F482670

General Info

Members Datasets Scaffolds Average Seq Length
830 402 822 179

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0016453|Ga0500568_0016453_854_1507
Length 217
Sequence VDDRDFWAKTRFALLPGRDERMLIQTCRLISSAPMSSLEIRPTAEADLSAITEIYGQAVRYGTATFELIPPDLAEMTRRFAVLRDGGFPYFVAALDGRVVGYAYASAYRPRPAYRFTIENSVYLDPAIHRRGIGLQLLQRLIAESEARGYRQMIAVIGDSANAGSIAVHTRCGFQMIGTHPNVGFKFGRWLDTVMMQRALREGGMTVPADGSTSVQR

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
3 2791355199
4 2922425934
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
359 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
377 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
399 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
400 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
401 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
402 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.12
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0.96
Rhizoplane 7.71
Rhizosphere 79.16
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001038 3300003203 Bacteria 12982
2 Ga0070658_10027535 3300005327 Bacteria 4559
3 Ga0070658_10286708 3300005327 Bacteria 1402
4 Ga0070676_10324087 3300005328 Bacteria 1052
5 Ga0070683_100017946 3300005329 Bacteria 6256
6 Ga0070683_100800069 3300005329 Bacteria 904
7 Ga0070690_100137371 3300005330 Bacteria 1656
8 Ga0070670_100184713 3300005331 Bacteria 1810
9 Ga0068869_100064257 3300005334 Bacteria 2699
10 Ga0068869_100382589 3300005334 Bacteria 1154
11 Ga0070666_10383185 3300005335 Bacteria 1009
12 Ga0070680_100074496 3300005336 Bacteria 2793
13 Ga0070680_100126836 3300005336 Bacteria 2132
14 Ga0070680_100361541 3300005336 Bacteria 1235
15 Ga0070682_100709271 3300005337 Bacteria 808
16 Ga0068868_100162651 3300005338 Bacteria 1844
17 Ga0068868_100682213 3300005338 Bacteria 917
18 Ga0070660_100001927 3300005339 Bacteria 14295
19 Ga0070689_100820970 3300005340 Bacteria 819
20 Ga0070691_10050950 3300005341 Bacteria 1976
21 Ga0070687_100760691 3300005343 Bacteria 683
22 Ga0070661_100050714 3300005344 Bacteria 3036
23 Ga0070661_100589486 3300005344 Bacteria 898
24 Ga0070675_100522164 3300005354 Bacteria 1071
25 Ga0070675_100591740 3300005354 Bacteria 1006
26 Ga0070671_100758109 3300005355 Bacteria 844
27 Ga0070674_100768080 3300005356 Bacteria 830
28 Ga0070673_100212996 3300005364 Bacteria 1669
29 Ga0070673_100588216 3300005364 Bacteria 1014
30 Ga0070673_100632025 3300005364 Bacteria 979
31 Ga0070673_100742133 3300005364 Bacteria 904
32 Ga0070673_101102603 3300005364 Bacteria 741
33 Ga0070688_100289591 3300005365 Bacteria 1180
34 Ga0070659_100084996 3300005366 Bacteria 2530
35 Ga0070659_100131163 3300005366 Bacteria 2035
36 Ga0070659_100595671 3300005366 Bacteria 949
37 Ga0070659_100663781 3300005366 Bacteria 900
38 Ga0070667_100300816 3300005367 Bacteria 1444
39 Ga0070709_10014869 3300005434 Bacteria 4414
40 Ga0070709_10536023 3300005434 Bacteria 894
41 Ga0070714_100191652 3300005435 Bacteria 1866
42 Ga0070701_10227418 3300005438 Bacteria 1115
43 Ga0070711_100220011 3300005439 Bacteria 1475
44 Ga0070711_100369176 3300005439 Bacteria 1158
45 Ga0070708_100353150 3300005445 Bacteria 1386
46 Ga0070663_100051597 3300005455 Bacteria 2931
47 Ga0070663_100055706 3300005455 Bacteria 2831
48 Ga0070663_100155680 3300005455 Bacteria 1756
49 Ga0070663_100334575 3300005455 Bacteria 1221
50 Ga0070663_100352173 3300005455 Bacteria 1192
51 Ga0070663_100720227 3300005455 Bacteria 850
52 Ga0070678_100075681 3300005456 Bacteria 2533
53 Ga0070678_100096396 3300005456 Bacteria 2282
54 Ga0070678_100119951 3300005456 Bacteria 2072
55 Ga0070678_100181951 3300005456 Bacteria 1721
56 Ga0070678_100188119 3300005456 Bacteria 1696
57 Ga0070678_100691876 3300005456 Bacteria 918
58 Ga0070662_100213843 3300005457 Bacteria 1535
59 Ga0070662_100293353 3300005457 Bacteria 1319
60 Ga0070681_10169332 3300005458 Bacteria 2106
61 Ga0068867_100257444 3300005459 Bacteria 1421
62 Ga0070685_10141415 3300005466 Bacteria 1515
63 Ga0070706_100710647 3300005467 Bacteria 932
64 Ga0070707_100142842 3300005468 Bacteria 2330
65 Ga0070698_100148394 3300005471 Bacteria 2294
66 Ga0070679_100138520 3300005530 Bacteria 2414
67 Ga0070679_100163428 3300005530 Bacteria 2200
68 Ga0070679_100341757 3300005530 Bacteria 1445
69 Ga0070679_100411099 3300005530 Bacteria 1299
70 Ga0070684_100028804 3300005535 Bacteria 4700
71 Ga0070684_101184504 3300005535 Bacteria 719
72 Ga0070697_100200902 3300005536 Bacteria 1694
73 Ga0070697_100627630 3300005536 Bacteria 945
74 Ga0068853_100000920 3300005539 Bacteria 20589
75 Ga0068853_100075228 3300005539 Bacteria 2947
76 Ga0068853_100116332 3300005539 Bacteria 2380
77 Ga0068853_100647449 3300005539 Bacteria 1005
78 Ga0070672_100231798 3300005543 Bacteria 1551
79 Ga0070672_100418482 3300005543 Bacteria 1151
80 Ga0070686_100782264 3300005544 Bacteria 768
81 Ga0070693_100059830 3300005547 Bacteria 2209
82 Ga0070693_100066801 3300005547 Bacteria 2105
83 Ga0070665_100058941 3300005548 Bacteria 3848
84 Ga0070665_100162041 3300005548 Bacteria 2238
85 Ga0070665_100182360 3300005548 Bacteria 2100
86 Ga0070665_100238690 3300005548 Bacteria 1818
87 Ga0070665_100324243 3300005548 Bacteria 1544
88 Ga0070665_100458723 3300005548 Bacteria 1284
89 Ga0068855_100029481 3300005563 Bacteria 6559
90 Ga0068855_100046913 3300005563 Bacteria 5106
91 Ga0068855_100166647 3300005563 Bacteria 2497
92 Ga0068855_100188673 3300005563 Bacteria 2326
93 Ga0068855_100505594 3300005563 Bacteria 1313
94 Ga0070664_100171516 3300005564 Bacteria 1924
95 Ga0070664_100238331 3300005564 Bacteria 1632
96 Ga0070664_100678646 3300005564 Bacteria 959
97 Ga0068857_100001037 3300005577 Bacteria 21487
98 Ga0068857_100223783 3300005577 Bacteria 1719
99 Ga0068857_101300699 3300005577 Bacteria 706
100 Ga0068854_100003979 3300005578 Bacteria 9266
101 Ga0068854_100323281 3300005578 Bacteria 1255
102 Ga0068854_100899502 3300005578 Bacteria 778
103 Ga0068854_101097191 3300005578 Bacteria 709
104 Ga0068856_100000883 3300005614 Bacteria 32112
105 Ga0068856_100004208 3300005614 Bacteria 14365
106 Ga0068856_100152442 3300005614 Bacteria 2321
107 Ga0068856_100262760 3300005614 Bacteria 1742
108 Ga0068856_100999315 3300005614 Bacteria 855
109 Ga0070702_100150872 3300005615 Bacteria 1492
110 Ga0070702_100267869 3300005615 Bacteria 1166
111 Ga0070702_100344973 3300005615 Bacteria 1046
112 Ga0070702_100404374 3300005615 Bacteria 978
113 Ga0068852_100034011 3300005616 Bacteria 4239
114 Ga0068852_100126529 3300005616 Bacteria 2347
115 Ga0068852_100142386 3300005616 Bacteria 2220
116 Ga0068852_100170191 3300005616 Bacteria 2041
117 Ga0068852_100441012 3300005616 Bacteria 1287
118 Ga0068852_101564800 3300005616 Bacteria 682
119 Ga0068859_100254022 3300005617 Bacteria 1848
120 Ga0068864_100203460 3300005618 Bacteria 1820
121 Ga0068864_100268989 3300005618 Bacteria 1587
122 Ga0068864_100614808 3300005618 Bacteria 1056
123 Ga0068866_10222960 3300005718 Bacteria 1139
124 Ga0068861_100019124 3300005719 Bacteria 4892
125 Ga0068861_100205381 3300005719 Bacteria 1656
126 Ga0068861_100404123 3300005719 Bacteria 1213
127 Ga0068861_100457085 3300005719 Bacteria 1145
128 Ga0068861_100920026 3300005719 Bacteria 830
129 Ga0068851_10006246 3300005834 Bacteria 5436
130 Ga0068851_10034786 3300005834 Bacteria 2516
131 Ga0068870_10598458 3300005840 Bacteria 749
132 Ga0068870_10647281 3300005840 Bacteria 723
133 Ga0068863_100296697 3300005841 Bacteria 1567
134 Ga0068858_100218548 3300005842 Bacteria 1804
135 Ga0068858_100330736 3300005842 Bacteria 1457
136 Ga0068858_100368348 3300005842 Bacteria 1378
137 Ga0068858_100392424 3300005842 Bacteria 1333
138 Ga0068860_100089952 3300005843 Bacteria 2923
139 Ga0068862_100266806 3300005844 Bacteria 1564
140 Ga0068862_100284118 3300005844 Bacteria 1517
141 Ga0068862_100369106 3300005844 Bacteria 1335
142 Ga0068862_100529498 3300005844 Bacteria 1122
143 Ga0068862_101403950 3300005844 Bacteria 702
144 Ga0081455_10025851 3300005937 Bacteria 5412
145 Ga0081455_10178537 3300005937 Bacteria 1610
146 Ga0081455_10249018 3300005937 Bacteria 1301
147 Ga0081538_10032665 3300005981 Bacteria 3480
148 Ga0081540_1000191 3300005983 Bacteria 63533
149 Ga0081540_1016110 3300005983 Bacteria 4699
150 Ga0081540_1019271 3300005983 Bacteria 4154
151 Ga0081540_1085029 3300005983 Bacteria 1410
152 Ga0081539_10000371 3300005985 Bacteria 98455
153 Ga0081539_10003753 3300005985 Bacteria 18030
154 Ga0081539_10035788 3300005985 Bacteria 2979
155 Ga0070717_10053768 3300006028 Bacteria 3319
156 Ga0070717_10306388 3300006028 Bacteria 1413
157 Ga0070717_10871034 3300006028 Bacteria 820
158 Ga0075365_10031473 3300006038 Bacteria 3403
159 Ga0075365_10318503 3300006038 Bacteria 1095
160 Ga0075365_10356865 3300006038 Bacteria 1030
161 Ga0075363_100040546 3300006048 Bacteria 2454
162 Ga0075363_100042055 3300006048 Bacteria 2412
163 Ga0075363_100059837 3300006048 Bacteria 2049
164 Ga0075363_100189089 3300006048 Bacteria 1174
165 Ga0075364_10081058 3300006051 Bacteria 2146
166 Ga0075364_10407697 3300006051 Bacteria 928
167 Ga0070716_100005454 3300006173 Bacteria 6164
168 Ga0070716_100208126 3300006173 Bacteria 1305
169 Ga0070712_100051297 3300006175 Bacteria 2873
170 Ga0075367_10022578 3300006178 Bacteria 3531
171 Ga0075367_10129008 3300006178 Bacteria 1562
172 Ga0075367_10204275 3300006178 Bacteria 1235
173 Ga0075369_10054951 3300006186 Bacteria 1729
174 Ga0075369_10094096 3300006186 Bacteria 1339
175 Ga0075369_10158915 3300006186 Bacteria 1035
176 Ga0097621_100465752 3300006237 Bacteria 1140
177 Ga0097621_100939775 3300006237 Bacteria 807
178 Ga0068871_101062922 3300006358 Bacteria 756
179 Ga0075434_100289220 3300006871 Bacteria 1659
180 Ga0075434_101225456 3300006871 Bacteria 762
181 Ga0068865_100097523 3300006881 Bacteria 2146
182 Ga0068865_100392575 3300006881 Bacteria 1135
183 Ga0097620_100254024 3300006931 Bacteria 1848
184 Ga0099794_10093674 3300007265 Bacteria 1493
185 Ga0099795_10012860 3300007788 Bacteria 2551
186 Ga0099795_10121689 3300007788 Bacteria 1044
187 Ga0099795_10226511 3300007788 Bacteria 798
