 595 | Ga0501084_0074010 | 3300054114 | Bacteria | 2852 |
| 596 | Ga0530510_0001837 | 3300061734 | Bacteria | 14507 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0250570 | Ga0501037_0250570_407_1222 | 271 |
| 2 | 3300009092 | Ga0105250_10016106 | Ga0105250_100161062 | 273 |
| 3 | 3300048905 | Ga0496102_0379705 | Ga0496102_0379705_437_1312 | 275 |
| 4 | 3300009177 | Ga0105248_10088718 | Ga0105248_100887183 | 281 |
| 5 | 3300042137 | Ga0450902_000025 | Ga0450902_000025_8527_9504 | 284 |
| 6 | 3300042142 | Ga0450905_000013 | Ga0450905_000013_2460_3437 | 284 |
| 7 | 3300042533 | Ga0450901_000048 | Ga0450901_000048_10650_11627 | 284 |
| 8 | 3300014326 | Ga0157380_10419432 | Ga0157380_104194322 | 285 |
| 9 | 3300041405 | Ga0439438_055098 | Ga0439438_055098_11_874 | 287 |
| 10 | 3300042013 | Ga0439456_015014 | Ga0439456_015014_742_1605 | 287 |
| 11 | 3300014325 | Ga0163163_10044116 | Ga0163163_100441162 | 291 |
| 12 | 3300048903 | Ga0496100_0336875 | Ga0496100_0336875_133_1008 | 291 |
| 13 | 3300048921 | Ga0496118_0005323 | Ga0496118_0005323_4052_4987 | 293 |
| 14 | 3300048924 | Ga0496121_0000272 | Ga0496121_0000272_97452_98387 | 293 |
| 15 | 3300005841 | Ga0068863_100004494 | Ga0068863_1000044946 | 296 |
| 16 | 3300026088 | Ga0207641_10022840 | Ga0207641_100228403 | 296 |
| 17 | 3300048927 | Ga0496124_0030005 | Ga0496124_0030005_2102_3079 | 299 |
| 18 | 3300009101 | Ga0105247_10005269 | Ga0105247_100052694 | 301 |
| 19 | 3300009553 | Ga0105249_10001100 | Ga0105249_1000110013 | 301 |
| 20 | 3300025900 | Ga0207710_10002771 | Ga0207710_100027714 | 301 |
| 21 | 3300025961 | Ga0207712_10000494 | Ga0207712_1000049413 | 301 |
| 22 | 3300005843 | Ga0068860_100006006 | Ga0068860_1000060063 | 302 |
| 23 | 3300005844 | Ga0068862_100001390 | Ga0068862_10000139013 | 302 |
| 24 | 3300028380 | Ga0268265_10001778 | Ga0268265_100017783 | 302 |
| 25 | 3300028381 | Ga0268264_10001534 | Ga0268264_100015346 | 302 |
| 26 | 3300005618 | Ga0068864_100000139 | Ga0068864_10000013930 | 304 |
| 27 | 3300005841 | Ga0068863_100000218 | Ga0068863_1000002185 | 304 |
| 28 | 3300026088 | Ga0207641_10000019 | Ga0207641_10000019157 | 304 |
| 29 | 3300026095 | Ga0207676_10000924 | Ga0207676_100009246 | 304 |
| 30 | 3300049571 | Ga0501034_0050549 | Ga0501034_0050549_1372_2340 | 305 |
| 31 | 3300049581 | Ga0501047_0245212 | Ga0501047_0245212_254_1222 | 305 |
| 32 | 3300013307 | Ga0157372_10003012 | Ga0157372_100030125 | 306 |
| 33 | 3300031730 | Ga0307516_10000019 | Ga0307516_100000197 | 306 |
| 34 | 3300039437 | Ga0436365_0703236 | Ga0436365_0703236_30_965 | 311 |
| 35 | 3300039437 | Ga0436365_1488395 | Ga0436365_1488395_1039_1974 | 311 |
| 36 | 3300005288 | Ga0065714_10081276 | Ga0065714_100812762 | 312 |
| 37 | 3300005353 | Ga0070669_100001006 | Ga0070669_10000100610 | 312 |
| 38 | 3300005539 | Ga0068853_100000372 | Ga0068853_1000003728 | 312 |
| 39 | 3300005564 | Ga0070664_100064535 | Ga0070664_1000645351 | 312 |
| 40 | 3300005578 | Ga0068854_100021339 | Ga0068854_1000213393 | 312 |
| 41 | 3300005834 | Ga0068851_10000007 | Ga0068851_1000000770 | 312 |
| 42 | 3300009011 | Ga0105251_10004239 | Ga0105251_1000423910 | 312 |
| 43 | 3300009011 | Ga0105251_10004948 | Ga0105251_100049488 | 312 |
| 44 | 3300009177 | Ga0105248_10075012 | Ga0105248_100750123 | 312 |
| 45 | 3300013100 | Ga0157373_10260663 | Ga0157373_102606631 | 312 |
| 46 | 3300013105 | Ga0157369_10456556 | Ga0157369_104565562 | 312 |
| 47 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000632 | 312 |
| 48 | 3300025735 | Ga0207713_1001441 | Ga0207713_10014419 | 312 |
| 49 | 3300025735 | Ga0207713_1002171 | Ga0207713_10021713 | 312 |
| 50 | 3300025914 | Ga0207671_10284499 | Ga0207671_102844992 | 312 |
| 51 | 3300025923 | Ga0207681_10000099 | Ga0207681_100000994 | 312 |
| 52 | 3300025941 | Ga0207711_10046333 | Ga0207711_100463334 | 312 |
| 53 | 3300025941 | Ga0207711_10068725 | Ga0207711_100687252 | 312 |
| 54 | 3300025981 | Ga0207640_10026125 | Ga0207640_100261253 | 312 |
| 55 | 3300026041 | Ga0207639_10000286 | Ga0207639_1000028621 | 312 |
| 56 | 3300042006 | Ga0439432_000624 | Ga0439432_000624_5330_6307 | 312 |
| 57 | 3300046460 | Ga0495638_0000415 | Ga0495638_0000415_39808_40797 | 312 |
| 58 | 3300048927 | Ga0496124_0043665 | Ga0496124_0043665_2876_3829 | 312 |
| 59 | 3300048927 | Ga0496124_0058758 | Ga0496124_0058758_210_1187 | 312 |
| 60 | 3300002738 | JGI25154J39366_1009458 | JGI25154J39366_10094581 | 313 |
| 61 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032164 | 313 |
| 62 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043164 | 313 |
| 63 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052164 | 313 |
| 64 | 3300003758 | Ga0055532_1000047 | Ga0055532_1000047144 | 313 |
| 65 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062164 | 313 |
| 66 | 3300003761 | Ga0055535_1004747 | Ga0055535_10047473 | 313 |
| 67 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030164 | 313 |
| 68 | 3300005289 | Ga0065704_10004501 | Ga0065704_100045012 | 313 |
| 69 | 3300005344 | Ga0070661_100000126 | Ga0070661_10000012640 | 313 |
| 70 | 3300005564 | Ga0070664_100001357 | Ga0070664_1000013579 | 313 |
| 71 | 3300009092 | Ga0105250_10000981 | Ga0105250_1000098110 | 313 |
| 72 | 3300009092 | Ga0105250_10012322 | Ga0105250_100123224 | 313 |
| 73 | 3300009148 | Ga0105243_10029744 | Ga0105243_100297444 | 313 |
| 74 | 3300009176 | Ga0105242_10003232 | Ga0105242_100032323 | 313 |
| 75 | 3300009545 | Ga0105237_10003007 | Ga0105237_1000300710 | 313 |
| 76 | 3300011119 | Ga0105246_10021361 | Ga0105246_100213615 | 313 |
| 77 | 3300013306 | Ga0163162_10138981 | Ga0163162_101389813 | 313 |
| 78 | 3300017792 | Ga0163161_10132377 | Ga0163161_101323772 | 313 |
| 79 | 3300025224 | Ga0209784_100007 | Ga0209784_100007352 | 313 |
| 80 | 3300025225 | Ga0209566_100009 | Ga0209566_100009352 | 313 |
| 81 | 3300025226 | Ga0209674_100021 | Ga0209674_100021352 | 313 |
| 82 | 3300025229 | Ga0209147_100009 | Ga0209147_100009352 | 313 |
| 83 | 3300025230 | Ga0209563_100018 | Ga0209563_100018352 | 313 |
| 84 | 3300025233 | Ga0209437_104938 | Ga0209437_1049383 | 313 |
| 85 | 3300025242 | Ga0209258_100169 | Ga0209258_100169131 | 313 |
| 86 | 3300025246 | Ga0209646_1000184 | Ga0209646_100018447 | 313 |
| 87 | 3300025253 | Ga0209677_100012 | Ga0209677_100012352 | 313 |
| 88 | 3300025256 | Ga0209759_1006804 | Ga0209759_10068041 | 313 |
| 89 | 3300025711 | Ga0207696_1000357 | Ga0207696_10003578 | 313 |
| 90 | 3300025728 | Ga0207655_1000388 | Ga0207655_10003889 | 313 |
| 91 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013172 | 313 |
| 92 | 3300025920 | Ga0207649_10000012 | Ga0207649_10000012137 | 313 |
| 93 | 3300025934 | Ga0207686_10001491 | Ga0207686_1000149113 | 313 |
| 94 | 3300025945 | Ga0207679_10000015 | Ga0207679_10000015137 | 313 |
| 95 | 3300036401 | Ga0373937_0000755 | Ga0373937_0000755_22744_23718 | 313 |
| 96 | 3300046453 | Ga0495627_002764 | Ga0495627_002764_1311_2288 | 313 |
| 97 | 3300046458 | Ga0495591_004920 | Ga0495591_004920_4287_5264 | 313 |
| 98 | 3300046501 | Ga0495607_0038030 | Ga0495607_0038030_1397_2374 | 313 |
| 99 | 3300046506 | Ga0495583_0007528 | Ga0495583_0007528_33_1010 | 313 |
| 100 | 3300046507 | Ga0495606_0007809 | Ga0495606_0007809_929_1906 | 313 |
| 101 | 3300046515 | Ga0495620_0013003 | Ga0495620_0013003_946_1923 | 313 |
| 102 | 3300046519 | Ga0495632_0020643 | Ga0495632_0020643_1762_2739 | 313 |
