F482713

General Info

Members Datasets Scaffolds Average Seq Length
832 232 823 206

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100112887|Ga0068864_1001128871
Length 219
Sequence MSEGKLIHVVDDDDSVRRSVGFMLKTSGHLVKSYGSGSELLKEAKRLEPGCILLDIRMPGMDGLEVQQELQSLGVNLPVIIMTGHGDIPLSVRAMKAGAIDFIEKPFEKAVLVAAIDEAFSSMSRSDSGRERAKDAIVRLQALTLRERDVLDGLAKGLPNKTIAYDLGISPRTVEIHRANLMSKLEVRSLSEALRLAFAAEEFSNGSVAGTQADTTKYP

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
5 2818991435 Caulobacter henricii 536 Isolate Unclassified
6 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
7 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
8 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
9 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0.24
Rhizoplane 1.2
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1015098 3300001904 Bacteria 1239
2 JGI24741J21665_1000406 3300001915 Bacteria 12985
3 JGI24741J21665_1004306 3300001915 Bacteria 3184
4 JGI24741J21665_1007449 3300001915 Bacteria 2124
5 JGI24741J21665_1007966 3300001915 Bacteria 2024
6 JGI24740J21852_10000582 3300001979 Bacteria 15705
7 JGI24740J21852_10001256 3300001979 Bacteria 11472
8 JGI24740J21852_10001897 3300001979 Bacteria 9577
9 JGI24740J21852_10003809 3300001979 Bacteria 6564
10 JGI24740J21852_10007124 3300001979 Bacteria 4568
11 JGI24740J21852_10042610 3300001979 Bacteria 1359
12 JGI24740J21852_10068613 3300001979 Bacteria 956
13 JGI24740J21852_10076386 3300001979 Bacteria 886
14 JGI24739J22299_10000649 3300001989 Bacteria 12493
15 JGI24739J22299_10006458 3300001989 Bacteria 4427
16 JGI24739J22299_10007428 3300001989 Bacteria 4113
17 JGI24739J22299_10007594 3300001989 Bacteria 4062
18 JGI24739J22299_10015958 3300001989 Bacteria 2725
19 JGI24739J22299_10023731 3300001989 Bacteria 2166
20 JGI24737J22298_10000359 3300001990 Bacteria 15434
21 JGI24737J22298_10002403 3300001990 Bacteria 6677
22 JGI24737J22298_10003444 3300001990 Bacteria 5591
23 JGI24737J22298_10029430 3300001990 Bacteria 1722
24 JGI24737J22298_10032754 3300001990 Bacteria 1617
25 JGI24737J22298_10035489 3300001990 Bacteria 1543
26 JGI24737J22298_10081505 3300001990 Unclassified 963
27 JGI24737J22298_10114029 3300001990 Bacteria 799
28 JGI24737J22298_10115064 3300001990 Bacteria 795
29 JGI24743J22301_10075676 3300001991 Unclassified 706
30 JGI24735J21928_10001154 3300002067 Bacteria 9448
31 JGI24735J21928_10005252 3300002067 Bacteria 4302
32 JGI24735J21928_10039063 3300002067 Bacteria 1388
33 JGI24735J21928_10052235 3300002067 Bacteria 1179
34 JGI24735J21928_10057671 3300002067 Bacteria 1117
35 JGI24735J21928_10082955 3300002067 Bacteria 919
36 JGI24738J21930_10001773 3300002075 Bacteria 5877
37 JGI24738J21930_10039085 3300002075 Unclassified 964
38 JGI24738J21930_10069089 3300002075 Bacteria 731
39 JGI24749J21850_1003662 3300002076 Bacteria 2147
40 JGI24035J26624_1002263 3300002126 Bacteria 1798
41 JGI25153J46596_10000179 3300003215 Bacteria 62415
42 rootL2_10067792 3300003322 Bacteria 4753
43 Ga0070658_10000933 3300005327 Bacteria 25045
44 Ga0070658_10001448 3300005327 Bacteria 20245
45 Ga0070658_10001594 3300005327 Bacteria 19164
46 Ga0070658_10002947 3300005327 Bacteria 14112
47 Ga0070658_10005505 3300005327 Bacteria 10279
48 Ga0070658_10011723 3300005327 Bacteria 7032
49 Ga0070658_10023315 3300005327 Bacteria 4968
50 Ga0070658_10024916 3300005327 Bacteria 4798
51 Ga0070658_10036625 3300005327 Bacteria 3954
52 Ga0070658_10192900 3300005327 Bacteria 1717
53 Ga0070658_10244103 3300005327 Bacteria 1523
54 Ga0070658_10245166 3300005327 Bacteria 1519
55 Ga0070676_10121678 3300005328 Bacteria 1639
56 Ga0070676_10124655 3300005328 Bacteria 1621
57 Ga0070676_10642845 3300005328 Bacteria 769
58 Ga0070683_100032331 3300005329 Bacteria 4764
59 Ga0070683_100048919 3300005329 Bacteria 3909
60 Ga0070683_100060893 3300005329 Bacteria 3509
61 Ga0070690_100150966 3300005330 Bacteria 1585
62 Ga0070670_100022308 3300005331 Bacteria 5450
63 Ga0070670_100033010 3300005331 Bacteria 4461
64 Ga0070670_100222414 3300005331 Bacteria 1643
65 Ga0070670_100686471 3300005331 Bacteria 920
66 Ga0068869_100004802 3300005334 Bacteria 8437
67 Ga0070666_10003680 3300005335 Bacteria 9291
68 Ga0070666_10031129 3300005335 Bacteria 3521
69 Ga0070680_100000576 3300005336 Bacteria 25229
70 Ga0070680_100014315 3300005336 Bacteria 6195
71 Ga0070680_100015212 3300005336 Bacteria 6029
72 Ga0070680_100056854 3300005336 Bacteria 3197
73 Ga0070680_100170823 3300005336 Bacteria 1829
74 Ga0070680_100307676 3300005336 Bacteria 1344
75 Ga0068868_100000839 3300005338 Bacteria 20812
76 Ga0068868_100583937 3300005338 Unclassified 988
77 Ga0070660_100000230 3300005339 Bacteria 37104
78 Ga0070660_100002668 3300005339 Bacteria 12258
79 Ga0070660_100003892 3300005339 Bacteria 10314
80 Ga0070660_100005392 3300005339 Bacteria 8853
81 Ga0070660_100017287 3300005339 Bacteria 5254
82 Ga0070660_100018975 3300005339 Bacteria 5035
83 Ga0070660_100049336 3300005339 Bacteria 3236
84 Ga0070660_100051580 3300005339 Bacteria 3169
85 Ga0070660_100070686 3300005339 Bacteria 2724
86 Ga0070660_100083758 3300005339 Bacteria 2506
87 Ga0070660_100090082 3300005339 Bacteria 2418
88 Ga0070660_100121550 3300005339 Bacteria 2084
89 Ga0070660_100297588 3300005339 Bacteria 1322
90 Ga0070660_100463485 3300005339 Bacteria 1052
91 Ga0070689_100001313 3300005340 Bacteria 15803
92 Ga0070689_100075079 3300005340 Bacteria 2646
93 Ga0070661_100000918 3300005344 Bacteria 21148
94 Ga0070661_100005833 3300005344 Bacteria 8469
95 Ga0070661_100005993 3300005344 Bacteria 8365
96 Ga0070661_100010311 3300005344 Bacteria 6495
97 Ga0070661_100023097 3300005344 Bacteria 4456
98 Ga0070661_100090785 3300005344 Bacteria 2262
99 Ga0070661_100098709 3300005344 Bacteria 2169
100 Ga0070661_100189197 3300005344 Bacteria 1569
101 Ga0070661_100197234 3300005344 Bacteria 1537
102 Ga0070661_100312306 3300005344 Bacteria 1226
103 Ga0070661_100324244 3300005344 Bacteria 1203
104 Ga0070661_100526240 3300005344 Bacteria 949
105 Ga0070661_100598542 3300005344 Bacteria 891
106 Ga0070661_100829115 3300005344 Bacteria 760
107 Ga0070661_101060905 3300005344 Bacteria 674
108 Ga0070692_10001829 3300005345 Bacteria 7973
109 Ga0070692_10003216 3300005345 Bacteria 6576
110 Ga0070692_10004187 3300005345 Bacteria 5981
111 Ga0070692_10012342 3300005345 Bacteria 3951
112 Ga0070668_100006652 3300005347 Bacteria 8570
113 Ga0070668_100026275 3300005347 Bacteria 4417
114 Ga0070668_100151258 3300005347 Bacteria 1877
115 Ga0070668_100896739 3300005347 Unclassified 792
116 Ga0070669_100001226 3300005353 Bacteria 18625
117 Ga0070669_100002670 3300005353 Bacteria 12843
118 Ga0070675_101249026 3300005354 Bacteria 684
119 Ga0070671_100003907 3300005355 Bacteria 11721
120 Ga0070671_100110502 3300005355 Bacteria 2309
121 Ga0070671_100143498 3300005355 Bacteria 2015
122 Ga0070674_100000306 3300005356 Bacteria 24136
123 Ga0070674_100011959 3300005356 Bacteria 5310
124 Ga0070674_100504789 3300005356 Unclassified 1008
125 Ga0070673_100002287 3300005364 Bacteria 11623
126 Ga0070673_100047189 3300005364 Bacteria 3350
127 Ga0070673_100120104 3300005364 Bacteria 2191
128 Ga0070688_100136682 3300005365 Bacteria 1660
129 Ga0070659_100001323 3300005366 Bacteria 17889
130 Ga0070659_100007575 3300005366 Bacteria 7891
131 Ga0070659_100008861 3300005366 Bacteria 7373
132 Ga0070659_100011779 3300005366 Bacteria 6472
133 Ga0070659_100031264 3300005366 Bacteria 4123
134 Ga0070659_100035050 3300005366 Bacteria 3906
135 Ga0070659_100035960 3300005366 Bacteria 3859
136 Ga0070659_100038189 3300005366 Bacteria 3745
137 Ga0070659_100067880 3300005366 Bacteria 2828
138 Ga0070659_100091113 3300005366 Bacteria 2444
139 Ga0070659_100091277 3300005366 Bacteria 2441
140 Ga0070659_100488117 3300005366 Bacteria 1049
141 Ga0070659_100918047 3300005366 Bacteria 766
142 Ga0070667_100014583 3300005367 Bacteria 6496
143 Ga0070667_100034455 3300005367 Bacteria 4236
144 Ga0070667_100058455 3300005367 Bacteria 3260
145 Ga0070667_100375294 3300005367 Bacteria 1291
146 Ga0070663_100000199 3300005455 Bacteria 29919
147 Ga0070663_100002474 3300005455 Bacteria 10425
148 Ga0070663_100004400 3300005455 Bacteria 8278
149 Ga0070663_100014625 3300005455 Bacteria 5042
150 Ga0070663_100070634 3300005455 Bacteria 2540
151 Ga0070663_100114291 3300005455 Bacteria 2032
152 Ga0070663_100149413 3300005455 Bacteria 1790
153 Ga0070663_100221452 3300005455 Bacteria 1486
154 Ga0070663_100402445 3300005455 Bacteria 1119
155 Ga0070678_100000647 3300005456 Bacteria 17026
156 Ga0070662_100001976 3300005457 Bacteria 12588
157 Ga0070662_100007810 3300005457 Bacteria 6950
158 Ga0070662_100015656 3300005457 Bacteria 5084
159 Ga0070662_100032436 3300005457 Bacteria 3671
160 Ga0070662_100049743 3300005457 Bacteria 3023
161 Ga0070662_100460339 3300005457 Bacteria 1057
162 Ga0070681_10022649 3300005458 Bacteria 6310
163 Ga0070681_10034155 3300005458 Bacteria 5108
164 Ga0070681_10054733 3300005458 Bacteria 3976
165 Ga0070681_10077070 3300005458 Bacteria 3292
166 Ga0070681_10249862 3300005458 Bacteria 1686
167 Ga0070681_10353997 3300005458 Bacteria 1378
168 Ga0068867_100002768 3300005459 Bacteria 12350
169 Ga0068867_100352502 3300005459 Bacteria 1228
170 Ga0068867_100356926 3300005459 Unclassified 1221
171 Ga0070685_10000391 3300005466 Bacteria 26284
172 Ga0070679_100006348 3300005530 Bacteria 11005
173 Ga0070679_100060615 3300005530 Bacteria 3770
174 Ga0070679_100323217 3300005530 Bacteria 1492
175 Ga0070679_100519647 3300005530 Unclassified 1134
176 Ga0070684_100057467 3300005535 Bacteria 3397
177 Ga0070684_100096617 3300005535 Bacteria 2634
178 Ga0070684_100124476 3300005535 Bacteria 2321
179 Ga0070684_101024806 3300005535 Bacteria 775
180 Ga0068853_100000058 3300005539 Bacteria 78682
181 Ga0068853_100000413 3300005539 Bacteria 29440
182 Ga0068853_100001611 3300005539 Bacteria 16464
183 Ga0068853_100027433 3300005539 Bacteria 4784
184 Ga0068853_100039082 3300005539 Bacteria 4046
185 Ga0068853_100048058 3300005539 Bacteria 3663
186 Ga0068853_100048919 3300005539 Bacteria 3632
187 Ga0070672_100080160 3300005543 Bacteria 2615
188 Ga0070686_100176090 3300005544 Bacteria 1516
189 Ga0070693_100047858 3300005547 Bacteria 2434
190 Ga0070665_100000019 3300005548 Bacteria 413972
191 Ga0070665_100002091 3300005548 Bacteria 22383
192 Ga0070665_100002939 3300005548 Bacteria 18407
193 Ga0070665_100104101 3300005548 Bacteria 2841
194 Ga0070665_100436799 3300005548 Bacteria 1318
195 Ga0070665_100522029 3300005548 Bacteria 1199
196 Ga0068855_100004526 3300005563 Bacteria 16985
197 Ga0068855_100017413 3300005563 Bacteria 8643
198 Ga0068855_100039453 3300005563 Bacteria 5606
199 Ga0068855_100043676 3300005563 Bacteria 5307
200 Ga0068855_100102538 3300005563 Bacteria 3293
201 Ga0068855_100382922 3300005563 Bacteria 1544
202 Ga0068855_101258268 3300005563 Bacteria 767
203 Ga0070664_100007094 3300005564 Bacteria 9040
204 Ga0070664_100031546 3300005564 Bacteria 4428
205 Ga0070664_100053211 3300005564 Bacteria 3431
206 Ga0070664_100068694 3300005564 Bacteria 3030
207 Ga0070664_100070104 3300005564 Bacteria 3001
208 Ga0070664_100484562 3300005564 Bacteria 1138
209 Ga0070664_100628809 3300005564 Bacteria 997
210 Ga0068857_100001206 3300005577 Bacteria 20155
211 Ga0068857_100005053 3300005577 Bacteria 11208
212 Ga0068857_100006083 3300005577 Bacteria 10308
213 Ga0068857_100056704 3300005577 Bacteria 3477
214 Ga0068857_100074880 3300005577 Bacteria 3018
215 Ga0068857_100144897 3300005577 Bacteria 2149
216 Ga0068857_100598053 3300005577 Bacteria 1042
217 Ga0068854_100004180 3300005578 Bacteria 9084