188 Ga0105240_10002459 3300009093 Bacteria 29768
189 Ga0105240_10092073 3300009093 Bacteria 3702
190 Ga0105240_10175273 3300009093 Bacteria 2535
191 Ga0105240_11479283 3300009093 Bacteria 712
192 Ga0111539_11207958 3300009094 Bacteria 878
193 Ga0105245_10287261 3300009098 Bacteria 1610
194 Ga0105247_10443916 3300009101 Bacteria 934
195 Ga0105247_10537262 3300009101 Bacteria 857
196 Ga0105243_10132920 3300009148 Bacteria 2114
197 Ga0105243_10688127 3300009148 Bacteria 995
198 Ga0105241_10068388 3300009174 Bacteria 2752
199 Ga0105241_10205614 3300009174 Bacteria 1647
200 Ga0105241_10843530 3300009174 Bacteria 847
201 Ga0105241_11185215 3300009174 Bacteria 723
202 Ga0105242_10493261 3300009176 Bacteria 1163
203 Ga0105242_10649936 3300009176 Bacteria 1025
204 Ga0105242_10849883 3300009176 Bacteria 908
205 Ga0105248_10089282 3300009177 Bacteria 3469
206 Ga0105248_10384390 3300009177 Bacteria 1580
207 Ga0105248_10677427 3300009177 Bacteria 1163
208 Ga0105248_10998438 3300009177 Bacteria 945
209 Ga0105237_10050492 3300009545 Bacteria 4179
210 Ga0105237_10285970 3300009545 Bacteria 1651
211 Ga0105237_10604474 3300009545 Bacteria 1104
212 Ga0105237_11107051 3300009545 Bacteria 799
213 Ga0105238_10001235 3300009551 Bacteria 25716
214 Ga0105238_10004895 3300009551 Bacteria 13252
215 Ga0105238_10263712 3300009551 Bacteria 1703
216 Ga0105238_10606697 3300009551 Bacteria 1103
217 Ga0105238_11162681 3300009551 Bacteria 795
218 Ga0105249_10862548 3300009553 Bacteria 971
219 Ga0105249_10918118 3300009553 Bacteria 943
220 Ga0105249_11073679 3300009553 Bacteria 875
221 Ga0099796_10016687 3300010159 Bacteria 2173
222 Ga0099796_10051347 3300010159 Bacteria 1432
223 Ga0105239_10047033 3300010375 Bacteria 4727
224 Ga0105239_10168725 3300010375 Bacteria 2447
225 Ga0105239_10442999 3300010375 Bacteria 1473
226 Ga0105239_10568052 3300010375 Bacteria 1292
227 Ga0105239_10839731 3300010375 Bacteria 1053
228 Ga0105239_11506916 3300010375 Bacteria 777
229 Ga0105246_10339482 3300011119 Bacteria 1227
230 Ga0105246_10381348 3300011119 Bacteria 1165
231 Ga0105246_10388473 3300011119 Bacteria 1155
232 Ga0105246_10696584 3300011119 Bacteria 890
233 Ga0157371_10142321 3300013102 Bacteria 1708
234 Ga0157370_10051849 3300013104 Bacteria 3918
235 Ga0157369_10002556 3300013105 Bacteria 21777
236 Ga0157369_10223644 3300013105 Bacteria 1969
237 Ga0157374_10154653 3300013296 Bacteria 2231
238 Ga0157378_10020601 3300013297 Bacteria 5799
239 Ga0157378_10318981 3300013297 Bacteria 1509
240 Ga0163162_10411441 3300013306 Bacteria 1485
241 Ga0163162_10550641 3300013306 Bacteria 1282
242 Ga0163162_10621464 3300013306 Bacteria 1205
243 Ga0163162_10670838 3300013306 Bacteria 1160
244 Ga0163162_10763602 3300013306 Bacteria 1086
245 Ga0163162_11712813 3300013306 Bacteria 718
246 Ga0157372_11653391 3300013307 Bacteria 737
247 Ga0163163_10081541 3300014325 Bacteria 3237
248 Ga0163163_10478401 3300014325 Bacteria 1306
249 Ga0163163_10887889 3300014325 Bacteria 955
250 Ga0163163_10914754 3300014325 Bacteria 941
251 Ga0163163_11372648 3300014325 Bacteria 768
252 Ga0157380_10797546 3300014326 Bacteria 961
253 Ga0157377_10117811 3300014745 Bacteria 1605
254 Ga0157379_10378242 3300014968 Bacteria 1299
255 Ga0157379_10481907 3300014968 Bacteria 1148
256 Ga0157376_10137875 3300014969 Bacteria 2185
257 Ga0157376_10240032 3300014969 Bacteria 1688
258 Ga0157376_10320265 3300014969 Bacteria 1474
259 Ga0157376_10562992 3300014969 Bacteria 1129
260 Ga0157376_10833860 3300014969 Bacteria 936
261 Ga0213871_10014132 3300021441 Bacteria 1888
262 Ga0209233_1018543 3300025261 Bacteria 1869
263 Ga0209758_1001013 3300025297 Bacteria 37209
264 Ga0207697_10068684 3300025315 Bacteria 1483
265 Ga0207697_10230004 3300025315 Bacteria 819
266 Ga0207656_10022809 3300025321 Bacteria 2515
267 Ga0207656_10031168 3300025321 Bacteria 2207
268 Ga0207656_10223490 3300025321 Bacteria 916
269 Ga0207696_1040275 3300025711 Bacteria 1369
270 Ga0207692_10006838 3300025898 Bacteria 4643
271 Ga0207642_10081164 3300025899 Bacteria 1575
272 Ga0207642_10366082 3300025899 Bacteria 854
273 Ga0207710_10169861 3300025900 Bacteria 1066
274 Ga0207688_10439939 3300025901 Bacteria 812
275 Ga0207647_10027240 3300025904 Bacteria 3728
276 Ga0207699_10042859 3300025906 Bacteria 2625
277 Ga0207645_10280161 3300025907 Bacteria 1107
278 Ga0207645_10329900 3300025907 Bacteria 1019
279 Ga0207645_10352424 3300025907 Bacteria 985
280 Ga0207643_10070154 3300025908 Bacteria 2015
281 Ga0207643_10231242 3300025908 Bacteria 1134
282 Ga0207705_10071743 3300025909 Bacteria 2511
283 Ga0207705_10363006 3300025909 Bacteria 1117
284 Ga0207705_10843515 3300025909 Bacteria 711
285 Ga0207684_10159090 3300025910 Bacteria 1944
286 Ga0207654_10001655 3300025911 Bacteria 11645
287 Ga0207654_10013803 3300025911 Bacteria 4162
288 Ga0207654_10385056 3300025911 Bacteria 972
289 Ga0207654_10490580 3300025911 Bacteria 866
290 Ga0207707_10017344 3300025912 Bacteria 6277
291 Ga0207695_10000387 3300025913 Bacteria 99734
292 Ga0207695_10155099 3300025913 Bacteria 2225
293 Ga0207671_10018972 3300025914 Bacteria 5269
294 Ga0207671_10021648 3300025914 Bacteria 4874
295 Ga0207671_10624364 3300025914 Bacteria 858
296 Ga0207693_10003895 3300025915 Bacteria 12708
297 Ga0207693_10004610 3300025915 Bacteria 11630
298 Ga0207663_10442873 3300025916 Bacteria 1001
299 Ga0207663_10650283 3300025916 Bacteria 832
300 Ga0207660_10005223 3300025917 Bacteria 8436
301 Ga0207660_10024440 3300025917 Bacteria 4091
302 Ga0207660_10064187 3300025917 Bacteria 2650
303 Ga0207662_10407233 3300025918 Bacteria 923
304 Ga0207657_10331115 3300025919 Bacteria 1203
305 Ga0207657_10518115 3300025919 Bacteria 933
306 Ga0207657_10550412 3300025919 Bacteria 902
307 Ga0207649_10448634 3300025920 Bacteria 973
308 Ga0207652_10006970 3300025921 Bacteria 9104
309 Ga0207652_10456565 3300025921 Bacteria 1151
310 Ga0207652_10736488 3300025921 Bacteria 878
311 Ga0207646_10425433 3300025922 Bacteria 1199
312 Ga0207681_10715308 3300025923 Bacteria 833
313 Ga0207694_10000121 3300025924 Bacteria 83123
314 Ga0207694_10016807 3300025924 Bacteria 5528
315 Ga0207694_10555966 3300025924 Bacteria 963
316 Ga0207650_10098980 3300025925 Bacteria 2241
317 Ga0207650_10614928 3300025925 Bacteria 914
318 Ga0207650_10798314 3300025925 Bacteria 800
319 Ga0207659_10895741 3300025926 Bacteria 763
320 Ga0207687_10353901 3300025927 Bacteria 1197
321 Ga0207687_10385443 3300025927 Bacteria 1149
322 Ga0207687_10561005 3300025927 Bacteria 959
323 Ga0207700_10037943 3300025928 Bacteria 3494
324 Ga0207690_10138871 3300025932 Bacteria 1788
325 Ga0207690_10305471 3300025932 Bacteria 1246
326 Ga0207690_10367308 3300025932 Bacteria 1141
327 Ga0207706_10272628 3300025933 Bacteria 1476
328 Ga0207706_10392382 3300025933 Bacteria 1204
329 Ga0207686_10262052 3300025934 Bacteria 1268
330 Ga0207709_10727289 3300025935 Bacteria 796
331 Ga0207704_10121863 3300025938 Bacteria 1787
332 Ga0207704_10973754 3300025938 Bacteria 716
333 Ga0207665_10006607 3300025939 Bacteria 7691
334 Ga0207691_10043997 3300025940 Bacteria 4112
335 Ga0207691_10441233 3300025940 Bacteria 1108
336 Ga0207711_10048929 3300025941 Bacteria 3618
337 Ga0207711_10250102 3300025941 Bacteria 1627
338 Ga0207711_10354486 3300025941 Bacteria 1359
339 Ga0207711_10692327 3300025941 Bacteria 951
340 Ga0207689_10098911 3300025942 Bacteria 2397
341 Ga0207661_10011150 3300025944 Bacteria 6500
342 Ga0207661_10528501 3300025944 Bacteria 1079
343 Ga0207679_10196054 3300025945 Bacteria 1683
344 Ga0207679_10269997 3300025945 Bacteria 1454
345 Ga0207667_10016621 3300025949 Bacteria 8307
346 Ga0207667_10022419 3300025949 Bacteria 6977
347 Ga0207667_10152080 3300025949 Bacteria 2381
348 Ga0207667_10582154 3300025949 Bacteria 1130
349 Ga0207651_10204727 3300025960 Bacteria 1584
350 Ga0207651_10446210 3300025960 Bacteria 1109
351 Ga0207712_10065403 3300025961 Bacteria 2595
352 Ga0207712_10286617 3300025961 Bacteria 1346
353 Ga0207712_10774398 3300025961 Bacteria 842
354 Ga0207712_10787931 3300025961 Bacteria 835
355 Ga0207668_10236505 3300025972 Bacteria 1475
356 Ga0207640_10015818 3300025981 Bacteria 4376
357 Ga0207640_10753416 3300025981 Bacteria 840
358 Ga0207640_11053587 3300025981 Bacteria 718
359 Ga0207677_10120722 3300026023 Bacteria 1971
360 Ga0207677_10556727 3300026023 Bacteria 1000
361 Ga0207703_10149148 3300026035 Bacteria 2037
362 Ga0207703_10165463 3300026035 Bacteria 1940
363 Ga0207703_10223960 3300026035 Bacteria 1683
364 Ga0207703_10535095 3300026035 Bacteria 1103
365 Ga0207639_10024254 3300026041 Bacteria 4387
366 Ga0207639_10291502 3300026041 Bacteria 1439
367 Ga0207639_10494735 3300026041 Bacteria 1116
368 Ga0207639_10705210 3300026041 Bacteria 936
369 Ga0207678_10037796 3300026067 Bacteria 4198
370 Ga0207678_10207968 3300026067 Bacteria 1674
371 Ga0207678_10412006 3300026067 Bacteria 1171
372 Ga0207678_10476937 3300026067 Bacteria 1086
373 Ga0207678_10590108 3300026067 Bacteria 973
374 Ga0207678_10712880 3300026067 Bacteria 883
375 Ga0207708_10330433 3300026075 Bacteria 1246
376 Ga0207708_10397591 3300026075 Bacteria 1139
377 Ga0207702_10000004 3300026078 Bacteria 422182
378 Ga0207702_10000318 3300026078 Bacteria 55209
379 Ga0207702_10286369 3300026078 Bacteria 1559
380 Ga0207702_10555193 3300026078 Bacteria 1124
381 Ga0207702_10580899 3300026078 Bacteria 1098
382 Ga0207648_10243902 3300026089 Bacteria 1600
383 Ga0207676_10554519 3300026095 Bacteria 1098
384 Ga0207674_10005764 3300026116 Bacteria 14691
385 Ga0207674_10199148 3300026116 Bacteria 1952
386 Ga0207674_10441985 3300026116 Bacteria 1257
387 Ga0207674_10840680 3300026116 Bacteria 885
388 Ga0207675_100059792 3300026118 Bacteria 3557
389 Ga0207675_100289091 3300026118 Bacteria 1594
390 Ga0207675_100429708 3300026118 Bacteria 1306
391 Ga0207675_100889986 3300026118 Bacteria 906
392 Ga0207683_10036296 3300026121 Bacteria 4291
393 Ga0207683_10077838 3300026121 Bacteria 2938
394 Ga0207683_10088714 3300026121 Bacteria 2752
395 Ga0207683_10231570 3300026121 Bacteria 1685
396 Ga0207683_10634552 3300026121 Bacteria 989
397 Ga0207698_10089767 3300026142 Bacteria 2511