| 103 | 3300046530 | Ga0495654_0002898 | Ga0495654_0002898_631_1608 | 313 |
| 104 | 3300046665 | Ga0495661_0004540 | Ga0495661_0004540_7620_8597 | 313 |
| 105 | 3300047470 | Ga0495681_0041937 | Ga0495681_0041937_469_1446 | 313 |
| 106 | 3300048920 | Ga0496117_0008162 | Ga0496117_0008162_7644_8621 | 313 |
| 107 | 3300048921 | Ga0496118_0066284 | Ga0496118_0066284_1596_2573 | 313 |
| 108 | 3300048921 | Ga0496118_0158082 | Ga0496118_0158082_142_1119 | 313 |
| 109 | 3300048922 | Ga0496119_0044221 | Ga0496119_0044221_636_1613 | 313 |
| 110 | 3300048923 | Ga0496120_0035323 | Ga0496120_0035323_874_1851 | 313 |
| 111 | 3300048925 | Ga0496122_0173015 | Ga0496122_0173015_70_1047 | 313 |
| 112 | 3300048927 | Ga0496124_0009601 | Ga0496124_0009601_1324_2301 | 313 |
| 113 | 3300048928 | Ga0496125_0009053 | Ga0496125_0009053_1706_2683 | 313 |
| 114 | 3300048928 | Ga0496125_0251532 | Ga0496125_0251532_115_1092 | 313 |
| 115 | 3300005290 | Ga0065712_10001367 | Ga0065712_100013672 | 314 |
| 116 | 3300005548 | Ga0070665_100396744 | Ga0070665_1003967441 | 314 |
| 117 | 3300009011 | Ga0105251_10011207 | Ga0105251_100112072 | 314 |
| 118 | 3300015262 | Ga0182007_10047307 | Ga0182007_100473071 | 314 |
| 119 | 3300025735 | Ga0207713_1008846 | Ga0207713_10088462 | 314 |
| 120 | 3300027111 | Ga0209281_1017333 | Ga0209281_10173331 | 314 |
| 121 | 3300031731 | Ga0307405_10215665 | Ga0307405_102156651 | 314 |
| 122 | 3300002737 | JGI25162J39368_1001123 | JGI25162J39368_10011239 | 315 |
| 123 | 3300002771 | JGI25163J39215_1001049 | JGI25163J39215_10010497 | 315 |
| 124 | 3300002772 | JGI25164J39214_1000593 | JGI25164J39214_10005938 | 315 |
| 125 | 3300003214 | JGI25165J46597_1001173 | JGI25165J46597_10011738 | 315 |
| 126 | 3300025207 | Ga0209760_100027 | Ga0209760_10002780 | 315 |
| 127 | 3300025231 | Ga0207427_100006 | Ga0207427_100006412 | 315 |
| 128 | 3300025233 | Ga0209437_100013 | Ga0209437_100013412 | 315 |
| 129 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022412 | 315 |
| 130 | 3300025292 | Ga0209676_1019306 | Ga0209676_10193062 | 316 |
| 131 | 3300026067 | Ga0207678_10269316 | Ga0207678_102693162 | 316 |
| 132 | 3300034816 | Ga0373930_0011861 | Ga0373930_0011861_60_1055 | 316 |
| 133 | 3300035084 | Ga0373928_0035363 | Ga0373928_0035363_72_1067 | 316 |
| 134 | 3300035242 | Ga0373962_0002569 | Ga0373962_0002569_987_1982 | 316 |
| 135 | 3300035691 | Ga0373931_0000910 | Ga0373931_0000910_1402_2397 | 316 |
| 136 | 3300047446 | Ga0495679_005870 | Ga0495679_005870_318_1295 | 316 |
| 137 | 3300005288 | Ga0065714_10073013 | Ga0065714_100730131 | 317 |
| 138 | 3300005331 | Ga0070670_100003472 | Ga0070670_1000034727 | 317 |
| 139 | 3300005331 | Ga0070670_100011975 | Ga0070670_1000119756 | 317 |
| 140 | 3300005457 | Ga0070662_100000101 | Ga0070662_1000001018 | 317 |
| 141 | 3300009011 | Ga0105251_10000009 | Ga0105251_10000009121 | 317 |
| 142 | 3300009092 | Ga0105250_10001636 | Ga0105250_100016368 | 317 |
| 143 | 3300009092 | Ga0105250_10014586 | Ga0105250_100145863 | 317 |
| 144 | 3300009148 | Ga0105243_10010014 | Ga0105243_100100143 | 317 |
| 145 | 3300013100 | Ga0157373_10036164 | Ga0157373_100361641 | 317 |
| 146 | 3300025711 | Ga0207696_1000020 | Ga0207696_1000020236 | 317 |
| 147 | 3300025711 | Ga0207696_1003002 | Ga0207696_10030025 | 317 |
| 148 | 3300025711 | Ga0207696_1019230 | Ga0207696_10192302 | 317 |
| 149 | 3300025728 | Ga0207655_1008819 | Ga0207655_10088194 | 317 |
| 150 | 3300025735 | Ga0207713_1000032 | Ga0207713_1000032140 | 317 |
| 151 | 3300025925 | Ga0207650_10000338 | Ga0207650_100003386 | 317 |
| 152 | 3300025925 | Ga0207650_10000564 | Ga0207650_1000056419 | 317 |
| 153 | 3300025933 | Ga0207706_10000580 | Ga0207706_100005801 | 317 |
| 154 | 3300025935 | Ga0207709_10005277 | Ga0207709_100052774 | 317 |
| 155 | 3300028786 | Ga0307517_10144273 | Ga0307517_101442732 | 317 |
| 156 | 3300031507 | Ga0307509_10209874 | Ga0307509_102098742 | 317 |
| 157 | 3300046512 | Ga0495610_0005204 | Ga0495610_0005204_269_1246 | 317 |
| 158 | 3300048928 | Ga0496125_0011937 | Ga0496125_0011937_492_1469 | 317 |
| 159 | iso_pu_bacteria | 2643221541 | 2643728712 | 317 |
| 160 | iso_pu_bacteria | 2643221606 | 2644044727 | 317 |
| 161 | iso_pu_bacteria | 2643221671 | 2644390900 | 317 |
| 162 | 3300013104 | Ga0157370_10000698 | Ga0157370_1000069835 | 318 |
| 163 | 3300042013 | Ga0439456_000058 | Ga0439456_000058_37022_37999 | 318 |
| 164 | 3300046507 | Ga0495606_0016882 | Ga0495606_0016882_2148_3104 | 318 |
| 165 | 3300046522 | Ga0495643_0007601 | Ga0495643_0007601_4211_5188 | 318 |
| 166 | 3300046810 | Ga0495660_0094192 | Ga0495660_0094192_50_1027 | 318 |
| 167 | 3300048917 | Ga0496114_0021519 | Ga0496114_0021519_2016_2993 | 318 |
| 168 | 3300006946 | Ga0079104_1001947 | Ga0079104_10019477 | 319 |
| 169 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019195 | 319 |
| 170 | 3300027111 | Ga0209281_1008353 | Ga0209281_10083531 | 319 |
| 171 | 3300030734 | Ga0316179_1074380 | Ga0316179_10743802 | 319 |
| 172 | 3300042006 | Ga0439432_035327 | Ga0439432_035327_68_1045 | 319 |
| 173 | 3300042010 | Ga0439452_015680 | Ga0439452_015680_1001_1978 | 319 |
| 174 | 3300042115 | Ga0450911_006235 | Ga0450911_006235_755_1732 | 319 |
| 175 | 3300046507 | Ga0495606_0052618 | Ga0495606_0052618_1610_2587 | 319 |
| 176 | 3300046515 | Ga0495620_0031796 | Ga0495620_0031796_564_1541 | 319 |
| 177 | 3300046794 | Ga0495589_0058198 | Ga0495589_0058198_47_1024 | 319 |
| 178 | 3300048927 | Ga0496124_0006941 | Ga0496124_0006941_2954_3934 | 319 |
| 179 | 2162886007 | SwRhRL2b_contig_2761050 | SwRhRL2b_0606.00003170 | 320 |
| 180 | 3300005289 | Ga0065704_10075640 | Ga0065704_100756403 | 320 |
| 181 | 3300005289 | Ga0065704_10078835 | Ga0065704_100788351 | 320 |
| 182 | 3300005347 | Ga0070668_100056706 | Ga0070668_1000567061 | 320 |
| 183 | 3300005548 | Ga0070665_100308603 | Ga0070665_1003086032 | 320 |
| 184 | 3300009036 | Ga0105244_10012421 | Ga0105244_100124214 | 320 |
| 185 | 3300009036 | Ga0105244_10034075 | Ga0105244_100340752 | 320 |
| 186 | 3300009148 | Ga0105243_10015686 | Ga0105243_100156867 | 320 |
| 187 | 3300025292 | Ga0209676_1001397 | Ga0209676_10013974 | 320 |
| 188 | 3300025711 | Ga0207696_1000050 | Ga0207696_100005069 | 320 |
| 189 | 3300025728 | Ga0207655_1009052 | Ga0207655_10090523 | 320 |
| 190 | 3300025728 | Ga0207655_1024965 | Ga0207655_10249651 | 320 |
| 191 | 3300025728 | Ga0207655_1038895 | Ga0207655_10388952 | 320 |
| 192 | 3300025735 | Ga0207713_1045592 | Ga0207713_10455921 | 320 |
| 193 | 3300025935 | Ga0207709_10002031 | Ga0207709_100020317 | 320 |
| 194 | 3300025935 | Ga0207709_10010766 | Ga0207709_100107664 | 320 |
| 195 | 3300027296 | Ga0209389_1039397 | Ga0209389_10393973 | 320 |
| 196 | 3300042129 | Ga0450891_006657 | Ga0450891_006657_17_982 | 320 |
| 197 | 3300046515 | Ga0495620_0000229 | Ga0495620_0000229_4146_5123 | 320 |
| 198 | 3300046519 | Ga0495632_0000593 | Ga0495632_0000593_28794_29771 | 320 |
| 199 | 3300046522 | Ga0495643_0000811 | Ga0495643_0000811_29025_30002 | 320 |
| 200 | 3300046524 | Ga0495648_0004597 | Ga0495648_0004597_2026_3003 | 320 |
| 201 | 3300048920 | Ga0496117_0001364 | Ga0496117_0001364_8447_9424 | 320 |
| 202 | 3300048920 | Ga0496117_0002208 | Ga0496117_0002208_3630_4607 | 320 |
| 203 | 3300048921 | Ga0496118_0001739 | Ga0496118_0001739_28377_29354 | 320 |
| 204 | 3300048924 | Ga0496121_0155520 | Ga0496121_0155520_627_1604 | 320 |