218 Ga0068854_100004889 3300005578 Bacteria 8454
219 Ga0068854_100028496 3300005578 Bacteria 3859
220 Ga0068854_100068236 3300005578 Bacteria 2592
221 Ga0068854_100093222 3300005578 Bacteria 2244
222 Ga0068854_100160141 3300005578 Bacteria 1742
223 Ga0068854_100277703 3300005578 Bacteria 1347
224 Ga0068854_100389464 3300005578 Bacteria 1150
225 Ga0068856_100006069 3300005614 Bacteria 11869
226 Ga0068856_100010677 3300005614 Bacteria 8923
227 Ga0068856_100012407 3300005614 Bacteria 8252
228 Ga0068856_100013223 3300005614 Bacteria 7993
229 Ga0068856_100014855 3300005614 Bacteria 7515
230 Ga0068856_100024005 3300005614 Bacteria 5932
231 Ga0068856_100030220 3300005614 Bacteria 5296
232 Ga0068856_100031032 3300005614 Bacteria 5227
233 Ga0068856_100048118 3300005614 Bacteria 4201
234 Ga0068856_100065694 3300005614 Bacteria 3585
235 Ga0068856_100144459 3300005614 Bacteria 2387
236 Ga0068856_101153146 3300005614 Bacteria 792
237 Ga0070702_100293531 3300005615 Unclassified 1121
238 Ga0068852_100001904 3300005616 Bacteria 14203
239 Ga0068852_100002370 3300005616 Bacteria 12984
240 Ga0068852_100041832 3300005616 Bacteria 3876
241 Ga0068852_100042340 3300005616 Bacteria 3855
242 Ga0068852_100048607 3300005616 Bacteria 3625
243 Ga0068852_100081949 3300005616 Bacteria 2866
244 Ga0068852_100130080 3300005616 Bacteria 2317
245 Ga0068852_100180741 3300005616 Bacteria 1983
246 Ga0068852_100362997 3300005616 Bacteria 1417
247 Ga0068852_100406317 3300005616 Bacteria 1340
248 Ga0068859_100003976 3300005617 Bacteria 15085
249 Ga0068859_100009320 3300005617 Bacteria 9910
250 Ga0068859_100037383 3300005617 Bacteria 4872
251 Ga0068859_100049223 3300005617 Bacteria 4233
252 Ga0068859_100265293 3300005617 Bacteria 1809
253 Ga0068859_101278750 3300005617 Bacteria 808
254 Ga0068864_100004350 3300005618 Bacteria 11623
255 Ga0068864_100112887 3300005618 Bacteria 2422
256 Ga0068861_100046869 3300005719 Bacteria 3261
257 Ga0068851_10009974 3300005834 Bacteria 4422
258 Ga0068851_10012161 3300005834 Bacteria 4053
259 Ga0068851_10051335 3300005834 Bacteria 2095
260 Ga0068851_10153592 3300005834 Bacteria 1260
261 Ga0068863_100004491 3300005841 Bacteria 13762
262 Ga0068863_100036130 3300005841 Bacteria 4706
263 Ga0068863_100734767 3300005841 Bacteria 982
264 Ga0068858_100009449 3300005842 Bacteria 9300
265 Ga0068858_100026457 3300005842 Bacteria 5389
266 Ga0068858_100121833 3300005842 Bacteria 2439
267 Ga0068860_100005610 3300005843 Bacteria 12679
268 Ga0068860_101181669 3300005843 Bacteria 785
269 Ga0068862_100000288 3300005844 Bacteria 55742
270 Ga0068862_100005735 3300005844 Bacteria 10365
271 Ga0075369_10005258 3300006186 Bacteria 4826
272 Ga0075366_10033709 3300006195 Bacteria 3017
273 Ga0075370_10118213 3300006353 Bacteria 1542
274 Ga0075370_10355832 3300006353 Bacteria 875
275 Ga0068871_100022940 3300006358 Bacteria 4819
276 Ga0068871_100048737 3300006358 Bacteria 3421
277 Ga0068865_100024042 3300006881 Bacteria 3994
278 Ga0097620_100003976 3300006931 Bacteria 15085
279 Ga0097620_100009320 3300006931 Bacteria 9910
280 Ga0097620_100037382 3300006931 Bacteria 4872
281 Ga0097620_100049222 3300006931 Bacteria 4233
282 Ga0097620_100265272 3300006931 Bacteria 1809
283 Ga0097620_101278727 3300006931 Bacteria 808
284 Ga0105240_10016809 3300009093 Bacteria 9894
285 Ga0105240_10545399 3300009093 Bacteria 1284
286 Ga0105245_10002373 3300009098 Bacteria 17035
287 Ga0114129_11104147 3300009147 Bacteria 993
288 Ga0105243_10002259 3300009148 Bacteria 16200
289 Ga0105243_10010913 3300009148 Bacteria 6872
290 Ga0105241_10010786 3300009174 Bacteria 6703
291 Ga0105241_10037405 3300009174 Bacteria 3656
292 Ga0105241_10219426 3300009174 Bacteria 1597
293 Ga0105241_10276532 3300009174 Bacteria 1432
294 Ga0105241_10362571 3300009174 Bacteria 1261
295 Ga0105248_10001628 3300009177 Bacteria 24943
296 Ga0105248_10004474 3300009177 Bacteria 15469
297 Ga0105248_10040031 3300009177 Bacteria 5253
298 Ga0105248_10041910 3300009177 Bacteria 5133
299 Ga0105237_10077251 3300009545 Bacteria 3320
300 Ga0105237_10159389 3300009545 Bacteria 2254
301 Ga0105237_10197955 3300009545 Bacteria 2009
302 Ga0105238_10028444 3300009551 Bacteria 5694
303 Ga0105238_10111830 3300009551 Bacteria 2711
304 Ga0105238_10324094 3300009551 Bacteria 1527
305 Ga0105238_10595169 3300009551 Bacteria 1113
306 Ga0105249_10304889 3300009553 Bacteria 1599
307 Ga0105239_10026042 3300010375 Bacteria 6440
308 Ga0105239_10136033 3300010375 Bacteria 2736
309 Ga0105239_11515061 3300010375 Bacteria 775
310 Ga0157326_1000007 3300012513 Bacteria 17180
311 Ga0157373_10014697 3300013100 Bacteria 5735
312 Ga0157373_10021218 3300013100 Bacteria 4715
313 Ga0157373_10028700 3300013100 Bacteria 4013
314 Ga0157373_10042823 3300013100 Bacteria 3235
315 Ga0157373_10068818 3300013100 Bacteria 2502
316 Ga0157373_10078403 3300013100 Bacteria 2329
317 Ga0157373_10089016 3300013100 Bacteria 2174
318 Ga0157373_10161804 3300013100 Bacteria 1575
319 Ga0157373_10178091 3300013100 Bacteria 1497
320 Ga0157371_10000183 3300013102 Bacteria 92426
321 Ga0157371_10005519 3300013102 Bacteria 10646
322 Ga0157371_10010590 3300013102 Bacteria 7165
323 Ga0157371_10015181 3300013102 Bacteria 5784
324 Ga0157371_10017589 3300013102 Bacteria 5307
325 Ga0157371_10027950 3300013102 Bacteria 4087
326 Ga0157371_10055135 3300013102 Bacteria 2821
327 Ga0157371_10060404 3300013102 Bacteria 2688
328 Ga0157371_10086368 3300013102 Bacteria 2222
329 Ga0157371_10331777 3300013102 Bacteria 1105
330 Ga0157370_10001246 3300013104 Bacteria 31790
331 Ga0157370_10007548 3300013104 Bacteria 11815
332 Ga0157370_10011496 3300013104 Bacteria 9249
333 Ga0157370_10016422 3300013104 Bacteria 7495
334 Ga0157370_10020885 3300013104 Bacteria 6533
335 Ga0157370_10031146 3300013104 Bacteria 5220
336 Ga0157370_10047657 3300013104 Bacteria 4107
337 Ga0157370_10048306 3300013104 Bacteria 4077
338 Ga0157370_10076230 3300013104 Bacteria 3159
339 Ga0157370_10083023 3300013104 Bacteria 3013
340 Ga0157370_10602159 3300013104 Bacteria 1006
341 Ga0157370_10669634 3300013104 Bacteria 948
342 Ga0157369_10000553 3300013105 Bacteria 49107
343 Ga0157369_10010995 3300013105 Bacteria 10302
344 Ga0157369_10013284 3300013105 Bacteria 9318
345 Ga0157369_10030710 3300013105 Bacteria 5924
346 Ga0157369_10032219 3300013105 Bacteria 5765
347 Ga0157369_10033190 3300013105 Bacteria 5675
348 Ga0157369_10038473 3300013105 Bacteria 5230
349 Ga0157369_10111201 3300013105 Bacteria 2912
350 Ga0157369_10116168 3300013105 Bacteria 2842
351 Ga0157369_10175866 3300013105 Bacteria 2254
352 Ga0157369_10203035 3300013105 Bacteria 2080
353 Ga0157369_10270741 3300013105 Bacteria 1770
354 Ga0157369_10425953 3300013105 Unclassified 1376
355 Ga0157374_10002140 3300013296 Bacteria 16643
356 Ga0157374_10030799 3300013296 Bacteria 4873
357 Ga0157374_10687002 3300013296 Bacteria 1036
358 Ga0157378_10011273 3300013297 Bacteria 7822
359 Ga0163162_10019610 3300013306 Bacteria 6638
360 Ga0157372_10013964 3300013307 Bacteria 8581
361 Ga0157372_10076529 3300013307 Bacteria 3778
362 Ga0157372_10083458 3300013307 Bacteria 3619
363 Ga0157372_10090330 3300013307 Bacteria 3482
364 Ga0157372_10101849 3300013307 Bacteria 3279
365 Ga0157372_10214308 3300013307 Bacteria 2232
366 Ga0157372_10384078 3300013307 Bacteria 1636
367 Ga0157375_10336573 3300013308 Bacteria 1674
368 Ga0163163_10518283 3300014325 Bacteria 1254
369 Ga0157380_10002492 3300014326 Bacteria 12415
370 Ga0157380_10189302 3300014326 Bacteria 1815
371 Ga0157379_10032636 3300014968 Bacteria 4643
372 Ga0157376_10139925 3300014969 Bacteria 2170
373 Ga0209455_1025473 3300025272 Bacteria 1075
374 Ga0209673_1045715 3300025273 Bacteria 1200
375 Ga0209758_1000007 3300025297 Bacteria 1270410
376 Ga0209257_1005853 3300025304 Bacteria 8323
377 Ga0207697_10000694 3300025315 Bacteria 19123
378 Ga0207656_10004017 3300025321 Bacteria 5104
379 Ga0207656_10010021 3300025321 Bacteria 3533
380 Ga0207656_10011531 3300025321 Bacteria 3340
381 Ga0207710_10001187 3300025900 Bacteria 13232
382 Ga0207688_10155701 3300025901 Unclassified 1352
383 Ga0207680_10029223 3300025903 Bacteria 3094
384 Ga0207647_10001132 3300025904 Bacteria 20537
385 Ga0207647_10003070 3300025904 Bacteria 12553
386 Ga0207647_10003287 3300025904 Bacteria 12138
387 Ga0207647_10004576 3300025904 Bacteria 10248
388 Ga0207647_10009755 3300025904 Bacteria 6814
389 Ga0207647_10015919 3300025904 Bacteria 5145
390 Ga0207647_10024721 3300025904 Bacteria 3959
391 Ga0207647_10025198 3300025904 Bacteria 3912
392 Ga0207647_10035713 3300025904 Bacteria 3165
393 Ga0207647_10049916 3300025904 Bacteria 2593
394 Ga0207647_10051636 3300025904 Bacteria 2540
395 Ga0207647_10060953 3300025904 Bacteria 2304
396 Ga0207647_10077571 3300025904 Bacteria 1997
397 Ga0207647_10190022 3300025904 Bacteria 1190
398 Ga0207645_10074766 3300025907 Bacteria 2169
399 Ga0207645_10126339 3300025907 Bacteria 1662
400 Ga0207645_10307139 3300025907 Bacteria 1057
401 Ga0207705_10000060 3300025909 Bacteria 152576
402 Ga0207705_10000569 3300025909 Bacteria 30895
403 Ga0207705_10000664 3300025909 Bacteria 28582
404 Ga0207705_10001019 3300025909 Bacteria 22717
405 Ga0207705_10001550 3300025909 Bacteria 18229
406 Ga0207705_10005773 3300025909 Bacteria 9229
407 Ga0207705_10008785 3300025909 Bacteria 7365
408 Ga0207705_10015149 3300025909 Bacteria 5542
409 Ga0207705_10031672 3300025909 Bacteria 3776
410 Ga0207705_10043642 3300025909 Bacteria 3221
411 Ga0207705_10111888 3300025909 Bacteria 2018
412 Ga0207705_10126606 3300025909 Bacteria 1899
413 Ga0207705_10167039 3300025909 Bacteria 1655
414 Ga0207705_10198636 3300025909 Bacteria 1519
415 Ga0207705_10280163 3300025909 Bacteria 1276
416 Ga0207654_10015216 3300025911 Bacteria 3988
417 Ga0207654_10043876 3300025911 Bacteria 2537
418 Ga0207707_10060794 3300025912 Bacteria 3286
419 Ga0207707_10106843 3300025912 Bacteria 2447
420 Ga0207707_10121131 3300025912 Bacteria 2287
421 Ga0207695_10003088 3300025913 Bacteria 23842
422 Ga0207695_10008652 3300025913 Bacteria 12706
423 Ga0207695_10009791 3300025913 Bacteria 11783
424 Ga0207695_10090117 3300025913 Bacteria 3083
425 Ga0207671_10005583 3300025914 Bacteria 11553
426 Ga0207671_10007141 3300025914 Bacteria 9745
427 Ga0207671_10269445 3300025914 Bacteria 1341
428 Ga0207660_10000159 3300025917 Bacteria 42039
429 Ga0207660_10012145 3300025917 Bacteria 5629
430 Ga0207660_10012886 3300025917 Bacteria 5476
431 Ga0207660_10085815 3300025917 Bacteria 2323
432 Ga0207660_10130730 3300025917 Bacteria 1911
433 Ga0207657_10000675 3300025919 Bacteria 36346
434 Ga0207657_10001311 3300025919 Bacteria 26393
435 Ga0207657_10002365 3300025919 Bacteria 20396
436 Ga0207657_10002554 3300025919 Bacteria 19692
437 Ga0207657_10002990 3300025919 Bacteria 18116
438 Ga0207657_10003648 3300025919 Bacteria 16390
439 Ga0207657_10006404 3300025919 Bacteria 12216
440 Ga0207657_10008069 3300025919 Bacteria 10737
441 Ga0207657_10053279 3300025919 Bacteria 3505
442 Ga0207657_10086405 3300025919 Bacteria 2625
443 Ga0207657_10142997 3300025919 Bacteria 1953
444 Ga0207657_10161439 3300025919 Bacteria 1820
445 Ga0207657_10177796 3300025919 Bacteria 1721
446 Ga0207657_10213544 3300025919 Bacteria 1548
447 Ga0207657_10294354 3300025919 Bacteria 1287
448 Ga0207657_10339531 3300025919 Bacteria 1186
449 Ga0207657_10464052 3300025919 Bacteria 993
450 Ga0207657_10522619 3300025919 Bacteria 929
451 Ga0207657_10783019 3300025919 Bacteria 738
452 Ga0207649_10000826 3300025920 Bacteria 19904
453 Ga0207649_10002343 3300025920 Bacteria 10622
454 Ga0207649_10003549 3300025920 Bacteria 8527
455 Ga0207649_10055301 3300025920 Bacteria 2473