398 Ga0207698_10296821 3300026142 Bacteria 1502
399 Ga0207698_10528381 3300026142 Bacteria 1152
400 Ga0207698_10921632 3300026142 Bacteria 882
401 Ga0207698_11029131 3300026142 Bacteria 835
402 Ga0209589_1000035 3300027357 Bacteria 134091
403 Ga0209489_100079 3300027361 Bacteria 134091
404 Ga0209700_100077 3300027363 Bacteria 134091
405 Ga0209813_10132321 3300027866 Bacteria 879
406 Ga0265357_1012247 3300028023 Bacteria 882
407 Ga0268266_10001906 3300028379 Bacteria 23472
408 Ga0268266_10009681 3300028379 Bacteria 8469
409 Ga0268266_10203362 3300028379 Bacteria 1813
410 Ga0268266_10228389 3300028379 Bacteria 1713
411 Ga0268266_10434822 3300028379 Bacteria 1245
412 Ga0268266_11297274 3300028379 Bacteria 703
413 Ga0268265_10096092 3300028380 Bacteria 2380
414 Ga0268265_10384998 3300028380 Bacteria 1291
415 Ga0268265_10531312 3300028380 Bacteria 1113
416 Ga0268264_10633722 3300028381 Bacteria 1056
417 Ga0265334_10006202 3300028573 Bacteria 5171
418 Ga0307517_10138245 3300028786 Bacteria 1722
419 Ga0307515_10256975 3300028794 Bacteria 1490
420 Ga0265338_10365098 3300028800 Bacteria 1035
421 Ga0265762_1013881 3300030760 Bacteria 1450
422 Ga0265330_10146619 3300031235 Bacteria 1003
423 Ga0265332_10006837 3300031238 Bacteria 5171
424 Ga0265328_10231538 3300031239 Bacteria 705
425 Ga0265325_10032360 3300031241 Bacteria 2792
426 Ga0265340_10012805 3300031247 Bacteria 4425
427 Ga0265339_10054742 3300031249 Bacteria 2166
428 Ga0265331_10058682 3300031250 Bacteria 1821
429 Ga0265316_10235800 3300031344 Bacteria 1346
430 Ga0307508_10084039 3300031616 Bacteria 2766
431 Ga0265314_10077282 3300031711 Bacteria 2209
432 Ga0265342_10105236 3300031712 Bacteria 1603
433 Ga0265342_10111267 3300031712 Bacteria 1550
434 Ga0265342_10113343 3300031712 Bacteria 1532
435 Ga0307516_10029260 3300031730 Bacteria 5570
436 Ga0307516_10105054 3300031730 Bacteria 2636
437 Ga0307516_10132990 3300031730 Bacteria 2265
438 Ga0307405_10543836 3300031731 Bacteria 939
439 Ga0307413_11058891 3300031824 Bacteria 698
440 Ga0307412_10183578 3300031911 Bacteria 1576
441 Ga0307409_100301760 3300031995 Bacteria 1490
442 Ga0307409_102298704 3300031995 Bacteria 568
443 Ga0307416_100991158 3300032002 Bacteria 943
444 Ga0307416_101018883 3300032002 Bacteria 931
445 Ga0307411_10287119 3300032005 Bacteria 1313
446 Ga0307411_10487544 3300032005 Bacteria 1039
447 Ga0307415_100729374 3300032126 Bacteria 897
448 Ga0307510_10024915 3300033180 Bacteria 6908
449 Ga0373934_0006674 3300035086 Bacteria 4287
450 Ga0373934_0030953 3300035086 Bacteria 2094
451 Ga0373944_0015410 3300035089 Bacteria 2145
452 Ga0373952_0076648 3300035092 Bacteria 846
453 Ga0373923_0003012 3300035111 Bacteria 5323
454 Ga0373923_0100092 3300035111 Bacteria 1277
455 Ga0373932_0198358 3300035112 Bacteria 712
456 Ga0373936_0041823 3300035113 Bacteria 1838
457 Ga0373936_0062817 3300035113 Bacteria 1519
458 Ga0373941_0059088 3300035115 Bacteria 1242
459 Ga0373953_0003523 3300035117 Bacteria 4889
460 Ga0373954_0001251 3300035118 Bacteria 10243
461 Ga0373954_0098981 3300035118 Bacteria 1406
462 Ga0373954_0473317 3300035118 Bacteria 620
463 Ga0373956_0002392 3300035119 Bacteria 7665
464 Ga0373957_0003300 3300035120 Bacteria 4753
465 Ga0373957_0181370 3300035120 Bacteria 873
466 Ga0373943_0018879 3300035170 Bacteria 3170
467 Ga0373943_0057672 3300035170 Bacteria 1930
468 Ga0373946_0032123 3300035171 Bacteria 2107
469 Ga0373955_0007575 3300035172 Bacteria 4997
470 Ga0373942_0127281 3300035207 Bacteria 801
471 Ga0373961_0111746 3300035241 Bacteria 896
472 Ga0373962_0085828 3300035242 Bacteria 962
473 Ga0373924_0037044 3300035410 Bacteria 1984
474 Ga0373931_0015889 3300035691 Bacteria 3697
475 Ga0373931_0057737 3300035691 Bacteria 2082
476 Ga0373935_0011386 3300035692 Bacteria 5340
477 Ga0373927_0000766 3300035695 Bacteria 24573
478 Ga0373927_0006850 3300035695 Bacteria 7747
479 Ga0373933_0000218 3300035724 Bacteria 37928
480 Ga0373933_0006129 3300035724 Bacteria 6547
481 Ga0373933_0658781 3300035724 Bacteria 688
482 Ga0373933_0802080 3300035724 Bacteria 620
483 Ga0373947_0000310 3300035725 Bacteria 27577
484 Ga0373947_0020656 3300035725 Bacteria 3804
485 Ga0373947_0282245 3300035725 Bacteria 1104
486 Ga0373937_0013830 3300036401 Bacteria 7111
487 Ga0373937_0101471 3300036401 Bacteria 2671
488 Ga0373937_0255663 3300036401 Bacteria 1651
489 Ga0373937_0508729 3300036401 Bacteria 1144
490 Ga0373925_0002455 3300037068 Bacteria 14850
491 Ga0436365_0585753 3300039437 Bacteria 654
492 Ga0436360_1122847 3300039438 Bacteria 640
493 Ga0436361_0042502 3300039447 Bacteria 4823
494 Ga0436363_0081426 3300039450 Bacteria 775
495 Ga0436363_0802555 3300039450 Bacteria 2593
496 Ga0436362_0261438 3300039453 Bacteria 614
497 Ga0439458_0071754 3300042157 Bacteria 875
498 Ga0439459_0013441 3300042438 Bacteria 1474
499 Ga0466969_0282419 3300044656 Bacteria 752
500 Ga0466966_0152331 3300044684 Bacteria 1410
501 Ga0466963_0203223 3300044694 Bacteria 1386
502 Ga0466971_0191701 3300044719 Bacteria 963
503 Ga0466970_0382122 3300044765 Bacteria 802
504 Ga0466959_0203327 3300045049 Bacteria 1378
505 Ga0466967_0309991 3300045976 Bacteria 1520
506 Ga0466967_0504505 3300045976 Bacteria 1188
507 Ga0466967_0852621 3300045976 Bacteria 905
508 Ga0495617_083339 3300046452 Bacteria 1047
509 Ga0495592_0004510 3300046454 Bacteria 10194
510 Ga0495592_0064253 3300046454 Bacteria 2690
511 Ga0495603_0000801 3300046455 Bacteria 18013
512 Ga0495603_0043798 3300046455 Bacteria 2671
513 Ga0495603_0087655 3300046455 Bacteria 1821
514 Ga0495629_0003266 3300046459 Bacteria 12271
515 Ga0495629_0007739 3300046459 Bacteria 7906
516 Ga0495629_0202273 3300046459 Bacteria 1373
517 Ga0495641_0002198 3300046461 Bacteria 15577
518 Ga0495651_0009476 3300046462 Bacteria 7477
519 Ga0495651_0097928 3300046462 Bacteria 2189
520 Ga0495653_0008190 3300046463 Bacteria 8561
521 Ga0495580_0583448 3300046472 Bacteria 740
522 Ga0495582_0000855 3300046473 Bacteria 16906
523 Ga0495582_0364597 3300046473 Bacteria 832
524 Ga0495639_0000072 3300046475 Bacteria 46904
525 Ga0495662_0000572 3300046476 Bacteria 16948
526 Ga0495664_0011398 3300046477 Bacteria 5012
527 Ga0495664_0070216 3300046477 Bacteria 2091
528 Ga0495664_0284032 3300046477 Bacteria 1000
529 Ga0495585_0066657 3300046492 Bacteria 1971
530 Ga0495585_0129040 3300046492 Bacteria 1332
531 Ga0495594_0000046 3300046499 Bacteria 53822
532 Ga0495594_0130994 3300046499 Bacteria 1421
533 Ga0495594_0635827 3300046499 Bacteria 604
534 Ga0495606_0005524 3300046507 Bacteria 12067
535 Ga0495606_0182001 3300046507 Bacteria 1211
536 Ga0495608_0004196 3300046511 Bacteria 10325
537 Ga0495618_0162499 3300046514 Bacteria 1423
538 Ga0495628_0011819 3300046516 Bacteria 7367
539 Ga0495630_0011525 3300046517 Bacteria 6402
540 Ga0495637_0079586 3300046520 Bacteria 1309
541 Ga0495644_0057427 3300046523 Bacteria 1463
542 Ga0495666_0003632 3300046526 Bacteria 7798
543 Ga0495666_0098996 3300046526 Bacteria 1374
544 Ga0495652_0234622 3300046529 Bacteria 1369
545 Ga0495652_0252270 3300046529 Bacteria 1307
546 Ga0495665_0000128 3300046531 Bacteria 36043
547 Ga0495640_0036663 3300046533 Bacteria 3463
548 Ga0495640_0094813 3300046533 Bacteria 1965
549 Ga0495586_0041802 3300046535 Bacteria 2469
550 Ga0495587_0009812 3300046536 Bacteria 6118
551 Ga0495609_0252334 3300046538 Bacteria 726
552 Ga0495645_0018687 3300046543 Bacteria 4982
553 Ga0495622_0001328 3300046557 Bacteria 12660
554 Ga0495667_0003525 3300046559 Bacteria 10504
555 Ga0495667_0028206 3300046559 Bacteria 3779
556 Ga0495656_0028598 3300046615 Bacteria 2237
557 Ga0495656_0070558 3300046615 Bacteria 1550
558 Ga0495668_0274126 3300046616 Bacteria 924
559 Ga0495668_0329825 3300046616 Bacteria 837
560 Ga0495634_0003037 3300046642 Bacteria 13668
561 Ga0495634_0022125 3300046642 Bacteria 4482
562 Ga0495634_0278345 3300046642 Bacteria 1017
563 Ga0495625_0550984 3300046660 Bacteria 698
564 Ga0495635_0002038 3300046663 Bacteria 13679
565 Ga0495635_0007778 3300046663 Bacteria 7484
566 Ga0495588_0010612 3300046674 Bacteria 4291
567 Ga0495657_0004913 3300046675 Bacteria 10635
568 Ga0495657_0350970 3300046675 Bacteria 873
569 Ga0495657_0661098 3300046675 Bacteria 602
570 Ga0495599_0010423 3300046678 Bacteria 5685
571 Ga0495623_0011237 3300046679 Bacteria 5792
572 Ga0495646_0007134 3300046680 Bacteria 7098
573 Ga0495646_0049702 3300046680 Bacteria 2544
574 Ga0495647_0002474 3300046681 Bacteria 5839
575 Ga0495658_0004429 3300046683 Bacteria 6911
576 Ga0495658_0449462 3300046683 Bacteria 823
577 Ga0495669_0026349 3300046684 Bacteria 2540
578 Ga0495669_0097292 3300046684 Bacteria 1364
579 Ga0495669_0117820 3300046684 Bacteria 1243
580 Ga0495613_0003702 3300046689 Bacteria 11465
581 Ga0495613_0868969 3300046689 Bacteria 585
582 Ga0495624_0000795 3300046690 Bacteria 24919
583 Ga0495670_0017082 3300046691 Bacteria 3568
584 Ga0495670_0530277 3300046691 Bacteria 640
585 Ga0495671_0141140 3300046692 Bacteria 1174
586 Ga0495600_0004657 3300046809 Bacteria 8217
587 Ga0495581_0000030 3300047315 Bacteria 53487
588 Ga0495581_0076482 3300047315 Bacteria 1937
589 Ga0495581_0076953 3300047315 Bacteria 1930
590 Ga0495581_0133456 3300047315 Bacteria 1447
591 Ga0495581_0638923 3300047315 Bacteria 615
592 Ga0495604_0002900 3300047317 Bacteria 13743
593 Ga0495604_0263011 3300047317 Bacteria 1172
594 Ga0495674_0001230 3300047319 Bacteria 24837
595 Ga0495672_0047254 3300047320 Bacteria 2561
596 Ga0495672_0051828 3300047320 Bacteria 2414
597 Ga0495676_0017129 3300047321 Bacteria 6412
598 Ga0495680_0027947 3300047322 Bacteria 4628
599 Ga0495675_0019998 3300047444 Bacteria 4254
600 Ga0495685_048884 3300047447 Bacteria 1438
601 Ga0495673_0033929 3300047469 Bacteria 2363
602 Ga0495673_0102910 3300047469 Bacteria 1152
603 Ga0495684_0005221 3300047471 Bacteria 10124
604 Ga0495684_0043185 3300047471 Bacteria 3451
605 Ga0495686_0074493 3300047472 Bacteria 2083
606 Ga0495593_0000470 3300047673 Bacteria 22684
607 Ga0495593_0002684 3300047673 Bacteria 10702
608 Ga0495602_0024305 3300048088 Bacteria 5879
609 Ga0495614_0022266 3300048089 Bacteria 2735
610 Ga0495615_0147762 3300048090 Bacteria 698