| 205 | 3300048925 | Ga0496122_0080144 | Ga0496122_0080144_1081_2058 | 320 |
| 206 | 3300048928 | Ga0496125_0001425 | Ga0496125_0001425_4760_5737 | 320 |
| 207 | 3300048929 | Ga0496126_0209387 | Ga0496126_0209387_41_1018 | 320 |
| 208 | iso_pu_bacteria | 2511231004 | 2511254823 | 321 |
| 209 | iso_pu_bacteria | 2511231006 | 2511266037 | 321 |
| 210 | iso_pu_bacteria | 2511231007 | 2511273350 | 321 |
| 211 | iso_pu_bacteria | 2511231008 | 2511275062 | 321 |
| 212 | iso_pu_bacteria | 2511231010 | 2511288490 | 321 |
| 213 | iso_pu_bacteria | 2511231011 | 2511297985 | 321 |
| 214 | iso_pu_bacteria | 2511231012 | 2511304002 | 321 |
| 215 | iso_pu_bacteria | 2511231014 | 2511311972 | 321 |
| 216 | iso_pu_bacteria | 2511231015 | 2511323417 | 321 |
| 217 | iso_pu_bacteria | 2511231016 | 2511327979 | 321 |
| 218 | iso_pu_bacteria | 2511231017 | 2511329702 | 321 |
| 219 | iso_pu_bacteria | 2511231018 | 2511335872 | 321 |
| 220 | iso_pu_bacteria | 2511231019 | 2511344764 | 321 |
| 221 | iso_pu_bacteria | 2511231020 | 2511349527 | 321 |
| 222 | iso_pu_bacteria | 2511231021 | 2511354102 | 321 |
| 223 | iso_pu_bacteria | 2511231022 | 2511365973 | 321 |
| 224 | iso_pu_bacteria | 2511231023 | 2511369007 | 321 |
| 225 | iso_pu_bacteria | 2511231024 | 2511376419 | 321 |
| 226 | iso_pu_bacteria | 2511231031 | 2511412145 | 321 |
| 227 | iso_pu_bacteria | 2511231156 | 2511827672 | 321 |
| 228 | iso_pu_bacteria | 2512047018 | 2512326640 | 321 |
| 229 | iso_pu_bacteria | 2554235341 | 2555672878 | 321 |
| 230 | iso_pu_bacteria | 2582580891 | 2583795691 | 321 |
| 231 | iso_pu_bacteria | 2597489887 | 2597860915 | 321 |
| 232 | iso_pu_bacteria | 2597489888 | 2597866659 | 321 |
| 233 | iso_pu_bacteria | 2597489889 | 2597872517 | 321 |
| 234 | iso_pu_bacteria | 2599185155 | 2599327537 | 321 |
| 235 | iso_pu_bacteria | 2599185160 | 2599355916 | 321 |
| 236 | iso_pu_bacteria | 2599185161 | 2599362682 | 321 |
| 237 | iso_pu_bacteria | 2599185162 | 2599369012 | 321 |
| 238 | iso_pu_bacteria | 2599185163 | 2599375791 | 321 |
| 239 | iso_pu_bacteria | 2599185164 | 2599381022 | 321 |
| 240 | iso_pu_bacteria | 2599185165 | 2599387462 | 321 |
| 241 | iso_pu_bacteria | 2599185166 | 2599394649 | 321 |
| 242 | iso_pu_bacteria | 2599185167 | 2599400508 | 321 |
| 243 | iso_pu_bacteria | 2599185168 | 2599406414 | 321 |
| 244 | iso_pu_bacteria | 2599185179 | 2599449832 | 321 |
| 245 | iso_pu_bacteria | 2599185181 | 2599462750 | 321 |
| 246 | iso_pu_bacteria | 2599185182 | 2599467827 | 321 |
| 247 | iso_pu_bacteria | 2599185185 | 2599485850 | 321 |
| 248 | iso_pu_bacteria | 2599185186 | 2599491767 | 321 |
| 249 | iso_pu_bacteria | 2599185188 | 2599500294 | 321 |
| 250 | iso_pu_bacteria | 2599185189 | 2599505779 | 321 |
| 251 | iso_pu_bacteria | 2599185190 | 2599511906 | 321 |
| 252 | iso_pu_bacteria | 2599185191 | 2599516890 | 321 |
| 253 | iso_pu_bacteria | 2599185212 | 2599614462 | 321 |
| 254 | iso_pu_bacteria | 2599185248 | 2599768114 | 321 |
| 255 | iso_pu_bacteria | 2599185257 | 2599804631 | 321 |
| 256 | iso_pu_bacteria | 2599185288 | 2599879068 | 321 |
| 257 | iso_pu_bacteria | 2599185289 | 2599885550 | 321 |
| 258 | iso_pu_bacteria | 2599185290 | 2599892732 | 321 |
| 259 | iso_pu_bacteria | 2599185291 | 2599897264 | 321 |
| 260 | iso_pu_bacteria | 2599185300 | 2599930683 | 321 |
| 261 | iso_pu_bacteria | 2599185302 | 2599942321 | 321 |
| 262 | iso_pu_bacteria | 2599185303 | 2599951482 | 321 |
| 263 | iso_pu_bacteria | 2599185304 | 2599954266 | 321 |
| 264 | iso_pu_bacteria | 2599185305 | 2599961949 | 321 |
| 265 | iso_pu_bacteria | 2599185306 | 2599965972 | 321 |
| 266 | iso_pu_bacteria | 2599185307 | 2599972337 | 321 |
| 267 | iso_pu_bacteria | 2599185308 | 2599977978 | 321 |
| 268 | iso_pu_bacteria | 2599185309 | 2599982891 | 321 |
| 269 | iso_pu_bacteria | 2599185311 | 2599994020 | 321 |
| 270 | iso_pu_bacteria | 2599185312 | 2599999154 | 321 |
| 271 | iso_pu_bacteria | 2599185313 | 2600004277 | 321 |
| 272 | iso_pu_bacteria | 2599185314 | 2600012145 | 321 |
| 273 | iso_pu_bacteria | 2599185315 | 2600020433 | 321 |
| 274 | iso_pu_bacteria | 2599185316 | 2600026312 | 321 |
| 275 | iso_pu_bacteria | 2599185317 | 2600032058 | 321 |
| 276 | iso_pu_bacteria | 2599185318 | 2600036005 | 321 |
| 277 | iso_pu_bacteria | 2599185319 | 2600042370 | 321 |
| 278 | iso_pu_bacteria | 2599185320 | 2600046685 | 321 |
| 279 | iso_pu_bacteria | 2599185321 | 2600054889 | 321 |
| 280 | iso_pu_bacteria | 2599185322 | 2600061080 | 321 |
| 281 | iso_pu_bacteria | 2599185323 | 2600066336 | 321 |
| 282 | iso_pu_bacteria | 2599185324 | 2600071900 | 321 |
| 283 | iso_pu_bacteria | 2599185325 | 2600076510 | 321 |
| 284 | iso_pu_bacteria | 2599185356 | 2600215376 | 321 |
| 285 | iso_pu_bacteria | 2600254930 | 2600358961 | 321 |
| 286 | iso_pu_bacteria | 2600254931 | 2600363516 | 321 |
| 287 | iso_pu_bacteria | 2600254954 | 2600444120 | 321 |
| 288 | iso_pu_bacteria | 2600255283 | 2601627437 | 321 |
| 289 | iso_pu_bacteria | 2600255296 | 2601693416 | 321 |
| 290 | iso_pu_bacteria | 2600255313 | 2601775542 | 321 |
| 291 | iso_pu_bacteria | 2600255318 | 2601798532 | 321 |
| 292 | iso_pu_bacteria | 2600255389 | 2602008395 | 321 |
| 293 | iso_pu_bacteria | 2603880185 | 2606077426 | 321 |
| 294 | iso_pu_bacteria | 2603880199 | 2606129328 | 321 |
| 295 | iso_pu_bacteria | 2619619299 | 2621296815 | 321 |
| 296 | iso_pu_bacteria | 2623620443 | 2624483439 | 321 |
| 297 | iso_pu_bacteria | 2623620446 | 2624494965 | 321 |
| 298 | iso_pu_bacteria | 2643221565 | 2643842992 | 321 |
| 299 | iso_pu_bacteria | 2643221571 | 2643872295 | 321 |
| 300 | iso_pu_bacteria | 2643221589 | 2643955603 | 321 |
| 301 | iso_pu_bacteria | 2643221602 | 2644020397 | 321 |
| 302 | iso_pu_bacteria | 2643221633 | 2644184450 | 321 |
| 303 | iso_pu_bacteria | 2643221650 | 2644283196 | 321 |
| 304 | iso_pu_bacteria | 2643221713 | 2644620196 | 321 |
| 305 | iso_pu_bacteria | 2651869719 | 2652547401 | 321 |
| 306 | iso_pu_bacteria | 2667528170 | 2671089586 | 321 |
| 307 | iso_pu_bacteria | 2667528171 | 2671099322 | 321 |
| 308 | iso_pu_bacteria | 2667528176 | 2671128556 | 321 |
| 309 | iso_pu_bacteria | 2671180172 | 2671771638 | 321 |
| 310 | iso_pu_bacteria | 2675903420 | 2677897161 | 321 |
| 311 | iso_pu_bacteria | 2675903515 | 2678266178 | 321 |
| 312 | iso_pu_bacteria | 2713897148 | 2715749802 | 321 |
| 313 | iso_pu_bacteria | 2713897149 | 2715754820 | 321 |
| 314 | iso_pu_bacteria | 2721755607 | 2723251395 | 321 |
| 315 | iso_pu_bacteria | 2728369097 | 2729146761 | 321 |
| 316 | iso_pu_bacteria | 2738541265 | 2738671635 | 321 |
| 317 | iso_pu_bacteria | 2738541271 | 2738690379 | 321 |
| 318 | iso_pu_bacteria | 2738541282 | 2738750029 | 321 |
| 319 | iso_pu_bacteria | 2738541294 | 2738807284 | 321 |
| 320 | iso_pu_bacteria | 2738541303 | 2738859069 | 321 |
| 321 | iso_pu_bacteria | 2738541309 | 2738894644 | 321 |
| 322 | iso_pu_bacteria | 2738543004 | 2739199088 | 321 |
| 323 | iso_pu_bacteria | 2738543015 | 2739259030 | 321 |
| 324 | iso_pu_bacteria | 2738543016 | 2739266153 | 321 |
| 325 | iso_pu_bacteria | 2738543025 | 2739312477 | 321 |
| 326 | iso_pu_bacteria | 2740892503 | 2743740455 | 321 |
| 327 | iso_pu_bacteria | 2744054620 | 2745007410 | 321 |
| 328 | iso_pu_bacteria | 2773857670 | 2774118345 | 321 |
| 329 | iso_pu_bacteria | 2773857673 | 2774135537 | 321 |