456 Ga0207649_10077114 3300025920 Bacteria 2146
457 Ga0207649_10098037 3300025920 Bacteria 1934
458 Ga0207649_10444934 3300025920 Bacteria 977
459 Ga0207649_10493155 3300025920 Bacteria 931
460 Ga0207649_10590275 3300025920 Bacteria 853
461 Ga0207652_10000356 3300025921 Bacteria 47404
462 Ga0207652_10284000 3300025921 Bacteria 1493
463 Ga0207652_10479558 3300025921 Bacteria 1120
464 Ga0207652_10775880 3300025921 Bacteria 852
465 Ga0207681_10000045 3300025923 Bacteria 128454
466 Ga0207681_10003678 3300025923 Bacteria 9534
467 Ga0207694_10005230 3300025924 Bacteria 10017
468 Ga0207694_10021557 3300025924 Bacteria 4883
469 Ga0207694_10066073 3300025924 Bacteria 2821
470 Ga0207694_10255689 3300025924 Bacteria 1434
471 Ga0207650_10009279 3300025925 Bacteria 6721
472 Ga0207650_10053822 3300025925 Bacteria 2984
473 Ga0207650_10076614 3300025925 Bacteria 2527
474 Ga0207650_10098895 3300025925 Bacteria 2242
475 Ga0207687_10007358 3300025927 Bacteria 7260
476 Ga0207644_10013142 3300025931 Bacteria 5511
477 Ga0207644_10028583 3300025931 Bacteria 3862
478 Ga0207644_10071346 3300025931 Bacteria 2541
479 Ga0207644_10202153 3300025931 Unclassified 1568
480 Ga0207690_10001355 3300025932 Bacteria 15367
481 Ga0207690_10006516 3300025932 Bacteria 6920
482 Ga0207690_10008364 3300025932 Bacteria 6141
483 Ga0207690_10009151 3300025932 Bacteria 5879
484 Ga0207690_10009662 3300025932 Bacteria 5727
485 Ga0207690_10028740 3300025932 Bacteria 3526
486 Ga0207690_10054854 3300025932 Bacteria 2681
487 Ga0207690_10105001 3300025932 Bacteria 2025
488 Ga0207690_10124615 3300025932 Bacteria 1877
489 Ga0207690_10125398 3300025932 Bacteria 1871
490 Ga0207690_10137962 3300025932 Bacteria 1793
491 Ga0207690_10335516 3300025932 Bacteria 1192
492 Ga0207690_10355118 3300025932 Bacteria 1160
493 Ga0207706_10001571 3300025933 Bacteria 22653
494 Ga0207706_10001910 3300025933 Bacteria 20460
495 Ga0207706_10015303 3300025933 Bacteria 6935
496 Ga0207706_10026568 3300025933 Bacteria 5181
497 Ga0207706_10034791 3300025933 Bacteria 4482
498 Ga0207706_10064610 3300025933 Bacteria 3222
499 Ga0207706_10067668 3300025933 Bacteria 3143
500 Ga0207706_10484084 3300025933 Bacteria 1069
501 Ga0207706_10621496 3300025933 Bacteria 927
502 Ga0207709_10000202 3300025935 Bacteria 78416
503 Ga0207709_10017933 3300025935 Bacteria 3959
504 Ga0207670_10000902 3300025936 Bacteria 15670
505 Ga0207669_10000150 3300025937 Bacteria 33077
506 Ga0207669_10000313 3300025937 Bacteria 22156
507 Ga0207704_10016383 3300025938 Bacteria 3808
508 Ga0207711_10006753 3300025941 Bacteria 9647
509 Ga0207711_10007900 3300025941 Bacteria 8899
510 Ga0207711_10009331 3300025941 Bacteria 8191
511 Ga0207711_10025316 3300025941 Bacteria 4979
512 Ga0207711_10112868 3300025941 Bacteria 2419
513 Ga0207689_10002135 3300025942 Bacteria 18609
514 Ga0207661_10048548 3300025944 Bacteria 3374
515 Ga0207661_10084487 3300025944 Bacteria 2629
516 Ga0207661_10101509 3300025944 Bacteria 2417
517 Ga0207679_10005153 3300025945 Bacteria 8184
518 Ga0207679_10077739 3300025945 Bacteria 2526
519 Ga0207679_10084947 3300025945 Bacteria 2430
520 Ga0207679_10209368 3300025945 Bacteria 1634
521 Ga0207679_10328847 3300025945 Bacteria 1326
522 Ga0207667_10000107 3300025949 Bacteria 133066
523 Ga0207667_10005823 3300025949 Bacteria 15024
524 Ga0207667_10020276 3300025949 Bacteria 7399
525 Ga0207667_10026493 3300025949 Bacteria 6333
526 Ga0207667_10043803 3300025949 Bacteria 4747
527 Ga0207667_10080132 3300025949 Bacteria 3383
528 Ga0207667_10122056 3300025949 Bacteria 2685
529 Ga0207667_10243254 3300025949 Bacteria 1841
530 Ga0207667_10310118 3300025949 Bacteria 1612
531 Ga0207651_10002056 3300025960 Bacteria 9473
532 Ga0207651_10912754 3300025960 Unclassified 782
533 Ga0207668_10037343 3300025972 Bacteria 3250
534 Ga0207668_10239876 3300025972 Bacteria 1466
535 Ga0207668_10782088 3300025972 Bacteria 844
536 Ga0207668_11057988 3300025972 Bacteria 726
537 Ga0207640_10000668 3300025981 Bacteria 20054
538 Ga0207640_10001164 3300025981 Bacteria 14432
539 Ga0207640_10007849 3300025981 Bacteria 5889
540 Ga0207640_10022354 3300025981 Bacteria 3783
541 Ga0207640_10263161 3300025981 Bacteria 1345
542 Ga0207640_10316215 3300025981 Bacteria 1241
543 Ga0207640_10337896 3300025981 Bacteria 1205
544 Ga0207640_10452631 3300025981 Bacteria 1058
545 Ga0207640_10502149 3300025981 Bacteria 1010
546 Ga0207640_11045711 3300025981 Bacteria 720
547 Ga0207658_10005842 3300025986 Bacteria 8416
548 Ga0207658_10023352 3300025986 Bacteria 4317
549 Ga0207658_10079910 3300025986 Bacteria 2503
550 Ga0207677_10006561 3300026023 Bacteria 6388
551 Ga0207703_10000888 3300026035 Bacteria 29349
552 Ga0207703_10005591 3300026035 Bacteria 10093
553 Ga0207703_10027992 3300026035 Bacteria 4438
554 Ga0207639_10000089 3300026041 Bacteria 77190
555 Ga0207639_10000445 3300026041 Bacteria 28582
556 Ga0207639_10004048 3300026041 Bacteria 9888
557 Ga0207639_10033050 3300026041 Bacteria 3813
558 Ga0207639_10037987 3300026041 Bacteria 3579
559 Ga0207639_10055385 3300026041 Bacteria 3035
560 Ga0207639_10245811 3300026041 Bacteria 1558
561 Ga0207639_10262244 3300026041 Bacteria 1512
562 Ga0207678_10000325 3300026067 Bacteria 42910
563 Ga0207678_10000472 3300026067 Bacteria 36426
564 Ga0207678_10002221 3300026067 Bacteria 17540
565 Ga0207678_10004571 3300026067 Bacteria 12450
566 Ga0207678_10005785 3300026067 Bacteria 11025
567 Ga0207678_10008840 3300026067 Bacteria 8868
568 Ga0207678_10031492 3300026067 Bacteria 4627
569 Ga0207678_10037465 3300026067 Bacteria 4217
570 Ga0207678_10118630 3300026067 Bacteria 2258
571 Ga0207678_10202190 3300026067 Bacteria 1699
572 Ga0207678_10219107 3300026067 Bacteria 1629
573 Ga0207678_10471784 3300026067 Bacteria 1092
574 Ga0207678_10543176 3300026067 Bacteria 1016
575 Ga0207702_10004172 3300026078 Bacteria 12940
576 Ga0207702_10004252 3300026078 Bacteria 12781
577 Ga0207702_10005497 3300026078 Bacteria 11083
578 Ga0207702_10005581 3300026078 Bacteria 10984
579 Ga0207702_10006296 3300026078 Bacteria 10254
580 Ga0207702_10039821 3300026078 Bacteria 3940
581 Ga0207702_10115622 3300026078 Bacteria 2393
582 Ga0207702_10359829 3300026078 Bacteria 1394
583 Ga0207702_10878182 3300026078 Bacteria 888
584 Ga0207702_11130995 3300026078 Bacteria 777
585 Ga0207641_10001052 3300026088 Bacteria 27867
586 Ga0207641_10026570 3300026088 Bacteria 4779
587 Ga0207641_10030146 3300026088 Bacteria 4492
588 Ga0207648_10002331 3300026089 Bacteria 20497
589 Ga0207648_10290950 3300026089 Bacteria 1463
590 Ga0207648_10405031 3300026089 Unclassified 1237
591 Ga0207648_11034473 3300026089 Bacteria 769
592 Ga0207676_10003527 3300026095 Bacteria 11071
593 Ga0207676_10358938 3300026095 Unclassified 1350
594 Ga0207674_10009370 3300026116 Bacteria 11198
595 Ga0207674_10010679 3300026116 Bacteria 10381
596 Ga0207674_10032651 3300026116 Bacteria 5457
597 Ga0207674_10037113 3300026116 Bacteria 5071
598 Ga0207674_10059155 3300026116 Bacteria 3879
599 Ga0207674_10098330 3300026116 Bacteria 2910
600 Ga0207674_10132721 3300026116 Bacteria 2453
601 Ga0207674_10234663 3300026116 Bacteria 1782
602 Ga0207674_10678919 3300026116 Bacteria 994
603 Ga0207675_100073363 3300026118 Bacteria 3202
604 Ga0207675_100413943 3300026118 Bacteria 1330
605 Ga0207675_101288415 3300026118 Bacteria 751
606 Ga0207683_10002303 3300026121 Bacteria 16747
607 Ga0207698_10000851 3300026142 Bacteria 17710
608 Ga0207698_10011452 3300026142 Bacteria 5753
609 Ga0207698_10034866 3300026142 Bacteria 3674
610 Ga0207698_10040676 3300026142 Bacteria 3457
611 Ga0207698_10051001 3300026142 Bacteria 3161
612 Ga0207698_10056929 3300026142 Bacteria 3021
613 Ga0207698_10122137 3300026142 Bacteria 2207
614 Ga0207698_10310029 3300026142 Bacteria 1473
615 Ga0207698_10312868 3300026142 Unclassified 1467
616 Ga0207698_10528276 3300026142 Bacteria 1153
617 Ga0207698_10848601 3300026142 Bacteria 918
618 Ga0209281_1010093 3300027111 Bacteria 2180
619 Ga0209971_1050417 3300027682 Bacteria 1006
620 Ga0209974_10006250 3300027876 Bacteria 4165
621 Ga0268266_10000025 3300028379 Bacteria 477143
622 Ga0268266_10002857 3300028379 Bacteria 17994
623 Ga0268266_10003721 3300028379 Bacteria 15009
624 Ga0268266_10303985 3300028379 Bacteria 1489
625 Ga0268265_10000049 3300028380 Bacteria 177242
626 Ga0268265_10006354 3300028380 Bacteria 8011
627 Ga0268265_10217891 3300028380 Bacteria 1668
628 Ga0268264_10053449 3300028381 Bacteria 3370
629 Ga0268264_10061876 3300028381 Bacteria 3141
630 Ga0268264_10960773 3300028381 Bacteria 860
631 Ga0307408_100020742 3300031548 Bacteria 4439
632 Ga0307408_100162073 3300031548 Bacteria 1777
633 Ga0307408_100502670 3300031548 Bacteria 1061
634 Ga0307405_10026575 3300031731 Bacteria 3342
635 Ga0307405_10040305 3300031731 Bacteria 2828
636 Ga0307405_10057509 3300031731 Bacteria 2443
637 Ga0307405_10157246 3300031731 Bacteria 1605
638 Ga0307405_10604044 3300031731 Bacteria 896
639 Ga0307405_10705112 3300031731 Bacteria 836
640 Ga0307413_10008058 3300031824 Bacteria 4944
641 Ga0307413_10011086 3300031824 Bacteria 4411
642 Ga0307413_10532545 3300031824 Bacteria 949
643 Ga0307413_10811630 3300031824 Bacteria 787
644 Ga0307410_10002760 3300031852 Bacteria 8586
645 Ga0307410_10018209 3300031852 Bacteria 4239
646 Ga0307410_10101644 3300031852 Bacteria 2061
647 Ga0307410_10233997 3300031852 Bacteria 1420
648 Ga0307406_10038166 3300031901 Bacteria 2972
649 Ga0307406_10083056 3300031901 Bacteria 2135
650 Ga0307406_10108720 3300031901 Bacteria 1904
651 Ga0307406_10136530 3300031901 Bacteria 1729
652 Ga0307406_10562699 3300031901 Bacteria 934
653 Ga0307406_11063874 3300031901 Bacteria 697
654 Ga0307407_10037822 3300031903 Bacteria 2669
655 Ga0307407_10150840 3300031903 Bacteria 1510
656 Ga0307412_10011454 3300031911 Bacteria 5140
657 Ga0307412_10048793 3300031911 Bacteria 2786
658 Ga0307412_10053566 3300031911 Bacteria 2675
659 Ga0307412_10132027 3300031911 Bacteria 1815
660 Ga0307412_10187406 3300031911 Bacteria 1561
661 Ga0307412_10359153 3300031911 Bacteria 1172
662 Ga0307409_100019223 3300031995 Bacteria 4619
663 Ga0307409_100577253 3300031995 Bacteria 1108
664 Ga0307416_100030857 3300032002 Bacteria 4028
665 Ga0307416_100128988 3300032002 Bacteria 2271
666 Ga0307416_100151048 3300032002 Bacteria 2130
667 Ga0307416_100169095 3300032002 Bacteria 2032
668 Ga0307416_100186381 3300032002 Bacteria 1951
669 Ga0307416_100513157 3300032002 Bacteria 1265
670 Ga0307416_100675791 3300032002 Bacteria 1120
671 Ga0307416_100798677 3300032002 Bacteria 1039
672 Ga0307414_10015215 3300032004 Bacteria 4639
673 Ga0307414_10072059 3300032004 Bacteria 2494
674 Ga0307414_10476343 3300032004 Bacteria 1100
675 Ga0307414_11328624 3300032004 Bacteria 667
676 Ga0307411_10003616 3300032005 Bacteria 7223
677 Ga0307411_10022362 3300032005 Bacteria 3721
678 Ga0307411_10140891 3300032005 Bacteria 1778
679 Ga0307411_10211584 3300032005 Bacteria 1497
680 Ga0307415_100027655 3300032126 Bacteria 3596
681 Ga0307415_100031241 3300032126 Bacteria 3428
682 Ga0307415_100034568 3300032126 Bacteria 3292
683 Ga0307415_100064401 3300032126 Bacteria 2550
684 Ga0307415_100070475 3300032126 Bacteria 2455
685 Ga0307510_10014402 3300033180 Bacteria 9364
686 Ga0395899_0000162 3300037312 Bacteria 102362
687 Ga0395899_0001034 3300037312 Bacteria 25336
688 Ga0395899_0001223 3300037312 Bacteria 22492
689 Ga0395899_0021918 3300037312 Bacteria 4845
690 Ga0395899_0029587 3300037312 Bacteria 4120
691 Ga0395899_0033667 3300037312 Bacteria 3847
692 Ga0395899_0039870 3300037312 Bacteria 3514
693 Ga0395899_0053773 3300037312 Bacteria 2980
694 Ga0395899_0057522 3300037312 Bacteria 2870