611 Ga0496100_0011102 3300048903 Bacteria 5115
612 Ga0496100_0045464 3300048903 Bacteria 2818
613 Ga0496100_0835453 3300048903 Bacteria 722
614 Ga0496101_0007163 3300048904 Bacteria 7211
615 Ga0496101_0213659 3300048904 Bacteria 1495
616 Ga0496101_0268680 3300048904 Bacteria 1331
617 Ga0496101_0364407 3300048904 Bacteria 1136
618 Ga0496102_0222278 3300048905 Bacteria 1780
619 Ga0496102_0260354 3300048905 Bacteria 1635
620 Ga0496102_0372279 3300048905 Bacteria 1344
621 Ga0496102_0552397 3300048905 Bacteria 1074
622 Ga0496103_0448749 3300048906 Bacteria 827
623 Ga0496103_0459363 3300048906 Bacteria 816
624 Ga0496104_0022374 3300048907 Bacteria 5806
625 Ga0496104_0115657 3300048907 Bacteria 2573
626 Ga0496104_0828287 3300048907 Bacteria 831
627 Ga0496105_0027959 3300048908 Bacteria 4611
628 Ga0496105_0125981 3300048908 Bacteria 2111
629 Ga0496105_0379627 3300048908 Bacteria 1125
630 Ga0496106_0119067 3300048909 Bacteria 2062
631 Ga0496106_0131471 3300048909 Bacteria 1963
632 Ga0496106_0239605 3300048909 Bacteria 1449
633 Ga0496106_0322287 3300048909 Bacteria 1240
634 Ga0496106_0528178 3300048909 Bacteria 947
635 Ga0496107_0007455 3300048910 Bacteria 7542
636 Ga0496107_0019166 3300048910 Bacteria 4826
637 Ga0496107_0046717 3300048910 Bacteria 3116
638 Ga0496107_0677466 3300048910 Bacteria 759
639 Ga0496108_0000927 3300048911 Bacteria 22857
640 Ga0496108_0075422 3300048911 Bacteria 2849
641 Ga0496108_0265614 3300048911 Bacteria 1493
642 Ga0496108_0456112 3300048911 Bacteria 1117
643 Ga0496109_0053221 3300048912 Bacteria 3691
644 Ga0496109_0068302 3300048912 Bacteria 3258
645 Ga0496109_0095265 3300048912 Bacteria 2756
646 Ga0496109_0108132 3300048912 Bacteria 2584
647 Ga0496109_0528669 3300048912 Bacteria 1113
648 Ga0496110_0017143 3300048913 Bacteria 6055
649 Ga0496110_0018413 3300048913 Bacteria 5857
650 Ga0496110_0134209 3300048913 Bacteria 2236
651 Ga0496110_0248654 3300048913 Bacteria 1618
652 Ga0496110_0444848 3300048913 Bacteria 1181
653 Ga0496111_0023210 3300048914 Bacteria 4354
654 Ga0496111_0122082 3300048914 Bacteria 1924
655 Ga0496111_0166487 3300048914 Bacteria 1637
656 Ga0496111_0208434 3300048914 Bacteria 1452
657 Ga0496112_0004583 3300048915 Bacteria 11751
658 Ga0496112_0039976 3300048915 Bacteria 4584
659 Ga0496112_0146271 3300048915 Bacteria 2332
660 Ga0496112_0298540 3300048915 Bacteria 1556
661 Ga0496112_0960033 3300048915 Bacteria 775
662 Ga0496113_0007783 3300048916 Bacteria 6923
663 Ga0496113_0215444 3300048916 Bacteria 1529
664 Ga0496113_0244403 3300048916 Bacteria 1432
665 Ga0496113_0673005 3300048916 Bacteria 827
666 Ga0496113_0893946 3300048916 Bacteria 703
667 Ga0496114_0096307 3300048917 Bacteria 2519
668 Ga0496114_0107180 3300048917 Bacteria 2391
669 Ga0496114_0382569 3300048917 Bacteria 1246
670 Ga0496115_0003360 3300048918 Bacteria 11473
671 Ga0496115_0044258 3300048918 Bacteria 3550
672 Ga0496115_0221729 3300048918 Bacteria 1560
673 Ga0496115_0316381 3300048918 Bacteria 1277
674 Ga0496115_0671389 3300048918 Bacteria 817
675 Ga0496119_0073501 3300048922 Bacteria 1994
676 Ga0496119_0079090 3300048922 Bacteria 1900
677 Ga0496121_0000278 3300048924 Bacteria 106838
678 Ga0496121_0054019 3300048924 Bacteria 3360
679 Ga0496121_0153536 3300048924 Bacteria 1691
680 Ga0496121_0242695 3300048924 Bacteria 1254
681 Ga0496121_0312171 3300048924 Bacteria 1062
682 Ga0496121_0571402 3300048924 Bacteria 703
683 Ga0496124_0161433 3300048927 Bacteria 1746
684 Ga0496125_0000869 3300048928 Bacteria 48286
685 Ga0496125_0489269 3300048928 Bacteria 695
686 Ga0496126_0006001 3300048929 Bacteria 13646
687 Ga0496126_0013876 3300048929 Bacteria 8172
688 Ga0496126_0026105 3300048929 Bacteria 5607
689 Ga0496126_0036323 3300048929 Bacteria 4607
690 Ga0496126_0064657 3300048929 Bacteria 3276
691 Ga0496126_0150631 3300048929 Bacteria 1994
692 Ga0496126_0176929 3300048929 Bacteria 1814
693 Ga0496126_0178961 3300048929 Bacteria 1802
694 Ga0496126_0413044 3300048929 Bacteria 1092
695 Ga0496126_0459614 3300048929 Bacteria 1023
696 Ga0496126_0527297 3300048929 Bacteria 940
697 Ga0496126_0654778 3300048929 Bacteria 821
698 Ga0496126_0731711 3300048929 Bacteria 766
699 Ga0496126_1068211 3300048929 Bacteria 601
700 Ga0495682_0226558 3300049460 Bacteria 662
701 Ga0501031_0242922 3300049568 Bacteria 1170
702 Ga0501032_0066349 3300049569 Bacteria 2411
703 Ga0501032_0067608 3300049569 Bacteria 2386
704 Ga0501032_0228323 3300049569 Bacteria 1210
705 Ga0501033_0047330 3300049570 Bacteria 3197
706 Ga0501034_0098555 3300049571 Bacteria 2918
707 Ga0501034_0190783 3300049571 Bacteria 2011
708 Ga0501034_0281447 3300049571 Bacteria 1602
709 Ga0501034_0862002 3300049571 Bacteria 795
710 Ga0501034_1029229 3300049571 Bacteria 706
711 Ga0501034_1290183 3300049571 Bacteria 607
712 Ga0501036_0028417 3300049572 Bacteria 4726
713 Ga0501036_0138795 3300049572 Bacteria 2051
714 Ga0501036_0154070 3300049572 Bacteria 1938
715 Ga0501036_0930954 3300049572 Bacteria 713
716 Ga0501037_0101501 3300049573 Bacteria 2076
717 Ga0501038_0001610 3300049574 Bacteria 20963
718 Ga0501038_0102330 3300049574 Bacteria 2384
719 Ga0501038_0202255 3300049574 Bacteria 1593
720 Ga0501039_0071309 3300049575 Bacteria 2699
721 Ga0501039_0086766 3300049575 Bacteria 2437
722 Ga0501039_0228591 3300049575 Bacteria 1462
723 Ga0501039_0440318 3300049575 Bacteria 1023
724 Ga0501040_0355026 3300049576 Bacteria 1050
725 Ga0501042_0096738 3300049578 Bacteria 2121
726 Ga0501043_0030435 3300049579 Bacteria 4242
727 Ga0501043_0046321 3300049579 Bacteria 3419
728 Ga0501043_0256981 3300049579 Bacteria 1344
729 Ga0501043_0287262 3300049579 Bacteria 1260
730 Ga0501046_0072186 3300049580 Bacteria 2680
731 Ga0501047_0031515 3300049581 Bacteria 5113
732 Ga0501047_0098605 3300049581 Bacteria 2800
733 Ga0501047_0472745 3300049581 Bacteria 1081
734 Ga0501047_0621439 3300049581 Bacteria 901
735 Ga0501067_0018457 3300049583 Bacteria 3864
736 Ga0501067_0043030 3300049583 Bacteria 2508
737 Ga0501068_0154274 3300049584 Bacteria 1445
738 Ga0501068_0782468 3300049584 Bacteria 625
739 Ga0501069_0172578 3300049585 Bacteria 1248
740 Ga0501069_0195420 3300049585 Bacteria 1171
741 Ga0501070_0058568 3300049586 Bacteria 3193
742 Ga0501070_0105463 3300049586 Bacteria 2330
743 Ga0501072_0122136 3300049588 Bacteria 2075
744 Ga0501073_0023122 3300049589 Bacteria 4468
745 Ga0501073_0105242 3300049589 Bacteria 1958
746 Ga0501073_0131464 3300049589 Bacteria 1735
747 Ga0501074_0192633 3300049590 Bacteria 1453
748 Ga0501074_0422208 3300049590 Bacteria 946
749 Ga0501076_0195023 3300049592 Bacteria 1653
750 Ga0501079_0034413 3300049741 Bacteria 3898
751 Ga0501079_0202434 3300049741 Bacteria 1551
752 Ga0501080_0083493 3300049742 Bacteria 2967
753 Ga0501080_0843041 3300049742 Bacteria 802
754 Ga0501035_0060571 3300049822 Bacteria 3369
755 Ga0501035_0206710 3300049822 Bacteria 1681
756 Ga0501035_0503731 3300049822 Bacteria 996
757 Ga0501035_0770832 3300049822 Bacteria 770
758 Ga0501044_0012055 3300049823 Bacteria 9363
759 Ga0501044_0101594 3300049823 Bacteria 2893
760 Ga0501044_0505495 3300049823 Bacteria 1109
761 Ga0501044_0725571 3300049823 Bacteria 877
762 Ga0501044_0796512 3300049823 Bacteria 824
763 Ga0501044_0957539 3300049823 Bacteria 729
764 Ga0501044_1065663 3300049823 Bacteria 678
765 Ga0501045_0362568 3300049824 Bacteria 1078
766 Ga0501045_0982581 3300049824 Bacteria 619
767 nmdc:mga03683_61226_c1 3300050489 Bacteria 885
768 nmdc:mga03n38_7962_c1 3300050490 Bacteria 3776
769 nmdc:mga03n38_95480_c1 3300050490 Bacteria 1424
770 nmdc:mga00v17_116481_c1 3300050491 Bacteria 1699
771 nmdc:mga00v17_201058_c1 3300050491 Bacteria 1288
772 nmdc:mga0yw44_63003_c1 3300050492 Bacteria 2279
773 nmdc:mga0k408_233891_c1 3300050493 Bacteria 1097
774 nmdc:mga0k408_269890_c1 3300050493 Bacteria 1016
775 nmdc:mga0k408_85432_c1 3300050493 Bacteria 1852
776 nmdc:mga06z11_15583_c1 3300050494 Bacteria 3397
777 nmdc:mga06z11_85331_c1 3300050494 Bacteria 1703
778 nmdc:mga04h51_116248_c1 3300050495 Bacteria 992
779 nmdc:mga07m45_104203_c1 3300050496 Bacteria 1631
780 nmdc:mga07m45_313946_c1 3300050496 Bacteria 911
781 nmdc:mga05p37_73784_c1 3300050507 Bacteria 4199
782 nmdc:mga0n895_501187_c1 3300050512 Bacteria 1223
783 nmdc:mga0a205_1205897_c1 3300050515 Bacteria 604
784 nmdc:mga0sz30_7031_c1 3300050516 Bacteria 4207
785 Ga0495601_0211795 3300053077 Bacteria 1266
786 Ga0495601_0255016 3300053077 Bacteria 1145
787 Ga0495612_0049565 3300053078 Bacteria 1723
788 Ga0495595_0001339 3300053084 Bacteria 9565
789 Ga0495619_0005596 3300053085 Bacteria 7971
790 Ga0500647_0014493 3300053091 Bacteria 3585
791 Ga0500647_0183660 3300053091 Bacteria 958
792 Ga0500566_0003437 3300053094 Bacteria 9442
793 Ga0500566_0015200 3300053094 Bacteria 4517
794 Ga0500554_006966 3300053102 Bacteria 2573
795 Ga0500554_007220 3300053102 Bacteria 2542
796 Ga0500557_174492 3300053105 Bacteria 700
797 Ga0500572_001342 3300053111 Bacteria 6819
798 Ga0500572_086015 3300053111 Bacteria 990
799 Ga0500595_001016 3300053119 Bacteria 15748
800 Ga0500595_006629 3300053119 Bacteria 4886
801 Ga0500595_117096 3300053119 Bacteria 754
802 Ga0500608_131552 3300053122 Bacteria 1121
803 Ga0500642_0000004 3300053130 Bacteria 433122
804 Ga0500652_000294 3300053131 Bacteria 18164
805 Ga0500559_0000649 3300053136 Bacteria 23438
806 Ga0500568_0016453 3300053139 Bacteria 3288
807 Ga0500589_143328 3300053147 Bacteria 981
808 Ga0500590_025848 3300053148 Bacteria 3049
809 Ga0500603_000630 3300053150 Bacteria 8688
810 Ga0500616_0000022 3300053153 Bacteria 460463
811 Ga0500630_091455 3300053159 Bacteria 1404
812 Ga0500638_000160 3300053162 Bacteria 13163
813 Ga0500639_008667 3300053163 Bacteria 5304
814 Ga0500639_026342 3300053163 Bacteria 3072
815 Ga0500636_0256440 3300053177 Bacteria 888
816 Ga0500637_0000180 3300053178 Bacteria 23612
817 Ga0500596_001070 3300053735 Bacteria 5519
818 Ga0500596_001745 3300053735 Bacteria 4395
819 Ga0501084_0086802 3300054114 Bacteria 2627
820 Ga0500661_010018 3300055283 Bacteria 1727
821 Ga0501082_0146982 3300060353 Bacteria 2046
822 Ga0530510_0494819 3300061734 Bacteria 927