| 330 | iso_pu_bacteria | 2784132063 | 2784261787 | 321 |
| 331 | iso_pu_bacteria | 2784132072 | 2784313606 | 321 |
| 332 | iso_pu_bacteria | 2791355520 | 2794593808 | 321 |
| 333 | iso_pu_bacteria | 2808606361 | 2808855668 | 321 |
| 334 | iso_pu_bacteria | 2808606373 | 2808905695 | 321 |
| 335 | iso_pu_bacteria | 2808606376 | 2808926537 | 321 |
| 336 | iso_pu_bacteria | 2808606377 | 2808928412 | 321 |
| 337 | iso_pu_bacteria | 2808606378 | 2808935495 | 321 |
| 338 | iso_pu_bacteria | 2808606380 | 2808948698 | 321 |
| 339 | iso_pu_bacteria | 2808606381 | 2808950405 | 321 |
| 340 | iso_pu_bacteria | 2808606382 | 2808959810 | 321 |
| 341 | iso_pu_bacteria | 2808606383 | 2808964103 | 321 |
| 342 | iso_pu_bacteria | 2808606385 | 2808976179 | 321 |
| 343 | iso_pu_bacteria | 2808606388 | 2808994357 | 321 |
| 344 | iso_pu_bacteria | 2808606389 | 2808999061 | 321 |
| 345 | iso_pu_bacteria | 2808606445 | 2809217216 | 321 |
| 346 | iso_pu_bacteria | 2811994881 | 2812369522 | 321 |
| 347 | iso_pu_bacteria | 2816332298 | 2817494072 | 321 |
| 348 | iso_pu_bacteria | 2818991456 | 2819655161 | 321 |
| 349 | iso_pu_bacteria | 2818991464 | 2819704444 | 321 |
| 350 | iso_pu_bacteria | 2823421272 | 2823425749 | 321 |
| 351 | iso_pu_bacteria | 2825651385 | 2825655064 | 321 |
| 352 | iso_pu_bacteria | 2826581358 | 2826581872 | 321 |
| 353 | iso_pu_bacteria | 2834028612 | 2834030983 | 321 |
| 354 | iso_pu_bacteria | 2842815866 | 2842816873 | 321 |
| 355 | iso_pu_bacteria | 2842826826 | 2842831258 | 321 |
| 356 | iso_pu_bacteria | 2842832357 | 2842833487 | 321 |
| 357 | iso_pu_bacteria | 2842837860 | 2842837928 | 321 |
| 358 | iso_pu_bacteria | 2842843487 | 2842845717 | 321 |
| 359 | iso_pu_bacteria | 2842849001 | 2842854140 | 321 |
| 360 | iso_pu_bacteria | 2842854478 | 2842855653 | 321 |
| 361 | iso_pu_bacteria | 2844665904 | 2844667132 | 321 |
| 362 | iso_pu_bacteria | 2852612431 | 2852616382 | 321 |
| 363 | iso_pu_bacteria | 2852657418 | 2852659707 | 321 |
| 364 | iso_pu_bacteria | 2852667396 | 2852671350 | 321 |
| 365 | iso_pu_bacteria | 2860339153 | 2860341748 | 321 |
| 366 | iso_pu_bacteria | 2860867994 | 2860873057 | 321 |
| 367 | iso_pu_bacteria | 2878029506 | 2878035381 | 321 |
| 368 | iso_pu_bacteria | 2880230671 | 2880236025 | 321 |
| 369 | iso_pu_bacteria | 2897803580 | 2897808294 | 321 |
| 370 | iso_pu_bacteria | 2904518522 | 2904518928 | 321 |
| 371 | iso_pu_bacteria | 2904550169 | 2904551393 | 321 |
| 372 | iso_pu_bacteria | 2908446538 | 2908452615 | 321 |
| 373 | iso_pu_bacteria | 2913036834 | 2913042561 | 321 |
| 374 | iso_pu_bacteria | 2917070673 | 2917076776 | 321 |
| 375 | iso_pu_bacteria | 2919063839 | 2919065489 | 321 |
| 376 | iso_pu_bacteria | 2919155634 | 2919155932 | 321 |
| 377 | iso_pu_bacteria | 2919385768 | 2919389162 | 321 |
| 378 | iso_pu_bacteria | 2919456309 | 2919457580 | 321 |
| 379 | iso_pu_bacteria | 2919481497 | 2919485688 | 321 |
| 380 | iso_pu_bacteria | 2919487758 | 2919488139 | 321 |
| 381 | iso_pu_bacteria | 2919501602 | 2919502495 | 321 |
| 382 | iso_pu_bacteria | 2919697872 | 2919700543 | 321 |
| 383 | iso_pu_bacteria | 2922361189 | 2922364885 | 321 |
| 384 | iso_pu_bacteria | 2923153595 | 2923159548 | 321 |
| 385 | iso_pu_bacteria | 2923519811 | 2923523608 | 321 |
| 386 | iso_pu_bacteria | 2923586266 | 2923589031 | 321 |
| 387 | iso_pu_bacteria | 2926063275 | 2926064168 | 321 |
| 388 | iso_pu_bacteria | 2929144301 | 2929149948 | 321 |
| 389 | iso_pu_bacteria | 2929189879 | 2929195181 | 321 |
| 390 | iso_pu_bacteria | 2931369376 | 2931372608 | 321 |
| 391 | iso_pu_bacteria | 2931396565 | 2931398112 | 321 |
| 392 | iso_pu_bacteria | 2935353572 | 2935358257 | 321 |
| 393 | iso_pu_bacteria | 2939636861 | 2939640776 | 321 |
| 394 | iso_pu_bacteria | 2939651529 | 2939656669 | 321 |
| 395 | iso_pu_bacteria | 2945928738 | 2945930883 | 321 |
| 396 | iso_pu_bacteria | 2945961074 | 2945966889 | 321 |
| 397 | iso_pu_bacteria | 2946006987 | 2946013252 | 321 |
| 398 | iso_pu_bacteria | 2946027586 | 2946027932 | 321 |
| 399 | iso_pu_bacteria | 2947233263 | 2947234456 | 321 |
| 400 | iso_pu_bacteria | 2969304461 | 2969310201 | 321 |
| 401 | iso_pu_bacteria | 2974289157 | 2974294052 | 321 |
| 402 | iso_pu_bacteria | 2984286254 | 2984286566 | 321 |
| 403 | iso_pu_bacteria | 2988728565 | 2988731488 | 321 |
| 404 | iso_pu_bacteria | 2990196909 | 2990197179 | 321 |
| 405 | iso_pu_bacteria | 2998139840 | 2998145425 | 321 |
| 406 | iso_pu_bacteria | 3007252601 | 3007255399 | 321 |
| 407 | iso_pu_bacteria | 3007315729 | 3007315797 | 321 |
| 408 | iso_pu_bacteria | 3007395558 | 3007399367 | 321 |
| 409 | iso_pu_bacteria | 3007419365 | 3007425757 | 321 |
| 410 | iso_pu_bacteria | 3007511990 | 3007517210 | 321 |
| 411 | iso_pu_bacteria | 3007614139 | 3007618877 | 321 |
| 412 | iso_pu_bacteria | 3007619802 | 3007620712 | 321 |
| 413 | iso_pu_bacteria | 3007718800 | 3007721785 | 321 |
| 414 | iso_pu_bacteria | 3007855910 | 3007859220 | 321 |
| 415 | iso_pu_bacteria | 3007861166 | 3007865076 | 321 |
| 416 | iso_pu_bacteria | 3007866637 | 3007866752 | 321 |
| 417 | iso_pu_bacteria | 637000220 | 637323312 | 321 |
| 418 | iso_pu_bacteria | 651053060 | 651178100 | 321 |
| 419 | iso_pu_bacteria | 8011350971 | 8011351047 | 321 |
| 420 | iso_pu_bacteria | 8015687852 | 8015693646 | 321 |
| 421 | iso_pu_bacteria | 8019769354 | 8019769726 | 321 |
| 422 | iso_pu_bacteria | 8019775933 | 8019777650 | 321 |
| 423 | iso_pu_bacteria | 8029995093 | 8029995477 | 321 |
| 424 | iso_pu_bacteria | 8034962539 | 8034965074 | 321 |
| 425 | iso_pu_bacteria | 8054347763 | 8054349555 | 321 |
| 426 | iso_pu_bacteria | 8054503363 | 8054508966 | 321 |
| 427 | iso_pu_bacteria | 8055770955 | 8055776893 | 321 |
| 428 | iso_pu_bacteria | 8055817908 | 8055823937 | 321 |
| 429 | iso_pu_bacteria | 8056125926 | 8056131636 | 321 |
| 430 | iso_pu_bacteria | 8056131705 | 8056137342 | 321 |
| 431 | iso_pu_bacteria | 8056143049 | 8056148802 | 321 |
| 432 | iso_pu_bacteria | 8056148874 | 8056151463 | 321 |
| 433 | iso_pu_bacteria | 8056155041 | 8056159733 | 321 |
| 434 | iso_pu_bacteria | 8056161164 | 8056163660 | 321 |
| 435 | iso_pu_bacteria | 8056166840 | 8056171280 | 321 |
| 436 | iso_pu_bacteria | 8056172158 | 8056177380 | 321 |
| 437 | iso_pu_bacteria | 8056177738 | 8056182028 | 321 |
| 438 | iso_pu_bacteria | 8056569372 | 8056570495 | 321 |
| 439 | iso_pu_bacteria | 8057798959 | 8057801984 | 321 |
| 440 | 3300005548 | Ga0070665_100335453 | Ga0070665_1003354532 | 322 |
| 441 | 3300005842 | Ga0068858_100000107 | Ga0068858_10000010730 | 322 |
| 442 | 3300026035 | Ga0207703_10000146 | Ga0207703_1000014659 | 322 |
| 443 | 3300028379 | Ga0268266_10416636 | Ga0268266_104166362 | 322 |
| 444 | 3300049571 | Ga0501034_0204659 | Ga0501034_0204659_874_1851 | 322 |
| 445 | 3300005347 | Ga0070668_100365128 | Ga0070668_1003651281 | 323 |
| 446 | 3300037418 | Ga0395900_0000021 | Ga0395900_0000021_125934_126911 | 323 |
| 447 | 3300037466 | Ga0395898_0001941 | Ga0395898_0001941_10372_11349 | 323 |
| 448 | 3300037471 | Ga0395905_0006642 | Ga0395905_0006642_5438_6415 | 323 |
| 449 | 3300038443 | Ga0395901_0131608 | Ga0395901_0131608_961_1938 | 323 |
| 450 | 3300049568 | Ga0501031_0050673 | Ga0501031_0050673_70_1041 | 323 |
| 451 | 3300049572 | Ga0501036_0062080 | Ga0501036_0062080_1059_2030 | 323 |
| 452 | 3300049574 | Ga0501038_0072695 | Ga0501038_0072695_419_1390 | 323 |
| 453 | 3300049576 | Ga0501040_0005851 | Ga0501040_0005851_4854_5825 | 323 |