695 Ga0395899_0069083 3300037312 Bacteria 2588
696 Ga0395899_0469434 3300037312 Bacteria 821
697 Ga0395900_0000129 3300037418 Bacteria 126281
698 Ga0395900_0001095 3300037418 Bacteria 34481
699 Ga0395900_0002600 3300037418 Bacteria 19734
700 Ga0395900_0004245 3300037418 Bacteria 15205
701 Ga0395900_0043389 3300037418 Bacteria 4635
702 Ga0395900_0043895 3300037418 Bacteria 4607
703 Ga0395900_0046175 3300037418 Bacteria 4485
704 Ga0395900_0077032 3300037418 Bacteria 3426
705 Ga0395900_0089711 3300037418 Bacteria 3160
706 Ga0395900_0126054 3300037418 Bacteria 2626
707 Ga0395900_0214720 3300037418 Bacteria 1942
708 Ga0395900_0229497 3300037418 Bacteria 1867
709 Ga0395900_0257083 3300037418 Bacteria 1745
710 Ga0395900_0363334 3300037418 Bacteria 1418
711 Ga0395900_0462389 3300037418 Bacteria 1223
712 Ga0395900_0480734 3300037418 Bacteria 1194
713 Ga0395900_0540886 3300037418 Bacteria 1110
714 Ga0395900_0735568 3300037418 Bacteria 918
715 Ga0395900_0880799 3300037418 Bacteria 819
716 Ga0395898_0001192 3300037466 Bacteria 39339
717 Ga0395898_0002741 3300037466 Bacteria 20324
718 Ga0395898_0019893 3300037466 Bacteria 6826
719 Ga0395898_0040419 3300037466 Bacteria 4611
720 Ga0395898_0068167 3300037466 Bacteria 3443
721 Ga0395898_0082184 3300037466 Bacteria 3105
722 Ga0395898_0083186 3300037466 Bacteria 3085
723 Ga0395898_0178156 3300037466 Bacteria 2031
724 Ga0395898_0288141 3300037466 Bacteria 1566
725 Ga0395898_0301807 3300037466 Bacteria 1527
726 Ga0395898_0939881 3300037466 Bacteria 802
727 Ga0395905_0029181 3300037471 Bacteria 5199
728 Ga0395905_0045319 3300037471 Bacteria 4124
729 Ga0395905_0052769 3300037471 Bacteria 3806
730 Ga0395905_0054162 3300037471 Bacteria 3754
731 Ga0395905_0101435 3300037471 Bacteria 2702
732 Ga0395905_0101716 3300037471 Bacteria 2697
733 Ga0395905_0125579 3300037471 Bacteria 2412
734 Ga0395905_0139425 3300037471 Bacteria 2281
735 Ga0395905_0173116 3300037471 Bacteria 2027
736 Ga0395905_0223790 3300037471 Bacteria 1761
737 Ga0395905_0253684 3300037471 Bacteria 1643
738 Ga0395905_0620770 3300037471 Bacteria 983
739 Ga0395905_0743668 3300037471 Bacteria 883
740 Ga0395905_0935759 3300037471 Bacteria 769
741 Ga0395905_1544288 3300037471 Bacteria 568
742 Ga0395901_0000041 3300038443 Bacteria 202314
743 Ga0395901_0000111 3300038443 Bacteria 112522
744 Ga0395901_0001052 3300038443 Bacteria 29727
745 Ga0395901_0001161 3300038443 Bacteria 27974
746 Ga0395901_0001382 3300038443 Bacteria 25390
747 Ga0395901_0001601 3300038443 Bacteria 23439
748 Ga0395901_0030406 3300038443 Bacteria 5563
749 Ga0395901_0035659 3300038443 Bacteria 5139
750 Ga0395901_0042563 3300038443 Bacteria 4709
751 Ga0395901_0059836 3300038443 Bacteria 3963
752 Ga0395901_0077120 3300038443 Bacteria 3478
753 Ga0395901_0085533 3300038443 Bacteria 3297
754 Ga0395901_0107709 3300038443 Bacteria 2925
755 Ga0395901_0201754 3300038443 Bacteria 2085
756 Ga0395901_0226123 3300038443 Bacteria 1954
757 Ga0395901_0303979 3300038443 Bacteria 1653
758 Ga0395901_0416850 3300038443 Bacteria 1377
759 Ga0395901_1252324 3300038443 Bacteria 705
760 Ga0237819_01796 3300038705 Bacteria 5001
761 Ga0451807_0060506 3300041486 Bacteria 709
762 Ga0439445_0004503 3300042004 Bacteria 3157
763 Ga0439432_040047 3300042006 Bacteria 1487
764 Ga0451577_0182042 3300042876 Bacteria 1895
765 Ga0466969_0054832 3300044656 Bacteria 1952
766 Ga0466972_0007112 3300044658 Bacteria 5620
767 Ga0466972_0164660 3300044658 Bacteria 1041
768 Ga0466966_0109629 3300044684 Bacteria 1702
769 Ga0466961_0022886 3300044693 Bacteria 4019
770 Ga0466963_0274983 3300044694 Bacteria 1183
771 Ga0466964_0012089 3300044706 Bacteria 3266
772 Ga0466971_0039274 3300044719 Bacteria 2124
773 Ga0466971_0103311 3300044719 Bacteria 1311
774 Ga0466970_0144346 3300044765 Bacteria 1312
775 Ga0466957_0046557 3300044842 Bacteria 2633
776 Ga0466957_0096063 3300044842 Bacteria 1862
777 Ga0466967_0211690 3300045976 Bacteria 1839
778 Ga0495584_0244480 3300046491 Bacteria 912
779 Ga0495585_0354860 3300046492 Bacteria 712
780 Ga0495583_0005499 3300046506 Bacteria 8581
781 Ga0495606_0008241 3300046507 Bacteria 9103
782 Ga0495643_0002866 3300046522 Bacteria 13101
783 Ga0495643_0005953 3300046522 Bacteria 8136
784 Ga0495663_0000929 3300046525 Bacteria 9794
785 Ga0495611_0004670 3300046648 Bacteria 5883
786 Ga0495625_0016835 3300046660 Bacteria 5740
787 Ga0495625_0305849 3300046660 Bacteria 1016
788 Ga0495649_0285857 3300046694 Bacteria 842
789 Ga0495683_0005013 3300047323 Bacteria 7418
790 Ga0495677_0007657 3300047445 Bacteria 4030
791 Ga0495681_0001609 3300047470 Bacteria 16813
792 Ga0496102_0000067 3300048905 Bacteria 156790
793 Ga0496103_0000242 3300048906 Bacteria 53258
794 Ga0496105_0047520 3300048908 Bacteria 3542
795 Ga0496107_0052322 3300048910 Bacteria 2946
796 Ga0496107_0142273 3300048910 Bacteria 1773
797 Ga0496111_0294897 3300048914 Bacteria 1202
798 Ga0496112_0499480 3300048915 Bacteria 1152
799 Ga0496114_0067829 3300048917 Bacteria 2993
800 Ga0496115_0000056 3300048918 Bacteria 104434
801 Ga0496116_0004119 3300048919 Bacteria 14012
802 Ga0496117_0000114 3300048920 Bacteria 180658
803 Ga0496118_0000082 3300048921 Bacteria 185820
804 Ga0496119_0005796 3300048922 Bacteria 11687
805 Ga0496119_0032184 3300048922 Bacteria 3500
806 Ga0496121_0000344 3300048924 Bacteria 96865
807 Ga0496123_0024198 3300048926 Bacteria 4622
808 Ga0496124_0000068 3300048927 Bacteria 221819
809 Ga0496125_0000219 3300048928 Bacteria 116721
810 Ga0496126_0000157 3300048929 Bacteria 156203
811 Ga0501036_1036239 3300049572 Bacteria 671
812 Ga0501047_0002069 3300049581 Bacteria 19195
813 Ga0501070_0009033 3300049586 Bacteria 8431
814 Ga0501035_0167396 3300049822 Bacteria 1900
815 Ga0501044_0769150 3300049823 Bacteria 844
816 nmdc:mga0k408_31541_c1 3300050493 Bacteria 3026
817 nmdc:mga05p37_847372_c1 3300050507 Bacteria 993
818 Ga0500643_000375 3300053087 Bacteria 34881
819 Ga0500643_004878 3300053087 Bacteria 5915
820 Ga0500643_011760 3300053087 Bacteria 3172
821 Ga0500642_0000486 3300053130 Bacteria 12255
822 Ga0500559_0003334 3300053136 Bacteria 7954
823 Ga0500616_0285451 3300053153 Bacteria 691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100413943 Ga0207675_1004139432 180
2 3300049572 Ga0501036_1036239 Ga0501036_1036239_18_566 180
3 3300037471 Ga0395905_1544288 Ga0395905_1544288_11_556 181
4 3300048914 Ga0496111_0294897 Ga0496111_0294897_629_1174 181
5 3300027111 Ga0209281_1010093 Ga0209281_10100933 182
6 3300042006 Ga0439432_040047 Ga0439432_040047_922_1476 184
7 3300026078 Ga0207702_11130995 Ga0207702_111309952 191
8 3300038705 Ga0237819_01796 Ga0237819_01796_1637_2263 192
9 3300050507 nmdc:mga05p37_847372_c1 nmdc:mga05p37_847372_c1_224_808 192
10 3300046492 Ga0495585_0354860 Ga0495585_0354860_32_631 197
11 3300046660 Ga0495625_0305849 Ga0495625_0305849_211_810 197
12 3300049823 Ga0501044_0769150 Ga0501044_0769150_233_826 197
13 3300050493 nmdc:mga0k408_31541_c1 nmdc:mga0k408_31541_c1_1894_2493 197
14 3300025931 Ga0207644_10202153 Ga0207644_102021533 199
15 3300053136 Ga0500559_0003334 Ga0500559_0003334_608_1213 199
16 3300053153 Ga0500616_0285451 Ga0500616_0285451_69_680 199
17 iso_pu_bacteria 2751185897 2753763199 199
18 iso_pu_bacteria 2856342000 2856343018 199
19 3300005843 Ga0068860_101181669 Ga0068860_1011816691 200
20 3300025907 Ga0207645_10307139 Ga0207645_103071391 200
21 3300028381 Ga0268264_10960773 Ga0268264_109607732 200
22 iso_pu_bacteria 2582581280 2585154255 200
23 iso_pu_bacteria 2582581293 2585197874 200
24 iso_pu_bacteria 2818991435 2819540515 200
25 iso_pu_bacteria 2818991454 2819649539 200
26 3300026067 Ga0207678_10543176 Ga0207678_105431762 201
27 3300027682 Ga0209971_1050417 Ga0209971_10504172 201
28 3300027876 Ga0209974_10006250 Ga0209974_100062503 201
29 iso_pu_bacteria 2884960567 2884961127 201
30 iso_pu_bacteria 2928531327 2928533442 201
31 3300001915 JGI24741J21665_1000406 JGI24741J21665_10004065 202
32 3300001979 JGI24740J21852_10007124 JGI24740J21852_100071244 202
33 3300001979 JGI24740J21852_10042610 JGI24740J21852_100426102 202
34 3300001989 JGI24739J22299_10006458 JGI24739J22299_100064586 202
35 3300001990 JGI24737J22298_10000359 JGI24737J22298_1000035914 202
36 3300001990 JGI24737J22298_10029430 JGI24737J22298_100294302 202
37 3300002067 JGI24735J21928_10052235 JGI24735J21928_100522352 202
38 3300003215 JGI25153J46596_10000179 JGI25153J46596_100001799 202
39 3300005327 Ga0070658_10011723 Ga0070658_100117237 202
40 3300005328 Ga0070676_10121678 Ga0070676_101216783 202
41 3300005339 Ga0070660_100005392 Ga0070660_1000053923 202
42 3300005344 Ga0070661_100005993 Ga0070661_1000059937 202
43 3300005347 Ga0070668_100151258 Ga0070668_1001512583 202
44 3300005354 Ga0070675_101249026 Ga0070675_1012490261 202
45 3300005356 Ga0070674_100000306 Ga0070674_1000003069 202
46 3300005356 Ga0070674_100011959 Ga0070674_1000119593 202
47 3300005364 Ga0070673_100120104 Ga0070673_1001201043 202
48 3300005366 Ga0070659_100035960 Ga0070659_1000359603 202
49 3300005367 Ga0070667_100034455 Ga0070667_1000344556 202
50 3300005456 Ga0070678_100000647 Ga0070678_1000006479 202
51 3300005457 Ga0070662_100460339 Ga0070662_1004603392 202
52 3300005459 Ga0068867_100352502 Ga0068867_1003525022 202
53 3300005539 Ga0068853_100039082 Ga0068853_1000390823 202
54 3300005539 Ga0068853_100048919 Ga0068853_1000489192 202
55 3300005548 Ga0070665_100436799 Ga0070665_1004367992 202
56 3300005563 Ga0068855_100043676 Ga0068855_1000436764 202
57 3300005564 Ga0070664_100007094 Ga0070664_1000070944 202
58 3300005577 Ga0068857_100074880 Ga0068857_1000748804 202
59 3300005577 Ga0068857_100598053 Ga0068857_1005980532 202
60 3300005578 Ga0068854_100028496 Ga0068854_1000284962 202
61 3300005578 Ga0068854_100160141 Ga0068854_1001601412 202
62 3300005578 Ga0068854_100277703 Ga0068854_1002777031 202
63 3300005614 Ga0068856_100065694 Ga0068856_1000656944 202
64 3300005616 Ga0068852_100048607 Ga0068852_1000486073 202
65 3300005616 Ga0068852_100180741 Ga0068852_1001807412 202
66 3300005834 Ga0068851_10009974 Ga0068851_100099744 202
67 3300005841 Ga0068863_100734767 Ga0068863_1007347671 202
68 3300006186 Ga0075369_10005258 Ga0075369_100052586 202
69 3300006195 Ga0075366_10033709 Ga0075366_100337093 202
70 3300006353 Ga0075370_10355832 Ga0075370_103558322 202
71 3300006358 Ga0068871_100022940 Ga0068871_1000229405 202
72 3300009148 Ga0105243_10002259 Ga0105243_1000225910 202
73 3300009174 Ga0105241_10010786 Ga0105241_100107864 202
74 3300009545 Ga0105237_10077251 Ga0105237_100772513 202
75 3300009551 Ga0105238_10028444 Ga0105238_100284445 202
76 3300009551 Ga0105238_10324094 Ga0105238_103240943 202
77 3300010375 Ga0105239_11515061 Ga0105239_115150612 202
78 3300012513 Ga0157326_1000007 Ga0157326_10000075 202
79 3300013100 Ga0157373_10021218 Ga0157373_100212184 202
80 3300013102 Ga0157371_10000183 Ga0157371_1000018377 202
81 3300013105 Ga0157369_10038473 Ga0157369_100384734 202
82 3300013307 Ga0157372_10013964 Ga0157372_100139644 202
83 3300014969 Ga0157376_10139925 Ga0157376_101399252 202
84 3300025272 Ga0209455_1025473 Ga0209455_10254731 202
85 3300025297 Ga0209758_1000007 Ga0209758_1000007846 202
86 3300025321 Ga0207656_10004017 Ga0207656_100040174 202
87 3300025904 Ga0207647_10004576 Ga0207647_100045768 202
88 3300025904 Ga0207647_10025198 Ga0207647_100251984 202
89 3300025907 Ga0207645_10074766 Ga0207645_100747662 202
90 3300025911 Ga0207654_10015216 Ga0207654_100152164 202
91 3300025913 Ga0207695_10009791 Ga0207695_100097914 202
92 3300025914 Ga0207671_10005583 Ga0207671_100055833 202
93 3300025919 Ga0207657_10002554 Ga0207657_1000255414 202
94 3300025920 Ga0207649_10002343 Ga0207649_100023439 202
95 3300025924 Ga0207694_10021557 Ga0207694_100215574 202
96 3300025924 Ga0207694_10255689 Ga0207694_102556892 202
97 3300025932 Ga0207690_10009662 Ga0207690_100096624 202
98 3300025933 Ga0207706_10015303 Ga0207706_100153035 202
99 3300025933 Ga0207706_10034791 Ga0207706_100347914 202
100 3300025933 Ga0207706_10067668 Ga0207706_100676682 202
101 3300025935 Ga0207709_10000202 Ga0207709_1000020260 202
102 3300025937 Ga0207669_10000150 Ga0207669_100001505 202
103 3300025937 Ga0207669_10000313 Ga0207669_1000031318 202
104 3300025945 Ga0207679_10077739 Ga0207679_100777392 202
105 3300025949 Ga0207667_10000107 Ga0207667_1000010723 202
106 3300025972 Ga0207668_10239876 Ga0207668_102398763 202
107 3300025981 Ga0207640_10007849 Ga0207640_100078494 202
108 3300025981 Ga0207640_10263161 Ga0207640_102631613 202
109 3300025981 Ga0207640_10452631 Ga0207640_104526312 202
110 3300025986 Ga0207658_10023352 Ga0207658_100233522 202
111 3300026041 Ga0207639_10033050 Ga0207639_100330504 202
112 3300026041 Ga0207639_10055385 Ga0207639_100553853 202
113 3300026067 Ga0207678_10002221 Ga0207678_1000222111 202
114 3300026078 Ga0207702_10004172 Ga0207702_100041725 202
115 3300026089 Ga0207648_10290950 Ga0207648_102909501 202
116 3300026116 Ga0207674_10032651 Ga0207674_100326512 202
117 3300026116 Ga0207674_10059155 Ga0207674_100591554 202
118 3300026121 Ga0207683_10002303 Ga0207683_100023039 202
119 3300026142 Ga0207698_10000851 Ga0207698_1000085111 202
120 3300026142 Ga0207698_10051001 Ga0207698_100510014 202
121 3300031548 Ga0307408_100502670 Ga0307408_1005026702 202
122 3300031731 Ga0307405_10057509 Ga0307405_100575093 202
123 3300031731 Ga0307405_10157246 Ga0307405_101572462 202
124 3300031901 Ga0307406_10038166 Ga0307406_100381665 202
125 3300031911 Ga0307412_10132027 Ga0307412_101320272 202
126 3300031911 Ga0307412_10187406 Ga0307412_101874062 202
127 3300032004 Ga0307414_11328624 Ga0307414_113286241 202
128 3300033180 Ga0307510_10014402 Ga0307510_100144023 202
129 3300041486 Ga0451807_0060506 Ga0451807_0060506_24_638 202
130 3300046491 Ga0495584_0244480 Ga0495584_0244480_70_684 202
131 3300046506 Ga0495583_0005499 Ga0495583_0005499_3827_4441 202
132 3300046507 Ga0495606_0008241 Ga0495606_0008241_3128_3742 202
133 3300046522 Ga0495643_0002866 Ga0495643_0002866_7763_8377 202
134 3300046522 Ga0495643_0005953 Ga0495643_0005953_1486_2100 202
135 3300046525 Ga0495663_0000929 Ga0495663_0000929_633_1247 202
136 3300046648 Ga0495611_0004670 Ga0495611_0004670_4319_4933 202
137 3300046660 Ga0495625_0016835 Ga0495625_0016835_2862_3476 202
138 3300046694 Ga0495649_0285857 Ga0495649_0285857_208_822 202
139 3300047323 Ga0495683_0005013 Ga0495683_0005013_2374_2988 202
140 3300047445 Ga0495677_0007657 Ga0495677_0007657_118_732 202
141 3300047470 Ga0495681_0001609 Ga0495681_0001609_8915_9529 202
142 3300048905 Ga0496102_0000067 Ga0496102_0000067_67753_68367 202
143 3300048906 Ga0496103_0000242 Ga0496103_0000242_34542_35156 202
144 3300048908 Ga0496105_0047520 Ga0496105_0047520_1740_2354 202
145 3300048910 Ga0496107_0052322 Ga0496107_0052322_445_1059 202
146 3300048917 Ga0496114_0067829 Ga0496114_0067829_1169_1783 202
147 3300048918 Ga0496115_0000056 Ga0496115_0000056_15091_15705 202
148 3300048919 Ga0496116_0004119 Ga0496116_0004119_11485_12099 202
149 3300048920 Ga0496117_0000114 Ga0496117_0000114_88356_88970 202
150 3300048921 Ga0496118_0000082 Ga0496118_0000082_96215_96829 202
151 3300048922 Ga0496119_0005796 Ga0496119_0005796_6003_6617 202
152 3300048922 Ga0496119_0032184 Ga0496119_0032184_1195_1815 202
153 3300048924 Ga0496121_0000344 Ga0496121_0000344_88473_89087 202
154 3300048926 Ga0496123_0024198 Ga0496123_0024198_767_1381 202
155 3300048927 Ga0496124_0000068 Ga0496124_0000068_88493_89107 202
156 3300048928 Ga0496125_0000219 Ga0496125_0000219_56839_57453 202
157 3300048929 Ga0496126_0000157 Ga0496126_0000157_88505_89119 202
158 3300049581 Ga0501047_0002069 Ga0501047_0002069_204_818 202
159 3300049822 Ga0501035_0167396 Ga0501035_0167396_256_870 202
160 3300053130 Ga0500642_0000486 Ga0500642_0000486_8503_9117 202
161 3300005331 Ga0070670_100033010 Ga0070670_1000330104 203
162 3300005455 Ga0070663_100114291 Ga0070663_1001142912 203
163 3300009147 Ga0114129_11104147 Ga0114129_111041472 203
164 3300009174 Ga0105241_10362571 Ga0105241_103625711 203
165 3300013100 Ga0157373_10014697 Ga0157373_100146974 203
166 3300025925 Ga0207650_10009279 Ga0207650_100092794 203
167 3300025933 Ga0207706_10621496 Ga0207706_106214961 203
168 3300026067 Ga0207678_10118630 Ga0207678_101186303 203
169 3300031548 Ga0307408_100020742 Ga0307408_1000207423 203
170 3300031901 Ga0307406_10083056 Ga0307406_100830563 203
171 3300032002 Ga0307416_100030857 Ga0307416_1000308572 203
172 3300005347 Ga0070668_100026275 Ga0070668_1000262755 204
173 3300005366 Ga0070659_100091113 Ga0070659_1000911131 204
174 3300005455 Ga0070663_100402445 Ga0070663_1004024452 204
175 3300005458 Ga0070681_10034155 Ga0070681_100341552 204
176 3300005617 Ga0068859_100037383 Ga0068859_1000373832 204
177 3300005841 Ga0068863_100004491 Ga0068863_1000044917 204
178 3300005844 Ga0068862_100000288 Ga0068862_10000028828 204
179 3300006931 Ga0097620_100037382 Ga0097620_1000373826 204
180 3300009177 Ga0105248_10040031 Ga0105248_100400315 204
181 3300009553 Ga0105249_10304889 Ga0105249_103048893 204
182 3300014326 Ga0157380_10189302 Ga0157380_101893022 204
183 3300025273 Ga0209673_1045715 Ga0209673_10457152 204
184 3300025304 Ga0209257_1005853 Ga0209257_10058534 204
185 3300025900 Ga0207710_10001187 Ga0207710_100011876 204
186 3300025912 Ga0207707_10106843 Ga0207707_101068433 204
187 3300025941 Ga0207711_10025316 Ga0207711_100253165 204
188 3300025972 Ga0207668_11057988 Ga0207668_110579881 204
189 3300026067 Ga0207678_10471784 Ga0207678_104717842 204
190 3300026088 Ga0207641_10001052 Ga0207641_1000105216 204
191 3300026118 Ga0207675_101288415 Ga0207675_1012884152 204
192 3300028380 Ga0268265_10000049 Ga0268265_100000496 204
193 3300031548 Ga0307408_100162073 Ga0307408_1001620732 204
194 3300031731 Ga0307405_10026575 Ga0307405_100265753 204
195 3300031731 Ga0307405_10040305 Ga0307405_100403052 204
196 3300031824 Ga0307413_10008058 Ga0307413_100080583 204
197 3300031824 Ga0307413_10011086 Ga0307413_100110863 204
198 3300031824 Ga0307413_10532545 Ga0307413_105325452 204
199 3300031852 Ga0307410_10002760 Ga0307410_100027608 204
200 3300031852 Ga0307410_10018209 Ga0307410_100182094 204
201 3300031852 Ga0307410_10101644 Ga0307410_101016442 204
202 3300031901 Ga0307406_10108720 Ga0307406_101087202 204
203 3300031901 Ga0307406_10562699 Ga0307406_105626992 204
204 3300031901 Ga0307406_11063874 Ga0307406_110638741 204
205 3300031903 Ga0307407_10037822 Ga0307407_100378223 204
206 3300031903 Ga0307407_10150840 Ga0307407_101508402 204
207 3300031911 Ga0307412_10011454 Ga0307412_100114542 204
208 3300031911 Ga0307412_10048793 Ga0307412_100487931 204
209 3300031995 Ga0307409_100019223 Ga0307409_1000192232 204
210 3300031995 Ga0307409_100577253 Ga0307409_1005772532 204
211 3300032002 Ga0307416_100513157 Ga0307416_1005131572 204
212 3300032002 Ga0307416_100798677 Ga0307416_1007986772 204
213 3300032004 Ga0307414_10015215 Ga0307414_100152156 204
214 3300032004 Ga0307414_10072059 Ga0307414_100720593 204
215 3300032005 Ga0307411_10003616 Ga0307411_100036164 204
216 3300032005 Ga0307411_10022362 Ga0307411_100223623 204
217 3300032005 Ga0307411_10211584 Ga0307411_102115842 204
218 3300032126 Ga0307415_100027655 Ga0307415_1000276553 204
219 3300032126 Ga0307415_100031241 Ga0307415_1000312413 204
220 3300032126 Ga0307415_100064401 Ga0307415_1000644012 204
221 3300037418 Ga0395900_0126054 Ga0395900_0126054_738_1352 204
222 3300037418 Ga0395900_0214720 Ga0395900_0214720_294_911 204
223 3300037418 Ga0395900_0880799 Ga0395900_0880799_186_800 204
224 3300037471 Ga0395905_0029181 Ga0395905_0029181_2476_3090 204
225 3300038443 Ga0395901_0001161 Ga0395901_0001161_3268_3882 204
226 3300038443 Ga0395901_0085533 Ga0395901_0085533_1049_1663 204
227 3300044656 Ga0466969_0054832 Ga0466969_0054832_180_794 204
228 3300044719 Ga0466971_0039274 Ga0466971_0039274_380_994 204
229 3300053087 Ga0500643_011760 Ga0500643_011760_223_837 204
230 iso_pu_bacteria 2791355253 2793280740 204
231 3300001915 JGI24741J21665_1007449 JGI24741J21665_10074493 205
232 3300001979 JGI24740J21852_10000582 JGI24740J21852_100005829 205
233 3300001979 JGI24740J21852_10001897 JGI24740J21852_100018976 205
234 3300001979 JGI24740J21852_10068613 JGI24740J21852_100686132 205
235 3300001989 JGI24739J22299_10000649 JGI24739J22299_1000064915 205
236 3300001989 JGI24739J22299_10007428 JGI24739J22299_100074284 205
237 3300001989 JGI24739J22299_10007594 JGI24739J22299_100075944 205
238 3300001989 JGI24739J22299_10015958 JGI24739J22299_100159583 205
239 3300001990 JGI24737J22298_10002403 JGI24737J22298_100024038 205
240 3300001990 JGI24737J22298_10032754 JGI24737J22298_100327542 205
241 3300001990 JGI24737J22298_10114029 JGI24737J22298_101140292 205
242 3300001990 JGI24737J22298_10115064 JGI24737J22298_101150641 205
243 3300001991 JGI24743J22301_10075676 JGI24743J22301_100756761 205
244 3300002067 JGI24735J21928_10001154 JGI24735J21928_100011548 205
245 3300002067 JGI24735J21928_10005252 JGI24735J21928_100052525 205
246 3300002075 JGI24738J21930_10001773 JGI24738J21930_100017736 205
247 3300002126 JGI24035J26624_1002263 JGI24035J26624_10022632 205
248 3300003322 rootL2_10067792 rootL2_100677923 205
249 3300005327 Ga0070658_10002947 Ga0070658_1000294719 205
250 3300005327 Ga0070658_10005505 Ga0070658_100055057 205
251 3300005327 Ga0070658_10023315 Ga0070658_100233153 205
252 3300005327 Ga0070658_10024916 Ga0070658_100249165 205
253 3300005327 Ga0070658_10036625 Ga0070658_100366256 205
254 3300005327 Ga0070658_10192900 Ga0070658_101929002 205
255 3300005327 Ga0070658_10244103 Ga0070658_102441032 205
256 3300005327 Ga0070658_10245166 Ga0070658_102451662 205
257 3300005328 Ga0070676_10124655 Ga0070676_101246552 205
258 3300005328 Ga0070676_10642845 Ga0070676_106428451 205
259 3300005329 Ga0070683_100032331 Ga0070683_1000323314 205
260 3300005329 Ga0070683_100048919 Ga0070683_1000489193 205
261 3300005331 Ga0070670_100222414 Ga0070670_1002224142 205
262 3300005331 Ga0070670_100686471 Ga0070670_1006864712 205
263 3300005334 Ga0068869_100004802 Ga0068869_1000048026 205
264 3300005336 Ga0070680_100000576 Ga0070680_10000057612 205
265 3300005336 Ga0070680_100014315 Ga0070680_1000143154 205
266 3300005336 Ga0070680_100056854 Ga0070680_1000568544 205
267 3300005338 Ga0068868_100000839 Ga0068868_10000083917 205
268 3300005339 Ga0070660_100000230 Ga0070660_10000023021 205
269 3300005339 Ga0070660_100003892 Ga0070660_1000038922 205
270 3300005339 Ga0070660_100049336 Ga0070660_1000493362 205
271 3300005339 Ga0070660_100051580 Ga0070660_1000515804 205
272 3300005339 Ga0070660_100070686 Ga0070660_1000706862 205
273 3300005339 Ga0070660_100083758 Ga0070660_1000837584 205
274 3300005339 Ga0070660_100090082 Ga0070660_1000900822 205
275 3300005339 Ga0070660_100297588 Ga0070660_1002975882 205
276 3300005339 Ga0070660_100463485 Ga0070660_1004634851 205
277 3300005340 Ga0070689_100075079 Ga0070689_1000750792 205
278 3300005344 Ga0070661_100000918 Ga0070661_10000091814 205
279 3300005344 Ga0070661_100090785 Ga0070661_1000907853 205
280 3300005344 Ga0070661_100189197 Ga0070661_1001891972 205
281 3300005344 Ga0070661_100312306 Ga0070661_1003123062 205
282 3300005344 Ga0070661_100324244 Ga0070661_1003242442 205
283 3300005344 Ga0070661_100526240 Ga0070661_1005262402 205
284 3300005344 Ga0070661_100598542 Ga0070661_1005985422 205
285 3300005344 Ga0070661_100829115 Ga0070661_1008291151 205
286 3300005345 Ga0070692_10001829 Ga0070692_100018294 205
287 3300005345 Ga0070692_10012342 Ga0070692_100123422 205
288 3300005347 Ga0070668_100006652 Ga0070668_1000066529 205
289 3300005353 Ga0070669_100001226 Ga0070669_10000122611 205
290 3300005355 Ga0070671_100003907 Ga0070671_10000390718 205
291 3300005355 Ga0070671_100110502 Ga0070671_1001105024 205
292 3300005356 Ga0070674_100504789 Ga0070674_1005047892 205
293 3300005364 Ga0070673_100002287 Ga0070673_10000228716 205
294 3300005366 Ga0070659_100007575 Ga0070659_1000075754 205
295 3300005366 Ga0070659_100008861 Ga0070659_1000088616 205
296 3300005366 Ga0070659_100035050 Ga0070659_1000350502 205
297 3300005366 Ga0070659_100038189 Ga0070659_1000381892 205
298 3300005366 Ga0070659_100488117 Ga0070659_1004881172 205
299 3300005366 Ga0070659_100918047 Ga0070659_1009180471 205
300 3300005367 Ga0070667_100014583 Ga0070667_1000145837 205
301 3300005367 Ga0070667_100058455 Ga0070667_1000584552 205
302 3300005455 Ga0070663_100000199 Ga0070663_1000001996 205
303 3300005455 Ga0070663_100014625 Ga0070663_1000146252 205
304 3300005455 Ga0070663_100221452 Ga0070663_1002214522 205
305 3300005457 Ga0070662_100001976 Ga0070662_10000197615 205
306 3300005457 Ga0070662_100015656 Ga0070662_1000156562 205
307 3300005458 Ga0070681_10022649 Ga0070681_100226496 205
308 3300005458 Ga0070681_10077070 Ga0070681_100770702 205
309 3300005459 Ga0068867_100002768 Ga0068867_10000276810 205
310 3300005530 Ga0070679_100006348 Ga0070679_10000634810 205
311 3300005530 Ga0070679_100323217 Ga0070679_1003232172 205
312 3300005535 Ga0070684_100057467 Ga0070684_1000574674 205
313 3300005535 Ga0070684_100096617 Ga0070684_1000966172 205
314 3300005535 Ga0070684_100124476 Ga0070684_1001244762 205
315 3300005535 Ga0070684_101024806 Ga0070684_1010248061 205
316 3300005539 Ga0068853_100001611 Ga0068853_10000161112 205
317 3300005539 Ga0068853_100048058 Ga0068853_1000480585 205
318 3300005543 Ga0070672_100080160 Ga0070672_1000801604 205
319 3300005544 Ga0070686_100176090 Ga0070686_1001760902 205
320 3300005548 Ga0070665_100002939 Ga0070665_1000029393 205
321 3300005548 Ga0070665_100104101 Ga0070665_1001041013 205
322 3300005563 Ga0068855_100004526 Ga0068855_10000452619 205
323 3300005563 Ga0068855_100017413 Ga0068855_1000174135 205
324 3300005563 Ga0068855_100102538 Ga0068855_1001025382 205
325 3300005563 Ga0068855_100382922 Ga0068855_1003829222 205
326 3300005563 Ga0068855_101258268 Ga0068855_1012582681 205
327 3300005564 Ga0070664_100053211 Ga0070664_1000532114 205
328 3300005564 Ga0070664_100068694 Ga0070664_1000686942 205
329 3300005564 Ga0070664_100484562 Ga0070664_1004845622 205
330 3300005564 Ga0070664_100628809 Ga0070664_1006288092 205
331 3300005577 Ga0068857_100001206 Ga0068857_1000012069 205
332 3300005577 Ga0068857_100006083 Ga0068857_10000608318 205
333 3300005577 Ga0068857_100056704 Ga0068857_1000567043 205
334 3300005578 Ga0068854_100004889 Ga0068854_1000048898 205
335 3300005578 Ga0068854_100068236 Ga0068854_1000682363 205
336 3300005614 Ga0068856_100012407 Ga0068856_1000124075 205
337 3300005614 Ga0068856_100030220 Ga0068856_1000302205 205
338 3300005614 Ga0068856_100144459 Ga0068856_1001444594 205
339 3300005614 Ga0068856_101153146 Ga0068856_1011531461 205
340 3300005615 Ga0070702_100293531 Ga0070702_1002935312 205
341 3300005616 Ga0068852_100001904 Ga0068852_10000190411 205
342 3300005616 Ga0068852_100081949 Ga0068852_1000819494 205
343 3300005616 Ga0068852_100130080 Ga0068852_1001300802 205
344 3300005616 Ga0068852_100362997 Ga0068852_1003629972 205
345 3300005617 Ga0068859_100003976 Ga0068859_10000397611 205
346 3300005617 Ga0068859_100049223 Ga0068859_1000492232 205
347 3300005617 Ga0068859_100265293 Ga0068859_1002652931 205
348 3300005618 Ga0068864_100004350 Ga0068864_10000435015 205
349 3300005719 Ga0068861_100046869 Ga0068861_1000468693 205
350 3300005834 Ga0068851_10051335 Ga0068851_100513352 205
351 3300005834 Ga0068851_10153592 Ga0068851_101535922 205
352 3300005842 Ga0068858_100009449 Ga0068858_1000094497 205
353 3300005842 Ga0068858_100026457 Ga0068858_1000264572 205
354 3300005843 Ga0068860_100005610 Ga0068860_1000056105 205
355 3300006353 Ga0075370_10118213 Ga0075370_101182133 205
356 3300006358 Ga0068871_100048737 Ga0068871_1000487372 205
357 3300006881 Ga0068865_100024042 Ga0068865_1000240423 205
358 3300006931 Ga0097620_100003976 Ga0097620_10000397611 205
359 3300006931 Ga0097620_100049222 Ga0097620_1000492222 205
360 3300006931 Ga0097620_100265272 Ga0097620_1002652721 205
361 3300009098 Ga0105245_10002373 Ga0105245_1000237311 205
362 3300009148 Ga0105243_10010913 Ga0105243_100109135 205
363 3300009174 Ga0105241_10219426 Ga0105241_102194262 205
364 3300009177 Ga0105248_10001628 Ga0105248_100016285 205
365 3300009177 Ga0105248_10004474 Ga0105248_100044749 205
366 3300009551 Ga0105238_10111830 Ga0105238_101118302 205
367 3300009551 Ga0105238_10595169 Ga0105238_105951692 205
368 3300010375 Ga0105239_10026042 Ga0105239_100260428 205
369 3300013100 Ga0157373_10089016 Ga0157373_100890163 205
370 3300013100 Ga0157373_10161804 Ga0157373_101618042 205
371 3300013100 Ga0157373_10178091 Ga0157373_101780913 205
372 3300013102 Ga0157371_10005519 Ga0157371_1000551912 205
373 3300013102 Ga0157371_10010590 Ga0157371_100105907 205
374 3300013102 Ga0157371_10015181 Ga0157371_100151814 205
375 3300013102 Ga0157371_10086368 Ga0157371_100863682 205
376 3300013102 Ga0157371_10331777 Ga0157371_103317772 205
377 3300013104 Ga0157370_10007548 Ga0157370_100075485 205
378 3300013104 Ga0157370_10016422 Ga0157370_100164225 205
379 3300013104 Ga0157370_10020885 Ga0157370_100208854 205
380 3300013104 Ga0157370_10602159 Ga0157370_106021592 205
381 3300013105 Ga0157369_10010995 Ga0157369_1001099510 205
382 3300013105 Ga0157369_10032219 Ga0157369_100322197 205
383 3300013105 Ga0157369_10116168 Ga0157369_101161683 205
384 3300013105 Ga0157369_10175866 Ga0157369_101758663 205
385 3300013105 Ga0157369_10270741 Ga0157369_102707412 205
386 3300013296 Ga0157374_10030799 Ga0157374_100307995 205
387 3300013297 Ga0157378_10011273 Ga0157378_100112736 205
388 3300013306 Ga0163162_10019610 Ga0163162_100196108 205
389 3300013307 Ga0157372_10076529 Ga0157372_100765292 205
390 3300013307 Ga0157372_10090330 Ga0157372_100903302 205
391 3300013307 Ga0157372_10101849 Ga0157372_101018493 205
392 3300013307 Ga0157372_10214308 Ga0157372_102143082 205
393 3300013308 Ga0157375_10336573 Ga0157375_103365732 205
394 3300014968 Ga0157379_10032636 Ga0157379_100326364 205
395 3300025315 Ga0207697_10000694 Ga0207697_1000069417 205
396 3300025904 Ga0207647_10001132 Ga0207647_1000113212 205
397 3300025904 Ga0207647_10003287 Ga0207647_100032874 205
398 3300025904 Ga0207647_10009755 Ga0207647_100097557 205
399 3300025904 Ga0207647_10049916 Ga0207647_100499161 205
400 3300025904 Ga0207647_10060953 Ga0207647_100609532 205
401 3300025904 Ga0207647_10190022 Ga0207647_101900222 205
402 3300025907 Ga0207645_10126339 Ga0207645_101263392 205
403 3300025909 Ga0207705_10000569 Ga0207705_100005699 205
404 3300025909 Ga0207705_10001019 Ga0207705_100010199 205
405 3300025909 Ga0207705_10001550 Ga0207705_1000155017 205
406 3300025909 Ga0207705_10005773 Ga0207705_100057733 205
407 3300025909 Ga0207705_10015149 Ga0207705_100151493 205
408 3300025909 Ga0207705_10031672 Ga0207705_100316723 205
409 3300025909 Ga0207705_10126606 Ga0207705_101266062 205
410 3300025909 Ga0207705_10167039 Ga0207705_101670392 205
411 3300025909 Ga0207705_10198636 Ga0207705_101986362 205
412 3300025909 Ga0207705_10280163 Ga0207705_102801632 205
413 3300025912 Ga0207707_10121131 Ga0207707_101211311 205
414 3300025917 Ga0207660_10000159 Ga0207660_100001599 205
415 3300025917 Ga0207660_10012886 Ga0207660_100128864 205
416 3300025917 Ga0207660_10130730 Ga0207660_101307301 205
417 3300025919 Ga0207657_10000675 Ga0207657_100006754 205
418 3300025919 Ga0207657_10002365 Ga0207657_1000236514 205
419 3300025919 Ga0207657_10003648 Ga0207657_1000364813 205
420 3300025919 Ga0207657_10086405 Ga0207657_100864052 205
421 3300025919 Ga0207657_10142997 Ga0207657_101429972 205
422 3300025919 Ga0207657_10161439 Ga0207657_101614392 205
423 3300025919 Ga0207657_10177796 Ga0207657_101777962 205
424 3300025919 Ga0207657_10294354 Ga0207657_102943542 205
425 3300025919 Ga0207657_10339531 Ga0207657_103395312 205
426 3300025919 Ga0207657_10464052 Ga0207657_104640521 205
427 3300025919 Ga0207657_10522619 Ga0207657_105226192 205
428 3300025920 Ga0207649_10077114 Ga0207649_100771142 205
429 3300025920 Ga0207649_10098037 Ga0207649_100980372 205
430 3300025920 Ga0207649_10444934 Ga0207649_104449341 205
431 3300025920 Ga0207649_10493155 Ga0207649_104931552 205
432 3300025920 Ga0207649_10590275 Ga0207649_105902751 205
433 3300025921 Ga0207652_10000356 Ga0207652_1000035635 205
434 3300025921 Ga0207652_10479558 Ga0207652_104795581 205
435 3300025921 Ga0207652_10775880 Ga0207652_107758801 205
436 3300025923 Ga0207681_10003678 Ga0207681_100036787 205
437 3300025924 Ga0207694_10066073 Ga0207694_100660732 205
438 3300025925 Ga0207650_10098895 Ga0207650_100988952 205
439 3300025927 Ga0207687_10007358 Ga0207687_100073585 205
440 3300025931 Ga0207644_10013142 Ga0207644_100131422 205
441 3300025931 Ga0207644_10071346 Ga0207644_100713462 205
442 3300025932 Ga0207690_10009151 Ga0207690_100091514 205
443 3300025932 Ga0207690_10028740 Ga0207690_100287403 205
444 3300025932 Ga0207690_10105001 Ga0207690_101050012 205
445 3300025932 Ga0207690_10124615 Ga0207690_101246152 205
446 3300025932 Ga0207690_10125398 Ga0207690_101253983 205
447 3300025932 Ga0207690_10335516 Ga0207690_103355162 205
448 3300025933 Ga0207706_10001910 Ga0207706_1000191011 205
449 3300025933 Ga0207706_10026568 Ga0207706_100265682 205
450 3300025933 Ga0207706_10484084 Ga0207706_104840842 205
451 3300025935 Ga0207709_10017933 Ga0207709_100179333 205
452 3300025938 Ga0207704_10016383 Ga0207704_100163833 205
453 3300025941 Ga0207711_10007900 Ga0207711_100079005 205
454 3300025941 Ga0207711_10009331 Ga0207711_100093318 205
455 3300025942 Ga0207689_10002135 Ga0207689_1000213511 205
456 3300025944 Ga0207661_10048548 Ga0207661_100485484 205
457 3300025944 Ga0207661_10101509 Ga0207661_101015092 205
458 3300025945 Ga0207679_10084947 Ga0207679_100849472 205
459 3300025945 Ga0207679_10209368 Ga0207679_102093682 205
460 3300025949 Ga0207667_10020276 Ga0207667_100202767 205
461 3300025949 Ga0207667_10026493 Ga0207667_100264936 205
462 3300025949 Ga0207667_10043803 Ga0207667_100438035 205
463 3300025949 Ga0207667_10310118 Ga0207667_103101182 205
464 3300025960 Ga0207651_10002056 Ga0207651_100020563 205
465 3300025972 Ga0207668_10037343 Ga0207668_100373434 205
466 3300025972 Ga0207668_10782088 Ga0207668_107820882 205
467 3300025981 Ga0207640_10001164 Ga0207640_1000116411 205
468 3300025981 Ga0207640_10022354 Ga0207640_100223542 205
469 3300025981 Ga0207640_10316215 Ga0207640_103162152 205
470 3300025986 Ga0207658_10005842 Ga0207658_100058423 205
471 3300026023 Ga0207677_10006561 Ga0207677_100065618 205
472 3300026035 Ga0207703_10005591 Ga0207703_100055919 205
473 3300026035 Ga0207703_10027992 Ga0207703_100279925 205
474 3300026041 Ga0207639_10037987 Ga0207639_100379874 205
475 3300026067 Ga0207678_10000325 Ga0207678_1000032512 205
476 3300026067 Ga0207678_10000472 Ga0207678_1000047216 205
477 3300026067 Ga0207678_10031492 Ga0207678_100314922 205
478 3300026067 Ga0207678_10202190 Ga0207678_102021902 205
479 3300026078 Ga0207702_10115622 Ga0207702_101156223 205
480 3300026078 Ga0207702_10359829 Ga0207702_103598292 205
481 3300026078 Ga0207702_10878182 Ga0207702_108781821 205
482 3300026088 Ga0207641_10030146 Ga0207641_100301464 205
483 3300026089 Ga0207648_10002331 Ga0207648_1000233111 205
484 3300026089 Ga0207648_11034473 Ga0207648_110344731 205
485 3300026095 Ga0207676_10003527 Ga0207676_1000352714 205
486 3300026116 Ga0207674_10009370 Ga0207674_1000937012 205
487 3300026116 Ga0207674_10010679 Ga0207674_100106792 205
488 3300026116 Ga0207674_10234663 Ga0207674_102346632 205
489 3300026116 Ga0207674_10678919 Ga0207674_106789192 205
490 3300026118 Ga0207675_100073363 Ga0207675_1000733633 205
491 3300026142 Ga0207698_10011452 Ga0207698_100114524 205
492 3300026142 Ga0207698_10034866 Ga0207698_100348663 205
493 3300026142 Ga0207698_10122137 Ga0207698_101221372 205
494 3300026142 Ga0207698_10528276 Ga0207698_105282762 205
495 3300028379 Ga0268266_10003721 Ga0268266_1000372121 205
496 3300028380 Ga0268265_10217891 Ga0268265_102178912 205
497 3300028381 Ga0268264_10061876 Ga0268264_100618764 205
498 3300031731 Ga0307405_10705112 Ga0307405_107051121 205
499 3300031824 Ga0307413_10811630 Ga0307413_108116302 205
500 3300031852 Ga0307410_10233997 Ga0307410_102339972 205
501 3300031901 Ga0307406_10136530 Ga0307406_101365301 205
502 3300031911 Ga0307412_10053566 Ga0307412_100535662 205
503 3300032002 Ga0307416_100128988 Ga0307416_1001289881 205
504 3300032002 Ga0307416_100151048 Ga0307416_1001510484 205
505 3300032002 Ga0307416_100169095 Ga0307416_1001690953 205
506 3300032002 Ga0307416_100186381 Ga0307416_1001863813 205
507 3300032004 Ga0307414_10476343 Ga0307414_104763432 205
508 3300032005 Ga0307411_10140891 Ga0307411_101408912 205
509 3300032126 Ga0307415_100034568 Ga0307415_1000345683 205
510 3300037312 Ga0395899_0001034 Ga0395899_0001034_2816_3433 205
511 3300037312 Ga0395899_0021918 Ga0395899_0021918_1188_1805 205
512 3300037312 Ga0395899_0033667 Ga0395899_0033667_2430_3047 205
513 3300037312 Ga0395899_0039870 Ga0395899_0039870_1910_2527 205
514 3300037312 Ga0395899_0069083 Ga0395899_0069083_1732_2349 205
515 3300037312 Ga0395899_0469434 Ga0395899_0469434_182_799 205
516 3300037418 Ga0395900_0001095 Ga0395900_0001095_26932_27549 205
517 3300037418 Ga0395900_0002600 Ga0395900_0002600_4958_5575 205
518 3300037418 Ga0395900_0004245 Ga0395900_0004245_72_689 205
519 3300037418 Ga0395900_0043895 Ga0395900_0043895_3611_4228 205
520 3300037418 Ga0395900_0046175 Ga0395900_0046175_2950_3567 205
521 3300037418 Ga0395900_0077032 Ga0395900_0077032_2255_2872 205
522 3300037418 Ga0395900_0229497 Ga0395900_0229497_619_1236 205
523 3300037418 Ga0395900_0257083 Ga0395900_0257083_450_1067 205
524 3300037418 Ga0395900_0363334 Ga0395900_0363334_479_1096 205
525 3300037418 Ga0395900_0462389 Ga0395900_0462389_117_734 205
526 3300037418 Ga0395900_0540886 Ga0395900_0540886_15_632 205
527 3300037418 Ga0395900_0735568 Ga0395900_0735568_261_878 205
528 3300037466 Ga0395898_0001192 Ga0395898_0001192_15470_16087 205
529 3300037466 Ga0395898_0019893 Ga0395898_0019893_1188_1805 205
530 3300037466 Ga0395898_0040419 Ga0395898_0040419_3441_4058 205
531 3300037466 Ga0395898_0068167 Ga0395898_0068167_1341_1958 205
532 3300037466 Ga0395898_0082184 Ga0395898_0082184_592_1209 205
533 3300037466 Ga0395898_0178156 Ga0395898_0178156_162_779 205
534 3300037466 Ga0395898_0939881 Ga0395898_0939881_83_700 205
535 3300037471 Ga0395905_0045319 Ga0395905_0045319_1188_1805 205
536 3300037471 Ga0395905_0052769 Ga0395905_0052769_2280_2897 205
537 3300037471 Ga0395905_0125579 Ga0395905_0125579_812_1429 205
538 3300037471 Ga0395905_0139425 Ga0395905_0139425_401_1018 205
539 3300037471 Ga0395905_0620770 Ga0395905_0620770_238_855 205
540 3300037471 Ga0395905_0935759 Ga0395905_0935759_36_653 205
541 3300038443 Ga0395901_0000041 Ga0395901_0000041_177950_178567 205
542 3300038443 Ga0395901_0001052 Ga0395901_0001052_25431_26048 205
543 3300038443 Ga0395901_0001382 Ga0395901_0001382_21960_22577 205
544 3300038443 Ga0395901_0030406 Ga0395901_0030406_764_1381 205
545 3300038443 Ga0395901_0042563 Ga0395901_0042563_1885_2502 205
546 3300038443 Ga0395901_0077120 Ga0395901_0077120_2076_2693 205
547 3300038443 Ga0395901_0107709 Ga0395901_0107709_1187_1804 205
548 3300038443 Ga0395901_0201754 Ga0395901_0201754_1230_1847 205
549 3300038443 Ga0395901_0303979 Ga0395901_0303979_304_921 205
550 3300038443 Ga0395901_0416850 Ga0395901_0416850_141_758 205
551 3300038443 Ga0395901_1252324 Ga0395901_1252324_20_637 205
552 3300042876 Ga0451577_0182042 Ga0451577_0182042_1030_1647 205
553 3300044684 Ga0466966_0109629 Ga0466966_0109629_832_1449 205
554 3300044693 Ga0466961_0022886 Ga0466961_0022886_2319_2936 205
555 3300044694 Ga0466963_0274983 Ga0466963_0274983_101_718 205
556 3300044706 Ga0466964_0012089 Ga0466964_0012089_936_1553 205
557 3300044719 Ga0466971_0103311 Ga0466971_0103311_313_930 205
558 3300044765 Ga0466970_0144346 Ga0466970_0144346_369_986 205
559 3300044842 Ga0466957_0046557 Ga0466957_0046557_1541_2158 205
560 3300044842 Ga0466957_0096063 Ga0466957_0096063_1142_1759 205
561 3300045976 Ga0466967_0211690 Ga0466967_0211690_1117_1734 205
562 3300048915 Ga0496112_0499480 Ga0496112_0499480_84_701 205
563 3300049586 Ga0501070_0009033 Ga0501070_0009033_6811_7431 205
564 3300053087 Ga0500643_000375 Ga0500643_000375_7709_8344 205
565 3300053087 Ga0500643_004878 Ga0500643_004878_1224_1853 205
566 3300001915 JGI24741J21665_1004306 JGI24741J21665_10043062 206
567 3300001915 JGI24741J21665_1007966 JGI24741J21665_10079663 206
568 3300001979 JGI24740J21852_10001256 JGI24740J21852_100012561 206
569 3300001979 JGI24740J21852_10076386 JGI24740J21852_100763862 206
570 3300001990 JGI24737J22298_10003444 JGI24737J22298_100034447 206
571 3300001990 JGI24737J22298_10035489 JGI24737J22298_100354891 206
572 3300002067 JGI24735J21928_10039063 JGI24735J21928_100390632 206
573 3300002067 JGI24735J21928_10082955 JGI24735J21928_100829551 206
574 3300002075 JGI24738J21930_10069089 JGI24738J21930_100690891 206
575 3300002076 JGI24749J21850_1003662 JGI24749J21850_10036622 206
576 3300005327 Ga0070658_10001448 Ga0070658_1000144810 206
577 3300005335 Ga0070666_10031129 Ga0070666_100311294 206
578 3300005338 Ga0068868_100583937 Ga0068868_1005839372 206
579 3300005339 Ga0070660_100002668 Ga0070660_10000266810 206
580 3300005339 Ga0070660_100018975 Ga0070660_1000189752 206
581 3300005339 Ga0070660_100121550 Ga0070660_1001215502 206
582 3300005340 Ga0070689_100001313 Ga0070689_10000131313 206
583 3300005344 Ga0070661_100005833 Ga0070661_1000058335 206
584 3300005344 Ga0070661_100010311 Ga0070661_1000103116 206
585 3300005344 Ga0070661_100098709 Ga0070661_1000987092 206
586 3300005344 Ga0070661_101060905 Ga0070661_1010609051 206
587 3300005353 Ga0070669_100002670 Ga0070669_1000026701 206
588 3300005365 Ga0070688_100136682 Ga0070688_1001366822 206
589 3300005366 Ga0070659_100001323 Ga0070659_1000013238 206
590 3300005366 Ga0070659_100011779 Ga0070659_1000117792 206
591 3300005366 Ga0070659_100031264 Ga0070659_1000312642 206
592 3300005455 Ga0070663_100149413 Ga0070663_1001494132 206
593 3300005457 Ga0070662_100007810 Ga0070662_1000078108 206
594 3300005457 Ga0070662_100032436 Ga0070662_1000324365 206
595 3300005466 Ga0070685_10000391 Ga0070685_1000039114 206
596 3300005539 Ga0068853_100027433 Ga0068853_1000274334 206
597 3300005548 Ga0070665_100000019 Ga0070665_100000019284 206
598 3300005548 Ga0070665_100522029 Ga0070665_1005220292 206
599 3300005564 Ga0070664_100031546 Ga0070664_1000315464 206
600 3300005578 Ga0068854_100004180 Ga0068854_1000041807 206
601 3300005578 Ga0068854_100389464 Ga0068854_1003894642 206
602 3300005614 Ga0068856_100006069 Ga0068856_10000606910 206
603 3300005614 Ga0068856_100013223 Ga0068856_10001322311 206
604 3300005614 Ga0068856_100024005 Ga0068856_1000240054 206
605 3300005614 Ga0068856_100031032 Ga0068856_1000310325 206
606 3300005616 Ga0068852_100406317 Ga0068852_1004063172 206
607 3300005617 Ga0068859_100009320 Ga0068859_10000932011 206
608 3300005617 Ga0068859_101278750 Ga0068859_1012787502 206
609 3300005618 Ga0068864_100112887 Ga0068864_1001128871 206
610 3300005841 Ga0068863_100036130 Ga0068863_1000361307 206
611 3300005842 Ga0068858_100121833 Ga0068858_1001218332 206
612 3300005844 Ga0068862_100005735 Ga0068862_10000573512 206
613 3300006931 Ga0097620_100009320 Ga0097620_10000932011 206
614 3300006931 Ga0097620_101278727 Ga0097620_1012787272 206
615 3300009093 Ga0105240_10016809 Ga0105240_100168095 206
616 3300009177 Ga0105248_10041910 Ga0105248_100419105 206
617 3300009545 Ga0105237_10197955 Ga0105237_101979552 206
618 3300010375 Ga0105239_10136033 Ga0105239_101360332 206
619 3300013100 Ga0157373_10042823 Ga0157373_100428233 206
620 3300013102 Ga0157371_10027950 Ga0157371_100279503 206
621 3300013104 Ga0157370_10011496 Ga0157370_100114968 206
622 3300013104 Ga0157370_10048306 Ga0157370_100483063 206
623 3300013104 Ga0157370_10083023 Ga0157370_100830232 206
624 3300013104 Ga0157370_10669634 Ga0157370_106696342 206
625 3300013105 Ga0157369_10000553 Ga0157369_1000055342 206
626 3300013105 Ga0157369_10013284 Ga0157369_100132845 206
627 3300013105 Ga0157369_10111201 Ga0157369_101112013 206
628 3300013296 Ga0157374_10002140 Ga0157374_100021403 206
629 3300013296 Ga0157374_10687002 Ga0157374_106870022 206
630 3300013307 Ga0157372_10384078 Ga0157372_103840782 206
631 3300014325 Ga0163163_10518283 Ga0163163_105182831 206
632 3300014326 Ga0157380_10002492 Ga0157380_100024928 206
633 3300025321 Ga0207656_10010021 Ga0207656_100100212 206
634 3300025904 Ga0207647_10003070 Ga0207647_100030708 206
635 3300025904 Ga0207647_10051636 Ga0207647_100516362 206
636 3300025909 Ga0207705_10000060 Ga0207705_100000607 206
637 3300025909 Ga0207705_10008785 Ga0207705_100087853 206
638 3300025911 Ga0207654_10043876 Ga0207654_100438762 206
639 3300025913 Ga0207695_10003088 Ga0207695_1000308811 206
640 3300025913 Ga0207695_10008652 Ga0207695_100086528 206
641 3300025913 Ga0207695_10090117 Ga0207695_100901175 206
642 3300025914 Ga0207671_10007141 Ga0207671_100071418 206
643 3300025919 Ga0207657_10006404 Ga0207657_100064045 206
644 3300025919 Ga0207657_10053279 Ga0207657_100532794 206
645 3300025919 Ga0207657_10213544 Ga0207657_102135442 206
646 3300025920 Ga0207649_10000826 Ga0207649_100008269 206
647 3300025920 Ga0207649_10003549 Ga0207649_100035495 206
648 3300025923 Ga0207681_10000045 Ga0207681_10000045127 206
649 3300025924 Ga0207694_10005230 Ga0207694_100052303 206
650 3300025932 Ga0207690_10006516 Ga0207690_100065165 206
651 3300025932 Ga0207690_10008364 Ga0207690_100083648 206
652 3300025932 Ga0207690_10137962 Ga0207690_101379622 206
653 3300025933 Ga0207706_10064610 Ga0207706_100646104 206
654 3300025936 Ga0207670_10000902 Ga0207670_1000090214 206
655 3300025941 Ga0207711_10006753 Ga0207711_100067536 206
656 3300025941 Ga0207711_10112868 Ga0207711_101128683 206
657 3300025945 Ga0207679_10005153 Ga0207679_100051535 206
658 3300025949 Ga0207667_10005823 Ga0207667_1000582310 206
659 3300025949 Ga0207667_10080132 Ga0207667_100801322 206
660 3300025981 Ga0207640_10000668 Ga0207640_100006687 206
661 3300025981 Ga0207640_10337896 Ga0207640_103378962 206
662 3300025981 Ga0207640_11045711 Ga0207640_110457111 206
663 3300026035 Ga0207703_10000888 Ga0207703_100008886 206
664 3300026041 Ga0207639_10004048 Ga0207639_100040488 206
665 3300026041 Ga0207639_10245811 Ga0207639_102458112 206
666 3300026067 Ga0207678_10008840 Ga0207678_100088408 206
667 3300026078 Ga0207702_10005497 Ga0207702_1000549710 206
668 3300026078 Ga0207702_10005581 Ga0207702_100055815 206
669 3300026078 Ga0207702_10006296 Ga0207702_100062968 206
670 3300026078 Ga0207702_10039821 Ga0207702_100398216 206
671 3300026088 Ga0207641_10026570 Ga0207641_100265707 206
672 3300026116 Ga0207674_10132721 Ga0207674_101327212 206
673 3300026142 Ga0207698_10056929 Ga0207698_100569295 206
674 3300026142 Ga0207698_10310029 Ga0207698_103100292 206
675 3300028379 Ga0268266_10000025 Ga0268266_10000025219 206
676 3300028379 Ga0268266_10303985 Ga0268266_103039852 206
677 3300028380 Ga0268265_10006354 Ga0268265_100063549 206
678 3300037312 Ga0395899_0001223 Ga0395899_0001223_21572_22204 206
679 3300037312 Ga0395899_0029587 Ga0395899_0029587_262_882 206
680 3300037312 Ga0395899_0053773 Ga0395899_0053773_863_1483 206
681 3300037418 Ga0395900_0043389 Ga0395900_0043389_194_826 206
682 3300037418 Ga0395900_0089711 Ga0395900_0089711_2289_2909 206
683 3300037466 Ga0395898_0083186 Ga0395898_0083186_1482_2102 206
684 3300037466 Ga0395898_0288141 Ga0395898_0288141_845_1465 206
685 3300037471 Ga0395905_0223790 Ga0395905_0223790_489_1109 206
686 3300037471 Ga0395905_0253684 Ga0395905_0253684_922_1554 206
687 3300038443 Ga0395901_0001601 Ga0395901_0001601_21594_22226 206
688 3300038443 Ga0395901_0059836 Ga0395901_0059836_748_1368 206
689 3300042004 Ga0439445_0004503 Ga0439445_0004503_2185_2808 206
690 3300044658 Ga0466972_0007112 Ga0466972_0007112_2447_3109 206
691 3300048910 Ga0496107_0142273 Ga0496107_0142273_83_727 206
692 3300001979 JGI24740J21852_10003809 JGI24740J21852_100038092 207
693 3300001989 JGI24739J22299_10023731 JGI24739J22299_100237314 207
694 3300001990 JGI24737J22298_10081505 JGI24737J22298_100815052 207
695 3300002075 JGI24738J21930_10039085 JGI24738J21930_100390852 207
696 3300005327 Ga0070658_10001594 Ga0070658_100015946 207
697 3300005330 Ga0070690_100150966 Ga0070690_1001509662 207
698 3300005331 Ga0070670_100022308 Ga0070670_1000223087 207
699 3300005335 Ga0070666_10003680 Ga0070666_100036804 207
700 3300005336 Ga0070680_100015212 Ga0070680_1000152126 207
701 3300005339 Ga0070660_100017287 Ga0070660_1000172876 207
702 3300005344 Ga0070661_100023097 Ga0070661_1000230973 207
703 3300005347 Ga0070668_100896739 Ga0070668_1008967391 207
704 3300005355 Ga0070671_100143498 Ga0070671_1001434981 207
705 3300005364 Ga0070673_100047189 Ga0070673_1000471892 207
706 3300005366 Ga0070659_100067880 Ga0070659_1000678802 207
707 3300005367 Ga0070667_100375294 Ga0070667_1003752941 207
708 3300005455 Ga0070663_100004400 Ga0070663_1000044009 207
709 3300005457 Ga0070662_100049743 Ga0070662_1000497433 207
710 3300005458 Ga0070681_10249862 Ga0070681_102498621 207
711 3300005459 Ga0068867_100356926 Ga0068867_1003569262 207
712 3300005530 Ga0070679_100519647 Ga0070679_1005196472 207
713 3300005539 Ga0068853_100000413 Ga0068853_10000041327 207
714 3300005547 Ga0070693_100047858 Ga0070693_1000478584 207
715 3300005548 Ga0070665_100002091 Ga0070665_1000020916 207
716 3300005563 Ga0068855_100039453 Ga0068855_1000394535 207
717 3300005564 Ga0070664_100070104 Ga0070664_1000701042 207
718 3300005577 Ga0068857_100144897 Ga0068857_1001448974 207
719 3300005578 Ga0068854_100093222 Ga0068854_1000932222 207
720 3300005616 Ga0068852_100042340 Ga0068852_1000423404 207
721 3300005834 Ga0068851_10012161 Ga0068851_100121614 207
722 3300009174 Ga0105241_10037405 Ga0105241_100374055 207
723 3300013100 Ga0157373_10028700 Ga0157373_100287005 207
724 3300013102 Ga0157371_10060404 Ga0157371_100604042 207
725 3300013105 Ga0157369_10425953 Ga0157369_104259532 207
726 3300013307 Ga0157372_10083458 Ga0157372_100834584 207
727 3300025321 Ga0207656_10011531 Ga0207656_100115311 207
728 3300025901 Ga0207688_10155701 Ga0207688_101557012 207
729 3300025903 Ga0207680_10029223 Ga0207680_100292234 207
730 3300025904 Ga0207647_10035713 Ga0207647_100357133 207
731 3300025909 Ga0207705_10000664 Ga0207705_1000066426 207
732 3300025912 Ga0207707_10060794 Ga0207707_100607944 207
733 3300025919 Ga0207657_10008069 Ga0207657_100080699 207
734 3300025921 Ga0207652_10284000 Ga0207652_102840001 207
735 3300025925 Ga0207650_10053822 Ga0207650_100538222 207
736 3300025925 Ga0207650_10076614 Ga0207650_100766142 207
737 3300025931 Ga0207644_10028583 Ga0207644_100285832 207
738 3300025932 Ga0207690_10001355 Ga0207690_100013557 207
739 3300025933 Ga0207706_10001571 Ga0207706_100015718 207
740 3300025945 Ga0207679_10328847 Ga0207679_103288472 207
741 3300025949 Ga0207667_10122056 Ga0207667_101220563 207
742 3300025960 Ga0207651_10912754 Ga0207651_109127541 207
743 3300025981 Ga0207640_10502149 Ga0207640_105021492 207
744 3300025986 Ga0207658_10079910 Ga0207658_100799103 207
745 3300026041 Ga0207639_10000445 Ga0207639_1000044526 207
746 3300026041 Ga0207639_10262244 Ga0207639_102622442 207
747 3300026067 Ga0207678_10005785 Ga0207678_100057859 207
748 3300026089 Ga0207648_10405031 Ga0207648_104050312 207
749 3300026095 Ga0207676_10358938 Ga0207676_103589382 207
750 3300026116 Ga0207674_10098330 Ga0207674_100983302 207
751 3300026142 Ga0207698_10312868 Ga0207698_103128682 207
752 3300028379 Ga0268266_10002857 Ga0268266_100028576 207
753 3300028381 Ga0268264_10053449 Ga0268264_100534493 207
754 3300031731 Ga0307405_10604044 Ga0307405_106040442 207
755 3300031911 Ga0307412_10359153 Ga0307412_103591532 207
756 3300032002 Ga0307416_100675791 Ga0307416_1006757911 207
757 3300032126 Ga0307415_100070475 Ga0307415_1000704752 207
758 3300037471 Ga0395905_0054162 Ga0395905_0054162_1588_2211 207
759 3300001904 JGI24736J21556_1015098 JGI24736J21556_10150982 208
760 3300002067 JGI24735J21928_10057671 JGI24735J21928_100576712 208
761 3300005327 Ga0070658_10000933 Ga0070658_1000093321 208
762 3300005329 Ga0070683_100060893 Ga0070683_1000608934 208
763 3300005336 Ga0070680_100170823 Ga0070680_1001708232 208
764 3300005336 Ga0070680_100307676 Ga0070680_1003076762 208
765 3300005344 Ga0070661_100197234 Ga0070661_1001972342 208
766 3300005345 Ga0070692_10003216 Ga0070692_100032162 208
767 3300005345 Ga0070692_10004187 Ga0070692_100041876 208
768 3300005366 Ga0070659_100091277 Ga0070659_1000912773 208
769 3300005455 Ga0070663_100002474 Ga0070663_1000024746 208
770 3300005455 Ga0070663_100070634 Ga0070663_1000706344 208
771 3300005458 Ga0070681_10054733 Ga0070681_100547333 208
772 3300005458 Ga0070681_10353997 Ga0070681_103539972 208
773 3300005530 Ga0070679_100060615 Ga0070679_1000606156 208
774 3300005539 Ga0068853_100000058 Ga0068853_10000005872 208
775 3300005577 Ga0068857_100005053 Ga0068857_1000050532 208
776 3300005614 Ga0068856_100010677 Ga0068856_1000106778 208
777 3300005614 Ga0068856_100014855 Ga0068856_1000148552 208
778 3300005614 Ga0068856_100048118 Ga0068856_1000481184 208
779 3300005616 Ga0068852_100002370 Ga0068852_1000023706 208
780 3300005616 Ga0068852_100041832 Ga0068852_1000418324 208
781 3300009093 Ga0105240_10545399 Ga0105240_105453992 208
782 3300009174 Ga0105241_10276532 Ga0105241_102765322 208
783 3300009545 Ga0105237_10159389 Ga0105237_101593892 208
784 3300013100 Ga0157373_10068818 Ga0157373_100688182 208
785 3300013100 Ga0157373_10078403 Ga0157373_100784032 208
786 3300013102 Ga0157371_10017589 Ga0157371_100175897 208
787 3300013102 Ga0157371_10055135 Ga0157371_100551354 208
788 3300013104 Ga0157370_10001246 Ga0157370_100012466 208
789 3300013104 Ga0157370_10031146 Ga0157370_100311463 208
790 3300013104 Ga0157370_10047657 Ga0157370_100476572 208
791 3300013104 Ga0157370_10076230 Ga0157370_100762302 208
792 3300013105 Ga0157369_10030710 Ga0157369_100307106 208
793 3300013105 Ga0157369_10033190 Ga0157369_100331909 208
794 3300013105 Ga0157369_10203035 Ga0157369_102030352 208
795 3300025904 Ga0207647_10015919 Ga0207647_100159194 208
796 3300025904 Ga0207647_10024721 Ga0207647_100247212 208
797 3300025904 Ga0207647_10077571 Ga0207647_100775712 208
798 3300025909 Ga0207705_10043642 Ga0207705_100436422 208
799 3300025909 Ga0207705_10111888 Ga0207705_101118882 208
800 3300025914 Ga0207671_10269445 Ga0207671_102694452 208
801 3300025917 Ga0207660_10012145 Ga0207660_100121459 208
802 3300025917 Ga0207660_10085815 Ga0207660_100858153 208
803 3300025919 Ga0207657_10001311 Ga0207657_1000131115 208
804 3300025919 Ga0207657_10002990 Ga0207657_1000299010 208
805 3300025919 Ga0207657_10783019 Ga0207657_107830191 208
806 3300025920 Ga0207649_10055301 Ga0207649_100553012 208
807 3300025932 Ga0207690_10054854 Ga0207690_100548545 208
808 3300025932 Ga0207690_10355118 Ga0207690_103551181 208
809 3300025944 Ga0207661_10084487 Ga0207661_100844874 208
810 3300025949 Ga0207667_10243254 Ga0207667_102432542 208
811 3300026041 Ga0207639_10000089 Ga0207639_1000008921 208
812 3300026067 Ga0207678_10004571 Ga0207678_100045718 208
813 3300026067 Ga0207678_10037465 Ga0207678_100374656 208
814 3300026067 Ga0207678_10219107 Ga0207678_102191072 208
815 3300026078 Ga0207702_10004252 Ga0207702_100042527 208
816 3300026116 Ga0207674_10037113 Ga0207674_1003711312 208
817 3300026142 Ga0207698_10040676 Ga0207698_100406762 208
818 3300026142 Ga0207698_10848601 Ga0207698_108486012 208
819 3300037312 Ga0395899_0000162 Ga0395899_0000162_32085_32723 208
820 3300037312 Ga0395899_0057522 Ga0395899_0057522_1483_2121 208
821 3300037418 Ga0395900_0000129 Ga0395900_0000129_93583_94221 208
822 3300037418 Ga0395900_0480734 Ga0395900_0480734_12_650 208
823 3300037466 Ga0395898_0002741 Ga0395898_0002741_7433_8071 208
824 3300037466 Ga0395898_0301807 Ga0395898_0301807_750_1388 208
825 3300037471 Ga0395905_0101435 Ga0395905_0101435_1853_2479 208
826 3300037471 Ga0395905_0101716 Ga0395905_0101716_1785_2423 208
827 3300037471 Ga0395905_0173116 Ga0395905_0173116_1054_1692 208
828 3300037471 Ga0395905_0743668 Ga0395905_0743668_44_688 208
829 3300038443 Ga0395901_0000111 Ga0395901_0000111_79808_80446 208
830 3300038443 Ga0395901_0035659 Ga0395901_0035659_3644_4282 208
831 3300038443 Ga0395901_0226123 Ga0395901_0226123_1149_1787 208
832 3300044658 Ga0466972_0164660 Ga0466972_0164660_71_700 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

117

0.99

PF00196

GerE

Bacterial regulatory proteins, luxR family

141

197

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.9697 130 203
1dck-assembly1.cif.gz_A structure of unphosphorylated fixj-n complexed with mn2+ 0.9666 8 123
3p7n-assembly2.cif.gz_B crystal structure of light activated transcription factor el222 from erythrobacter litoralis 0.9556 132 203
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9445 142 203
4d6x-assembly1.cif.gz_A crystal structure of the receiver domain of ntrx from brucella abortus 0.9439 9 123
ID Description Score Start End Superfamily
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9709 134 203 1.10.10.10
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9642 8 85 3.40.50.2300
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9528 134 203 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 145 200 1.10.10.10
1dckB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9503 1 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7T2GJG6-F1-model_v4 Response regulator transcription factor 0.955 1 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A2E9AFR6-F1-model_v4 DNA-binding response regulator 0.9399 6 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A6G9ND94-F1-model_v4 Response regulator transcription factor 0.9343 6 203 GO:0000160
GO:0003677
GO:0006355
AF-A0A7T2GJG6-F1-model_v4 Response regulator transcription factor 0.9326 1 208 GO:0000160
GO:0003677
GO:0006355
AF-T0GVY3-F1-model_v4 Chemotaxis protein CheY 0.929 1 207 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
89.65 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map