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10580899 Ga0207702_105808992 172
2 iso_pu_bacteria 2513237141 2513888589 172
3 iso_pu_bacteria 8006964411 8006967627 172
4 iso_pu_bacteria 8006984368 8006991097 172
5 3300005844 Ga0068862_101403950 Ga0068862_1014039501 174
6 3300028023 Ga0265357_1012247 Ga0265357_10122472 174
7 3300030760 Ga0265762_1013881 Ga0265762_10138812 174
8 3300046689 Ga0495613_0868969 Ga0495613_0868969_36_560 174
9 3300047315 Ga0495581_0133456 Ga0495581_0133456_58_582 174
10 3300048928 Ga0496125_0000869 Ga0496125_0000869_27029_27553 174
11 3300048929 Ga0496126_0036323 Ga0496126_0036323_2164_2688 174
12 3300049585 Ga0501069_0172578 Ga0501069_0172578_357_881 174
13 3300053105 Ga0500557_174492 Ga0500557_174492_107_631 174
14 3300053130 Ga0500642_0000004 Ga0500642_0000004_259308_259832 174
15 3300053131 Ga0500652_000294 Ga0500652_000294_9449_9973 174
16 3300053153 Ga0500616_0000022 Ga0500616_0000022_221844_222368 174
17 3300005335 Ga0070666_10383185 Ga0070666_103831852 175
18 3300005344 Ga0070661_100050714 Ga0070661_1000507144 175
19 3300005354 Ga0070675_100522164 Ga0070675_1005221642 175
20 3300005364 Ga0070673_100212996 Ga0070673_1002129962 175
21 3300005367 Ga0070667_100300816 Ga0070667_1003008161 175
22 3300005535 Ga0070684_101184504 Ga0070684_1011845041 175
23 3300005539 Ga0068853_100116332 Ga0068853_1001163323 175
24 3300005543 Ga0070672_100231798 Ga0070672_1002317983 175
25 3300005548 Ga0070665_100458723 Ga0070665_1004587232 175
26 3300005618 Ga0068864_100268989 Ga0068864_1002689892 175
27 3300005719 Ga0068861_100457085 Ga0068861_1004570852 175
28 3300005842 Ga0068858_100368348 Ga0068858_1003683482 175
29 3300005844 Ga0068862_100529498 Ga0068862_1005294982 175
30 3300006173 Ga0070716_100208126 Ga0070716_1002081262 175
31 3300014325 Ga0163163_10887889 Ga0163163_108878892 175
32 3300025919 Ga0207657_10518115 Ga0207657_105181152 175
33 3300025920 Ga0207649_10448634 Ga0207649_104486341 175
34 3300025941 Ga0207711_10692327 Ga0207711_106923272 175
35 3300026035 Ga0207703_10535095 Ga0207703_105350952 175
36 3300026142 Ga0207698_10921632 Ga0207698_109216322 175
37 3300028379 Ga0268266_10009681 Ga0268266_100096814 175
38 3300028380 Ga0268265_10531312 Ga0268265_105313122 175
39 3300039437 Ga0436365_0585753 Ga0436365_0585753_63_590 175
40 3300047320 Ga0495672_0051828 Ga0495672_0051828_887_1414 175
41 3300048912 Ga0496109_0068302 Ga0496109_0068302_1848_2378 175
42 3300048929 Ga0496126_0459614 Ga0496126_0459614_217_765 175
43 3300050512 nmdc:mga0n895_501187_c1 nmdc:mga0n895_501187_c1_187_717 175
44 3300053111 Ga0500572_001342 Ga0500572_001342_5189_5716 175
45 3300053122 Ga0500608_131552 Ga0500608_131552_488_1015 175
46 3300053136 Ga0500559_0000649 Ga0500559_0000649_10409_10936 175
47 3300053163 Ga0500639_008667 Ga0500639_008667_2348_2875 175
48 3300053177 Ga0500636_0256440 Ga0500636_0256440_349_876 175
49 3300053735 Ga0500596_001745 Ga0500596_001745_2813_3340 175
50 3300003203 JGI25406J46586_10001038 JGI25406J46586_1000103814 176
51 3300005327 Ga0070658_10027535 Ga0070658_100275352 176
52 3300005327 Ga0070658_10286708 Ga0070658_102867082 176
53 3300005328 Ga0070676_10324087 Ga0070676_103240872 176
54 3300005329 Ga0070683_100017946 Ga0070683_1000179466 176
55 3300005329 Ga0070683_100800069 Ga0070683_1008000692 176
56 3300005330 Ga0070690_100137371 Ga0070690_1001373713 176
57 3300005331 Ga0070670_100184713 Ga0070670_1001847132 176
58 3300005334 Ga0068869_100064257 Ga0068869_1000642573 176
59 3300005334 Ga0068869_100382589 Ga0068869_1003825892 176
60 3300005336 Ga0070680_100074496 Ga0070680_1000744962 176
61 3300005336 Ga0070680_100126836 Ga0070680_1001268363 176
62 3300005336 Ga0070680_100361541 Ga0070680_1003615412 176
63 3300005337 Ga0070682_100709271 Ga0070682_1007092711 176
64 3300005338 Ga0068868_100162651 Ga0068868_1001626512 176
65 3300005338 Ga0068868_100682213 Ga0068868_1006822131 176
66 3300005339 Ga0070660_100001927 Ga0070660_1000019277 176
67 3300005340 Ga0070689_100820970 Ga0070689_1008209701 176
68 3300005341 Ga0070691_10050950 Ga0070691_100509501 176
69 3300005343 Ga0070687_100760691 Ga0070687_1007606911 176
70 3300005344 Ga0070661_100589486 Ga0070661_1005894861 176
71 3300005354 Ga0070675_100591740 Ga0070675_1005917402 176
72 3300005355 Ga0070671_100758109 Ga0070671_1007581091 176
73 3300005356 Ga0070674_100768080 Ga0070674_1007680801 176
74 3300005364 Ga0070673_100588216 Ga0070673_1005882161 176
75 3300005364 Ga0070673_100632025 Ga0070673_1006320252 176
76 3300005364 Ga0070673_100742133 Ga0070673_1007421332 176
77 3300005364 Ga0070673_101102603 Ga0070673_1011026031 176
78 3300005365 Ga0070688_100289591 Ga0070688_1002895912 176
79 3300005366 Ga0070659_100084996 Ga0070659_1000849963 176
80 3300005366 Ga0070659_100131163 Ga0070659_1001311633 176
81 3300005366 Ga0070659_100595671 Ga0070659_1005956711 176
82 3300005366 Ga0070659_100663781 Ga0070659_1006637812 176
83 3300005434 Ga0070709_10014869 Ga0070709_100148691 176
84 3300005434 Ga0070709_10536023 Ga0070709_105360231 176
85 3300005435 Ga0070714_100191652 Ga0070714_1001916522 176
86 3300005438 Ga0070701_10227418 Ga0070701_102274182 176
87 3300005439 Ga0070711_100220011 Ga0070711_1002200112 176
88 3300005439 Ga0070711_100369176 Ga0070711_1003691761 176
89 3300005445 Ga0070708_100353150 Ga0070708_1003531502 176
90 3300005455 Ga0070663_100051597 Ga0070663_1000515973 176
91 3300005455 Ga0070663_100055706 Ga0070663_1000557064 176
92 3300005455 Ga0070663_100155680 Ga0070663_1001556802 176
93 3300005455 Ga0070663_100334575 Ga0070663_1003345752 176
94 3300005455 Ga0070663_100352173 Ga0070663_1003521731 176
95 3300005455 Ga0070663_100720227 Ga0070663_1007202271 176
96 3300005456 Ga0070678_100075681 Ga0070678_1000756813 176
97 3300005456 Ga0070678_100096396 Ga0070678_1000963963 176
98 3300005456 Ga0070678_100119951 Ga0070678_1001199513 176
99 3300005456 Ga0070678_100181951 Ga0070678_1001819512 176
100 3300005456 Ga0070678_100188119 Ga0070678_1001881192 176
101 3300005456 Ga0070678_100691876 Ga0070678_1006918761 176
102 3300005457 Ga0070662_100213843 Ga0070662_1002138431 176
103 3300005457 Ga0070662_100293353 Ga0070662_1002933532 176
104 3300005458 Ga0070681_10169332 Ga0070681_101693322 176
105 3300005459 Ga0068867_100257444 Ga0068867_1002574442 176
106 3300005466 Ga0070685_10141415 Ga0070685_101414151 176
107 3300005467 Ga0070706_100710647 Ga0070706_1007106472 176
108 3300005468 Ga0070707_100142842 Ga0070707_1001428422 176
109 3300005471 Ga0070698_100148394 Ga0070698_1001483942 176
110 3300005530 Ga0070679_100138520 Ga0070679_1001385201 176
111 3300005530 Ga0070679_100163428 Ga0070679_1001634281 176
112 3300005530 Ga0070679_100341757 Ga0070679_1003417572 176
113 3300005530 Ga0070679_100411099 Ga0070679_1004110993 176
114 3300005535 Ga0070684_100028804 Ga0070684_1000288046 176
115 3300005536 Ga0070697_100200902 Ga0070697_1002009022 176
116 3300005536 Ga0070697_100627630 Ga0070697_1006276301 176
117 3300005539 Ga0068853_100000920 Ga0068853_1000009202 176
118 3300005539 Ga0068853_100075228 Ga0068853_1000752283 176
119 3300005539 Ga0068853_100647449 Ga0068853_1006474492 176
120 3300005543 Ga0070672_100418482 Ga0070672_1004184821 176
121 3300005544 Ga0070686_100782264 Ga0070686_1007822641 176
122 3300005547 Ga0070693_100059830 Ga0070693_1000598303 176
123 3300005547 Ga0070693_100066801 Ga0070693_1000668012 176
124 3300005548 Ga0070665_100058941 Ga0070665_1000589414 176
125 3300005548 Ga0070665_100162041 Ga0070665_1001620412 176
126 3300005548 Ga0070665_100182360 Ga0070665_1001823601 176
127 3300005548 Ga0070665_100238690 Ga0070665_1002386902 176
128 3300005548 Ga0070665_100324243 Ga0070665_1003242431 176
129 3300005563 Ga0068855_100029481 Ga0068855_1000294814 176
130 3300005563 Ga0068855_100046913 Ga0068855_1000469133 176
131 3300005563 Ga0068855_100166647 Ga0068855_1001666473 176
132 3300005563 Ga0068855_100188673 Ga0068855_1001886732 176
133 3300005563 Ga0068855_100505594 Ga0068855_1005055942 176
134 3300005564 Ga0070664_100171516 Ga0070664_1001715162 176
135 3300005564 Ga0070664_100238331 Ga0070664_1002383312 176
136 3300005564 Ga0070664_100678646 Ga0070664_1006786461 176
137 3300005577 Ga0068857_100001037 Ga0068857_10000103723 176
138 3300005577 Ga0068857_100223783 Ga0068857_1002237832 176
139 3300005577 Ga0068857_101300699 Ga0068857_1013006992 176
140 3300005578 Ga0068854_100003979 Ga0068854_1000039793 176
141 3300005578 Ga0068854_100323281 Ga0068854_1003232812 176
142 3300005578 Ga0068854_100899502 Ga0068854_1008995021 176
143 3300005578 Ga0068854_101097191 Ga0068854_1010971911 176
144 3300005614 Ga0068856_100000883 Ga0068856_10000088324 176
145 3300005614 Ga0068856_100004208 Ga0068856_1000042088 176
146 3300005614 Ga0068856_100152442 Ga0068856_1001524422 176
147 3300005614 Ga0068856_100262760 Ga0068856_1002627603 176
148 3300005614 Ga0068856_100999315 Ga0068856_1009993152 176
149 3300005615 Ga0070702_100150872 Ga0070702_1001508722 176
150 3300005615 Ga0070702_100267869 Ga0070702_1002678692 176
151 3300005615 Ga0070702_100344973 Ga0070702_1003449731 176
152 3300005615 Ga0070702_100404374 Ga0070702_1004043742 176
153 3300005616 Ga0068852_100034011 Ga0068852_1000340114 176
154 3300005616 Ga0068852_100126529 Ga0068852_1001265291 176
155 3300005616 Ga0068852_100142386 Ga0068852_1001423863 176
156 3300005616 Ga0068852_100170191 Ga0068852_1001701912 176
157 3300005616 Ga0068852_100441012 Ga0068852_1004410122 176
158 3300005616 Ga0068852_101564800 Ga0068852_1015648001 176
159 3300005617 Ga0068859_100254022 Ga0068859_1002540222 176
160 3300005618 Ga0068864_100203460 Ga0068864_1002034601 176
161 3300005618 Ga0068864_100614808 Ga0068864_1006148081 176
162 3300005718 Ga0068866_10222960 Ga0068866_102229601 176
163 3300005719 Ga0068861_100019124 Ga0068861_1000191244 176
164 3300005719 Ga0068861_100205381 Ga0068861_1002053812 176
165 3300005719 Ga0068861_100404123 Ga0068861_1004041232 176
166 3300005719 Ga0068861_100920026 Ga0068861_1009200261 176
167 3300005834 Ga0068851_10006246 Ga0068851_100062463 176
168 3300005834 Ga0068851_10034786 Ga0068851_100347862 176
169 3300005840 Ga0068870_10598458 Ga0068870_105984582 176
170 3300005840 Ga0068870_10647281 Ga0068870_106472812 176
171 3300005841 Ga0068863_100296697 Ga0068863_1002966972 176
172 3300005842 Ga0068858_100218548 Ga0068858_1002185482 176
173 3300005842 Ga0068858_100330736 Ga0068858_1003307362 176
174 3300005842 Ga0068858_100392424 Ga0068858_1003924242 176
175 3300005843 Ga0068860_100089952 Ga0068860_1000899522 176
176 3300005844 Ga0068862_100266806 Ga0068862_1002668062 176
177 3300005844 Ga0068862_100284118 Ga0068862_1002841182 176
178 3300005844 Ga0068862_100369106 Ga0068862_1003691062 176
179 3300005937 Ga0081455_10025851 Ga0081455_100258514 176
180 3300005937 Ga0081455_10178537 Ga0081455_101785371 176
181 3300005937 Ga0081455_10249018 Ga0081455_102490182 176
182 3300005981 Ga0081538_10032665 Ga0081538_100326653 176
183 3300005983 Ga0081540_1000191 Ga0081540_100019151 176
184 3300005983 Ga0081540_1016110 Ga0081540_10161104 176
185 3300005983 Ga0081540_1019271 Ga0081540_10192715 176
186 3300005983 Ga0081540_1085029 Ga0081540_10850293 176
187 3300005985 Ga0081539_10000371 Ga0081539_1000037130 176
188 3300005985 Ga0081539_10003753 Ga0081539_1000375321 176
189 3300005985 Ga0081539_10035788 Ga0081539_100357884 176
190 3300006028 Ga0070717_10053768 Ga0070717_100537683 176
191 3300006028 Ga0070717_10306388 Ga0070717_103063881 176
192 3300006028 Ga0070717_10871034 Ga0070717_108710341 176
193 3300006038 Ga0075365_10031473 Ga0075365_100314732 176
194 3300006038 Ga0075365_10318503 Ga0075365_103185032 176
195 3300006038 Ga0075365_10356865 Ga0075365_103568652 176
196 3300006048 Ga0075363_100040546 Ga0075363_1000405464 176
197 3300006048 Ga0075363_100042055 Ga0075363_1000420553 176
198 3300006048 Ga0075363_100059837 Ga0075363_1000598372 176
199 3300006048 Ga0075363_100189089 Ga0075363_1001890892 176
200 3300006051 Ga0075364_10081058 Ga0075364_100810583 176
201 3300006051 Ga0075364_10407697 Ga0075364_104076972 176
202 3300006173 Ga0070716_100005454 Ga0070716_1000054543 176
203 3300006175 Ga0070712_100051297 Ga0070712_1000512972 176
204 3300006178 Ga0075367_10022578 Ga0075367_100225784 176
205 3300006178 Ga0075367_10129008 Ga0075367_101290082 176
206 3300006178 Ga0075367_10204275 Ga0075367_102042752 176
207 3300006186 Ga0075369_10054951 Ga0075369_100549512 176
208 3300006186 Ga0075369_10094096 Ga0075369_100940962 176
209 3300006186 Ga0075369_10158915 Ga0075369_101589152 176
210 3300006237 Ga0097621_100465752 Ga0097621_1004657522 176
211 3300006237 Ga0097621_100939775 Ga0097621_1009397752 176
212 3300006358 Ga0068871_101062922 Ga0068871_1010629221 176
213 3300006871 Ga0075434_100289220 Ga0075434_1002892202 176
214 3300006871 Ga0075434_101225456 Ga0075434_1012254562 176
215 3300006881 Ga0068865_100097523 Ga0068865_1000975231 176
216 3300006881 Ga0068865_100392575 Ga0068865_1003925752 176
217 3300006931 Ga0097620_100254024 Ga0097620_1002540242 176
218 3300007265 Ga0099794_10093674 Ga0099794_100936743 176
219 3300007788 Ga0099795_10012860 Ga0099795_100128603 176
220 3300007788 Ga0099795_10121689 Ga0099795_101216891 176