| 454 | 3300049577 | Ga0501041_0001880 | Ga0501041_0001880_1608_2579 | 323 |
| 455 | 3300049579 | Ga0501043_0050587 | Ga0501043_0050587_1438_2409 | 323 |
| 456 | 3300049580 | Ga0501046_0223131 | Ga0501046_0223131_20_991 | 323 |
| 457 | 3300049582 | Ga0501048_0077292 | Ga0501048_0077292_955_1926 | 323 |
| 458 | 3300049585 | Ga0501069_0025984 | Ga0501069_0025984_1241_2212 | 323 |
| 459 | 3300049589 | Ga0501073_0060700 | Ga0501073_0060700_642_1613 | 323 |
| 460 | 3300049590 | Ga0501074_0113396 | Ga0501074_0113396_325_1296 | 323 |
| 461 | 3300049591 | Ga0501075_0012099 | Ga0501075_0012099_3723_4694 | 323 |
| 462 | 3300049592 | Ga0501076_0035194 | Ga0501076_0035194_1925_2896 | 323 |
| 463 | 3300049743 | Ga0501081_0090278 | Ga0501081_0090278_160_1131 | 323 |
| 464 | 3300049822 | Ga0501035_0015708 | Ga0501035_0015708_15_986 | 323 |
| 465 | 3300053730 | Ga0500645_007042 | Ga0500645_007042_1702_2703 | 323 |
| 466 | 3300054114 | Ga0501084_0074010 | Ga0501084_0074010_1023_1994 | 323 |
| 467 | 3300061734 | Ga0530510_0001837 | Ga0530510_0001837_2276_3247 | 323 |
| 468 | 3300005329 | Ga0070683_100011524 | Ga0070683_1000115243 | 324 |
| 469 | 3300005334 | Ga0068869_100096037 | Ga0068869_1000960372 | 324 |
| 470 | 3300005335 | Ga0070666_10002542 | Ga0070666_100025427 | 324 |
| 471 | 3300005336 | Ga0070680_100172221 | Ga0070680_1001722211 | 324 |
| 472 | 3300005337 | Ga0070682_100063067 | Ga0070682_1000630674 | 324 |
| 473 | 3300005341 | Ga0070691_10026206 | Ga0070691_100262062 | 324 |
| 474 | 3300005341 | Ga0070691_10034404 | Ga0070691_100344042 | 324 |
| 475 | 3300005347 | Ga0070668_100000320 | Ga0070668_1000003208 | 324 |
| 476 | 3300005347 | Ga0070668_100143744 | Ga0070668_1001437442 | 324 |
| 477 | 3300005353 | Ga0070669_100046952 | Ga0070669_1000469522 | 324 |
| 478 | 3300005367 | Ga0070667_100000100 | Ga0070667_10000010071 | 324 |
| 479 | 3300005440 | Ga0070705_100034406 | Ga0070705_1000344061 | 324 |
| 480 | 3300005458 | Ga0070681_10047931 | Ga0070681_100479314 | 324 |
| 481 | 3300005458 | Ga0070681_10212289 | Ga0070681_102122892 | 324 |
| 482 | 3300005530 | Ga0070679_100016449 | Ga0070679_1000164495 | 324 |
| 483 | 3300005530 | Ga0070679_100062851 | Ga0070679_1000628514 | 324 |
| 484 | 3300005535 | Ga0070684_100030811 | Ga0070684_1000308113 | 324 |
| 485 | 3300005535 | Ga0070684_100035380 | Ga0070684_1000353805 | 324 |
| 486 | 3300005545 | Ga0070695_100022399 | Ga0070695_1000223993 | 324 |
| 487 | 3300005577 | Ga0068857_100025141 | Ga0068857_1000251417 | 324 |
| 488 | 3300005577 | Ga0068857_100103944 | Ga0068857_1001039442 | 324 |
| 489 | 3300005614 | Ga0068856_100021703 | Ga0068856_1000217032 | 324 |
| 490 | 3300005841 | Ga0068863_100000075 | Ga0068863_10000007579 | 324 |
| 491 | 3300005843 | Ga0068860_100007209 | Ga0068860_1000072092 | 324 |
| 492 | 3300005983 | Ga0081540_1000048 | Ga0081540_100004861 | 324 |
| 493 | 3300005983 | Ga0081540_1032576 | Ga0081540_10325762 | 324 |
| 494 | 3300006844 | Ga0075428_100062521 | Ga0075428_1000625212 | 324 |
| 495 | 3300006852 | Ga0075433_10006882 | Ga0075433_100068824 | 324 |
| 496 | 3300006871 | Ga0075434_100002490 | Ga0075434_1000024906 | 324 |
| 497 | 3300009094 | Ga0111539_10038874 | Ga0111539_100388742 | 324 |
| 498 | 3300009094 | Ga0111539_10373291 | Ga0111539_103732912 | 324 |
| 499 | 3300009098 | Ga0105245_10020417 | Ga0105245_100204176 | 324 |
| 500 | 3300009147 | Ga0114129_10043509 | Ga0114129_100435095 | 324 |
| 501 | 3300009545 | Ga0105237_10075496 | Ga0105237_100754965 | 324 |
| 502 | 3300014969 | Ga0157376_10003731 | Ga0157376_100037314 | 324 |
| 503 | 3300025903 | Ga0207680_10007348 | Ga0207680_100073483 | 324 |
| 504 | 3300025912 | Ga0207707_10107652 | Ga0207707_101076522 | 324 |
| 505 | 3300025921 | Ga0207652_10387571 | Ga0207652_103875712 | 324 |
| 506 | 3300025923 | Ga0207681_10037180 | Ga0207681_100371803 | 324 |
| 507 | 3300025927 | Ga0207687_10013217 | Ga0207687_100132176 | 324 |
| 508 | 3300025929 | Ga0207664_10100135 | Ga0207664_101001352 | 324 |
| 509 | 3300025944 | Ga0207661_10075763 | Ga0207661_100757631 | 324 |
| 510 | 3300025972 | Ga0207668_10000381 | Ga0207668_1000038122 | 324 |
| 511 | 3300025972 | Ga0207668_10175272 | Ga0207668_101752721 | 324 |
| 512 | 3300025986 | Ga0207658_10000079 | Ga0207658_1000007971 | 324 |
| 513 | 3300026078 | Ga0207702_10041671 | Ga0207702_100416712 | 324 |
| 514 | 3300026088 | Ga0207641_10000381 | Ga0207641_1000038122 | 324 |
| 515 | 3300026116 | Ga0207674_10000581 | Ga0207674_1000058123 | 324 |
| 516 | 3300026116 | Ga0207674_10007464 | Ga0207674_100074647 | 324 |
| 517 | 3300027907 | Ga0207428_10164592 | Ga0207428_101645921 | 324 |
| 518 | 3300028381 | Ga0268264_10004836 | Ga0268264_100048366 | 324 |
| 519 | 3300028556 | Ga0265337_1001036 | Ga0265337_100103610 | 324 |
| 520 | 3300031240 | Ga0265320_10000743 | Ga0265320_1000074313 | 324 |
| 521 | 3300035091 | Ga0373951_0020439 | Ga0373951_0020439_508_1503 | 324 |
| 522 | 3300035114 | Ga0373939_0003102 | Ga0373939_0003102_1624_2619 | 324 |
| 523 | 3300035115 | Ga0373941_0003895 | Ga0373941_0003895_1292_2287 | 324 |
| 524 | 3300035691 | Ga0373931_0000508 | Ga0373931_0000508_13468_14463 | 324 |
| 525 | 3300036401 | Ga0373937_0488303 | Ga0373937_0488303_71_1045 | 324 |
| 526 | 3300037418 | Ga0395900_0018240 | Ga0395900_0018240_2862_3836 | 324 |
| 527 | 3300037471 | Ga0395905_0009143 | Ga0395905_0009143_7279_8358 | 324 |
| 528 | 3300038443 | Ga0395901_0021168 | Ga0395901_0021168_71_1045 | 324 |
| 529 | 3300038443 | Ga0395901_0558773 | Ga0395901_0558773_118_1092 | 324 |
| 530 | 3300045051 | Ga0451576_0464713 | Ga0451576_0464713_284_1297 | 324 |
| 531 | 3300046471 | Ga0495650_0001251 | Ga0495650_0001251_11458_12456 | 324 |
| 532 | 3300046501 | Ga0495607_0001277 | Ga0495607_0001277_652_1626 | 324 |
| 533 | 3300046675 | Ga0495657_0102393 | Ga0495657_0102393_61_1074 | 324 |
| 534 | 3300046678 | Ga0495599_0047983 | Ga0495599_0047983_1518_2531 | 324 |
| 535 | 3300048915 | Ga0496112_0074343 | Ga0496112_0074343_1332_2306 | 324 |
| 536 | 3300050511 | nmdc:mga08y16_84946_c1 | nmdc:mga08y16_84946_c1_2099_3094 | 324 |
| 537 | 3300050512 | nmdc:mga0n895_6835_c1 | nmdc:mga0n895_6835_c1_5072_6067 | 324 |
| 538 | 3300050515 | nmdc:mga0a205_110_c1 | nmdc:mga0a205_110_c1_13531_14526 | 324 |
| 539 | 3300053085 | Ga0495619_0224293 | Ga0495619_0224293_189_1202 | 324 |
| 540 | 3300053087 | Ga0500643_008570 | Ga0500643_008570_1655_2665 | 324 |
| 541 | 2124908027 | MRS2a_Contig_718 | MRS2a_00573900 | 325 |
| 542 | 2162886007 | SwRhRL2b_contig_519873 | SwRhRL2b_0505.00004780 | 325 |
| 543 | 3300002737 | JGI25162J39368_1001366 | JGI25162J39368_10013665 | 325 |
| 544 | 3300002771 | JGI25163J39215_1001615 | JGI25163J39215_10016154 | 325 |
| 545 | 3300002772 | JGI25164J39214_1000683 | JGI25164J39214_10006835 | 325 |
| 546 | 3300003214 | JGI25165J46597_1001371 | JGI25165J46597_10013715 | 325 |
| 547 | 3300003323 | rootH1_10163451 | rootH1_101634512 | 325 |
| 548 | 3300003781 | Ga0055536_1001844 | Ga0055536_10018449 | 325 |
| 549 | 3300003781 | Ga0055536_1004928 | Ga0055536_10049284 | 325 |
| 550 | 3300003781 | Ga0055536_1005802 | Ga0055536_10058026 | 325 |
| 551 | 3300003791 | Ga0055530_10001310 | Ga0055530_100013109 | 325 |
| 552 | 3300003791 | Ga0055530_10001782 | Ga0055530_100017829 | 325 |
| 553 | 3300003791 | Ga0055530_10002801 | Ga0055530_100028017 | 325 |