221 3300007788 Ga0099795_10226511 Ga0099795_102265111 176
222 3300009093 Ga0105240_10002459 Ga0105240_100024593 176
223 3300009093 Ga0105240_10092073 Ga0105240_100920731 176
224 3300009093 Ga0105240_10175273 Ga0105240_101752732 176
225 3300009093 Ga0105240_11479283 Ga0105240_114792831 176
226 3300009094 Ga0111539_11207958 Ga0111539_112079581 176
227 3300009098 Ga0105245_10287261 Ga0105245_102872612 176
228 3300009101 Ga0105247_10443916 Ga0105247_104439162 176
229 3300009101 Ga0105247_10537262 Ga0105247_105372621 176
230 3300009148 Ga0105243_10132920 Ga0105243_101329203 176
231 3300009148 Ga0105243_10688127 Ga0105243_106881271 176
232 3300009174 Ga0105241_10068388 Ga0105241_100683883 176
233 3300009174 Ga0105241_10205614 Ga0105241_102056141 176
234 3300009174 Ga0105241_10843530 Ga0105241_108435302 176
235 3300009174 Ga0105241_11185215 Ga0105241_111852151 176
236 3300009176 Ga0105242_10493261 Ga0105242_104932612 176
237 3300009176 Ga0105242_10649936 Ga0105242_106499362 176
238 3300009176 Ga0105242_10849883 Ga0105242_108498831 176
239 3300009177 Ga0105248_10089282 Ga0105248_100892822 176
240 3300009177 Ga0105248_10384390 Ga0105248_103843902 176
241 3300009177 Ga0105248_10677427 Ga0105248_106774272 176
242 3300009177 Ga0105248_10998438 Ga0105248_109984381 176
243 3300009545 Ga0105237_10050492 Ga0105237_100504925 176
244 3300009545 Ga0105237_10285970 Ga0105237_102859702 176
245 3300009545 Ga0105237_10604474 Ga0105237_106044742 176
246 3300009545 Ga0105237_11107051 Ga0105237_111070511 176
247 3300009551 Ga0105238_10001235 Ga0105238_1000123518 176
248 3300009551 Ga0105238_10004895 Ga0105238_100048955 176
249 3300009551 Ga0105238_10263712 Ga0105238_102637122 176
250 3300009551 Ga0105238_10606697 Ga0105238_106066971 176
251 3300009551 Ga0105238_11162681 Ga0105238_111626811 176
252 3300009553 Ga0105249_10862548 Ga0105249_108625482 176
253 3300009553 Ga0105249_10918118 Ga0105249_109181182 176
254 3300009553 Ga0105249_11073679 Ga0105249_110736792 176
255 3300010159 Ga0099796_10016687 Ga0099796_100166873 176
256 3300010159 Ga0099796_10051347 Ga0099796_100513472 176
257 3300010375 Ga0105239_10047033 Ga0105239_100470332 176
258 3300010375 Ga0105239_10168725 Ga0105239_101687252 176
259 3300010375 Ga0105239_10442999 Ga0105239_104429992 176
260 3300010375 Ga0105239_10568052 Ga0105239_105680522 176
261 3300010375 Ga0105239_10839731 Ga0105239_108397312 176
262 3300010375 Ga0105239_11506916 Ga0105239_115069161 176
263 3300011119 Ga0105246_10339482 Ga0105246_103394822 176
264 3300011119 Ga0105246_10381348 Ga0105246_103813482 176
265 3300011119 Ga0105246_10388473 Ga0105246_103884731 176
266 3300011119 Ga0105246_10696584 Ga0105246_106965842 176
267 3300013102 Ga0157371_10142321 Ga0157371_101423212 176
268 3300013104 Ga0157370_10051849 Ga0157370_100518491 176
269 3300013105 Ga0157369_10002556 Ga0157369_1000255610 176
270 3300013105 Ga0157369_10223644 Ga0157369_102236443 176
271 3300013296 Ga0157374_10154653 Ga0157374_101546533 176
272 3300013297 Ga0157378_10020601 Ga0157378_100206014 176
273 3300013297 Ga0157378_10318981 Ga0157378_103189812 176
274 3300013306 Ga0163162_10411441 Ga0163162_104114412 176
275 3300013306 Ga0163162_10550641 Ga0163162_105506412 176
276 3300013306 Ga0163162_10621464 Ga0163162_106214642 176
277 3300013306 Ga0163162_10670838 Ga0163162_106708382 176
278 3300013306 Ga0163162_10763602 Ga0163162_107636022 176
279 3300013306 Ga0163162_11712813 Ga0163162_117128131 176
280 3300013307 Ga0157372_11653391 Ga0157372_116533911 176
281 3300014325 Ga0163163_10081541 Ga0163163_100815412 176
282 3300014325 Ga0163163_10478401 Ga0163163_104784012 176
283 3300014325 Ga0163163_10914754 Ga0163163_109147541 176
284 3300014325 Ga0163163_11372648 Ga0163163_113726481 176
285 3300014326 Ga0157380_10797546 Ga0157380_107975462 176
286 3300014745 Ga0157377_10117811 Ga0157377_101178112 176
287 3300014968 Ga0157379_10378242 Ga0157379_103782422 176
288 3300014968 Ga0157379_10481907 Ga0157379_104819072 176
289 3300014969 Ga0157376_10137875 Ga0157376_101378753 176
290 3300014969 Ga0157376_10240032 Ga0157376_102400323 176
291 3300014969 Ga0157376_10320265 Ga0157376_103202652 176
292 3300014969 Ga0157376_10562992 Ga0157376_105629922 176
293 3300014969 Ga0157376_10833860 Ga0157376_108338602 176
294 3300021441 Ga0213871_10014132 Ga0213871_100141323 176
295 3300025261 Ga0209233_1018543 Ga0209233_10185432 176
296 3300025297 Ga0209758_1001013 Ga0209758_100101310 176
297 3300025315 Ga0207697_10068684 Ga0207697_100686842 176
298 3300025315 Ga0207697_10230004 Ga0207697_102300041 176
299 3300025321 Ga0207656_10022809 Ga0207656_100228092 176
300 3300025321 Ga0207656_10031168 Ga0207656_100311682 176
301 3300025321 Ga0207656_10223490 Ga0207656_102234901 176
302 3300025711 Ga0207696_1040275 Ga0207696_10402752 176
303 3300025898 Ga0207692_10006838 Ga0207692_100068383 176
304 3300025899 Ga0207642_10081164 Ga0207642_100811642 176
305 3300025899 Ga0207642_10366082 Ga0207642_103660822 176
306 3300025900 Ga0207710_10169861 Ga0207710_101698611 176
307 3300025901 Ga0207688_10439939 Ga0207688_104399392 176
308 3300025904 Ga0207647_10027240 Ga0207647_100272404 176
309 3300025906 Ga0207699_10042859 Ga0207699_100428593 176
310 3300025907 Ga0207645_10280161 Ga0207645_102801611 176
311 3300025907 Ga0207645_10329900 Ga0207645_103299002 176
312 3300025907 Ga0207645_10352424 Ga0207645_103524242 176
313 3300025908 Ga0207643_10070154 Ga0207643_100701543 176
314 3300025908 Ga0207643_10231242 Ga0207643_102312421 176
315 3300025909 Ga0207705_10071743 Ga0207705_100717432 176
316 3300025909 Ga0207705_10363006 Ga0207705_103630062 176
317 3300025909 Ga0207705_10843515 Ga0207705_108435151 176
318 3300025910 Ga0207684_10159090 Ga0207684_101590902 176
319 3300025911 Ga0207654_10001655 Ga0207654_100016557 176
320 3300025911 Ga0207654_10013803 Ga0207654_100138034 176
321 3300025911 Ga0207654_10385056 Ga0207654_103850561 176
322 3300025911 Ga0207654_10490580 Ga0207654_104905802 176
323 3300025912 Ga0207707_10017344 Ga0207707_100173445 176
324 3300025913 Ga0207695_10000387 Ga0207695_1000038710 176
325 3300025913 Ga0207695_10155099 Ga0207695_101550991 176
326 3300025914 Ga0207671_10018972 Ga0207671_100189723 176
327 3300025914 Ga0207671_10021648 Ga0207671_100216485 176
328 3300025914 Ga0207671_10624364 Ga0207671_106243641 176
329 3300025915 Ga0207693_10003895 Ga0207693_1000389510 176
330 3300025915 Ga0207693_10004610 Ga0207693_1000461010 176
331 3300025916 Ga0207663_10442873 Ga0207663_104428731 176
332 3300025916 Ga0207663_10650283 Ga0207663_106502831 176
333 3300025917 Ga0207660_10005223 Ga0207660_100052233 176
334 3300025917 Ga0207660_10024440 Ga0207660_100244404 176
335 3300025917 Ga0207660_10064187 Ga0207660_100641872 176
336 3300025918 Ga0207662_10407233 Ga0207662_104072331 176
337 3300025919 Ga0207657_10331115 Ga0207657_103311152 176
338 3300025919 Ga0207657_10550412 Ga0207657_105504122 176
339 3300025921 Ga0207652_10006970 Ga0207652_100069705 176
340 3300025921 Ga0207652_10456565 Ga0207652_104565652 176
341 3300025921 Ga0207652_10736488 Ga0207652_107364881 176
342 3300025922 Ga0207646_10425433 Ga0207646_104254332 176
343 3300025923 Ga0207681_10715308 Ga0207681_107153082 176
344 3300025924 Ga0207694_10000121 Ga0207694_1000012122 176
345 3300025924 Ga0207694_10016807 Ga0207694_100168073 176
346 3300025924 Ga0207694_10555966 Ga0207694_105559661 176
347 3300025925 Ga0207650_10098980 Ga0207650_100989802 176
348 3300025925 Ga0207650_10614928 Ga0207650_106149281 176
349 3300025925 Ga0207650_10798314 Ga0207650_107983141 176
350 3300025926 Ga0207659_10895741 Ga0207659_108957411 176
351 3300025927 Ga0207687_10353901 Ga0207687_103539012 176
352 3300025927 Ga0207687_10385443 Ga0207687_103854431 176
353 3300025927 Ga0207687_10561005 Ga0207687_105610051 176
354 3300025928 Ga0207700_10037943 Ga0207700_100379432 176
355 3300025932 Ga0207690_10138871 Ga0207690_101388713 176
356 3300025932 Ga0207690_10305471 Ga0207690_103054712 176
357 3300025932 Ga0207690_10367308 Ga0207690_103673081 176
358 3300025933 Ga0207706_10272628 Ga0207706_102726282 176
359 3300025933 Ga0207706_10392382 Ga0207706_103923822 176
360 3300025934 Ga0207686_10262052 Ga0207686_102620522 176
361 3300025935 Ga0207709_10727289 Ga0207709_107272891 176
362 3300025938 Ga0207704_10121863 Ga0207704_101218631 176
363 3300025938 Ga0207704_10973754 Ga0207704_109737541 176
364 3300025939 Ga0207665_10006607 Ga0207665_100066075 176
365 3300025940 Ga0207691_10043997 Ga0207691_100439974 176
366 3300025940 Ga0207691_10441233 Ga0207691_104412332 176
367 3300025941 Ga0207711_10048929 Ga0207711_100489292 176
368 3300025941 Ga0207711_10250102 Ga0207711_102501022 176
369 3300025941 Ga0207711_10354486 Ga0207711_103544862 176
370 3300025942 Ga0207689_10098911 Ga0207689_100989112 176
371 3300025944 Ga0207661_10011150 Ga0207661_100111505 176
372 3300025944 Ga0207661_10528501 Ga0207661_105285011 176
373 3300025945 Ga0207679_10196054 Ga0207679_101960542 176
374 3300025945 Ga0207679_10269997 Ga0207679_102699972 176
375 3300025949 Ga0207667_10016621 Ga0207667_100166213 176
376 3300025949 Ga0207667_10022419 Ga0207667_100224193 176
377 3300025949 Ga0207667_10152080 Ga0207667_101520803 176
378 3300025949 Ga0207667_10582154 Ga0207667_105821542 176
379 3300025960 Ga0207651_10204727 Ga0207651_102047271 176
380 3300025960 Ga0207651_10446210 Ga0207651_104462102 176
381 3300025961 Ga0207712_10065403 Ga0207712_100654032 176
382 3300025961 Ga0207712_10286617 Ga0207712_102866172 176
383 3300025961 Ga0207712_10774398 Ga0207712_107743982 176
384 3300025961 Ga0207712_10787931 Ga0207712_107879312 176
385 3300025972 Ga0207668_10236505 Ga0207668_102365052 176
386 3300025981 Ga0207640_10015818 Ga0207640_100158183 176
387 3300025981 Ga0207640_10753416 Ga0207640_107534161 176
388 3300025981 Ga0207640_11053587 Ga0207640_110535871 176
389 3300026023 Ga0207677_10120722 Ga0207677_101207222 176
390 3300026023 Ga0207677_10556727 Ga0207677_105567271 176
391 3300026035 Ga0207703_10149148 Ga0207703_101491482 176
392 3300026035 Ga0207703_10165463 Ga0207703_101654632 176
393 3300026035 Ga0207703_10223960 Ga0207703_102239602 176
394 3300026041 Ga0207639_10024254 Ga0207639_100242542 176
395 3300026041 Ga0207639_10291502 Ga0207639_102915022 176
396 3300026041 Ga0207639_10494735 Ga0207639_104947352 176
397 3300026041 Ga0207639_10705210 Ga0207639_107052101 176
398 3300026067 Ga0207678_10037796 Ga0207678_100377962 176
399 3300026067 Ga0207678_10207968 Ga0207678_102079682 176
400 3300026067 Ga0207678_10412006 Ga0207678_104120062 176
401 3300026067 Ga0207678_10476937 Ga0207678_104769372 176
402 3300026067 Ga0207678_10590108 Ga0207678_105901082 176
403 3300026067 Ga0207678_10712880 Ga0207678_107128802 176
404 3300026075 Ga0207708_10330433 Ga0207708_103304332 176
405 3300026075 Ga0207708_10397591 Ga0207708_103975912 176
406 3300026078 Ga0207702_10000004 Ga0207702_10000004102 176
407 3300026078 Ga0207702_10000318 Ga0207702_1000031823 176
408 3300026078 Ga0207702_10286369 Ga0207702_102863692 176
409 3300026078 Ga0207702_10555193 Ga0207702_105551931 176
410 3300026089 Ga0207648_10243902 Ga0207648_102439022 176
411 3300026095 Ga0207676_10554519 Ga0207676_105545192 176
412 3300026116 Ga0207674_10005764 Ga0207674_100057648 176
413 3300026116 Ga0207674_10199148 Ga0207674_101991483 176
414 3300026116 Ga0207674_10441985 Ga0207674_104419852 176
415 3300026116 Ga0207674_10840680 Ga0207674_108406802 176
416 3300026118 Ga0207675_100059792 Ga0207675_1000597922 176
417 3300026118 Ga0207675_100289091 Ga0207675_1002890912 176
418 3300026118 Ga0207675_100429708 Ga0207675_1004297082 176
419 3300026118 Ga0207675_100889986 Ga0207675_1008899862 176
420 3300026121 Ga0207683_10036296 Ga0207683_100362964 176
421 3300026121 Ga0207683_10077838 Ga0207683_100778383 176
422 3300026121 Ga0207683_10088714 Ga0207683_100887143 176
423 3300026121 Ga0207683_10231570 Ga0207683_102315702 176
424 3300026121 Ga0207683_10634552 Ga0207683_106345522 176
425 3300026142 Ga0207698_10089767 Ga0207698_100897673 176
426 3300026142 Ga0207698_10296821 Ga0207698_102968212 176
427 3300026142 Ga0207698_10528381 Ga0207698_105283812 176
428 3300026142 Ga0207698_11029131 Ga0207698_110291311 176
429 3300027357 Ga0209589_1000035 Ga0209589_100003567 176
430 3300027361 Ga0209489_100079 Ga0209489_10007967 176
431 3300027363 Ga0209700_100077 Ga0209700_10007767 176
432 3300027866 Ga0209813_10132321 Ga0209813_101323212 176
433 3300028379 Ga0268266_10001906 Ga0268266_1000190615 176
434 3300028379 Ga0268266_10203362 Ga0268266_102033623 176
435 3300028379 Ga0268266_10228389 Ga0268266_102283892 176
436 3300028379 Ga0268266_10434822 Ga0268266_104348222 176
437 3300028379 Ga0268266_11297274 Ga0268266_112972741 176
438 3300028380 Ga0268265_10096092 Ga0268265_100960923 176
439 3300028380 Ga0268265_10384998 Ga0268265_103849982 176
440 3300028381 Ga0268264_10633722 Ga0268264_106337221 176
441 3300028573 Ga0265334_10006202 Ga0265334_100062023 176
442 3300028786 Ga0307517_10138245 Ga0307517_101382452 176
443 3300028794 Ga0307515_10256975 Ga0307515_102569752 176
444 3300028800 Ga0265338_10365098 Ga0265338_103650982 176
445 3300031235 Ga0265330_10146619 Ga0265330_101466192 176
446 3300031238 Ga0265332_10006837 Ga0265332_100068371 176
447 3300031239 Ga0265328_10231538 Ga0265328_102315381 176
448 3300031241 Ga0265325_10032360 Ga0265325_100323603 176
449 3300031247 Ga0265340_10012805 Ga0265340_100128053 176
450 3300031249 Ga0265339_10054742 Ga0265339_100547422 176
451 3300031250 Ga0265331_10058682 Ga0265331_100586822 176
452 3300031344 Ga0265316_10235800 Ga0265316_102358003 176
453 3300031616 Ga0307508_10084039 Ga0307508_100840394 176
454 3300031711 Ga0265314_10077282 Ga0265314_100772821 176
455 3300031712 Ga0265342_10105236 Ga0265342_101052362 176
456 3300031712 Ga0265342_10111267 Ga0265342_101112672 176
457 3300031712 Ga0265342_10113343 Ga0265342_101133433 176
458 3300031730 Ga0307516_10029260 Ga0307516_100292603 176
459 3300031730 Ga0307516_10105054 Ga0307516_101050542 176
460 3300031730 Ga0307516_10132990 Ga0307516_101329903 176
461 3300031731 Ga0307405_10543836 Ga0307405_105438361 176
462 3300031824 Ga0307413_11058891 Ga0307413_110588911 176
463 3300031911 Ga0307412_10183578 Ga0307412_101835782 176
464 3300031995 Ga0307409_100301760 Ga0307409_1003017602 176
465 3300031995 Ga0307409_102298704 Ga0307409_1022987041 176
466 3300032002 Ga0307416_100991158 Ga0307416_1009911582 176
467 3300032002 Ga0307416_101018883 Ga0307416_1010188832 176
468 3300032005 Ga0307411_10287119 Ga0307411_102871192 176
469 3300032005 Ga0307411_10487544 Ga0307411_104875442 176
470 3300032126 Ga0307415_100729374 Ga0307415_1007293741 176
471 3300033180 Ga0307510_10024915 Ga0307510_100249152 176
472 3300035086 Ga0373934_0006674 Ga0373934_0006674_247_777 176
473 3300035086 Ga0373934_0030953 Ga0373934_0030953_1370_1921 176
474 3300035089 Ga0373944_0015410 Ga0373944_0015410_68_619 176
475 3300035092 Ga0373952_0076648 Ga0373952_0076648_214_747 176
476 3300035111 Ga0373923_0003012 Ga0373923_0003012_2904_3434 176
477 3300035111 Ga0373923_0100092 Ga0373923_0100092_77_628 176
478 3300035112 Ga0373932_0198358 Ga0373932_0198358_146_679 176
479 3300035113 Ga0373936_0041823 Ga0373936_0041823_72_605 176
480 3300035113 Ga0373936_0062817 Ga0373936_0062817_721_1251 176
481 3300035115 Ga0373941_0059088 Ga0373941_0059088_155_688 176
482 3300035117 Ga0373953_0003523 Ga0373953_0003523_2363_2893 176
483 3300035118 Ga0373954_0001251 Ga0373954_0001251_2978_3508 176
484 3300035118 Ga0373954_0098981 Ga0373954_0098981_73_624 176
485 3300035118 Ga0373954_0473317 Ga0373954_0473317_10_561 176
486 3300035119 Ga0373956_0002392 Ga0373956_0002392_74_604 176
487 3300035120 Ga0373957_0003300 Ga0373957_0003300_4056_4586 176
488 3300035120 Ga0373957_0181370 Ga0373957_0181370_19_549 176
489 3300035170 Ga0373943_0018879 Ga0373943_0018879_312_863 176
490 3300035170 Ga0373943_0057672 Ga0373943_0057672_676_1209 176
491 3300035171 Ga0373946_0032123 Ga0373946_0032123_284_835 176
492 3300035172 Ga0373955_0007575 Ga0373955_0007575_3913_4443 176
493 3300035207 Ga0373942_0127281 Ga0373942_0127281_100_633 176
494 3300035241 Ga0373961_0111746 Ga0373961_0111746_87_617 176
495 3300035242 Ga0373962_0085828 Ga0373962_0085828_33_566 176
496 3300035410 Ga0373924_0037044 Ga0373924_0037044_854_1405 176
497 3300035691 Ga0373931_0015889 Ga0373931_0015889_2905_3438 176
498 3300035691 Ga0373931_0057737 Ga0373931_0057737_670_1203 176
499 3300035692 Ga0373935_0011386 Ga0373935_0011386_111_662 176
500 3300035695 Ga0373927_0000766 Ga0373927_0000766_23030_23581 176
501 3300035695 Ga0373927_0006850 Ga0373927_0006850_6357_6890 176
502 3300035724 Ga0373933_0000218 Ga0373933_0000218_1700_2251 176
503 3300035724 Ga0373933_0006129 Ga0373933_0006129_3850_4380 176
504 3300035724 Ga0373933_0658781 Ga0373933_0658781_17_562 176
505 3300035724 Ga0373933_0802080 Ga0373933_0802080_16_549 176
506 3300035725 Ga0373947_0000310 Ga0373947_0000310_24590_25141 176
507 3300035725 Ga0373947_0020656 Ga0373947_0020656_454_987 176
508 3300035725 Ga0373947_0282245 Ga0373947_0282245_522_1055 176
509 3300036401 Ga0373937_0013830 Ga0373937_0013830_3279_3809 176
510 3300036401 Ga0373937_0101471 Ga0373937_0101471_1251_1796 176
511 3300036401 Ga0373937_0255663 Ga0373937_0255663_865_1416 176
512 3300036401 Ga0373937_0508729 Ga0373937_0508729_10_561 176
513 3300037068 Ga0373925_0002455 Ga0373925_0002455_5887_6438 176
514 3300039438 Ga0436360_1122847 Ga0436360_1122847_92_622 176
515 3300039447 Ga0436361_0042502 Ga0436361_0042502_233_763 176
516 3300039450 Ga0436363_0081426 Ga0436363_0081426_101_646 176
517 3300039450 Ga0436363_0802555 Ga0436363_0802555_2037_2570 176
518 3300039453 Ga0436362_0261438 Ga0436362_0261438_27_557 176
519 3300042157 Ga0439458_0071754 Ga0439458_0071754_244_780 176
520 3300042438 Ga0439459_0013441 Ga0439459_0013441_267_803 176
521 3300044656 Ga0466969_0282419 Ga0466969_0282419_155_685 176
522 3300044684 Ga0466966_0152331 Ga0466966_0152331_752_1282 176
523 3300044694 Ga0466963_0203223 Ga0466963_0203223_706_1239 176
524 3300044719 Ga0466971_0191701 Ga0466971_0191701_36_566 176
525 3300044765 Ga0466970_0382122 Ga0466970_0382122_70_600 176
526 3300045049 Ga0466959_0203327 Ga0466959_0203327_651_1286 176
527 3300045976 Ga0466967_0309991 Ga0466967_0309991_387_932 176
528 3300045976 Ga0466967_0504505 Ga0466967_0504505_600_1130 176
529 3300045976 Ga0466967_0852621 Ga0466967_0852621_346_879 176
530 3300046452 Ga0495617_083339 Ga0495617_083339_230_763 176
531 3300046454 Ga0495592_0004510 Ga0495592_0004510_3548_4078 176
532 3300046454 Ga0495592_0064253 Ga0495592_0064253_1535_2086 176
533 3300046455 Ga0495603_0000801 Ga0495603_0000801_6927_7478 176
534 3300046455 Ga0495603_0043798 Ga0495603_0043798_1785_2318 176
535 3300046455 Ga0495603_0087655 Ga0495603_0087655_505_1038 176
536 3300046459 Ga0495629_0003266 Ga0495629_0003266_2159_2689 176
537 3300046459 Ga0495629_0007739 Ga0495629_0007739_5076_5627 176
538 3300046459 Ga0495629_0202273 Ga0495629_0202273_517_1050 176
539 3300046461 Ga0495641_0002198 Ga0495641_0002198_6851_7402 176
540 3300046462 Ga0495651_0009476 Ga0495651_0009476_5144_5674 176
541 3300046462 Ga0495651_0097928 Ga0495651_0097928_821_1357 176
542 3300046463 Ga0495653_0008190 Ga0495653_0008190_7604_8134 176
543 3300046472 Ga0495580_0583448 Ga0495580_0583448_189_722 176
544 3300046473 Ga0495582_0000855 Ga0495582_0000855_1143_1694 176
545 3300046473 Ga0495582_0364597 Ga0495582_0364597_187_726 176
546 3300046475 Ga0495639_0000072 Ga0495639_0000072_30055_30606 176
547 3300046476 Ga0495662_0000572 Ga0495662_0000572_3885_4436 176
548 3300046477 Ga0495664_0011398 Ga0495664_0011398_1805_2356 176
549 3300046477 Ga0495664_0070216 Ga0495664_0070216_1452_1988 176
550 3300046477 Ga0495664_0284032 Ga0495664_0284032_250_780 176
551 3300046492 Ga0495585_0066657 Ga0495585_0066657_826_1356 176
552 3300046492 Ga0495585_0129040 Ga0495585_0129040_107_706 176
553 3300046499 Ga0495594_0000046 Ga0495594_0000046_40865_41416 176
554 3300046499 Ga0495594_0130994 Ga0495594_0130994_461_994 176
555 3300046499 Ga0495594_0635827 Ga0495594_0635827_18_551 176
556 3300046507 Ga0495606_0005524 Ga0495606_0005524_197_739 176
557 3300046507 Ga0495606_0182001 Ga0495606_0182001_152_694 176
558 3300046511 Ga0495608_0004196 Ga0495608_0004196_4177_4707 176
559 3300046514 Ga0495618_0162499 Ga0495618_0162499_635_1186 176
560 3300046516 Ga0495628_0011819 Ga0495628_0011819_759_1289 176
561 3300046517 Ga0495630_0011525 Ga0495630_0011525_2032_2583 176
562 3300046520 Ga0495637_0079586 Ga0495637_0079586_675_1208 176
563 3300046523 Ga0495644_0057427 Ga0495644_0057427_427_957 176
564 3300046526 Ga0495666_0003632 Ga0495666_0003632_3632_4183 176
565 3300046526 Ga0495666_0098996 Ga0495666_0098996_261_812 176
566 3300046529 Ga0495652_0234622 Ga0495652_0234622_169_699 176
567 3300046529 Ga0495652_0252270 Ga0495652_0252270_339_875 176
568 3300046531 Ga0495665_0000128 Ga0495665_0000128_8446_8997 176
569 3300046533 Ga0495640_0036663 Ga0495640_0036663_654_1205 176
570 3300046533 Ga0495640_0094813 Ga0495640_0094813_891_1421 176
571 3300046535 Ga0495586_0041802 Ga0495586_0041802_1321_1872 176
572 3300046536 Ga0495587_0009812 Ga0495587_0009812_3913_4443 176
573 3300046538 Ga0495609_0252334 Ga0495609_0252334_180_713 176
574 3300046543 Ga0495645_0018687 Ga0495645_0018687_385_915 176
575 3300046557 Ga0495622_0001328 Ga0495622_0001328_356_907 176
576 3300046559 Ga0495667_0003525 Ga0495667_0003525_7688_8218 176
577 3300046559 Ga0495667_0028206 Ga0495667_0028206_2393_2944 176
578 3300046615 Ga0495656_0028598 Ga0495656_0028598_1120_1650 176
579 3300046615 Ga0495656_0070558 Ga0495656_0070558_401_1000 176
580 3300046616 Ga0495668_0274126 Ga0495668_0274126_262_792 176
581 3300046616 Ga0495668_0329825 Ga0495668_0329825_188_745 176
582 3300046642 Ga0495634_0003037 Ga0495634_0003037_755_1306 176
583 3300046642 Ga0495634_0022125 Ga0495634_0022125_2190_2720 176
584 3300046642 Ga0495634_0278345 Ga0495634_0278345_265_804 176
585 3300046660 Ga0495625_0550984 Ga0495625_0550984_103_633 176
586 3300046663 Ga0495635_0002038 Ga0495635_0002038_2264_2815 176
587 3300046663 Ga0495635_0007778 Ga0495635_0007778_5279_5809 176
588 3300046674 Ga0495588_0010612 Ga0495588_0010612_1274_1825 176
589 3300046675 Ga0495657_0004913 Ga0495657_0004913_7819_8349 176
590 3300046675 Ga0495657_0350970 Ga0495657_0350970_18_551 176
591 3300046675 Ga0495657_0661098 Ga0495657_0661098_45_581 176
592 3300046678 Ga0495599_0010423 Ga0495599_0010423_954_1484 176
593 3300046679 Ga0495623_0011237 Ga0495623_0011237_3947_4477 176
594 3300046680 Ga0495646_0007134 Ga0495646_0007134_6059_6589 176
595 3300046680 Ga0495646_0049702 Ga0495646_0049702_1733_2284 176
596 3300046681 Ga0495647_0002474 Ga0495647_0002474_4898_5449 176
597 3300046683 Ga0495658_0004429 Ga0495658_0004429_3539_4090 176
598 3300046683 Ga0495658_0449462 Ga0495658_0449462_201_740 176
599 3300046684 Ga0495669_0026349 Ga0495669_0026349_242_775 176
600 3300046684 Ga0495669_0097292 Ga0495669_0097292_211_813 176
601 3300046684 Ga0495669_0117820 Ga0495669_0117820_697_1230 176
602 3300046689 Ga0495613_0003702 Ga0495613_0003702_2252_2803 176
603 3300046690 Ga0495624_0000795 Ga0495624_0000795_3906_4457 176
604 3300046691 Ga0495670_0017082 Ga0495670_0017082_186_785 176
605 3300046691 Ga0495670_0530277 Ga0495670_0530277_44_577 176
606 3300046692 Ga0495671_0141140 Ga0495671_0141140_64_594 176
607 3300046809 Ga0495600_0004657 Ga0495600_0004657_2929_3459 176
608 3300047315 Ga0495581_0000030 Ga0495581_0000030_32408_32959 176
609 3300047315 Ga0495581_0076482 Ga0495581_0076482_416_955 176
610 3300047315 Ga0495581_0076953 Ga0495581_0076953_856_1389 176
611 3300047315 Ga0495581_0638923 Ga0495581_0638923_32_574 176
612 3300047317 Ga0495604_0002900 Ga0495604_0002900_8416_8946 176
613 3300047317 Ga0495604_0263011 Ga0495604_0263011_382_933 176
614 3300047319 Ga0495674_0001230 Ga0495674_0001230_9481_10032 176
615 3300047320 Ga0495672_0047254 Ga0495672_0047254_60_611 176
616 3300047321 Ga0495676_0017129 Ga0495676_0017129_2547_3098 176
617 3300047322 Ga0495680_0027947 Ga0495680_0027947_3579_4109 176
618 3300047444 Ga0495675_0019998 Ga0495675_0019998_2771_3301 176
619 3300047447 Ga0495685_048884 Ga0495685_048884_825_1355 176
620 3300047469 Ga0495673_0033929 Ga0495673_0033929_1602_2135 176
621 3300047469 Ga0495673_0102910 Ga0495673_0102910_98_628 176
622 3300047471 Ga0495684_0005221 Ga0495684_0005221_8220_8750 176
623 3300047471 Ga0495684_0043185 Ga0495684_0043185_2078_2629 176
624 3300047472 Ga0495686_0074493 Ga0495686_0074493_781_1317 176
625 3300047673 Ga0495593_0000470 Ga0495593_0000470_5835_6386 176
626 3300047673 Ga0495593_0002684 Ga0495593_0002684_784_1314 176
627 3300048088 Ga0495602_0024305 Ga0495602_0024305_4162_4692 176
628 3300048089 Ga0495614_0022266 Ga0495614_0022266_1009_1560 176
629 3300048090 Ga0495615_0147762 Ga0495615_0147762_43_573 176
630 3300048903 Ga0496100_0011102 Ga0496100_0011102_4350_4892 176
631 3300048903 Ga0496100_0045464 Ga0496100_0045464_1577_2119 176
632 3300048903 Ga0496100_0835453 Ga0496100_0835453_67_597 176
633 3300048904 Ga0496101_0007163 Ga0496101_0007163_160_702 176
634 3300048904 Ga0496101_0213659 Ga0496101_0213659_592_1122 176
635 3300048904 Ga0496101_0268680 Ga0496101_0268680_351_881 176
636 3300048904 Ga0496101_0364407 Ga0496101_0364407_392_934 176
637 3300048905 Ga0496102_0222278 Ga0496102_0222278_255_788 176
638 3300048905 Ga0496102_0260354 Ga0496102_0260354_12_554 176
639 3300048905 Ga0496102_0372279 Ga0496102_0372279_116_658 176
640 3300048905 Ga0496102_0552397 Ga0496102_0552397_267_797 176
641 3300048906 Ga0496103_0448749 Ga0496103_0448749_287_817 176
642 3300048906 Ga0496103_0459363 Ga0496103_0459363_100_642 176
643 3300048907 Ga0496104_0022374 Ga0496104_0022374_2233_2775 176
644 3300048907 Ga0496104_0115657 Ga0496104_0115657_564_1106 176
645 3300048907 Ga0496104_0828287 Ga0496104_0828287_187_717 176
646 3300048908 Ga0496105_0027959 Ga0496105_0027959_297_839 176
647 3300048908 Ga0496105_0125981 Ga0496105_0125981_808_1341 176
648 3300048908 Ga0496105_0379627 Ga0496105_0379627_425_958 176
649 3300048909 Ga0496106_0119067 Ga0496106_0119067_1259_1789 176
650 3300048909 Ga0496106_0131471 Ga0496106_0131471_564_1097 176
651 3300048909 Ga0496106_0239605 Ga0496106_0239605_48_578 176
652 3300048909 Ga0496106_0322287 Ga0496106_0322287_548_1078 176
653 3300048909 Ga0496106_0528178 Ga0496106_0528178_250_792 176
654 3300048910 Ga0496107_0007455 Ga0496107_0007455_6589_7131 176
655 3300048910 Ga0496107_0019166 Ga0496107_0019166_3967_4509 176
656 3300048910 Ga0496107_0046717 Ga0496107_0046717_1527_2060 176
657 3300048910 Ga0496107_0677466 Ga0496107_0677466_168_698 176
658 3300048911 Ga0496108_0000927 Ga0496108_0000927_169_711 176
659 3300048911 Ga0496108_0075422 Ga0496108_0075422_190_720 176
660 3300048911 Ga0496108_0265614 Ga0496108_0265614_70_612 176
661 3300048911 Ga0496108_0456112 Ga0496108_0456112_541_1074 176
662 3300048912 Ga0496109_0053221 Ga0496109_0053221_2912_3454 176
663 3300048912 Ga0496109_0095265 Ga0496109_0095265_520_1053 176
664 3300048912 Ga0496109_0108132 Ga0496109_0108132_238_771 176
665 3300048912 Ga0496109_0528669 Ga0496109_0528669_243_806 176
666 3300048913 Ga0496110_0017143 Ga0496110_0017143_5245_5787 176
667 3300048913 Ga0496110_0018413 Ga0496110_0018413_5144_5686 176
668 3300048913 Ga0496110_0134209 Ga0496110_0134209_1604_2137 176
669 3300048913 Ga0496110_0248654 Ga0496110_0248654_17_550 176
670 3300048913 Ga0496110_0444848 Ga0496110_0444848_43_576 176
671 3300048914 Ga0496111_0023210 Ga0496111_0023210_760_1302 176
672 3300048914 Ga0496111_0122082 Ga0496111_0122082_952_1485 176
673 3300048914 Ga0496111_0166487 Ga0496111_0166487_205_735 176
674 3300048914 Ga0496111_0208434 Ga0496111_0208434_802_1335 176
675 3300048915 Ga0496112_0004583 Ga0496112_0004583_32_565 176
676 3300048915 Ga0496112_0039976 Ga0496112_0039976_143_685 176
677 3300048915 Ga0496112_0146271 Ga0496112_0146271_1154_1699 176
678 3300048915 Ga0496112_0298540 Ga0496112_0298540_304_837 176
679 3300048915 Ga0496112_0960033 Ga0496112_0960033_22_555 176
680 3300048916 Ga0496113_0007783 Ga0496113_0007783_5229_5771 176
681 3300048916 Ga0496113_0215444 Ga0496113_0215444_594_1136 176
682 3300048916 Ga0496113_0244403 Ga0496113_0244403_24_557 176
683 3300048916 Ga0496113_0673005 Ga0496113_0673005_141_671 176
684 3300048916 Ga0496113_0893946 Ga0496113_0893946_27_566 176
685 3300048917 Ga0496114_0096307 Ga0496114_0096307_1195_1728 176
686 3300048917 Ga0496114_0107180 Ga0496114_0107180_178_708 176
687 3300048917 Ga0496114_0382569 Ga0496114_0382569_488_1087 176
688 3300048918 Ga0496115_0003360 Ga0496115_0003360_781_1323 176
689 3300048918 Ga0496115_0044258 Ga0496115_0044258_2115_2648 176
690 3300048918 Ga0496115_0221729 Ga0496115_0221729_847_1380 176
691 3300048918 Ga0496115_0316381 Ga0496115_0316381_503_1036 176
692 3300048918 Ga0496115_0671389 Ga0496115_0671389_152_682 176
693 3300048922 Ga0496119_0073501 Ga0496119_0073501_1082_1615 176
694 3300048922 Ga0496119_0079090 Ga0496119_0079090_314_850 176
695 3300048924 Ga0496121_0000278 Ga0496121_0000278_38024_38635 176
696 3300048924 Ga0496121_0054019 Ga0496121_0054019_1294_1827 176
697 3300048924 Ga0496121_0153536 Ga0496121_0153536_292_822 176
698 3300048924 Ga0496121_0242695 Ga0496121_0242695_208_753 176
699 3300048924 Ga0496121_0312171 Ga0496121_0312171_313_843 176
700 3300048924 Ga0496121_0571402 Ga0496121_0571402_31_630 176
701 3300048927 Ga0496124_0161433 Ga0496124_0161433_514_1044 176
702 3300048928 Ga0496125_0489269 Ga0496125_0489269_69_599 176
703 3300048929 Ga0496126_0006001 Ga0496126_0006001_5292_5822 176
704 3300048929 Ga0496126_0013876 Ga0496126_0013876_3052_3597 176
705 3300048929 Ga0496126_0026105 Ga0496126_0026105_892_1422 176
706 3300048929 Ga0496126_0064657 Ga0496126_0064657_2068_2601 176
707 3300048929 Ga0496126_0150631 Ga0496126_0150631_728_1264 176
708 3300048929 Ga0496126_0176929 Ga0496126_0176929_579_1109 176
709 3300048929 Ga0496126_0178961 Ga0496126_0178961_542_1075 176
710 3300048929 Ga0496126_0413044 Ga0496126_0413044_479_1009 176
711 3300048929 Ga0496126_0527297 Ga0496126_0527297_204_734 176
712 3300048929 Ga0496126_0654778 Ga0496126_0654778_44_574 176
713 3300048929 Ga0496126_0731711 Ga0496126_0731711_163_708 176
714 3300048929 Ga0496126_1068211 Ga0496126_1068211_13_546 176
715 3300049460 Ga0495682_0226558 Ga0495682_0226558_16_546 176
716 3300049568 Ga0501031_0242922 Ga0501031_0242922_132_662 176
717 3300049569 Ga0501032_0066349 Ga0501032_0066349_1787_2326 176
718 3300049569 Ga0501032_0067608 Ga0501032_0067608_20_571 176
719 3300049569 Ga0501032_0228323 Ga0501032_0228323_429_959 176
720 3300049570 Ga0501033_0047330 Ga0501033_0047330_145_684 176
721 3300049571 Ga0501034_0098555 Ga0501034_0098555_2270_2821 176
722 3300049571 Ga0501034_0190783 Ga0501034_0190783_1320_1859 176
723 3300049571 Ga0501034_0281447 Ga0501034_0281447_614_1165 176
724 3300049571 Ga0501034_0862002 Ga0501034_0862002_221_751 176
725 3300049571 Ga0501034_1029229 Ga0501034_1029229_145_684 176
726 3300049571 Ga0501034_1290183 Ga0501034_1290183_36_587 176
727 3300049572 Ga0501036_0028417 Ga0501036_0028417_2299_2850 176
728 3300049572 Ga0501036_0138795 Ga0501036_0138795_1388_1927 176
729 3300049572 Ga0501036_0154070 Ga0501036_0154070_143_694 176
730 3300049572 Ga0501036_0930954 Ga0501036_0930954_103_654 176
731 3300049573 Ga0501037_0101501 Ga0501037_0101501_899_1450 176
732 3300049574 Ga0501038_0001610 Ga0501038_0001610_7615_8166 176
733 3300049574 Ga0501038_0102330 Ga0501038_0102330_951_1481 176
734 3300049574 Ga0501038_0202255 Ga0501038_0202255_475_1014 176
735 3300049575 Ga0501039_0071309 Ga0501039_0071309_1736_2266 176
736 3300049575 Ga0501039_0086766 Ga0501039_0086766_177_728 176
737 3300049575 Ga0501039_0228591 Ga0501039_0228591_213_764 176
738 3300049575 Ga0501039_0440318 Ga0501039_0440318_284_814 176
739 3300049576 Ga0501040_0355026 Ga0501040_0355026_170_709 176
740 3300049578 Ga0501042_0096738 Ga0501042_0096738_1025_1564 176
741 3300049579 Ga0501043_0030435 Ga0501043_0030435_3405_3956 176
742 3300049579 Ga0501043_0046321 Ga0501043_0046321_2084_2635 176
743 3300049579 Ga0501043_0256981 Ga0501043_0256981_28_558 176
744 3300049579 Ga0501043_0287262 Ga0501043_0287262_218_748 176
745 3300049580 Ga0501046_0072186 Ga0501046_0072186_117_656 176
746 3300049581 Ga0501047_0031515 Ga0501047_0031515_3828_4358 176
747 3300049581 Ga0501047_0098605 Ga0501047_0098605_1895_2446 176
748 3300049581 Ga0501047_0472745 Ga0501047_0472745_391_921 176
749 3300049581 Ga0501047_0621439 Ga0501047_0621439_79_624 176
750 3300049583 Ga0501067_0018457 Ga0501067_0018457_491_1036 176
751 3300049583 Ga0501067_0043030 Ga0501067_0043030_1816_2346 176
752 3300049584 Ga0501068_0154274 Ga0501068_0154274_238_789 176
753 3300049584 Ga0501068_0782468 Ga0501068_0782468_23_562 176
754 3300049585 Ga0501069_0195420 Ga0501069_0195420_191_730 176
755 3300049586 Ga0501070_0058568 Ga0501070_0058568_1896_2435 176
756 3300049586 Ga0501070_0105463 Ga0501070_0105463_1699_2250 176
757 3300049588 Ga0501072_0122136 Ga0501072_0122136_1007_1546 176
758 3300049589 Ga0501073_0023122 Ga0501073_0023122_198_737 176
759 3300049589 Ga0501073_0105242 Ga0501073_0105242_68_598 176
760 3300049589 Ga0501073_0131464 Ga0501073_0131464_211_762 176
761 3300049590 Ga0501074_0192633 Ga0501074_0192633_259_798 176
762 3300049590 Ga0501074_0422208 Ga0501074_0422208_349_879 176
763 3300049592 Ga0501076_0195023 Ga0501076_0195023_756_1295 176
764 3300049741 Ga0501079_0034413 Ga0501079_0034413_3137_3676 176
765 3300049741 Ga0501079_0202434 Ga0501079_0202434_623_1153 176
766 3300049742 Ga0501080_0083493 Ga0501080_0083493_2214_2753 176
767 3300049742 Ga0501080_0843041 Ga0501080_0843041_120_722 176
768 3300049822 Ga0501035_0060571 Ga0501035_0060571_810_1349 176
769 3300049822 Ga0501035_0206710 Ga0501035_0206710_69_599 176
770 3300049822 Ga0501035_0503731 Ga0501035_0503731_115_645 176
771 3300049822 Ga0501035_0770832 Ga0501035_0770832_118_648 176
772 3300049823 Ga0501044_0012055 Ga0501044_0012055_599_1150 176
773 3300049823 Ga0501044_0101594 Ga0501044_0101594_1446_1976 176
774 3300049823 Ga0501044_0505495 Ga0501044_0505495_316_873 176
775 3300049823 Ga0501044_0725571 Ga0501044_0725571_223_753 176
776 3300049823 Ga0501044_0796512 Ga0501044_0796512_215_754 176
777 3300049823 Ga0501044_0957539 Ga0501044_0957539_68_601 176
778 3300049823 Ga0501044_1065663 Ga0501044_1065663_45_596 176
779 3300049824 Ga0501045_0362568 Ga0501045_0362568_529_1068 176
780 3300049824 Ga0501045_0982581 Ga0501045_0982581_54_605 176
781 3300050489 nmdc:mga03683_61226_c1 nmdc:mga03683_61226_c1_342_872 176
782 3300050490 nmdc:mga03n38_7962_c1 nmdc:mga03n38_7962_c1_2899_3429 176
783 3300050490 nmdc:mga03n38_95480_c1 nmdc:mga03n38_95480_c1_474_1004 176
784 3300050491 nmdc:mga00v17_116481_c1 nmdc:mga00v17_116481_c1_896_1426 176
785 3300050491 nmdc:mga00v17_201058_c1 nmdc:mga00v17_201058_c1_600_1130 176
786 3300050492 nmdc:mga0yw44_63003_c1 nmdc:mga0yw44_63003_c1_411_941 176
787 3300050493 nmdc:mga0k408_233891_c1 nmdc:mga0k408_233891_c1_187_717 176
788 3300050493 nmdc:mga0k408_269890_c1 nmdc:mga0k408_269890_c1_211_741 176
789 3300050493 nmdc:mga0k408_85432_c1 nmdc:mga0k408_85432_c1_372_902 176
790 3300050494 nmdc:mga06z11_15583_c1 nmdc:mga06z11_15583_c1_2399_2929 176
791 3300050494 nmdc:mga06z11_85331_c1 nmdc:mga06z11_85331_c1_106_639 176
792 3300050495 nmdc:mga04h51_116248_c1 nmdc:mga04h51_116248_c1_57_587 176
793 3300050496 nmdc:mga07m45_104203_c1 nmdc:mga07m45_104203_c1_367_897 176
794 3300050496 nmdc:mga07m45_313946_c1 nmdc:mga07m45_313946_c1_355_885 176
795 3300050507 nmdc:mga05p37_73784_c1 nmdc:mga05p37_73784_c1_792_1406 176
796 3300050515 nmdc:mga0a205_1205897_c1 nmdc:mga0a205_1205897_c1_47_577 176
797 3300050516 nmdc:mga0sz30_7031_c1 nmdc:mga0sz30_7031_c1_913_1527 176
798 3300053077 Ga0495601_0211795 Ga0495601_0211795_652_1203 176
799 3300053077 Ga0495601_0255016 Ga0495601_0255016_555_1085 176
800 3300053078 Ga0495612_0049565 Ga0495612_0049565_354_887 176
801 3300053084 Ga0495595_0001339 Ga0495595_0001339_1733_2263 176
802 3300053085 Ga0495619_0005596 Ga0495619_0005596_4362_4892 176
803 3300053091 Ga0500647_0014493 Ga0500647_0014493_2305_2835 176
804 3300053091 Ga0500647_0183660 Ga0500647_0183660_164_706 176
805 3300053094 Ga0500566_0003437 Ga0500566_0003437_3183_3713 176
806 3300053094 Ga0500566_0015200 Ga0500566_0015200_587_1129 176
807 3300053102 Ga0500554_006966 Ga0500554_006966_584_1126 176
808 3300053102 Ga0500554_007220 Ga0500554_007220_186_737 176
809 3300053111 Ga0500572_086015 Ga0500572_086015_394_924 176
810 3300053119 Ga0500595_001016 Ga0500595_001016_4543_5085 176
811 3300053119 Ga0500595_006629 Ga0500595_006629_787_1326 176
812 3300053119 Ga0500595_117096 Ga0500595_117096_10_546 176
813 3300053139 Ga0500568_0016453 Ga0500568_0016453_854_1507 176
814 3300053147 Ga0500589_143328 Ga0500589_143328_237_767 176
815 3300053148 Ga0500590_025848 Ga0500590_025848_2334_2864 176
816 3300053150 Ga0500603_000630 Ga0500603_000630_7078_7629 176
817 3300053159 Ga0500630_091455 Ga0500630_091455_680_1210 176
818 3300053162 Ga0500638_000160 Ga0500638_000160_6511_7053 176
819 3300053163 Ga0500639_026342 Ga0500639_026342_1450_1980 176
820 3300053178 Ga0500637_0000180 Ga0500637_0000180_21400_21942 176
821 3300053735 Ga0500596_001070 Ga0500596_001070_3223_3753 176
822 3300054114 Ga0501084_0086802 Ga0501084_0086802_708_1247 176
823 3300055283 Ga0500661_010018 Ga0500661_010018_740_1282 176
824 3300060353 Ga0501082_0146982 Ga0501082_0146982_89_628 176
825 3300061734 Ga0530510_0494819 Ga0530510_0494819_240_770 176
826 iso_pu_bacteria 2791355197 2793072720 176
827 iso_pu_bacteria 2791355199 2793078314 176
828 iso_pu_bacteria 2922425934 2922434020 176
829 iso_pu_bacteria 8019555841 8019562642 176
830 iso_pu_bacteria 8019565922 8019572721 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

40

195

0.91

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

37

175

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

51

174

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

86

176

0.77

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

35

162

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9938 4 174
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9825 3 166
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9779 5 166
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9766 3 166
4jxr-assembly1.cif.gz_B crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa 0.9753 2 176
ID Description Score Start End Superfamily
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9918 4 174 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9803 5 167 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9744 5 167 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9641 4 170 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9583 4 174 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A523F9T1-F1-model_v4 N-acetyltransferase family protein 0.9978 4 115 GO:0016747
AF-A0A537T1M5-F1-model_v4 N-acetyltransferase family protein 0.9958 66 174 GO:0016747
AF-A0A7W4PBU3-F1-model_v4 N-acetyltransferase 0.9945 4 176 GO:0016747
AF-A0A244EGG1-F1-model_v4 GCN5 family acetyltransferase 0.9933 4 175 GO:0016747
AF-A0A192IM53-F1-model_v4 deleted 0.9929 2 165

Feature Viewer

pLDDT pTM Quality
93.95 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map