| 554 | 3300003792 | Ga0055540_1000960 | Ga0055540_10009609 | 325 |
| 555 | 3300003792 | Ga0055540_1001320 | Ga0055540_10013206 | 325 |
| 556 | 3300003792 | Ga0055540_1002155 | Ga0055540_10021557 | 325 |
| 557 | 3300003794 | Ga0055531_10000404 | Ga0055531_1000040438 | 325 |
| 558 | 3300003794 | Ga0055531_10000483 | Ga0055531_1000048336 | 325 |
| 559 | 3300005288 | Ga0065714_10002460 | Ga0065714_100024607 | 325 |
| 560 | 3300005288 | Ga0065714_10003917 | Ga0065714_100039178 | 325 |
| 561 | 3300005288 | Ga0065714_10003949 | Ga0065714_100039492 | 325 |
| 562 | 3300005288 | Ga0065714_10075748 | Ga0065714_100757482 | 325 |
| 563 | 3300005289 | Ga0065704_10070757 | Ga0065704_100707579 | 325 |
| 564 | 3300005290 | Ga0065712_10002401 | Ga0065712_100024013 | 325 |
| 565 | 3300005290 | Ga0065712_10067900 | Ga0065712_1006790016 | 325 |
| 566 | 3300005353 | Ga0070669_100012886 | Ga0070669_1000128863 | 325 |
| 567 | 3300005353 | Ga0070669_100047838 | Ga0070669_1000478383 | 325 |
| 568 | 3300005353 | Ga0070669_100191144 | Ga0070669_1001911442 | 325 |
| 569 | 3300005364 | Ga0070673_100214660 | Ga0070673_1002146602 | 325 |
| 570 | 3300005436 | Ga0070713_100018878 | Ga0070713_1000188784 | 325 |
| 571 | 3300005437 | Ga0070710_10005945 | Ga0070710_100059454 | 325 |
| 572 | 3300005457 | Ga0070662_100004142 | Ga0070662_1000041429 | 325 |
| 573 | 3300005548 | Ga0070665_100056139 | Ga0070665_1000561394 | 325 |
| 574 | 3300005548 | Ga0070665_100175393 | Ga0070665_1001753932 | 325 |
| 575 | 3300005617 | Ga0068859_100121645 | Ga0068859_1001216451 | 325 |
| 576 | 3300005843 | Ga0068860_100038578 | Ga0068860_1000385785 | 325 |
| 577 | 3300006028 | Ga0070717_10019939 | Ga0070717_100199391 | 325 |
| 578 | 3300006058 | Ga0075432_10001293 | Ga0075432_100012937 | 325 |
| 579 | 3300006058 | Ga0075432_10011785 | Ga0075432_100117853 | 325 |
| 580 | 3300006931 | Ga0097620_100121652 | Ga0097620_1001216523 | 325 |
| 581 | 3300006946 | Ga0079104_1000424 | Ga0079104_10004248 | 325 |
| 582 | 3300009011 | Ga0105251_10001765 | Ga0105251_100017658 | 325 |
| 583 | 3300009011 | Ga0105251_10001772 | Ga0105251_1000177214 | 325 |
| 584 | 3300009011 | Ga0105251_10003299 | Ga0105251_100032998 | 325 |
| 585 | 3300009036 | Ga0105244_10001453 | Ga0105244_1000145317 | 325 |
| 586 | 3300009036 | Ga0105244_10018147 | Ga0105244_100181473 | 325 |
| 587 | 3300009036 | Ga0105244_10018552 | Ga0105244_100185524 | 325 |
| 588 | 3300009036 | Ga0105244_10031978 | Ga0105244_100319781 | 325 |
| 589 | 3300009036 | Ga0105244_10033541 | Ga0105244_100335413 | 325 |
| 590 | 3300009036 | Ga0105244_10037553 | Ga0105244_100375533 | 325 |
| 591 | 3300009036 | Ga0105244_10049296 | Ga0105244_100492961 | 325 |
| 592 | 3300009036 | Ga0105244_10072789 | Ga0105244_100727892 | 325 |
| 593 | 3300009036 | Ga0105244_10099476 | Ga0105244_100994762 | 325 |
| 594 | 3300009092 | Ga0105250_10030459 | Ga0105250_100304592 | 325 |
| 595 | 3300009092 | Ga0105250_10071453 | Ga0105250_100714532 | 325 |
| 596 | 3300009148 | Ga0105243_10005105 | Ga0105243_1000510510 | 325 |
| 597 | 3300009148 | Ga0105243_10007073 | Ga0105243_100070735 | 325 |
| 598 | 3300009176 | Ga0105242_10050113 | Ga0105242_100501135 | 325 |
| 599 | 3300011119 | Ga0105246_10023768 | Ga0105246_100237683 | 325 |
| 600 | 3300011119 | Ga0105246_10057824 | Ga0105246_100578243 | 325 |
| 601 | 3300012498 | Ga0157345_1000367 | Ga0157345_10003675 | 325 |
| 602 | 3300013100 | Ga0157373_10003979 | Ga0157373_1000397911 | 325 |
| 603 | 3300013100 | Ga0157373_10004112 | Ga0157373_100041127 | 325 |
| 604 | 3300013100 | Ga0157373_10131153 | Ga0157373_101311532 | 325 |
| 605 | 3300013102 | Ga0157371_10003709 | Ga0157371_1000370910 | 325 |
| 606 | 3300013104 | Ga0157370_10102117 | Ga0157370_101021173 | 325 |
| 607 | 3300013104 | Ga0157370_10327544 | Ga0157370_103275441 | 325 |
| 608 | 3300014497 | Ga0182008_10002828 | Ga0182008_100028284 | 325 |
| 609 | 3300015262 | Ga0182007_10057397 | Ga0182007_100573971 | 325 |
| 610 | 3300015265 | Ga0182005_1009972 | Ga0182005_10099722 | 325 |
| 611 | 3300021384 | Ga0213876_10040655 | Ga0213876_100406552 | 325 |
| 612 | 3300025207 | Ga0209760_100367 | Ga0209760_1003678 | 325 |
| 613 | 3300025230 | Ga0209563_102304 | Ga0209563_1023043 | 325 |
| 614 | 3300025231 | Ga0207427_100005 | Ga0207427_100005372 | 325 |
| 615 | 3300025233 | Ga0209437_100018 | Ga0209437_100018282 | 325 |
| 616 | 3300025256 | Ga0209759_1002680 | Ga0209759_10026805 | 325 |
| 617 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021372 | 325 |
| 618 | 3300025284 | Ga0209130_1011547 | Ga0209130_10115471 | 325 |
| 619 | 3300025291 | Ga0209675_1000989 | Ga0209675_100098912 | 325 |
| 620 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015383 | 325 |
| 621 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030302 | 325 |
| 622 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041146 | 325 |
| 623 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024141 | 325 |
| 624 | 3300025298 | Ga0209050_1000030 | Ga0209050_100003055 | 325 |
| 625 | 3300025298 | Ga0209050_1000518 | Ga0209050_10005186 | 325 |
| 626 | 3300025298 | Ga0209050_1002563 | Ga0209050_100256310 | 325 |
| 627 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012296 | 325 |
| 628 | 3300025303 | Ga0209051_1000023 | Ga0209051_100002357 | 325 |
| 629 | 3300025303 | Ga0209051_1001294 | Ga0209051_100129410 | 325 |
| 630 | 3300025304 | Ga0209257_1002874 | Ga0209257_10028745 | 325 |
| 631 | 3300025304 | Ga0209257_1004425 | Ga0209257_10044257 | 325 |
| 632 | 3300025711 | Ga0207696_1000031 | Ga0207696_1000031262 | 325 |
| 633 | 3300025711 | Ga0207696_1008529 | Ga0207696_10085291 | 325 |
| 634 | 3300025711 | Ga0207696_1018984 | Ga0207696_10189842 | 325 |
| 635 | 3300025728 | Ga0207655_1000033 | Ga0207655_100003386 | 325 |
| 636 | 3300025728 | Ga0207655_1000202 | Ga0207655_100020211 | 325 |
| 637 | 3300025728 | Ga0207655_1005474 | Ga0207655_10054743 | 325 |
| 638 | 3300025728 | Ga0207655_1005579 | Ga0207655_10055798 | 325 |
| 639 | 3300025728 | Ga0207655_1010707 | Ga0207655_10107075 | 325 |
| 640 | 3300025728 | Ga0207655_1010965 | Ga0207655_10109656 | 325 |
| 641 | 3300025728 | Ga0207655_1012603 | Ga0207655_10126035 | 325 |
| 642 | 3300025728 | Ga0207655_1016443 | Ga0207655_10164432 | 325 |
| 643 | 3300025728 | Ga0207655_1025001 | Ga0207655_10250013 | 325 |
| 644 | 3300025735 | Ga0207713_1000079 | Ga0207713_1000079123 | 325 |
| 645 | 3300025735 | Ga0207713_1000659 | Ga0207713_100065914 | 325 |
| 646 | 3300025735 | Ga0207713_1000881 | Ga0207713_10008817 | 325 |
| 647 | 3300025735 | Ga0207713_1001352 | Ga0207713_10013526 | 325 |
| 648 | 3300025735 | Ga0207713_1001720 | Ga0207713_100172019 | 325 |
| 649 | 3300025735 | Ga0207713_1032956 | Ga0207713_10329562 | 325 |
| 650 | 3300025735 | Ga0207713_1052121 | Ga0207713_10521212 | 325 |
| 651 | 3300025898 | Ga0207692_10008666 | Ga0207692_100086662 | 325 |
| 652 | 3300025905 | Ga0207685_10014357 | Ga0207685_100143572 | 325 |
| 653 | 3300025912 | Ga0207707_10135044 | Ga0207707_101350442 | 325 |
| 654 | 3300025916 | Ga0207663_10005895 | Ga0207663_100058954 | 325 |
| 655 | 3300025923 | Ga0207681_10003495 | Ga0207681_100034958 | 325 |
| 656 | 3300025933 | Ga0207706_10001804 | Ga0207706_100018043 | 325 |
| 657 | 3300025934 | Ga0207686_10093117 | Ga0207686_100931172 | 325 |
| 658 | 3300025935 | Ga0207709_10000248 | Ga0207709_100002489 | 325 |
| 659 | 3300025935 | Ga0207709_10002118 | Ga0207709_100021187 | 325 |
| 660 | 3300025935 | Ga0207709_10004819 | Ga0207709_100048195 | 325 |
| 661 | 3300025960 | Ga0207651_10242508 | Ga0207651_102425081 | 325 |
| 662 | 3300025961 | Ga0207712_10036357 | Ga0207712_100363573 | 325 |
| 663 | 3300026095 | Ga0207676_10131736 | Ga0207676_101317362 | 325 |
| 664 | 3300026121 | Ga0207683_10452553 | Ga0207683_104525532 | 325 |
| 665 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016342 | 325 |
| 666 | 3300027312 | Ga0209371_1000032 | Ga0209371_100003265 | 325 |
| 667 | 3300027907 | Ga0207428_10066064 | Ga0207428_100660643 | 325 |
| 668 | 3300028379 | Ga0268266_10017876 | Ga0268266_100178764 | 325 |
| 669 | 3300028381 | Ga0268264_10027626 | Ga0268264_100276265 | 325 |
| 670 | 3300028573 | Ga0265334_10014029 | Ga0265334_100140292 | 325 |
| 671 | 3300030500 | Ga0268256_1000232 | Ga0268256_100023214 | 325 |
| 672 | 3300030742 | Ga0316183_1004754 | Ga0316183_10047546 | 325 |
| 673 | 3300030744 | Ga0316181_1248978 | Ga0316181_12489782 | 325 |
| 674 | 3300031251 | Ga0265327_10000225 | Ga0265327_1000022534 | 325 |
| 675 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002433 | 325 |
| 676 | 3300031548 | Ga0307408_100005271 | Ga0307408_1000052712 | 325 |
| 677 | 3300031548 | Ga0307408_100008555 | Ga0307408_1000085554 | 325 |
| 678 | 3300031730 | Ga0307516_10048628 | Ga0307516_100486284 | 325 |
| 679 | 3300031731 | Ga0307405_10003779 | Ga0307405_100037794 | 325 |
| 680 | 3300031903 | Ga0307407_10027385 | Ga0307407_100273853 | 325 |
| 681 | 3300031911 | Ga0307412_10003115 | Ga0307412_100031154 | 325 |
| 682 | 3300031911 | Ga0307412_10006197 | Ga0307412_100061975 | 325 |
| 683 | 3300031911 | Ga0307412_10008593 | Ga0307412_100085935 | 325 |
| 684 | 3300032002 | Ga0307416_100040568 | Ga0307416_1000405682 | 325 |
| 685 | 3300032005 | Ga0307411_10007691 | Ga0307411_100076915 | 325 |
| 686 | 3300038705 | Ga0237819_01191 | Ga0237819_01191_2674_3651 | 325 |
| 687 | 3300041404 | Ga0439436_0000130 | Ga0439436_0000130_14062_15039 | 325 |
| 688 | 3300041405 | Ga0439438_005440 | Ga0439438_005440_2542_3519 | 325 |
| 689 | 3300041405 | Ga0439438_013062 | Ga0439438_013062_292_1269 | 325 |
| 690 | 3300041408 | Ga0439453_0000335 | Ga0439453_0000335_2615_3592 | 325 |
| 691 | 3300041410 | Ga0439461_0037012 | Ga0439461_0037012_50_1030 | 325 |
| 692 | 3300041411 | Ga0439466_0001538 | Ga0439466_0001538_7031_8008 | 325 |
| 693 | 3300041411 | Ga0439466_0016276 | Ga0439466_0016276_396_1373 | 325 |
| 694 | 3300041411 | Ga0439466_0029187 | Ga0439466_0029187_249_1226 | 325 |
| 695 | 3300041411 | Ga0439466_0035683 | Ga0439466_0035683_17_994 | 325 |
| 696 | 3300042000 | Ga0439437_000827 | Ga0439437_000827_1944_2924 | 325 |
| 697 | 3300042001 | Ga0439441_017284 | Ga0439441_017284_86_1063 | 325 |
| 698 | 3300042003 | Ga0439443_001325 | Ga0439443_001325_189_1166 | 325 |
| 699 | 3300042006 | Ga0439432_003130 | Ga0439432_003130_4336_5313 | 325 |
| 700 | 3300042009 | Ga0439451_013932 | Ga0439451_013932_278_1255 | 325 |
| 701 | 3300042009 | Ga0439451_019669 | Ga0439451_019669_328_1305 | 325 |
| 702 | 3300042010 | Ga0439452_001777 | Ga0439452_001777_1851_2828 | 325 |
| 703 | 3300042013 | Ga0439456_007379 | Ga0439456_007379_1108_2088 | 325 |
| 704 | 3300042016 | Ga0439463_003592 | Ga0439463_003592_2057_3034 | 325 |
| 705 | 3300042016 | Ga0439463_017897 | Ga0439463_017897_96_1073 | 325 |
| 706 | 3300042115 | Ga0450911_000024 | Ga0450911_000024_58022_59002 | 325 |
| 707 | 3300042125 | Ga0450923_000807 | Ga0450923_000807_290_1267 | 325 |
| 708 | 3300042139 | Ga0450904_000070 | Ga0450904_000070_2017_2997 | 325 |
| 709 | 3300042146 | Ga0450907_004917 | Ga0450907_004917_934_1911 | 325 |
| 710 | 3300042156 | Ga0439446_0000025 | Ga0439446_0000025_10693_11673 | 325 |
| 711 | 3300042156 | Ga0439446_0001438 | Ga0439446_0001438_3139_4116 | 325 |
| 712 | 3300042435 | Ga0439434_0001044 | Ga0439434_0001044_1914_2891 | 325 |
| 713 | 3300042436 | Ga0439435_0008188 | Ga0439435_0008188_252_1229 | 325 |
| 714 | 3300042439 | Ga0439464_0002389 | Ga0439464_0002389_1205_2185 | 325 |
| 715 | 3300042439 | Ga0439464_0003144 | Ga0439464_0003144_2418_3407 | 325 |
| 716 | 3300042461 | Ga0439460_0016567 | Ga0439460_0016567_975_1952 | 325 |
| 717 | 3300046453 | Ga0495627_000240 | Ga0495627_000240_14631_15674 | 325 |
| 718 | 3300046453 | Ga0495627_019160 | Ga0495627_019160_818_1795 | 325 |
| 719 | 3300046458 | Ga0495591_000113 | Ga0495591_000113_36174_37217 | 325 |
| 720 | 3300046458 | Ga0495591_003234 | Ga0495591_003234_4837_5814 | 325 |
| 721 | 3300046458 | Ga0495591_003979 | Ga0495591_003979_659_1636 | 325 |
| 722 | 3300046458 | Ga0495591_004557 | Ga0495591_004557_2481_3458 | 325 |
| 723 | 3300046458 | Ga0495591_012617 | Ga0495591_012617_1283_2260 | 325 |
| 724 | 3300046459 | Ga0495629_0026617 | Ga0495629_0026617_1442_2422 | 325 |
| 725 | 3300046460 | Ga0495638_0014331 | Ga0495638_0014331_2293_3270 | 325 |
| 726 | 3300046460 | Ga0495638_0016717 | Ga0495638_0016717_2742_3719 | 325 |
| 727 | 3300046471 | Ga0495650_0004070 | Ga0495650_0004070_8677_9654 | 325 |
| 728 | 3300046474 | Ga0495605_0000100 | Ga0495605_0000100_89114_90091 | 325 |
| 729 | 3300046474 | Ga0495605_0000122 | Ga0495605_0000122_84116_85093 | 325 |
| 730 | 3300046474 | Ga0495605_0000720 | Ga0495605_0000720_3007_3984 | 325 |
| 731 | 3300046474 | Ga0495605_0008842 | Ga0495605_0008842_2248_3225 | 325 |
| 732 | 3300046474 | Ga0495605_0009980 | Ga0495605_0009980_2044_3087 | 325 |
| 733 | 3300046492 | Ga0495585_0011234 | Ga0495585_0011234_2629_3606 | 325 |
| 734 | 3300046499 | Ga0495594_0024774 | Ga0495594_0024774_1537_2514 | 325 |
| 735 | 3300046501 | Ga0495607_0000478 | Ga0495607_0000478_2867_3910 | 325 |
| 736 | 3300046501 | Ga0495607_0000778 | Ga0495607_0000778_29143_30186 | 325 |
| 737 | 3300046501 | Ga0495607_0002257 | Ga0495607_0002257_11876_12853 | 325 |
| 738 | 3300046501 | Ga0495607_0002708 | Ga0495607_0002708_174_1151 | 325 |
| 739 | 3300046501 | Ga0495607_0008693 | Ga0495607_0008693_2470_3447 | 325 |
| 740 | 3300046501 | Ga0495607_0010888 | Ga0495607_0010888_4286_5263 | 325 |
| 741 | 3300046501 | Ga0495607_0044473 | Ga0495607_0044473_772_1749 | 325 |
| 742 | 3300046506 | Ga0495583_0000174 | Ga0495583_0000174_18942_19919 | 325 |
| 743 | 3300046506 | Ga0495583_0001423 | Ga0495583_0001423_18114_19091 | 325 |
| 744 | 3300046506 | Ga0495583_0003451 | Ga0495583_0003451_2358_3335 | 325 |
| 745 | 3300046506 | Ga0495583_0006082 | Ga0495583_0006082_2398_3375 | 325 |
| 746 | 3300046506 | Ga0495583_0006222 | Ga0495583_0006222_2212_3189 | 325 |
| 747 | 3300046506 | Ga0495583_0010507 | Ga0495583_0010507_1746_2723 | 325 |
| 748 | 3300046507 | Ga0495606_0002133 | Ga0495606_0002133_2530_3507 | 325 |
| 749 | 3300046512 | Ga0495610_0005689 | Ga0495610_0005689_1402_2379 | 325 |
| 750 | 3300046512 | Ga0495610_0019337 | Ga0495610_0019337_2478_3455 | 325 |
| 751 | 3300046513 | Ga0495616_0057426 | Ga0495616_0057426_52_1029 | 325 |
| 752 | 3300046515 | Ga0495620_0000416 | Ga0495620_0000416_18947_19924 | 325 |
| 753 | 3300046515 | Ga0495620_0003579 | Ga0495620_0003579_5236_6213 | 325 |
| 754 | 3300046515 | Ga0495620_0009573 | Ga0495620_0009573_3062_4039 | 325 |
| 755 | 3300046518 | Ga0495631_0017707 | Ga0495631_0017707_113_1090 | 325 |
| 756 | 3300046519 | Ga0495632_0000855 | Ga0495632_0000855_13553_14530 | 325 |
| 757 | 3300046519 | Ga0495632_0085917 | Ga0495632_0085917_72_1049 | 325 |
| 758 | 3300046520 | Ga0495637_0000045 | Ga0495637_0000045_9235_10212 | 325 |
| 759 | 3300046520 | Ga0495637_0003284 | Ga0495637_0003284_2427_3404 | 325 |
| 760 | 3300046520 | Ga0495637_0010872 | Ga0495637_0010872_3169_4146 | 325 |
| 761 | 3300046524 | Ga0495648_0010440 | Ga0495648_0010440_1451_2428 | 325 |
| 762 | 3300046530 | Ga0495654_0005992 | Ga0495654_0005992_712_1689 | 325 |
| 763 | 3300046530 | Ga0495654_0013219 | Ga0495654_0013219_2702_3679 | 325 |
| 764 | 3300046530 | Ga0495654_0020328 | Ga0495654_0020328_1210_2187 | 325 |
| 765 | 3300046538 | Ga0495609_0000023 | Ga0495609_0000023_81209_82186 | 325 |
| 766 | 3300046538 | Ga0495609_0000088 | Ga0495609_0000088_19033_20010 | 325 |
| 767 | 3300046542 | Ga0495597_0000240 | Ga0495597_0000240_12715_13764 | 325 |
| 768 | 3300046558 | Ga0495633_0000777 | Ga0495633_0000777_19031_20008 | 325 |
| 769 | 3300046558 | Ga0495633_0018993 | Ga0495633_0018993_55_1032 | 325 |
| 770 | 3300046558 | Ga0495633_0124537 | Ga0495633_0124537_166_1143 | 325 |
| 771 | 3300046616 | Ga0495668_0015169 | Ga0495668_0015169_2329_3306 | 325 |
| 772 | 3300046616 | Ga0495668_0031787 | Ga0495668_0031787_899_1876 | 325 |
| 773 | 3300046616 | Ga0495668_0062748 | Ga0495668_0062748_37_1014 | 325 |
| 774 | 3300046648 | Ga0495611_0055613 | Ga0495611_0055613_93_1136 | 325 |
| 775 | 3300046660 | Ga0495625_0000061 | Ga0495625_0000061_87954_88931 | 325 |
| 776 | 3300046660 | Ga0495625_0060668 | Ga0495625_0060668_870_1913 | 325 |
| 777 | 3300046660 | Ga0495625_0278636 | Ga0495625_0278636_26_1003 | 325 |
| 778 | 3300046664 | Ga0495659_0002272 | Ga0495659_0002272_4000_4977 | 325 |
| 779 | 3300046665 | Ga0495661_0000072 | Ga0495661_0000072_9933_10910 | 325 |
| 780 | 3300046665 | Ga0495661_0000841 | Ga0495661_0000841_19033_20010 | 325 |
| 781 | 3300046665 | Ga0495661_0019472 | Ga0495661_0019472_1438_2415 | 325 |
| 782 | 3300046665 | Ga0495661_0036893 | Ga0495661_0036893_190_1167 | 325 |
| 783 | 3300046683 | Ga0495658_0209403 | Ga0495658_0209403_186_1166 | 325 |
| 784 | 3300046691 | Ga0495670_0105866 | Ga0495670_0105866_84_1061 | 325 |
| 785 | 3300046692 | Ga0495671_0004440 | Ga0495671_0004440_2369_3346 | 325 |
| 786 | 3300046692 | Ga0495671_0013286 | Ga0495671_0013286_3477_4454 | 325 |
| 787 | 3300046692 | Ga0495671_0034409 | Ga0495671_0034409_278_1294 | 325 |
| 788 | 3300046692 | Ga0495671_0047935 | Ga0495671_0047935_795_1772 | 325 |
| 789 | 3300046810 | Ga0495660_0004806 | Ga0495660_0004806_5734_6777 | 325 |
| 790 | 3300046810 | Ga0495660_0020931 | Ga0495660_0020931_1889_2866 | 325 |
| 791 | 3300046810 | Ga0495660_0065991 | Ga0495660_0065991_885_1862 | 325 |
| 792 | 3300047320 | Ga0495672_0004169 | Ga0495672_0004169_7701_8678 | 325 |
| 793 | 3300047320 | Ga0495672_0014093 | Ga0495672_0014093_493_1470 | 325 |
| 794 | 3300047320 | Ga0495672_0021543 | Ga0495672_0021543_808_1851 | 325 |
| 795 | 3300047320 | Ga0495672_0033583 | Ga0495672_0033583_1930_2907 | 325 |
| 796 | 3300047320 | Ga0495672_0135331 | Ga0495672_0135331_73_1050 | 325 |
| 797 | 3300047322 | Ga0495680_0004392 | Ga0495680_0004392_425_1402 | 325 |
| 798 | 3300047323 | Ga0495683_0000070 | Ga0495683_0000070_18138_19115 | 325 |
| 799 | 3300047446 | Ga0495679_000814 | Ga0495679_000814_990_2033 | 325 |
| 800 | 3300047469 | Ga0495673_0002493 | Ga0495673_0002493_4010_5053 | 325 |
| 801 | 3300047469 | Ga0495673_0002965 | Ga0495673_0002965_7274_8251 | 325 |
| 802 | 3300047469 | Ga0495673_0011343 | Ga0495673_0011343_1415_2392 | 325 |
| 803 | 3300047469 | Ga0495673_0037789 | Ga0495673_0037789_152_1129 | 325 |
| 804 | 3300047470 | Ga0495681_0009957 | Ga0495681_0009957_645_1622 | 325 |
| 805 | 3300047470 | Ga0495681_0066142 | Ga0495681_0066142_485_1462 | 325 |
| 806 | 3300047472 | Ga0495686_0028959 | Ga0495686_0028959_2581_3558 | 325 |
| 807 | 3300048905 | Ga0496102_0133813 | Ga0496102_0133813_443_1420 | 325 |
| 808 | 3300048919 | Ga0496116_0004519 | Ga0496116_0004519_7694_8671 | 325 |
| 809 | 3300048920 | Ga0496117_0005978 | Ga0496117_0005978_7686_8663 | 325 |
| 810 | 3300048921 | Ga0496118_0016641 | Ga0496118_0016641_602_1579 | 325 |
| 811 | 3300048922 | Ga0496119_0001575 | Ga0496119_0001575_11777_12760 | 325 |
| 812 | 3300048923 | Ga0496120_0002964 | Ga0496120_0002964_5319_6302 | 325 |
| 813 | 3300048924 | Ga0496121_0002538 | Ga0496121_0002538_5841_6818 | 325 |
| 814 | 3300048924 | Ga0496121_0006595 | Ga0496121_0006595_12719_13696 | 325 |
| 815 | 3300048924 | Ga0496121_0007491 | Ga0496121_0007491_4532_5509 | 325 |
| 816 | 3300048925 | Ga0496122_0000398 | Ga0496122_0000398_5660_6637 | 325 |
| 817 | 3300048925 | Ga0496122_0052728 | Ga0496122_0052728_14_991 | 325 |
| 818 | 3300048926 | Ga0496123_0000302 | Ga0496123_0000302_5554_6531 | 325 |
| 819 | 3300048926 | Ga0496123_0071453 | Ga0496123_0071453_244_1221 | 325 |
| 820 | 3300048927 | Ga0496124_0000073 | Ga0496124_0000073_130245_131222 | 325 |
| 821 | 3300048927 | Ga0496124_0022223 | Ga0496124_0022223_45_1022 | 325 |
| 822 | 3300048927 | Ga0496124_0050920 | Ga0496124_0050920_2173_3216 | 325 |
| 823 | 3300048927 | Ga0496124_0115208 | Ga0496124_0115208_45_1022 | 325 |
| 824 | 3300049459 | Ga0495678_000325 | Ga0495678_000325_37242_38219 | 325 |
| 825 | 3300049459 | Ga0495678_000692 | Ga0495678_000692_8597_9574 | 325 |
| 826 | 3300049459 | Ga0495678_011303 | Ga0495678_011303_3233_4210 | 325 |
| 827 | 3300049459 | Ga0495678_030399 | Ga0495678_030399_271_1248 | 325 |
| 828 | 3300049460 | Ga0495682_0000090 | Ga0495682_0000090_3153_4130 | 325 |
| 829 | 3300049460 | Ga0495682_0000607 | Ga0495682_0000607_14187_15164 | 325 |
| 830 | 3300049460 | Ga0495682_0079633 | Ga0495682_0079633_71_1048 | 325 |
| 831 | 3300049853 | Ga0501226_000001 | Ga0501226_000001_262582_263562 | 325 |
| 832 | iso_pu_bacteria | 640427133 | 640490018 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eye-assembly1.cif.gz_A | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.9475 | 1 | 322 |
| 4eye-assembly2.cif.gz_B | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.9402 | 1 | 322 |
| 1yb5-assembly1.cif.gz_A | crystal structure of human zeta-crystallin with bound nadp | 0.9389 | 1 | 323 |
| 1iyz-assembly1.cif.gz_A-2 | crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph | 0.9366 | 1 | 323 |
| 1iyz-assembly1.cif.gz_A-2 | crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph | 0.9336 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q3UNZ8_155_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.987 | 134 | 257 | 3.40.50.720 |
| af_P47199_9_127_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9752 | 3 | 118 | 3.90.180.10 |
| af_Q3UNZ8_26_154_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9706 | 2 | 130 | 3.90.180.10 |
| af_O45496_9_126_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9704 | 1 | 118 | 3.90.180.10 |
| af_B0BNC9_25_138_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9682 | 2 | 114 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A4AT29-F1-model_v4 | deleted | 0.9942 | 1 | 324 |
|
| AF-A0A7X5WVL9-F1-model_v4 | Alcohol dehydrogenase catalytic domain-containing protein | 0.9936 | 21 | 114 |
GO:0016491
|
| AF-A0A2A4AT29-F1-model_v4 | deleted | 0.9911 | 1 | 324 |
|
| AF-A0A6H9HTU4-F1-model_v4 | NADPH:quinone oxidoreductase family protein | 0.9863 | 1 | 324 |
GO:0008270
GO:0016491 |
| AF-A0A522AWD5-F1-model_v4 | NADPH:quinone oxidoreductase family protein | 0.9847 | 1 | 226 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar