F482670
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 402 | 822 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0016453|Ga0500568_0016453_854_1507 |
| Length | 217 |
| Sequence | VDDRDFWAKTRFALLPGRDERMLIQTCRLISSAPMSSLEIRPTAEADLSAITEIYGQAVRYGTATFELIPPDLAEMTRRFAVLRDGGFPYFVAALDGRVVGYAYASAYRPRPAYRFTIENSVYLDPAIHRRGIGLQLLQRLIAESEARGYRQMIAVIGDSANAGSIAVHTRCGFQMIGTHPNVGFKFGRWLDTVMMQRALREGGMTVPADGSTSVQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 3 | 2791355199 | |||
| 4 | 2922425934 | |||
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 238 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 363 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 365 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 377 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 378 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 382 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 390 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 394 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 399 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 400 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 401 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 402 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0.12 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.59 |
| Nodule | 0.96 |
| Rhizoplane | 7.71 |
| Rhizosphere | 79.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001038 | 3300003203 | Bacteria | 12982 |
| 2 | Ga0070658_10027535 | 3300005327 | Bacteria | 4559 |
| 3 | Ga0070658_10286708 | 3300005327 | Bacteria | 1402 |
| 4 | Ga0070676_10324087 | 3300005328 | Bacteria | 1052 |
| 5 | Ga0070683_100017946 | 3300005329 | Bacteria | 6256 |
| 6 | Ga0070683_100800069 | 3300005329 | Bacteria | 904 |
| 7 | Ga0070690_100137371 | 3300005330 | Bacteria | 1656 |
| 8 | Ga0070670_100184713 | 3300005331 | Bacteria | 1810 |
| 9 | Ga0068869_100064257 | 3300005334 | Bacteria | 2699 |
| 10 | Ga0068869_100382589 | 3300005334 | Bacteria | 1154 |
| 11 | Ga0070666_10383185 | 3300005335 | Bacteria | 1009 |
| 12 | Ga0070680_100074496 | 3300005336 | Bacteria | 2793 |
| 13 | Ga0070680_100126836 | 3300005336 | Bacteria | 2132 |
| 14 | Ga0070680_100361541 | 3300005336 | Bacteria | 1235 |
| 15 | Ga0070682_100709271 | 3300005337 | Bacteria | 808 |
| 16 | Ga0068868_100162651 | 3300005338 | Bacteria | 1844 |
| 17 | Ga0068868_100682213 | 3300005338 | Bacteria | 917 |
| 18 | Ga0070660_100001927 | 3300005339 | Bacteria | 14295 |
| 19 | Ga0070689_100820970 | 3300005340 | Bacteria | 819 |
| 20 | Ga0070691_10050950 | 3300005341 | Bacteria | 1976 |
| 21 | Ga0070687_100760691 | 3300005343 | Bacteria | 683 |
| 22 | Ga0070661_100050714 | 3300005344 | Bacteria | 3036 |
| 23 | Ga0070661_100589486 | 3300005344 | Bacteria | 898 |
| 24 | Ga0070675_100522164 | 3300005354 | Bacteria | 1071 |
| 25 | Ga0070675_100591740 | 3300005354 | Bacteria | 1006 |
| 26 | Ga0070671_100758109 | 3300005355 | Bacteria | 844 |
| 27 | Ga0070674_100768080 | 3300005356 | Bacteria | 830 |
| 28 | Ga0070673_100212996 | 3300005364 | Bacteria | 1669 |
| 29 | Ga0070673_100588216 | 3300005364 | Bacteria | 1014 |
| 30 | Ga0070673_100632025 | 3300005364 | Bacteria | 979 |
| 31 | Ga0070673_100742133 | 3300005364 | Bacteria | 904 |
| 32 | Ga0070673_101102603 | 3300005364 | Bacteria | 741 |
| 33 | Ga0070688_100289591 | 3300005365 | Bacteria | 1180 |
| 34 | Ga0070659_100084996 | 3300005366 | Bacteria | 2530 |
| 35 | Ga0070659_100131163 | 3300005366 | Bacteria | 2035 |
| 36 | Ga0070659_100595671 | 3300005366 | Bacteria | 949 |
| 37 | Ga0070659_100663781 | 3300005366 | Bacteria | 900 |
| 38 | Ga0070667_100300816 | 3300005367 | Bacteria | 1444 |
| 39 | Ga0070709_10014869 | 3300005434 | Bacteria | 4414 |
| 40 | Ga0070709_10536023 | 3300005434 | Bacteria | 894 |
| 41 | Ga0070714_100191652 | 3300005435 | Bacteria | 1866 |
| 42 | Ga0070701_10227418 | 3300005438 | Bacteria | 1115 |
| 43 | Ga0070711_100220011 | 3300005439 | Bacteria | 1475 |
| 44 | Ga0070711_100369176 | 3300005439 | Bacteria | 1158 |
| 45 | Ga0070708_100353150 | 3300005445 | Bacteria | 1386 |
| 46 | Ga0070663_100051597 | 3300005455 | Bacteria | 2931 |
| 47 | Ga0070663_100055706 | 3300005455 | Bacteria | 2831 |
| 48 | Ga0070663_100155680 | 3300005455 | Bacteria | 1756 |
| 49 | Ga0070663_100334575 | 3300005455 | Bacteria | 1221 |
| 50 | Ga0070663_100352173 | 3300005455 | Bacteria | 1192 |
| 51 | Ga0070663_100720227 | 3300005455 | Bacteria | 850 |
| 52 | Ga0070678_100075681 | 3300005456 | Bacteria | 2533 |
| 53 | Ga0070678_100096396 | 3300005456 | Bacteria | 2282 |
| 54 | Ga0070678_100119951 | 3300005456 | Bacteria | 2072 |
| 55 | Ga0070678_100181951 | 3300005456 | Bacteria | 1721 |
| 56 | Ga0070678_100188119 | 3300005456 | Bacteria | 1696 |
| 57 | Ga0070678_100691876 | 3300005456 | Bacteria | 918 |
| 58 | Ga0070662_100213843 | 3300005457 | Bacteria | 1535 |
| 59 | Ga0070662_100293353 | 3300005457 | Bacteria | 1319 |
| 60 | Ga0070681_10169332 | 3300005458 | Bacteria | 2106 |
| 61 | Ga0068867_100257444 | 3300005459 | Bacteria | 1421 |
| 62 | Ga0070685_10141415 | 3300005466 | Bacteria | 1515 |
| 63 | Ga0070706_100710647 | 3300005467 | Bacteria | 932 |
| 64 | Ga0070707_100142842 | 3300005468 | Bacteria | 2330 |
| 65 | Ga0070698_100148394 | 3300005471 | Bacteria | 2294 |
| 66 | Ga0070679_100138520 | 3300005530 | Bacteria | 2414 |
| 67 | Ga0070679_100163428 | 3300005530 | Bacteria | 2200 |
| 68 | Ga0070679_100341757 | 3300005530 | Bacteria | 1445 |
| 69 | Ga0070679_100411099 | 3300005530 | Bacteria | 1299 |
| 70 | Ga0070684_100028804 | 3300005535 | Bacteria | 4700 |
| 71 | Ga0070684_101184504 | 3300005535 | Bacteria | 719 |
| 72 | Ga0070697_100200902 | 3300005536 | Bacteria | 1694 |
| 73 | Ga0070697_100627630 | 3300005536 | Bacteria | 945 |
| 74 | Ga0068853_100000920 | 3300005539 | Bacteria | 20589 |
| 75 | Ga0068853_100075228 | 3300005539 | Bacteria | 2947 |
| 76 | Ga0068853_100116332 | 3300005539 | Bacteria | 2380 |
| 77 | Ga0068853_100647449 | 3300005539 | Bacteria | 1005 |
| 78 | Ga0070672_100231798 | 3300005543 | Bacteria | 1551 |
| 79 | Ga0070672_100418482 | 3300005543 | Bacteria | 1151 |
| 80 | Ga0070686_100782264 | 3300005544 | Bacteria | 768 |
| 81 | Ga0070693_100059830 | 3300005547 | Bacteria | 2209 |
| 82 | Ga0070693_100066801 | 3300005547 | Bacteria | 2105 |
| 83 | Ga0070665_100058941 | 3300005548 | Bacteria | 3848 |
| 84 | Ga0070665_100162041 | 3300005548 | Bacteria | 2238 |
| 85 | Ga0070665_100182360 | 3300005548 | Bacteria | 2100 |
| 86 | Ga0070665_100238690 | 3300005548 | Bacteria | 1818 |
| 87 | Ga0070665_100324243 | 3300005548 | Bacteria | 1544 |
| 88 | Ga0070665_100458723 | 3300005548 | Bacteria | 1284 |
| 89 | Ga0068855_100029481 | 3300005563 | Bacteria | 6559 |
| 90 | Ga0068855_100046913 | 3300005563 | Bacteria | 5106 |
| 91 | Ga0068855_100166647 | 3300005563 | Bacteria | 2497 |
| 92 | Ga0068855_100188673 | 3300005563 | Bacteria | 2326 |
| 93 | Ga0068855_100505594 | 3300005563 | Bacteria | 1313 |
| 94 | Ga0070664_100171516 | 3300005564 | Bacteria | 1924 |
| 95 | Ga0070664_100238331 | 3300005564 | Bacteria | 1632 |
| 96 | Ga0070664_100678646 | 3300005564 | Bacteria | 959 |
| 97 | Ga0068857_100001037 | 3300005577 | Bacteria | 21487 |
| 98 | Ga0068857_100223783 | 3300005577 | Bacteria | 1719 |
| 99 | Ga0068857_101300699 | 3300005577 | Bacteria | 706 |
| 100 | Ga0068854_100003979 | 3300005578 | Bacteria | 9266 |
| 101 | Ga0068854_100323281 | 3300005578 | Bacteria | 1255 |
| 102 | Ga0068854_100899502 | 3300005578 | Bacteria | 778 |
| 103 | Ga0068854_101097191 | 3300005578 | Bacteria | 709 |
| 104 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 105 | Ga0068856_100004208 | 3300005614 | Bacteria | 14365 |
| 106 | Ga0068856_100152442 | 3300005614 | Bacteria | 2321 |
| 107 | Ga0068856_100262760 | 3300005614 | Bacteria | 1742 |
| 108 | Ga0068856_100999315 | 3300005614 | Bacteria | 855 |
| 109 | Ga0070702_100150872 | 3300005615 | Bacteria | 1492 |
| 110 | Ga0070702_100267869 | 3300005615 | Bacteria | 1166 |
| 111 | Ga0070702_100344973 | 3300005615 | Bacteria | 1046 |
| 112 | Ga0070702_100404374 | 3300005615 | Bacteria | 978 |
| 113 | Ga0068852_100034011 | 3300005616 | Bacteria | 4239 |
| 114 | Ga0068852_100126529 | 3300005616 | Bacteria | 2347 |
| 115 | Ga0068852_100142386 | 3300005616 | Bacteria | 2220 |
| 116 | Ga0068852_100170191 | 3300005616 | Bacteria | 2041 |
| 117 | Ga0068852_100441012 | 3300005616 | Bacteria | 1287 |
| 118 | Ga0068852_101564800 | 3300005616 | Bacteria | 682 |
| 119 | Ga0068859_100254022 | 3300005617 | Bacteria | 1848 |
| 120 | Ga0068864_100203460 | 3300005618 | Bacteria | 1820 |
| 121 | Ga0068864_100268989 | 3300005618 | Bacteria | 1587 |
| 122 | Ga0068864_100614808 | 3300005618 | Bacteria | 1056 |
| 123 | Ga0068866_10222960 | 3300005718 | Bacteria | 1139 |
| 124 | Ga0068861_100019124 | 3300005719 | Bacteria | 4892 |
| 125 | Ga0068861_100205381 | 3300005719 | Bacteria | 1656 |
| 126 | Ga0068861_100404123 | 3300005719 | Bacteria | 1213 |
| 127 | Ga0068861_100457085 | 3300005719 | Bacteria | 1145 |
| 128 | Ga0068861_100920026 | 3300005719 | Bacteria | 830 |
| 129 | Ga0068851_10006246 | 3300005834 | Bacteria | 5436 |
| 130 | Ga0068851_10034786 | 3300005834 | Bacteria | 2516 |
| 131 | Ga0068870_10598458 | 3300005840 | Bacteria | 749 |
| 132 | Ga0068870_10647281 | 3300005840 | Bacteria | 723 |
| 133 | Ga0068863_100296697 | 3300005841 | Bacteria | 1567 |
| 134 | Ga0068858_100218548 | 3300005842 | Bacteria | 1804 |
| 135 | Ga0068858_100330736 | 3300005842 | Bacteria | 1457 |
| 136 | Ga0068858_100368348 | 3300005842 | Bacteria | 1378 |
| 137 | Ga0068858_100392424 | 3300005842 | Bacteria | 1333 |
| 138 | Ga0068860_100089952 | 3300005843 | Bacteria | 2923 |
| 139 | Ga0068862_100266806 | 3300005844 | Bacteria | 1564 |
| 140 | Ga0068862_100284118 | 3300005844 | Bacteria | 1517 |
| 141 | Ga0068862_100369106 | 3300005844 | Bacteria | 1335 |
| 142 | Ga0068862_100529498 | 3300005844 | Bacteria | 1122 |
| 143 | Ga0068862_101403950 | 3300005844 | Bacteria | 702 |
| 144 | Ga0081455_10025851 | 3300005937 | Bacteria | 5412 |
| 145 | Ga0081455_10178537 | 3300005937 | Bacteria | 1610 |
| 146 | Ga0081455_10249018 | 3300005937 | Bacteria | 1301 |
| 147 | Ga0081538_10032665 | 3300005981 | Bacteria | 3480 |
| 148 | Ga0081540_1000191 | 3300005983 | Bacteria | 63533 |
| 149 | Ga0081540_1016110 | 3300005983 | Bacteria | 4699 |
| 150 | Ga0081540_1019271 | 3300005983 | Bacteria | 4154 |
| 151 | Ga0081540_1085029 | 3300005983 | Bacteria | 1410 |
| 152 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 153 | Ga0081539_10003753 | 3300005985 | Bacteria | 18030 |
| 154 | Ga0081539_10035788 | 3300005985 | Bacteria | 2979 |
| 155 | Ga0070717_10053768 | 3300006028 | Bacteria | 3319 |
| 156 | Ga0070717_10306388 | 3300006028 | Bacteria | 1413 |
| 157 | Ga0070717_10871034 | 3300006028 | Bacteria | 820 |
| 158 | Ga0075365_10031473 | 3300006038 | Bacteria | 3403 |
| 159 | Ga0075365_10318503 | 3300006038 | Bacteria | 1095 |
| 160 | Ga0075365_10356865 | 3300006038 | Bacteria | 1030 |
| 161 | Ga0075363_100040546 | 3300006048 | Bacteria | 2454 |
| 162 | Ga0075363_100042055 | 3300006048 | Bacteria | 2412 |
| 163 | Ga0075363_100059837 | 3300006048 | Bacteria | 2049 |
| 164 | Ga0075363_100189089 | 3300006048 | Bacteria | 1174 |
| 165 | Ga0075364_10081058 | 3300006051 | Bacteria | 2146 |
| 166 | Ga0075364_10407697 | 3300006051 | Bacteria | 928 |
| 167 | Ga0070716_100005454 | 3300006173 | Bacteria | 6164 |
| 168 | Ga0070716_100208126 | 3300006173 | Bacteria | 1305 |
| 169 | Ga0070712_100051297 | 3300006175 | Bacteria | 2873 |
| 170 | Ga0075367_10022578 | 3300006178 | Bacteria | 3531 |
| 171 | Ga0075367_10129008 | 3300006178 | Bacteria | 1562 |
| 172 | Ga0075367_10204275 | 3300006178 | Bacteria | 1235 |
| 173 | Ga0075369_10054951 | 3300006186 | Bacteria | 1729 |
| 174 | Ga0075369_10094096 | 3300006186 | Bacteria | 1339 |
| 175 | Ga0075369_10158915 | 3300006186 | Bacteria | 1035 |
| 176 | Ga0097621_100465752 | 3300006237 | Bacteria | 1140 |
| 177 | Ga0097621_100939775 | 3300006237 | Bacteria | 807 |
| 178 | Ga0068871_101062922 | 3300006358 | Bacteria | 756 |
| 179 | Ga0075434_100289220 | 3300006871 | Bacteria | 1659 |
| 180 | Ga0075434_101225456 | 3300006871 | Bacteria | 762 |
| 181 | Ga0068865_100097523 | 3300006881 | Bacteria | 2146 |
| 182 | Ga0068865_100392575 | 3300006881 | Bacteria | 1135 |
| 183 | Ga0097620_100254024 | 3300006931 | Bacteria | 1848 |
| 184 | Ga0099794_10093674 | 3300007265 | Bacteria | 1493 |
| 185 | Ga0099795_10012860 | 3300007788 | Bacteria | 2551 |
| 186 | Ga0099795_10121689 | 3300007788 | Bacteria | 1044 |
| 187 | Ga0099795_10226511 | 3300007788 | Bacteria | 798 |
| 188 | Ga0105240_10002459 | 3300009093 | Bacteria | 29768 |
| 189 | Ga0105240_10092073 | 3300009093 | Bacteria | 3702 |
| 190 | Ga0105240_10175273 | 3300009093 | Bacteria | 2535 |
| 191 | Ga0105240_11479283 | 3300009093 | Bacteria | 712 |
| 192 | Ga0111539_11207958 | 3300009094 | Bacteria | 878 |
| 193 | Ga0105245_10287261 | 3300009098 | Bacteria | 1610 |
| 194 | Ga0105247_10443916 | 3300009101 | Bacteria | 934 |
| 195 | Ga0105247_10537262 | 3300009101 | Bacteria | 857 |
| 196 | Ga0105243_10132920 | 3300009148 | Bacteria | 2114 |
| 197 | Ga0105243_10688127 | 3300009148 | Bacteria | 995 |
| 198 | Ga0105241_10068388 | 3300009174 | Bacteria | 2752 |
| 199 | Ga0105241_10205614 | 3300009174 | Bacteria | 1647 |
| 200 | Ga0105241_10843530 | 3300009174 | Bacteria | 847 |
| 201 | Ga0105241_11185215 | 3300009174 | Bacteria | 723 |
| 202 | Ga0105242_10493261 | 3300009176 | Bacteria | 1163 |
| 203 | Ga0105242_10649936 | 3300009176 | Bacteria | 1025 |
| 204 | Ga0105242_10849883 | 3300009176 | Bacteria | 908 |
| 205 | Ga0105248_10089282 | 3300009177 | Bacteria | 3469 |
| 206 | Ga0105248_10384390 | 3300009177 | Bacteria | 1580 |
| 207 | Ga0105248_10677427 | 3300009177 | Bacteria | 1163 |
| 208 | Ga0105248_10998438 | 3300009177 | Bacteria | 945 |
| 209 | Ga0105237_10050492 | 3300009545 | Bacteria | 4179 |
| 210 | Ga0105237_10285970 | 3300009545 | Bacteria | 1651 |
| 211 | Ga0105237_10604474 | 3300009545 | Bacteria | 1104 |
| 212 | Ga0105237_11107051 | 3300009545 | Bacteria | 799 |
| 213 | Ga0105238_10001235 | 3300009551 | Bacteria | 25716 |
| 214 | Ga0105238_10004895 | 3300009551 | Bacteria | 13252 |
| 215 | Ga0105238_10263712 | 3300009551 | Bacteria | 1703 |
| 216 | Ga0105238_10606697 | 3300009551 | Bacteria | 1103 |
| 217 | Ga0105238_11162681 | 3300009551 | Bacteria | 795 |
| 218 | Ga0105249_10862548 | 3300009553 | Bacteria | 971 |
| 219 | Ga0105249_10918118 | 3300009553 | Bacteria | 943 |
| 220 | Ga0105249_11073679 | 3300009553 | Bacteria | 875 |
| 221 | Ga0099796_10016687 | 3300010159 | Bacteria | 2173 |
| 222 | Ga0099796_10051347 | 3300010159 | Bacteria | 1432 |
| 223 | Ga0105239_10047033 | 3300010375 | Bacteria | 4727 |
| 224 | Ga0105239_10168725 | 3300010375 | Bacteria | 2447 |
| 225 | Ga0105239_10442999 | 3300010375 | Bacteria | 1473 |
| 226 | Ga0105239_10568052 | 3300010375 | Bacteria | 1292 |
| 227 | Ga0105239_10839731 | 3300010375 | Bacteria | 1053 |
| 228 | Ga0105239_11506916 | 3300010375 | Bacteria | 777 |
| 229 | Ga0105246_10339482 | 3300011119 | Bacteria | 1227 |
| 230 | Ga0105246_10381348 | 3300011119 | Bacteria | 1165 |
| 231 | Ga0105246_10388473 | 3300011119 | Bacteria | 1155 |
| 232 | Ga0105246_10696584 | 3300011119 | Bacteria | 890 |
| 233 | Ga0157371_10142321 | 3300013102 | Bacteria | 1708 |
| 234 | Ga0157370_10051849 | 3300013104 | Bacteria | 3918 |
| 235 | Ga0157369_10002556 | 3300013105 | Bacteria | 21777 |
| 236 | Ga0157369_10223644 | 3300013105 | Bacteria | 1969 |
| 237 | Ga0157374_10154653 | 3300013296 | Bacteria | 2231 |
| 238 | Ga0157378_10020601 | 3300013297 | Bacteria | 5799 |
| 239 | Ga0157378_10318981 | 3300013297 | Bacteria | 1509 |
| 240 | Ga0163162_10411441 | 3300013306 | Bacteria | 1485 |
| 241 | Ga0163162_10550641 | 3300013306 | Bacteria | 1282 |
| 242 | Ga0163162_10621464 | 3300013306 | Bacteria | 1205 |
| 243 | Ga0163162_10670838 | 3300013306 | Bacteria | 1160 |
| 244 | Ga0163162_10763602 | 3300013306 | Bacteria | 1086 |
| 245 | Ga0163162_11712813 | 3300013306 | Bacteria | 718 |
| 246 | Ga0157372_11653391 | 3300013307 | Bacteria | 737 |
| 247 | Ga0163163_10081541 | 3300014325 | Bacteria | 3237 |
| 248 | Ga0163163_10478401 | 3300014325 | Bacteria | 1306 |
| 249 | Ga0163163_10887889 | 3300014325 | Bacteria | 955 |
| 250 | Ga0163163_10914754 | 3300014325 | Bacteria | 941 |
| 251 | Ga0163163_11372648 | 3300014325 | Bacteria | 768 |
| 252 | Ga0157380_10797546 | 3300014326 | Bacteria | 961 |
| 253 | Ga0157377_10117811 | 3300014745 | Bacteria | 1605 |
| 254 | Ga0157379_10378242 | 3300014968 | Bacteria | 1299 |
| 255 | Ga0157379_10481907 | 3300014968 | Bacteria | 1148 |
| 256 | Ga0157376_10137875 | 3300014969 | Bacteria | 2185 |
| 257 | Ga0157376_10240032 | 3300014969 | Bacteria | 1688 |
| 258 | Ga0157376_10320265 | 3300014969 | Bacteria | 1474 |
| 259 | Ga0157376_10562992 | 3300014969 | Bacteria | 1129 |
| 260 | Ga0157376_10833860 | 3300014969 | Bacteria | 936 |
| 261 | Ga0213871_10014132 | 3300021441 | Bacteria | 1888 |
| 262 | Ga0209233_1018543 | 3300025261 | Bacteria | 1869 |
| 263 | Ga0209758_1001013 | 3300025297 | Bacteria | 37209 |
| 264 | Ga0207697_10068684 | 3300025315 | Bacteria | 1483 |
| 265 | Ga0207697_10230004 | 3300025315 | Bacteria | 819 |
| 266 | Ga0207656_10022809 | 3300025321 | Bacteria | 2515 |
| 267 | Ga0207656_10031168 | 3300025321 | Bacteria | 2207 |
| 268 | Ga0207656_10223490 | 3300025321 | Bacteria | 916 |
| 269 | Ga0207696_1040275 | 3300025711 | Bacteria | 1369 |
| 270 | Ga0207692_10006838 | 3300025898 | Bacteria | 4643 |
| 271 | Ga0207642_10081164 | 3300025899 | Bacteria | 1575 |
| 272 | Ga0207642_10366082 | 3300025899 | Bacteria | 854 |
| 273 | Ga0207710_10169861 | 3300025900 | Bacteria | 1066 |
| 274 | Ga0207688_10439939 | 3300025901 | Bacteria | 812 |
| 275 | Ga0207647_10027240 | 3300025904 | Bacteria | 3728 |
| 276 | Ga0207699_10042859 | 3300025906 | Bacteria | 2625 |
| 277 | Ga0207645_10280161 | 3300025907 | Bacteria | 1107 |
| 278 | Ga0207645_10329900 | 3300025907 | Bacteria | 1019 |
| 279 | Ga0207645_10352424 | 3300025907 | Bacteria | 985 |
| 280 | Ga0207643_10070154 | 3300025908 | Bacteria | 2015 |
| 281 | Ga0207643_10231242 | 3300025908 | Bacteria | 1134 |
| 282 | Ga0207705_10071743 | 3300025909 | Bacteria | 2511 |
| 283 | Ga0207705_10363006 | 3300025909 | Bacteria | 1117 |
| 284 | Ga0207705_10843515 | 3300025909 | Bacteria | 711 |
| 285 | Ga0207684_10159090 | 3300025910 | Bacteria | 1944 |
| 286 | Ga0207654_10001655 | 3300025911 | Bacteria | 11645 |
| 287 | Ga0207654_10013803 | 3300025911 | Bacteria | 4162 |
| 288 | Ga0207654_10385056 | 3300025911 | Bacteria | 972 |
| 289 | Ga0207654_10490580 | 3300025911 | Bacteria | 866 |
| 290 | Ga0207707_10017344 | 3300025912 | Bacteria | 6277 |
| 291 | Ga0207695_10000387 | 3300025913 | Bacteria | 99734 |
| 292 | Ga0207695_10155099 | 3300025913 | Bacteria | 2225 |
| 293 | Ga0207671_10018972 | 3300025914 | Bacteria | 5269 |
| 294 | Ga0207671_10021648 | 3300025914 | Bacteria | 4874 |
| 295 | Ga0207671_10624364 | 3300025914 | Bacteria | 858 |
| 296 | Ga0207693_10003895 | 3300025915 | Bacteria | 12708 |
| 297 | Ga0207693_10004610 | 3300025915 | Bacteria | 11630 |
| 298 | Ga0207663_10442873 | 3300025916 | Bacteria | 1001 |
| 299 | Ga0207663_10650283 | 3300025916 | Bacteria | 832 |
| 300 | Ga0207660_10005223 | 3300025917 | Bacteria | 8436 |
| 301 | Ga0207660_10024440 | 3300025917 | Bacteria | 4091 |
| 302 | Ga0207660_10064187 | 3300025917 | Bacteria | 2650 |
| 303 | Ga0207662_10407233 | 3300025918 | Bacteria | 923 |
| 304 | Ga0207657_10331115 | 3300025919 | Bacteria | 1203 |
| 305 | Ga0207657_10518115 | 3300025919 | Bacteria | 933 |
| 306 | Ga0207657_10550412 | 3300025919 | Bacteria | 902 |
| 307 | Ga0207649_10448634 | 3300025920 | Bacteria | 973 |
| 308 | Ga0207652_10006970 | 3300025921 | Bacteria | 9104 |
| 309 | Ga0207652_10456565 | 3300025921 | Bacteria | 1151 |
| 310 | Ga0207652_10736488 | 3300025921 | Bacteria | 878 |
| 311 | Ga0207646_10425433 | 3300025922 | Bacteria | 1199 |
| 312 | Ga0207681_10715308 | 3300025923 | Bacteria | 833 |
| 313 | Ga0207694_10000121 | 3300025924 | Bacteria | 83123 |
| 314 | Ga0207694_10016807 | 3300025924 | Bacteria | 5528 |
| 315 | Ga0207694_10555966 | 3300025924 | Bacteria | 963 |
| 316 | Ga0207650_10098980 | 3300025925 | Bacteria | 2241 |
| 317 | Ga0207650_10614928 | 3300025925 | Bacteria | 914 |
| 318 | Ga0207650_10798314 | 3300025925 | Bacteria | 800 |
| 319 | Ga0207659_10895741 | 3300025926 | Bacteria | 763 |
| 320 | Ga0207687_10353901 | 3300025927 | Bacteria | 1197 |
| 321 | Ga0207687_10385443 | 3300025927 | Bacteria | 1149 |
| 322 | Ga0207687_10561005 | 3300025927 | Bacteria | 959 |
| 323 | Ga0207700_10037943 | 3300025928 | Bacteria | 3494 |
| 324 | Ga0207690_10138871 | 3300025932 | Bacteria | 1788 |
| 325 | Ga0207690_10305471 | 3300025932 | Bacteria | 1246 |
| 326 | Ga0207690_10367308 | 3300025932 | Bacteria | 1141 |
| 327 | Ga0207706_10272628 | 3300025933 | Bacteria | 1476 |
| 328 | Ga0207706_10392382 | 3300025933 | Bacteria | 1204 |
| 329 | Ga0207686_10262052 | 3300025934 | Bacteria | 1268 |
| 330 | Ga0207709_10727289 | 3300025935 | Bacteria | 796 |
| 331 | Ga0207704_10121863 | 3300025938 | Bacteria | 1787 |
| 332 | Ga0207704_10973754 | 3300025938 | Bacteria | 716 |
| 333 | Ga0207665_10006607 | 3300025939 | Bacteria | 7691 |
| 334 | Ga0207691_10043997 | 3300025940 | Bacteria | 4112 |
| 335 | Ga0207691_10441233 | 3300025940 | Bacteria | 1108 |
| 336 | Ga0207711_10048929 | 3300025941 | Bacteria | 3618 |
| 337 | Ga0207711_10250102 | 3300025941 | Bacteria | 1627 |
| 338 | Ga0207711_10354486 | 3300025941 | Bacteria | 1359 |
| 339 | Ga0207711_10692327 | 3300025941 | Bacteria | 951 |
| 340 | Ga0207689_10098911 | 3300025942 | Bacteria | 2397 |
| 341 | Ga0207661_10011150 | 3300025944 | Bacteria | 6500 |
| 342 | Ga0207661_10528501 | 3300025944 | Bacteria | 1079 |
| 343 | Ga0207679_10196054 | 3300025945 | Bacteria | 1683 |
| 344 | Ga0207679_10269997 | 3300025945 | Bacteria | 1454 |
| 345 | Ga0207667_10016621 | 3300025949 | Bacteria | 8307 |
| 346 | Ga0207667_10022419 | 3300025949 | Bacteria | 6977 |
| 347 | Ga0207667_10152080 | 3300025949 | Bacteria | 2381 |
| 348 | Ga0207667_10582154 | 3300025949 | Bacteria | 1130 |
| 349 | Ga0207651_10204727 | 3300025960 | Bacteria | 1584 |
| 350 | Ga0207651_10446210 | 3300025960 | Bacteria | 1109 |
| 351 | Ga0207712_10065403 | 3300025961 | Bacteria | 2595 |
| 352 | Ga0207712_10286617 | 3300025961 | Bacteria | 1346 |
| 353 | Ga0207712_10774398 | 3300025961 | Bacteria | 842 |
| 354 | Ga0207712_10787931 | 3300025961 | Bacteria | 835 |
| 355 | Ga0207668_10236505 | 3300025972 | Bacteria | 1475 |
| 356 | Ga0207640_10015818 | 3300025981 | Bacteria | 4376 |
| 357 | Ga0207640_10753416 | 3300025981 | Bacteria | 840 |
| 358 | Ga0207640_11053587 | 3300025981 | Bacteria | 718 |
| 359 | Ga0207677_10120722 | 3300026023 | Bacteria | 1971 |
| 360 | Ga0207677_10556727 | 3300026023 | Bacteria | 1000 |
| 361 | Ga0207703_10149148 | 3300026035 | Bacteria | 2037 |
| 362 | Ga0207703_10165463 | 3300026035 | Bacteria | 1940 |
| 363 | Ga0207703_10223960 | 3300026035 | Bacteria | 1683 |
| 364 | Ga0207703_10535095 | 3300026035 | Bacteria | 1103 |
| 365 | Ga0207639_10024254 | 3300026041 | Bacteria | 4387 |
| 366 | Ga0207639_10291502 | 3300026041 | Bacteria | 1439 |
| 367 | Ga0207639_10494735 | 3300026041 | Bacteria | 1116 |
| 368 | Ga0207639_10705210 | 3300026041 | Bacteria | 936 |
| 369 | Ga0207678_10037796 | 3300026067 | Bacteria | 4198 |
| 370 | Ga0207678_10207968 | 3300026067 | Bacteria | 1674 |
| 371 | Ga0207678_10412006 | 3300026067 | Bacteria | 1171 |
| 372 | Ga0207678_10476937 | 3300026067 | Bacteria | 1086 |
| 373 | Ga0207678_10590108 | 3300026067 | Bacteria | 973 |
| 374 | Ga0207678_10712880 | 3300026067 | Bacteria | 883 |
| 375 | Ga0207708_10330433 | 3300026075 | Bacteria | 1246 |
| 376 | Ga0207708_10397591 | 3300026075 | Bacteria | 1139 |
| 377 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 378 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 379 | Ga0207702_10286369 | 3300026078 | Bacteria | 1559 |
| 380 | Ga0207702_10555193 | 3300026078 | Bacteria | 1124 |
| 381 | Ga0207702_10580899 | 3300026078 | Bacteria | 1098 |
| 382 | Ga0207648_10243902 | 3300026089 | Bacteria | 1600 |
| 383 | Ga0207676_10554519 | 3300026095 | Bacteria | 1098 |
| 384 | Ga0207674_10005764 | 3300026116 | Bacteria | 14691 |
| 385 | Ga0207674_10199148 | 3300026116 | Bacteria | 1952 |
| 386 | Ga0207674_10441985 | 3300026116 | Bacteria | 1257 |
| 387 | Ga0207674_10840680 | 3300026116 | Bacteria | 885 |
| 388 | Ga0207675_100059792 | 3300026118 | Bacteria | 3557 |
| 389 | Ga0207675_100289091 | 3300026118 | Bacteria | 1594 |
| 390 | Ga0207675_100429708 | 3300026118 | Bacteria | 1306 |
| 391 | Ga0207675_100889986 | 3300026118 | Bacteria | 906 |
| 392 | Ga0207683_10036296 | 3300026121 | Bacteria | 4291 |
| 393 | Ga0207683_10077838 | 3300026121 | Bacteria | 2938 |
| 394 | Ga0207683_10088714 | 3300026121 | Bacteria | 2752 |
| 395 | Ga0207683_10231570 | 3300026121 | Bacteria | 1685 |
| 396 | Ga0207683_10634552 | 3300026121 | Bacteria | 989 |
| 397 | Ga0207698_10089767 | 3300026142 | Bacteria | 2511 |
| 398 | Ga0207698_10296821 | 3300026142 | Bacteria | 1502 |
| 399 | Ga0207698_10528381 | 3300026142 | Bacteria | 1152 |
| 400 | Ga0207698_10921632 | 3300026142 | Bacteria | 882 |
| 401 | Ga0207698_11029131 | 3300026142 | Bacteria | 835 |
| 402 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 403 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 404 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 405 | Ga0209813_10132321 | 3300027866 | Bacteria | 879 |
| 406 | Ga0265357_1012247 | 3300028023 | Bacteria | 882 |
| 407 | Ga0268266_10001906 | 3300028379 | Bacteria | 23472 |
| 408 | Ga0268266_10009681 | 3300028379 | Bacteria | 8469 |
| 409 | Ga0268266_10203362 | 3300028379 | Bacteria | 1813 |
| 410 | Ga0268266_10228389 | 3300028379 | Bacteria | 1713 |
| 411 | Ga0268266_10434822 | 3300028379 | Bacteria | 1245 |
| 412 | Ga0268266_11297274 | 3300028379 | Bacteria | 703 |
| 413 | Ga0268265_10096092 | 3300028380 | Bacteria | 2380 |
| 414 | Ga0268265_10384998 | 3300028380 | Bacteria | 1291 |
| 415 | Ga0268265_10531312 | 3300028380 | Bacteria | 1113 |
| 416 | Ga0268264_10633722 | 3300028381 | Bacteria | 1056 |
| 417 | Ga0265334_10006202 | 3300028573 | Bacteria | 5171 |
| 418 | Ga0307517_10138245 | 3300028786 | Bacteria | 1722 |
| 419 | Ga0307515_10256975 | 3300028794 | Bacteria | 1490 |
| 420 | Ga0265338_10365098 | 3300028800 | Bacteria | 1035 |
| 421 | Ga0265762_1013881 | 3300030760 | Bacteria | 1450 |
| 422 | Ga0265330_10146619 | 3300031235 | Bacteria | 1003 |
| 423 | Ga0265332_10006837 | 3300031238 | Bacteria | 5171 |
| 424 | Ga0265328_10231538 | 3300031239 | Bacteria | 705 |
| 425 | Ga0265325_10032360 | 3300031241 | Bacteria | 2792 |
| 426 | Ga0265340_10012805 | 3300031247 | Bacteria | 4425 |
| 427 | Ga0265339_10054742 | 3300031249 | Bacteria | 2166 |
| 428 | Ga0265331_10058682 | 3300031250 | Bacteria | 1821 |
| 429 | Ga0265316_10235800 | 3300031344 | Bacteria | 1346 |
| 430 | Ga0307508_10084039 | 3300031616 | Bacteria | 2766 |
| 431 | Ga0265314_10077282 | 3300031711 | Bacteria | 2209 |
| 432 | Ga0265342_10105236 | 3300031712 | Bacteria | 1603 |
| 433 | Ga0265342_10111267 | 3300031712 | Bacteria | 1550 |
| 434 | Ga0265342_10113343 | 3300031712 | Bacteria | 1532 |
| 435 | Ga0307516_10029260 | 3300031730 | Bacteria | 5570 |
| 436 | Ga0307516_10105054 | 3300031730 | Bacteria | 2636 |
| 437 | Ga0307516_10132990 | 3300031730 | Bacteria | 2265 |
| 438 | Ga0307405_10543836 | 3300031731 | Bacteria | 939 |
| 439 | Ga0307413_11058891 | 3300031824 | Bacteria | 698 |
| 440 | Ga0307412_10183578 | 3300031911 | Bacteria | 1576 |
| 441 | Ga0307409_100301760 | 3300031995 | Bacteria | 1490 |
| 442 | Ga0307409_102298704 | 3300031995 | Bacteria | 568 |
| 443 | Ga0307416_100991158 | 3300032002 | Bacteria | 943 |
| 444 | Ga0307416_101018883 | 3300032002 | Bacteria | 931 |
| 445 | Ga0307411_10287119 | 3300032005 | Bacteria | 1313 |
| 446 | Ga0307411_10487544 | 3300032005 | Bacteria | 1039 |
| 447 | Ga0307415_100729374 | 3300032126 | Bacteria | 897 |
| 448 | Ga0307510_10024915 | 3300033180 | Bacteria | 6908 |
| 449 | Ga0373934_0006674 | 3300035086 | Bacteria | 4287 |
| 450 | Ga0373934_0030953 | 3300035086 | Bacteria | 2094 |
| 451 | Ga0373944_0015410 | 3300035089 | Bacteria | 2145 |
| 452 | Ga0373952_0076648 | 3300035092 | Bacteria | 846 |
| 453 | Ga0373923_0003012 | 3300035111 | Bacteria | 5323 |
| 454 | Ga0373923_0100092 | 3300035111 | Bacteria | 1277 |
| 455 | Ga0373932_0198358 | 3300035112 | Bacteria | 712 |
| 456 | Ga0373936_0041823 | 3300035113 | Bacteria | 1838 |
| 457 | Ga0373936_0062817 | 3300035113 | Bacteria | 1519 |
| 458 | Ga0373941_0059088 | 3300035115 | Bacteria | 1242 |
| 459 | Ga0373953_0003523 | 3300035117 | Bacteria | 4889 |
| 460 | Ga0373954_0001251 | 3300035118 | Bacteria | 10243 |
| 461 | Ga0373954_0098981 | 3300035118 | Bacteria | 1406 |
| 462 | Ga0373954_0473317 | 3300035118 | Bacteria | 620 |
| 463 | Ga0373956_0002392 | 3300035119 | Bacteria | 7665 |
| 464 | Ga0373957_0003300 | 3300035120 | Bacteria | 4753 |
| 465 | Ga0373957_0181370 | 3300035120 | Bacteria | 873 |
| 466 | Ga0373943_0018879 | 3300035170 | Bacteria | 3170 |
| 467 | Ga0373943_0057672 | 3300035170 | Bacteria | 1930 |
| 468 | Ga0373946_0032123 | 3300035171 | Bacteria | 2107 |
| 469 | Ga0373955_0007575 | 3300035172 | Bacteria | 4997 |
| 470 | Ga0373942_0127281 | 3300035207 | Bacteria | 801 |
| 471 | Ga0373961_0111746 | 3300035241 | Bacteria | 896 |
| 472 | Ga0373962_0085828 | 3300035242 | Bacteria | 962 |
| 473 | Ga0373924_0037044 | 3300035410 | Bacteria | 1984 |
| 474 | Ga0373931_0015889 | 3300035691 | Bacteria | 3697 |
| 475 | Ga0373931_0057737 | 3300035691 | Bacteria | 2082 |
| 476 | Ga0373935_0011386 | 3300035692 | Bacteria | 5340 |
| 477 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 478 | Ga0373927_0006850 | 3300035695 | Bacteria | 7747 |
| 479 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 480 | Ga0373933_0006129 | 3300035724 | Bacteria | 6547 |
| 481 | Ga0373933_0658781 | 3300035724 | Bacteria | 688 |
| 482 | Ga0373933_0802080 | 3300035724 | Bacteria | 620 |
| 483 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 484 | Ga0373947_0020656 | 3300035725 | Bacteria | 3804 |
| 485 | Ga0373947_0282245 | 3300035725 | Bacteria | 1104 |
| 486 | Ga0373937_0013830 | 3300036401 | Bacteria | 7111 |
| 487 | Ga0373937_0101471 | 3300036401 | Bacteria | 2671 |
| 488 | Ga0373937_0255663 | 3300036401 | Bacteria | 1651 |
| 489 | Ga0373937_0508729 | 3300036401 | Bacteria | 1144 |
| 490 | Ga0373925_0002455 | 3300037068 | Bacteria | 14850 |
| 491 | Ga0436365_0585753 | 3300039437 | Bacteria | 654 |
| 492 | Ga0436360_1122847 | 3300039438 | Bacteria | 640 |
| 493 | Ga0436361_0042502 | 3300039447 | Bacteria | 4823 |
| 494 | Ga0436363_0081426 | 3300039450 | Bacteria | 775 |
| 495 | Ga0436363_0802555 | 3300039450 | Bacteria | 2593 |
| 496 | Ga0436362_0261438 | 3300039453 | Bacteria | 614 |
| 497 | Ga0439458_0071754 | 3300042157 | Bacteria | 875 |
| 498 | Ga0439459_0013441 | 3300042438 | Bacteria | 1474 |
| 499 | Ga0466969_0282419 | 3300044656 | Bacteria | 752 |
| 500 | Ga0466966_0152331 | 3300044684 | Bacteria | 1410 |
| 501 | Ga0466963_0203223 | 3300044694 | Bacteria | 1386 |
| 502 | Ga0466971_0191701 | 3300044719 | Bacteria | 963 |
| 503 | Ga0466970_0382122 | 3300044765 | Bacteria | 802 |
| 504 | Ga0466959_0203327 | 3300045049 | Bacteria | 1378 |
| 505 | Ga0466967_0309991 | 3300045976 | Bacteria | 1520 |
| 506 | Ga0466967_0504505 | 3300045976 | Bacteria | 1188 |
| 507 | Ga0466967_0852621 | 3300045976 | Bacteria | 905 |
| 508 | Ga0495617_083339 | 3300046452 | Bacteria | 1047 |
| 509 | Ga0495592_0004510 | 3300046454 | Bacteria | 10194 |
| 510 | Ga0495592_0064253 | 3300046454 | Bacteria | 2690 |
| 511 | Ga0495603_0000801 | 3300046455 | Bacteria | 18013 |
| 512 | Ga0495603_0043798 | 3300046455 | Bacteria | 2671 |
| 513 | Ga0495603_0087655 | 3300046455 | Bacteria | 1821 |
| 514 | Ga0495629_0003266 | 3300046459 | Bacteria | 12271 |
| 515 | Ga0495629_0007739 | 3300046459 | Bacteria | 7906 |
| 516 | Ga0495629_0202273 | 3300046459 | Bacteria | 1373 |
| 517 | Ga0495641_0002198 | 3300046461 | Bacteria | 15577 |
| 518 | Ga0495651_0009476 | 3300046462 | Bacteria | 7477 |
| 519 | Ga0495651_0097928 | 3300046462 | Bacteria | 2189 |
| 520 | Ga0495653_0008190 | 3300046463 | Bacteria | 8561 |
| 521 | Ga0495580_0583448 | 3300046472 | Bacteria | 740 |
| 522 | Ga0495582_0000855 | 3300046473 | Bacteria | 16906 |
| 523 | Ga0495582_0364597 | 3300046473 | Bacteria | 832 |
| 524 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 525 | Ga0495662_0000572 | 3300046476 | Bacteria | 16948 |
| 526 | Ga0495664_0011398 | 3300046477 | Bacteria | 5012 |
| 527 | Ga0495664_0070216 | 3300046477 | Bacteria | 2091 |
| 528 | Ga0495664_0284032 | 3300046477 | Bacteria | 1000 |
| 529 | Ga0495585_0066657 | 3300046492 | Bacteria | 1971 |
| 530 | Ga0495585_0129040 | 3300046492 | Bacteria | 1332 |
| 531 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 532 | Ga0495594_0130994 | 3300046499 | Bacteria | 1421 |
| 533 | Ga0495594_0635827 | 3300046499 | Bacteria | 604 |
| 534 | Ga0495606_0005524 | 3300046507 | Bacteria | 12067 |
| 535 | Ga0495606_0182001 | 3300046507 | Bacteria | 1211 |
| 536 | Ga0495608_0004196 | 3300046511 | Bacteria | 10325 |
| 537 | Ga0495618_0162499 | 3300046514 | Bacteria | 1423 |
| 538 | Ga0495628_0011819 | 3300046516 | Bacteria | 7367 |
| 539 | Ga0495630_0011525 | 3300046517 | Bacteria | 6402 |
| 540 | Ga0495637_0079586 | 3300046520 | Bacteria | 1309 |
| 541 | Ga0495644_0057427 | 3300046523 | Bacteria | 1463 |
| 542 | Ga0495666_0003632 | 3300046526 | Bacteria | 7798 |
| 543 | Ga0495666_0098996 | 3300046526 | Bacteria | 1374 |
| 544 | Ga0495652_0234622 | 3300046529 | Bacteria | 1369 |
| 545 | Ga0495652_0252270 | 3300046529 | Bacteria | 1307 |
| 546 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 547 | Ga0495640_0036663 | 3300046533 | Bacteria | 3463 |
| 548 | Ga0495640_0094813 | 3300046533 | Bacteria | 1965 |
| 549 | Ga0495586_0041802 | 3300046535 | Bacteria | 2469 |
| 550 | Ga0495587_0009812 | 3300046536 | Bacteria | 6118 |
| 551 | Ga0495609_0252334 | 3300046538 | Bacteria | 726 |
| 552 | Ga0495645_0018687 | 3300046543 | Bacteria | 4982 |
| 553 | Ga0495622_0001328 | 3300046557 | Bacteria | 12660 |
| 554 | Ga0495667_0003525 | 3300046559 | Bacteria | 10504 |
| 555 | Ga0495667_0028206 | 3300046559 | Bacteria | 3779 |
| 556 | Ga0495656_0028598 | 3300046615 | Bacteria | 2237 |
| 557 | Ga0495656_0070558 | 3300046615 | Bacteria | 1550 |
| 558 | Ga0495668_0274126 | 3300046616 | Bacteria | 924 |
| 559 | Ga0495668_0329825 | 3300046616 | Bacteria | 837 |
| 560 | Ga0495634_0003037 | 3300046642 | Bacteria | 13668 |
| 561 | Ga0495634_0022125 | 3300046642 | Bacteria | 4482 |
| 562 | Ga0495634_0278345 | 3300046642 | Bacteria | 1017 |
| 563 | Ga0495625_0550984 | 3300046660 | Bacteria | 698 |
| 564 | Ga0495635_0002038 | 3300046663 | Bacteria | 13679 |
| 565 | Ga0495635_0007778 | 3300046663 | Bacteria | 7484 |
| 566 | Ga0495588_0010612 | 3300046674 | Bacteria | 4291 |
| 567 | Ga0495657_0004913 | 3300046675 | Bacteria | 10635 |
| 568 | Ga0495657_0350970 | 3300046675 | Bacteria | 873 |
| 569 | Ga0495657_0661098 | 3300046675 | Bacteria | 602 |
| 570 | Ga0495599_0010423 | 3300046678 | Bacteria | 5685 |
| 571 | Ga0495623_0011237 | 3300046679 | Bacteria | 5792 |
| 572 | Ga0495646_0007134 | 3300046680 | Bacteria | 7098 |
| 573 | Ga0495646_0049702 | 3300046680 | Bacteria | 2544 |
| 574 | Ga0495647_0002474 | 3300046681 | Bacteria | 5839 |
| 575 | Ga0495658_0004429 | 3300046683 | Bacteria | 6911 |
| 576 | Ga0495658_0449462 | 3300046683 | Bacteria | 823 |
| 577 | Ga0495669_0026349 | 3300046684 | Bacteria | 2540 |
| 578 | Ga0495669_0097292 | 3300046684 | Bacteria | 1364 |
| 579 | Ga0495669_0117820 | 3300046684 | Bacteria | 1243 |
| 580 | Ga0495613_0003702 | 3300046689 | Bacteria | 11465 |
| 581 | Ga0495613_0868969 | 3300046689 | Bacteria | 585 |
| 582 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 583 | Ga0495670_0017082 | 3300046691 | Bacteria | 3568 |
| 584 | Ga0495670_0530277 | 3300046691 | Bacteria | 640 |
| 585 | Ga0495671_0141140 | 3300046692 | Bacteria | 1174 |
| 586 | Ga0495600_0004657 | 3300046809 | Bacteria | 8217 |
| 587 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 588 | Ga0495581_0076482 | 3300047315 | Bacteria | 1937 |
| 589 | Ga0495581_0076953 | 3300047315 | Bacteria | 1930 |
| 590 | Ga0495581_0133456 | 3300047315 | Bacteria | 1447 |
| 591 | Ga0495581_0638923 | 3300047315 | Bacteria | 615 |
| 592 | Ga0495604_0002900 | 3300047317 | Bacteria | 13743 |
| 593 | Ga0495604_0263011 | 3300047317 | Bacteria | 1172 |
| 594 | Ga0495674_0001230 | 3300047319 | Bacteria | 24837 |
| 595 | Ga0495672_0047254 | 3300047320 | Bacteria | 2561 |
| 596 | Ga0495672_0051828 | 3300047320 | Bacteria | 2414 |
| 597 | Ga0495676_0017129 | 3300047321 | Bacteria | 6412 |
| 598 | Ga0495680_0027947 | 3300047322 | Bacteria | 4628 |
| 599 | Ga0495675_0019998 | 3300047444 | Bacteria | 4254 |
| 600 | Ga0495685_048884 | 3300047447 | Bacteria | 1438 |
| 601 | Ga0495673_0033929 | 3300047469 | Bacteria | 2363 |
| 602 | Ga0495673_0102910 | 3300047469 | Bacteria | 1152 |
| 603 | Ga0495684_0005221 | 3300047471 | Bacteria | 10124 |
| 604 | Ga0495684_0043185 | 3300047471 | Bacteria | 3451 |
| 605 | Ga0495686_0074493 | 3300047472 | Bacteria | 2083 |
| 606 | Ga0495593_0000470 | 3300047673 | Bacteria | 22684 |
| 607 | Ga0495593_0002684 | 3300047673 | Bacteria | 10702 |
| 608 | Ga0495602_0024305 | 3300048088 | Bacteria | 5879 |
| 609 | Ga0495614_0022266 | 3300048089 | Bacteria | 2735 |
| 610 | Ga0495615_0147762 | 3300048090 | Bacteria | 698 |
| 611 | Ga0496100_0011102 | 3300048903 | Bacteria | 5115 |
| 612 | Ga0496100_0045464 | 3300048903 | Bacteria | 2818 |
| 613 | Ga0496100_0835453 | 3300048903 | Bacteria | 722 |
| 614 | Ga0496101_0007163 | 3300048904 | Bacteria | 7211 |
| 615 | Ga0496101_0213659 | 3300048904 | Bacteria | 1495 |
| 616 | Ga0496101_0268680 | 3300048904 | Bacteria | 1331 |
| 617 | Ga0496101_0364407 | 3300048904 | Bacteria | 1136 |
| 618 | Ga0496102_0222278 | 3300048905 | Bacteria | 1780 |
| 619 | Ga0496102_0260354 | 3300048905 | Bacteria | 1635 |
| 620 | Ga0496102_0372279 | 3300048905 | Bacteria | 1344 |
| 621 | Ga0496102_0552397 | 3300048905 | Bacteria | 1074 |
| 622 | Ga0496103_0448749 | 3300048906 | Bacteria | 827 |
| 623 | Ga0496103_0459363 | 3300048906 | Bacteria | 816 |
| 624 | Ga0496104_0022374 | 3300048907 | Bacteria | 5806 |
| 625 | Ga0496104_0115657 | 3300048907 | Bacteria | 2573 |
| 626 | Ga0496104_0828287 | 3300048907 | Bacteria | 831 |
| 627 | Ga0496105_0027959 | 3300048908 | Bacteria | 4611 |
| 628 | Ga0496105_0125981 | 3300048908 | Bacteria | 2111 |
| 629 | Ga0496105_0379627 | 3300048908 | Bacteria | 1125 |
| 630 | Ga0496106_0119067 | 3300048909 | Bacteria | 2062 |
| 631 | Ga0496106_0131471 | 3300048909 | Bacteria | 1963 |
| 632 | Ga0496106_0239605 | 3300048909 | Bacteria | 1449 |
| 633 | Ga0496106_0322287 | 3300048909 | Bacteria | 1240 |
| 634 | Ga0496106_0528178 | 3300048909 | Bacteria | 947 |
| 635 | Ga0496107_0007455 | 3300048910 | Bacteria | 7542 |
| 636 | Ga0496107_0019166 | 3300048910 | Bacteria | 4826 |
| 637 | Ga0496107_0046717 | 3300048910 | Bacteria | 3116 |
| 638 | Ga0496107_0677466 | 3300048910 | Bacteria | 759 |
| 639 | Ga0496108_0000927 | 3300048911 | Bacteria | 22857 |
| 640 | Ga0496108_0075422 | 3300048911 | Bacteria | 2849 |
| 641 | Ga0496108_0265614 | 3300048911 | Bacteria | 1493 |
| 642 | Ga0496108_0456112 | 3300048911 | Bacteria | 1117 |
| 643 | Ga0496109_0053221 | 3300048912 | Bacteria | 3691 |
| 644 | Ga0496109_0068302 | 3300048912 | Bacteria | 3258 |
| 645 | Ga0496109_0095265 | 3300048912 | Bacteria | 2756 |
| 646 | Ga0496109_0108132 | 3300048912 | Bacteria | 2584 |
| 647 | Ga0496109_0528669 | 3300048912 | Bacteria | 1113 |
| 648 | Ga0496110_0017143 | 3300048913 | Bacteria | 6055 |
| 649 | Ga0496110_0018413 | 3300048913 | Bacteria | 5857 |
| 650 | Ga0496110_0134209 | 3300048913 | Bacteria | 2236 |
| 651 | Ga0496110_0248654 | 3300048913 | Bacteria | 1618 |
| 652 | Ga0496110_0444848 | 3300048913 | Bacteria | 1181 |
| 653 | Ga0496111_0023210 | 3300048914 | Bacteria | 4354 |
| 654 | Ga0496111_0122082 | 3300048914 | Bacteria | 1924 |
| 655 | Ga0496111_0166487 | 3300048914 | Bacteria | 1637 |
| 656 | Ga0496111_0208434 | 3300048914 | Bacteria | 1452 |
| 657 | Ga0496112_0004583 | 3300048915 | Bacteria | 11751 |
| 658 | Ga0496112_0039976 | 3300048915 | Bacteria | 4584 |
| 659 | Ga0496112_0146271 | 3300048915 | Bacteria | 2332 |
| 660 | Ga0496112_0298540 | 3300048915 | Bacteria | 1556 |
| 661 | Ga0496112_0960033 | 3300048915 | Bacteria | 775 |
| 662 | Ga0496113_0007783 | 3300048916 | Bacteria | 6923 |
| 663 | Ga0496113_0215444 | 3300048916 | Bacteria | 1529 |
| 664 | Ga0496113_0244403 | 3300048916 | Bacteria | 1432 |
| 665 | Ga0496113_0673005 | 3300048916 | Bacteria | 827 |
| 666 | Ga0496113_0893946 | 3300048916 | Bacteria | 703 |
| 667 | Ga0496114_0096307 | 3300048917 | Bacteria | 2519 |
| 668 | Ga0496114_0107180 | 3300048917 | Bacteria | 2391 |
| 669 | Ga0496114_0382569 | 3300048917 | Bacteria | 1246 |
| 670 | Ga0496115_0003360 | 3300048918 | Bacteria | 11473 |
| 671 | Ga0496115_0044258 | 3300048918 | Bacteria | 3550 |
| 672 | Ga0496115_0221729 | 3300048918 | Bacteria | 1560 |
| 673 | Ga0496115_0316381 | 3300048918 | Bacteria | 1277 |
| 674 | Ga0496115_0671389 | 3300048918 | Bacteria | 817 |
| 675 | Ga0496119_0073501 | 3300048922 | Bacteria | 1994 |
| 676 | Ga0496119_0079090 | 3300048922 | Bacteria | 1900 |
| 677 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 678 | Ga0496121_0054019 | 3300048924 | Bacteria | 3360 |
| 679 | Ga0496121_0153536 | 3300048924 | Bacteria | 1691 |
| 680 | Ga0496121_0242695 | 3300048924 | Bacteria | 1254 |
| 681 | Ga0496121_0312171 | 3300048924 | Bacteria | 1062 |
| 682 | Ga0496121_0571402 | 3300048924 | Bacteria | 703 |
| 683 | Ga0496124_0161433 | 3300048927 | Bacteria | 1746 |
| 684 | Ga0496125_0000869 | 3300048928 | Bacteria | 48286 |
| 685 | Ga0496125_0489269 | 3300048928 | Bacteria | 695 |
| 686 | Ga0496126_0006001 | 3300048929 | Bacteria | 13646 |
| 687 | Ga0496126_0013876 | 3300048929 | Bacteria | 8172 |
| 688 | Ga0496126_0026105 | 3300048929 | Bacteria | 5607 |
| 689 | Ga0496126_0036323 | 3300048929 | Bacteria | 4607 |
| 690 | Ga0496126_0064657 | 3300048929 | Bacteria | 3276 |
| 691 | Ga0496126_0150631 | 3300048929 | Bacteria | 1994 |
| 692 | Ga0496126_0176929 | 3300048929 | Bacteria | 1814 |
| 693 | Ga0496126_0178961 | 3300048929 | Bacteria | 1802 |
| 694 | Ga0496126_0413044 | 3300048929 | Bacteria | 1092 |
| 695 | Ga0496126_0459614 | 3300048929 | Bacteria | 1023 |
| 696 | Ga0496126_0527297 | 3300048929 | Bacteria | 940 |
| 697 | Ga0496126_0654778 | 3300048929 | Bacteria | 821 |
| 698 | Ga0496126_0731711 | 3300048929 | Bacteria | 766 |
| 699 | Ga0496126_1068211 | 3300048929 | Bacteria | 601 |
| 700 | Ga0495682_0226558 | 3300049460 | Bacteria | 662 |
| 701 | Ga0501031_0242922 | 3300049568 | Bacteria | 1170 |
| 702 | Ga0501032_0066349 | 3300049569 | Bacteria | 2411 |
| 703 | Ga0501032_0067608 | 3300049569 | Bacteria | 2386 |
| 704 | Ga0501032_0228323 | 3300049569 | Bacteria | 1210 |
| 705 | Ga0501033_0047330 | 3300049570 | Bacteria | 3197 |
| 706 | Ga0501034_0098555 | 3300049571 | Bacteria | 2918 |
| 707 | Ga0501034_0190783 | 3300049571 | Bacteria | 2011 |
| 708 | Ga0501034_0281447 | 3300049571 | Bacteria | 1602 |
| 709 | Ga0501034_0862002 | 3300049571 | Bacteria | 795 |
| 710 | Ga0501034_1029229 | 3300049571 | Bacteria | 706 |
| 711 | Ga0501034_1290183 | 3300049571 | Bacteria | 607 |
| 712 | Ga0501036_0028417 | 3300049572 | Bacteria | 4726 |
| 713 | Ga0501036_0138795 | 3300049572 | Bacteria | 2051 |
| 714 | Ga0501036_0154070 | 3300049572 | Bacteria | 1938 |
| 715 | Ga0501036_0930954 | 3300049572 | Bacteria | 713 |
| 716 | Ga0501037_0101501 | 3300049573 | Bacteria | 2076 |
| 717 | Ga0501038_0001610 | 3300049574 | Bacteria | 20963 |
| 718 | Ga0501038_0102330 | 3300049574 | Bacteria | 2384 |
| 719 | Ga0501038_0202255 | 3300049574 | Bacteria | 1593 |
| 720 | Ga0501039_0071309 | 3300049575 | Bacteria | 2699 |
| 721 | Ga0501039_0086766 | 3300049575 | Bacteria | 2437 |
| 722 | Ga0501039_0228591 | 3300049575 | Bacteria | 1462 |
| 723 | Ga0501039_0440318 | 3300049575 | Bacteria | 1023 |
| 724 | Ga0501040_0355026 | 3300049576 | Bacteria | 1050 |
| 725 | Ga0501042_0096738 | 3300049578 | Bacteria | 2121 |
| 726 | Ga0501043_0030435 | 3300049579 | Bacteria | 4242 |
| 727 | Ga0501043_0046321 | 3300049579 | Bacteria | 3419 |
| 728 | Ga0501043_0256981 | 3300049579 | Bacteria | 1344 |
| 729 | Ga0501043_0287262 | 3300049579 | Bacteria | 1260 |
| 730 | Ga0501046_0072186 | 3300049580 | Bacteria | 2680 |
| 731 | Ga0501047_0031515 | 3300049581 | Bacteria | 5113 |
| 732 | Ga0501047_0098605 | 3300049581 | Bacteria | 2800 |
| 733 | Ga0501047_0472745 | 3300049581 | Bacteria | 1081 |
| 734 | Ga0501047_0621439 | 3300049581 | Bacteria | 901 |
| 735 | Ga0501067_0018457 | 3300049583 | Bacteria | 3864 |
| 736 | Ga0501067_0043030 | 3300049583 | Bacteria | 2508 |
| 737 | Ga0501068_0154274 | 3300049584 | Bacteria | 1445 |
| 738 | Ga0501068_0782468 | 3300049584 | Bacteria | 625 |
| 739 | Ga0501069_0172578 | 3300049585 | Bacteria | 1248 |
| 740 | Ga0501069_0195420 | 3300049585 | Bacteria | 1171 |
| 741 | Ga0501070_0058568 | 3300049586 | Bacteria | 3193 |
| 742 | Ga0501070_0105463 | 3300049586 | Bacteria | 2330 |
| 743 | Ga0501072_0122136 | 3300049588 | Bacteria | 2075 |
| 744 | Ga0501073_0023122 | 3300049589 | Bacteria | 4468 |
| 745 | Ga0501073_0105242 | 3300049589 | Bacteria | 1958 |
| 746 | Ga0501073_0131464 | 3300049589 | Bacteria | 1735 |
| 747 | Ga0501074_0192633 | 3300049590 | Bacteria | 1453 |
| 748 | Ga0501074_0422208 | 3300049590 | Bacteria | 946 |
| 749 | Ga0501076_0195023 | 3300049592 | Bacteria | 1653 |
| 750 | Ga0501079_0034413 | 3300049741 | Bacteria | 3898 |
| 751 | Ga0501079_0202434 | 3300049741 | Bacteria | 1551 |
| 752 | Ga0501080_0083493 | 3300049742 | Bacteria | 2967 |
| 753 | Ga0501080_0843041 | 3300049742 | Bacteria | 802 |
| 754 | Ga0501035_0060571 | 3300049822 | Bacteria | 3369 |
| 755 | Ga0501035_0206710 | 3300049822 | Bacteria | 1681 |
| 756 | Ga0501035_0503731 | 3300049822 | Bacteria | 996 |
| 757 | Ga0501035_0770832 | 3300049822 | Bacteria | 770 |
| 758 | Ga0501044_0012055 | 3300049823 | Bacteria | 9363 |
| 759 | Ga0501044_0101594 | 3300049823 | Bacteria | 2893 |
| 760 | Ga0501044_0505495 | 3300049823 | Bacteria | 1109 |
| 761 | Ga0501044_0725571 | 3300049823 | Bacteria | 877 |
| 762 | Ga0501044_0796512 | 3300049823 | Bacteria | 824 |
| 763 | Ga0501044_0957539 | 3300049823 | Bacteria | 729 |
| 764 | Ga0501044_1065663 | 3300049823 | Bacteria | 678 |
| 765 | Ga0501045_0362568 | 3300049824 | Bacteria | 1078 |
| 766 | Ga0501045_0982581 | 3300049824 | Bacteria | 619 |
| 767 | nmdc:mga03683_61226_c1 | 3300050489 | Bacteria | 885 |
| 768 | nmdc:mga03n38_7962_c1 | 3300050490 | Bacteria | 3776 |
| 769 | nmdc:mga03n38_95480_c1 | 3300050490 | Bacteria | 1424 |
| 770 | nmdc:mga00v17_116481_c1 | 3300050491 | Bacteria | 1699 |
| 771 | nmdc:mga00v17_201058_c1 | 3300050491 | Bacteria | 1288 |
| 772 | nmdc:mga0yw44_63003_c1 | 3300050492 | Bacteria | 2279 |
| 773 | nmdc:mga0k408_233891_c1 | 3300050493 | Bacteria | 1097 |
| 774 | nmdc:mga0k408_269890_c1 | 3300050493 | Bacteria | 1016 |
| 775 | nmdc:mga0k408_85432_c1 | 3300050493 | Bacteria | 1852 |
| 776 | nmdc:mga06z11_15583_c1 | 3300050494 | Bacteria | 3397 |
| 777 | nmdc:mga06z11_85331_c1 | 3300050494 | Bacteria | 1703 |
| 778 | nmdc:mga04h51_116248_c1 | 3300050495 | Bacteria | 992 |
| 779 | nmdc:mga07m45_104203_c1 | 3300050496 | Bacteria | 1631 |
| 780 | nmdc:mga07m45_313946_c1 | 3300050496 | Bacteria | 911 |
| 781 | nmdc:mga05p37_73784_c1 | 3300050507 | Bacteria | 4199 |
| 782 | nmdc:mga0n895_501187_c1 | 3300050512 | Bacteria | 1223 |
| 783 | nmdc:mga0a205_1205897_c1 | 3300050515 | Bacteria | 604 |
| 784 | nmdc:mga0sz30_7031_c1 | 3300050516 | Bacteria | 4207 |
| 785 | Ga0495601_0211795 | 3300053077 | Bacteria | 1266 |
| 786 | Ga0495601_0255016 | 3300053077 | Bacteria | 1145 |
| 787 | Ga0495612_0049565 | 3300053078 | Bacteria | 1723 |
| 788 | Ga0495595_0001339 | 3300053084 | Bacteria | 9565 |
| 789 | Ga0495619_0005596 | 3300053085 | Bacteria | 7971 |
| 790 | Ga0500647_0014493 | 3300053091 | Bacteria | 3585 |
| 791 | Ga0500647_0183660 | 3300053091 | Bacteria | 958 |
| 792 | Ga0500566_0003437 | 3300053094 | Bacteria | 9442 |
| 793 | Ga0500566_0015200 | 3300053094 | Bacteria | 4517 |
| 794 | Ga0500554_006966 | 3300053102 | Bacteria | 2573 |
| 795 | Ga0500554_007220 | 3300053102 | Bacteria | 2542 |
| 796 | Ga0500557_174492 | 3300053105 | Bacteria | 700 |
| 797 | Ga0500572_001342 | 3300053111 | Bacteria | 6819 |
| 798 | Ga0500572_086015 | 3300053111 | Bacteria | 990 |
| 799 | Ga0500595_001016 | 3300053119 | Bacteria | 15748 |
| 800 | Ga0500595_006629 | 3300053119 | Bacteria | 4886 |
| 801 | Ga0500595_117096 | 3300053119 | Bacteria | 754 |
| 802 | Ga0500608_131552 | 3300053122 | Bacteria | 1121 |
| 803 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 804 | Ga0500652_000294 | 3300053131 | Bacteria | 18164 |
| 805 | Ga0500559_0000649 | 3300053136 | Bacteria | 23438 |
| 806 | Ga0500568_0016453 | 3300053139 | Bacteria | 3288 |
| 807 | Ga0500589_143328 | 3300053147 | Bacteria | 981 |
| 808 | Ga0500590_025848 | 3300053148 | Bacteria | 3049 |
| 809 | Ga0500603_000630 | 3300053150 | Bacteria | 8688 |
| 810 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 811 | Ga0500630_091455 | 3300053159 | Bacteria | 1404 |
| 812 | Ga0500638_000160 | 3300053162 | Bacteria | 13163 |
| 813 | Ga0500639_008667 | 3300053163 | Bacteria | 5304 |
| 814 | Ga0500639_026342 | 3300053163 | Bacteria | 3072 |
| 815 | Ga0500636_0256440 | 3300053177 | Bacteria | 888 |
| 816 | Ga0500637_0000180 | 3300053178 | Bacteria | 23612 |
| 817 | Ga0500596_001070 | 3300053735 | Bacteria | 5519 |
| 818 | Ga0500596_001745 | 3300053735 | Bacteria | 4395 |
| 819 | Ga0501084_0086802 | 3300054114 | Bacteria | 2627 |
| 820 | Ga0500661_010018 | 3300055283 | Bacteria | 1727 |
| 821 | Ga0501082_0146982 | 3300060353 | Bacteria | 2046 |
| 822 | Ga0530510_0494819 | 3300061734 | Bacteria | 927 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_10580899 | Ga0207702_105808992 | 172 |
| 2 | iso_pu_bacteria | 2513237141 | 2513888589 | 172 |
| 3 | iso_pu_bacteria | 8006964411 | 8006967627 | 172 |
| 4 | iso_pu_bacteria | 8006984368 | 8006991097 | 172 |
| 5 | 3300005844 | Ga0068862_101403950 | Ga0068862_1014039501 | 174 |
| 6 | 3300028023 | Ga0265357_1012247 | Ga0265357_10122472 | 174 |
| 7 | 3300030760 | Ga0265762_1013881 | Ga0265762_10138812 | 174 |
| 8 | 3300046689 | Ga0495613_0868969 | Ga0495613_0868969_36_560 | 174 |
| 9 | 3300047315 | Ga0495581_0133456 | Ga0495581_0133456_58_582 | 174 |
| 10 | 3300048928 | Ga0496125_0000869 | Ga0496125_0000869_27029_27553 | 174 |
| 11 | 3300048929 | Ga0496126_0036323 | Ga0496126_0036323_2164_2688 | 174 |
| 12 | 3300049585 | Ga0501069_0172578 | Ga0501069_0172578_357_881 | 174 |
| 13 | 3300053105 | Ga0500557_174492 | Ga0500557_174492_107_631 | 174 |
| 14 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_259308_259832 | 174 |
| 15 | 3300053131 | Ga0500652_000294 | Ga0500652_000294_9449_9973 | 174 |
| 16 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_221844_222368 | 174 |
| 17 | 3300005335 | Ga0070666_10383185 | Ga0070666_103831852 | 175 |
| 18 | 3300005344 | Ga0070661_100050714 | Ga0070661_1000507144 | 175 |
| 19 | 3300005354 | Ga0070675_100522164 | Ga0070675_1005221642 | 175 |
| 20 | 3300005364 | Ga0070673_100212996 | Ga0070673_1002129962 | 175 |
| 21 | 3300005367 | Ga0070667_100300816 | Ga0070667_1003008161 | 175 |
| 22 | 3300005535 | Ga0070684_101184504 | Ga0070684_1011845041 | 175 |
| 23 | 3300005539 | Ga0068853_100116332 | Ga0068853_1001163323 | 175 |
| 24 | 3300005543 | Ga0070672_100231798 | Ga0070672_1002317983 | 175 |
| 25 | 3300005548 | Ga0070665_100458723 | Ga0070665_1004587232 | 175 |
| 26 | 3300005618 | Ga0068864_100268989 | Ga0068864_1002689892 | 175 |
| 27 | 3300005719 | Ga0068861_100457085 | Ga0068861_1004570852 | 175 |
| 28 | 3300005842 | Ga0068858_100368348 | Ga0068858_1003683482 | 175 |
| 29 | 3300005844 | Ga0068862_100529498 | Ga0068862_1005294982 | 175 |
| 30 | 3300006173 | Ga0070716_100208126 | Ga0070716_1002081262 | 175 |
| 31 | 3300014325 | Ga0163163_10887889 | Ga0163163_108878892 | 175 |
| 32 | 3300025919 | Ga0207657_10518115 | Ga0207657_105181152 | 175 |
| 33 | 3300025920 | Ga0207649_10448634 | Ga0207649_104486341 | 175 |
| 34 | 3300025941 | Ga0207711_10692327 | Ga0207711_106923272 | 175 |
| 35 | 3300026035 | Ga0207703_10535095 | Ga0207703_105350952 | 175 |
| 36 | 3300026142 | Ga0207698_10921632 | Ga0207698_109216322 | 175 |
| 37 | 3300028379 | Ga0268266_10009681 | Ga0268266_100096814 | 175 |
| 38 | 3300028380 | Ga0268265_10531312 | Ga0268265_105313122 | 175 |
| 39 | 3300039437 | Ga0436365_0585753 | Ga0436365_0585753_63_590 | 175 |
| 40 | 3300047320 | Ga0495672_0051828 | Ga0495672_0051828_887_1414 | 175 |
| 41 | 3300048912 | Ga0496109_0068302 | Ga0496109_0068302_1848_2378 | 175 |
| 42 | 3300048929 | Ga0496126_0459614 | Ga0496126_0459614_217_765 | 175 |
| 43 | 3300050512 | nmdc:mga0n895_501187_c1 | nmdc:mga0n895_501187_c1_187_717 | 175 |
| 44 | 3300053111 | Ga0500572_001342 | Ga0500572_001342_5189_5716 | 175 |
| 45 | 3300053122 | Ga0500608_131552 | Ga0500608_131552_488_1015 | 175 |
| 46 | 3300053136 | Ga0500559_0000649 | Ga0500559_0000649_10409_10936 | 175 |
| 47 | 3300053163 | Ga0500639_008667 | Ga0500639_008667_2348_2875 | 175 |
| 48 | 3300053177 | Ga0500636_0256440 | Ga0500636_0256440_349_876 | 175 |
| 49 | 3300053735 | Ga0500596_001745 | Ga0500596_001745_2813_3340 | 175 |
| 50 | 3300003203 | JGI25406J46586_10001038 | JGI25406J46586_1000103814 | 176 |
| 51 | 3300005327 | Ga0070658_10027535 | Ga0070658_100275352 | 176 |
| 52 | 3300005327 | Ga0070658_10286708 | Ga0070658_102867082 | 176 |
| 53 | 3300005328 | Ga0070676_10324087 | Ga0070676_103240872 | 176 |
| 54 | 3300005329 | Ga0070683_100017946 | Ga0070683_1000179466 | 176 |
| 55 | 3300005329 | Ga0070683_100800069 | Ga0070683_1008000692 | 176 |
| 56 | 3300005330 | Ga0070690_100137371 | Ga0070690_1001373713 | 176 |
| 57 | 3300005331 | Ga0070670_100184713 | Ga0070670_1001847132 | 176 |
| 58 | 3300005334 | Ga0068869_100064257 | Ga0068869_1000642573 | 176 |
| 59 | 3300005334 | Ga0068869_100382589 | Ga0068869_1003825892 | 176 |
| 60 | 3300005336 | Ga0070680_100074496 | Ga0070680_1000744962 | 176 |
| 61 | 3300005336 | Ga0070680_100126836 | Ga0070680_1001268363 | 176 |
| 62 | 3300005336 | Ga0070680_100361541 | Ga0070680_1003615412 | 176 |
| 63 | 3300005337 | Ga0070682_100709271 | Ga0070682_1007092711 | 176 |
| 64 | 3300005338 | Ga0068868_100162651 | Ga0068868_1001626512 | 176 |
| 65 | 3300005338 | Ga0068868_100682213 | Ga0068868_1006822131 | 176 |
| 66 | 3300005339 | Ga0070660_100001927 | Ga0070660_1000019277 | 176 |
| 67 | 3300005340 | Ga0070689_100820970 | Ga0070689_1008209701 | 176 |
| 68 | 3300005341 | Ga0070691_10050950 | Ga0070691_100509501 | 176 |
| 69 | 3300005343 | Ga0070687_100760691 | Ga0070687_1007606911 | 176 |
| 70 | 3300005344 | Ga0070661_100589486 | Ga0070661_1005894861 | 176 |
| 71 | 3300005354 | Ga0070675_100591740 | Ga0070675_1005917402 | 176 |
| 72 | 3300005355 | Ga0070671_100758109 | Ga0070671_1007581091 | 176 |
| 73 | 3300005356 | Ga0070674_100768080 | Ga0070674_1007680801 | 176 |
| 74 | 3300005364 | Ga0070673_100588216 | Ga0070673_1005882161 | 176 |
| 75 | 3300005364 | Ga0070673_100632025 | Ga0070673_1006320252 | 176 |
| 76 | 3300005364 | Ga0070673_100742133 | Ga0070673_1007421332 | 176 |
| 77 | 3300005364 | Ga0070673_101102603 | Ga0070673_1011026031 | 176 |
| 78 | 3300005365 | Ga0070688_100289591 | Ga0070688_1002895912 | 176 |
| 79 | 3300005366 | Ga0070659_100084996 | Ga0070659_1000849963 | 176 |
| 80 | 3300005366 | Ga0070659_100131163 | Ga0070659_1001311633 | 176 |
| 81 | 3300005366 | Ga0070659_100595671 | Ga0070659_1005956711 | 176 |
| 82 | 3300005366 | Ga0070659_100663781 | Ga0070659_1006637812 | 176 |
| 83 | 3300005434 | Ga0070709_10014869 | Ga0070709_100148691 | 176 |
| 84 | 3300005434 | Ga0070709_10536023 | Ga0070709_105360231 | 176 |
| 85 | 3300005435 | Ga0070714_100191652 | Ga0070714_1001916522 | 176 |
| 86 | 3300005438 | Ga0070701_10227418 | Ga0070701_102274182 | 176 |
| 87 | 3300005439 | Ga0070711_100220011 | Ga0070711_1002200112 | 176 |
| 88 | 3300005439 | Ga0070711_100369176 | Ga0070711_1003691761 | 176 |
| 89 | 3300005445 | Ga0070708_100353150 | Ga0070708_1003531502 | 176 |
| 90 | 3300005455 | Ga0070663_100051597 | Ga0070663_1000515973 | 176 |
| 91 | 3300005455 | Ga0070663_100055706 | Ga0070663_1000557064 | 176 |
| 92 | 3300005455 | Ga0070663_100155680 | Ga0070663_1001556802 | 176 |
| 93 | 3300005455 | Ga0070663_100334575 | Ga0070663_1003345752 | 176 |
| 94 | 3300005455 | Ga0070663_100352173 | Ga0070663_1003521731 | 176 |
| 95 | 3300005455 | Ga0070663_100720227 | Ga0070663_1007202271 | 176 |
| 96 | 3300005456 | Ga0070678_100075681 | Ga0070678_1000756813 | 176 |
| 97 | 3300005456 | Ga0070678_100096396 | Ga0070678_1000963963 | 176 |
| 98 | 3300005456 | Ga0070678_100119951 | Ga0070678_1001199513 | 176 |
| 99 | 3300005456 | Ga0070678_100181951 | Ga0070678_1001819512 | 176 |
| 100 | 3300005456 | Ga0070678_100188119 | Ga0070678_1001881192 | 176 |
| 101 | 3300005456 | Ga0070678_100691876 | Ga0070678_1006918761 | 176 |
| 102 | 3300005457 | Ga0070662_100213843 | Ga0070662_1002138431 | 176 |
| 103 | 3300005457 | Ga0070662_100293353 | Ga0070662_1002933532 | 176 |
| 104 | 3300005458 | Ga0070681_10169332 | Ga0070681_101693322 | 176 |
| 105 | 3300005459 | Ga0068867_100257444 | Ga0068867_1002574442 | 176 |
| 106 | 3300005466 | Ga0070685_10141415 | Ga0070685_101414151 | 176 |
| 107 | 3300005467 | Ga0070706_100710647 | Ga0070706_1007106472 | 176 |
| 108 | 3300005468 | Ga0070707_100142842 | Ga0070707_1001428422 | 176 |
| 109 | 3300005471 | Ga0070698_100148394 | Ga0070698_1001483942 | 176 |
| 110 | 3300005530 | Ga0070679_100138520 | Ga0070679_1001385201 | 176 |
| 111 | 3300005530 | Ga0070679_100163428 | Ga0070679_1001634281 | 176 |
| 112 | 3300005530 | Ga0070679_100341757 | Ga0070679_1003417572 | 176 |
| 113 | 3300005530 | Ga0070679_100411099 | Ga0070679_1004110993 | 176 |
| 114 | 3300005535 | Ga0070684_100028804 | Ga0070684_1000288046 | 176 |
| 115 | 3300005536 | Ga0070697_100200902 | Ga0070697_1002009022 | 176 |
| 116 | 3300005536 | Ga0070697_100627630 | Ga0070697_1006276301 | 176 |
| 117 | 3300005539 | Ga0068853_100000920 | Ga0068853_1000009202 | 176 |
| 118 | 3300005539 | Ga0068853_100075228 | Ga0068853_1000752283 | 176 |
| 119 | 3300005539 | Ga0068853_100647449 | Ga0068853_1006474492 | 176 |
| 120 | 3300005543 | Ga0070672_100418482 | Ga0070672_1004184821 | 176 |
| 121 | 3300005544 | Ga0070686_100782264 | Ga0070686_1007822641 | 176 |
| 122 | 3300005547 | Ga0070693_100059830 | Ga0070693_1000598303 | 176 |
| 123 | 3300005547 | Ga0070693_100066801 | Ga0070693_1000668012 | 176 |
| 124 | 3300005548 | Ga0070665_100058941 | Ga0070665_1000589414 | 176 |
| 125 | 3300005548 | Ga0070665_100162041 | Ga0070665_1001620412 | 176 |
| 126 | 3300005548 | Ga0070665_100182360 | Ga0070665_1001823601 | 176 |
| 127 | 3300005548 | Ga0070665_100238690 | Ga0070665_1002386902 | 176 |
| 128 | 3300005548 | Ga0070665_100324243 | Ga0070665_1003242431 | 176 |
| 129 | 3300005563 | Ga0068855_100029481 | Ga0068855_1000294814 | 176 |
| 130 | 3300005563 | Ga0068855_100046913 | Ga0068855_1000469133 | 176 |
| 131 | 3300005563 | Ga0068855_100166647 | Ga0068855_1001666473 | 176 |
| 132 | 3300005563 | Ga0068855_100188673 | Ga0068855_1001886732 | 176 |
| 133 | 3300005563 | Ga0068855_100505594 | Ga0068855_1005055942 | 176 |
| 134 | 3300005564 | Ga0070664_100171516 | Ga0070664_1001715162 | 176 |
| 135 | 3300005564 | Ga0070664_100238331 | Ga0070664_1002383312 | 176 |
| 136 | 3300005564 | Ga0070664_100678646 | Ga0070664_1006786461 | 176 |
| 137 | 3300005577 | Ga0068857_100001037 | Ga0068857_10000103723 | 176 |
| 138 | 3300005577 | Ga0068857_100223783 | Ga0068857_1002237832 | 176 |
| 139 | 3300005577 | Ga0068857_101300699 | Ga0068857_1013006992 | 176 |
| 140 | 3300005578 | Ga0068854_100003979 | Ga0068854_1000039793 | 176 |
| 141 | 3300005578 | Ga0068854_100323281 | Ga0068854_1003232812 | 176 |
| 142 | 3300005578 | Ga0068854_100899502 | Ga0068854_1008995021 | 176 |
| 143 | 3300005578 | Ga0068854_101097191 | Ga0068854_1010971911 | 176 |
| 144 | 3300005614 | Ga0068856_100000883 | Ga0068856_10000088324 | 176 |
| 145 | 3300005614 | Ga0068856_100004208 | Ga0068856_1000042088 | 176 |
| 146 | 3300005614 | Ga0068856_100152442 | Ga0068856_1001524422 | 176 |
| 147 | 3300005614 | Ga0068856_100262760 | Ga0068856_1002627603 | 176 |
| 148 | 3300005614 | Ga0068856_100999315 | Ga0068856_1009993152 | 176 |
| 149 | 3300005615 | Ga0070702_100150872 | Ga0070702_1001508722 | 176 |
| 150 | 3300005615 | Ga0070702_100267869 | Ga0070702_1002678692 | 176 |
| 151 | 3300005615 | Ga0070702_100344973 | Ga0070702_1003449731 | 176 |
| 152 | 3300005615 | Ga0070702_100404374 | Ga0070702_1004043742 | 176 |
| 153 | 3300005616 | Ga0068852_100034011 | Ga0068852_1000340114 | 176 |
| 154 | 3300005616 | Ga0068852_100126529 | Ga0068852_1001265291 | 176 |
| 155 | 3300005616 | Ga0068852_100142386 | Ga0068852_1001423863 | 176 |
| 156 | 3300005616 | Ga0068852_100170191 | Ga0068852_1001701912 | 176 |
| 157 | 3300005616 | Ga0068852_100441012 | Ga0068852_1004410122 | 176 |
| 158 | 3300005616 | Ga0068852_101564800 | Ga0068852_1015648001 | 176 |
| 159 | 3300005617 | Ga0068859_100254022 | Ga0068859_1002540222 | 176 |
| 160 | 3300005618 | Ga0068864_100203460 | Ga0068864_1002034601 | 176 |
| 161 | 3300005618 | Ga0068864_100614808 | Ga0068864_1006148081 | 176 |
| 162 | 3300005718 | Ga0068866_10222960 | Ga0068866_102229601 | 176 |
| 163 | 3300005719 | Ga0068861_100019124 | Ga0068861_1000191244 | 176 |
| 164 | 3300005719 | Ga0068861_100205381 | Ga0068861_1002053812 | 176 |
| 165 | 3300005719 | Ga0068861_100404123 | Ga0068861_1004041232 | 176 |
| 166 | 3300005719 | Ga0068861_100920026 | Ga0068861_1009200261 | 176 |
| 167 | 3300005834 | Ga0068851_10006246 | Ga0068851_100062463 | 176 |
| 168 | 3300005834 | Ga0068851_10034786 | Ga0068851_100347862 | 176 |
| 169 | 3300005840 | Ga0068870_10598458 | Ga0068870_105984582 | 176 |
| 170 | 3300005840 | Ga0068870_10647281 | Ga0068870_106472812 | 176 |
| 171 | 3300005841 | Ga0068863_100296697 | Ga0068863_1002966972 | 176 |
| 172 | 3300005842 | Ga0068858_100218548 | Ga0068858_1002185482 | 176 |
| 173 | 3300005842 | Ga0068858_100330736 | Ga0068858_1003307362 | 176 |
| 174 | 3300005842 | Ga0068858_100392424 | Ga0068858_1003924242 | 176 |
| 175 | 3300005843 | Ga0068860_100089952 | Ga0068860_1000899522 | 176 |
| 176 | 3300005844 | Ga0068862_100266806 | Ga0068862_1002668062 | 176 |
| 177 | 3300005844 | Ga0068862_100284118 | Ga0068862_1002841182 | 176 |
| 178 | 3300005844 | Ga0068862_100369106 | Ga0068862_1003691062 | 176 |
| 179 | 3300005937 | Ga0081455_10025851 | Ga0081455_100258514 | 176 |
| 180 | 3300005937 | Ga0081455_10178537 | Ga0081455_101785371 | 176 |
| 181 | 3300005937 | Ga0081455_10249018 | Ga0081455_102490182 | 176 |
| 182 | 3300005981 | Ga0081538_10032665 | Ga0081538_100326653 | 176 |
| 183 | 3300005983 | Ga0081540_1000191 | Ga0081540_100019151 | 176 |
| 184 | 3300005983 | Ga0081540_1016110 | Ga0081540_10161104 | 176 |
| 185 | 3300005983 | Ga0081540_1019271 | Ga0081540_10192715 | 176 |
| 186 | 3300005983 | Ga0081540_1085029 | Ga0081540_10850293 | 176 |
| 187 | 3300005985 | Ga0081539_10000371 | Ga0081539_1000037130 | 176 |
| 188 | 3300005985 | Ga0081539_10003753 | Ga0081539_1000375321 | 176 |
| 189 | 3300005985 | Ga0081539_10035788 | Ga0081539_100357884 | 176 |
| 190 | 3300006028 | Ga0070717_10053768 | Ga0070717_100537683 | 176 |
| 191 | 3300006028 | Ga0070717_10306388 | Ga0070717_103063881 | 176 |
| 192 | 3300006028 | Ga0070717_10871034 | Ga0070717_108710341 | 176 |
| 193 | 3300006038 | Ga0075365_10031473 | Ga0075365_100314732 | 176 |
| 194 | 3300006038 | Ga0075365_10318503 | Ga0075365_103185032 | 176 |
| 195 | 3300006038 | Ga0075365_10356865 | Ga0075365_103568652 | 176 |
| 196 | 3300006048 | Ga0075363_100040546 | Ga0075363_1000405464 | 176 |
| 197 | 3300006048 | Ga0075363_100042055 | Ga0075363_1000420553 | 176 |
| 198 | 3300006048 | Ga0075363_100059837 | Ga0075363_1000598372 | 176 |
| 199 | 3300006048 | Ga0075363_100189089 | Ga0075363_1001890892 | 176 |
| 200 | 3300006051 | Ga0075364_10081058 | Ga0075364_100810583 | 176 |
| 201 | 3300006051 | Ga0075364_10407697 | Ga0075364_104076972 | 176 |
| 202 | 3300006173 | Ga0070716_100005454 | Ga0070716_1000054543 | 176 |
| 203 | 3300006175 | Ga0070712_100051297 | Ga0070712_1000512972 | 176 |
| 204 | 3300006178 | Ga0075367_10022578 | Ga0075367_100225784 | 176 |
| 205 | 3300006178 | Ga0075367_10129008 | Ga0075367_101290082 | 176 |
| 206 | 3300006178 | Ga0075367_10204275 | Ga0075367_102042752 | 176 |
| 207 | 3300006186 | Ga0075369_10054951 | Ga0075369_100549512 | 176 |
| 208 | 3300006186 | Ga0075369_10094096 | Ga0075369_100940962 | 176 |
| 209 | 3300006186 | Ga0075369_10158915 | Ga0075369_101589152 | 176 |
| 210 | 3300006237 | Ga0097621_100465752 | Ga0097621_1004657522 | 176 |
| 211 | 3300006237 | Ga0097621_100939775 | Ga0097621_1009397752 | 176 |
| 212 | 3300006358 | Ga0068871_101062922 | Ga0068871_1010629221 | 176 |
| 213 | 3300006871 | Ga0075434_100289220 | Ga0075434_1002892202 | 176 |
| 214 | 3300006871 | Ga0075434_101225456 | Ga0075434_1012254562 | 176 |
| 215 | 3300006881 | Ga0068865_100097523 | Ga0068865_1000975231 | 176 |
| 216 | 3300006881 | Ga0068865_100392575 | Ga0068865_1003925752 | 176 |
| 217 | 3300006931 | Ga0097620_100254024 | Ga0097620_1002540242 | 176 |
| 218 | 3300007265 | Ga0099794_10093674 | Ga0099794_100936743 | 176 |
| 219 | 3300007788 | Ga0099795_10012860 | Ga0099795_100128603 | 176 |
| 220 | 3300007788 | Ga0099795_10121689 | Ga0099795_101216891 | 176 |
| 221 | 3300007788 | Ga0099795_10226511 | Ga0099795_102265111 | 176 |
| 222 | 3300009093 | Ga0105240_10002459 | Ga0105240_100024593 | 176 |
| 223 | 3300009093 | Ga0105240_10092073 | Ga0105240_100920731 | 176 |
| 224 | 3300009093 | Ga0105240_10175273 | Ga0105240_101752732 | 176 |
| 225 | 3300009093 | Ga0105240_11479283 | Ga0105240_114792831 | 176 |
| 226 | 3300009094 | Ga0111539_11207958 | Ga0111539_112079581 | 176 |
| 227 | 3300009098 | Ga0105245_10287261 | Ga0105245_102872612 | 176 |
| 228 | 3300009101 | Ga0105247_10443916 | Ga0105247_104439162 | 176 |
| 229 | 3300009101 | Ga0105247_10537262 | Ga0105247_105372621 | 176 |
| 230 | 3300009148 | Ga0105243_10132920 | Ga0105243_101329203 | 176 |
| 231 | 3300009148 | Ga0105243_10688127 | Ga0105243_106881271 | 176 |
| 232 | 3300009174 | Ga0105241_10068388 | Ga0105241_100683883 | 176 |
| 233 | 3300009174 | Ga0105241_10205614 | Ga0105241_102056141 | 176 |
| 234 | 3300009174 | Ga0105241_10843530 | Ga0105241_108435302 | 176 |
| 235 | 3300009174 | Ga0105241_11185215 | Ga0105241_111852151 | 176 |
| 236 | 3300009176 | Ga0105242_10493261 | Ga0105242_104932612 | 176 |
| 237 | 3300009176 | Ga0105242_10649936 | Ga0105242_106499362 | 176 |
| 238 | 3300009176 | Ga0105242_10849883 | Ga0105242_108498831 | 176 |
| 239 | 3300009177 | Ga0105248_10089282 | Ga0105248_100892822 | 176 |
| 240 | 3300009177 | Ga0105248_10384390 | Ga0105248_103843902 | 176 |
| 241 | 3300009177 | Ga0105248_10677427 | Ga0105248_106774272 | 176 |
| 242 | 3300009177 | Ga0105248_10998438 | Ga0105248_109984381 | 176 |
| 243 | 3300009545 | Ga0105237_10050492 | Ga0105237_100504925 | 176 |
| 244 | 3300009545 | Ga0105237_10285970 | Ga0105237_102859702 | 176 |
| 245 | 3300009545 | Ga0105237_10604474 | Ga0105237_106044742 | 176 |
| 246 | 3300009545 | Ga0105237_11107051 | Ga0105237_111070511 | 176 |
| 247 | 3300009551 | Ga0105238_10001235 | Ga0105238_1000123518 | 176 |
| 248 | 3300009551 | Ga0105238_10004895 | Ga0105238_100048955 | 176 |
| 249 | 3300009551 | Ga0105238_10263712 | Ga0105238_102637122 | 176 |
| 250 | 3300009551 | Ga0105238_10606697 | Ga0105238_106066971 | 176 |
| 251 | 3300009551 | Ga0105238_11162681 | Ga0105238_111626811 | 176 |
| 252 | 3300009553 | Ga0105249_10862548 | Ga0105249_108625482 | 176 |
| 253 | 3300009553 | Ga0105249_10918118 | Ga0105249_109181182 | 176 |
| 254 | 3300009553 | Ga0105249_11073679 | Ga0105249_110736792 | 176 |
| 255 | 3300010159 | Ga0099796_10016687 | Ga0099796_100166873 | 176 |
| 256 | 3300010159 | Ga0099796_10051347 | Ga0099796_100513472 | 176 |
| 257 | 3300010375 | Ga0105239_10047033 | Ga0105239_100470332 | 176 |
| 258 | 3300010375 | Ga0105239_10168725 | Ga0105239_101687252 | 176 |
| 259 | 3300010375 | Ga0105239_10442999 | Ga0105239_104429992 | 176 |
| 260 | 3300010375 | Ga0105239_10568052 | Ga0105239_105680522 | 176 |
| 261 | 3300010375 | Ga0105239_10839731 | Ga0105239_108397312 | 176 |
| 262 | 3300010375 | Ga0105239_11506916 | Ga0105239_115069161 | 176 |
| 263 | 3300011119 | Ga0105246_10339482 | Ga0105246_103394822 | 176 |
| 264 | 3300011119 | Ga0105246_10381348 | Ga0105246_103813482 | 176 |
| 265 | 3300011119 | Ga0105246_10388473 | Ga0105246_103884731 | 176 |
| 266 | 3300011119 | Ga0105246_10696584 | Ga0105246_106965842 | 176 |
| 267 | 3300013102 | Ga0157371_10142321 | Ga0157371_101423212 | 176 |
| 268 | 3300013104 | Ga0157370_10051849 | Ga0157370_100518491 | 176 |
| 269 | 3300013105 | Ga0157369_10002556 | Ga0157369_1000255610 | 176 |
| 270 | 3300013105 | Ga0157369_10223644 | Ga0157369_102236443 | 176 |
| 271 | 3300013296 | Ga0157374_10154653 | Ga0157374_101546533 | 176 |
| 272 | 3300013297 | Ga0157378_10020601 | Ga0157378_100206014 | 176 |
| 273 | 3300013297 | Ga0157378_10318981 | Ga0157378_103189812 | 176 |
| 274 | 3300013306 | Ga0163162_10411441 | Ga0163162_104114412 | 176 |
| 275 | 3300013306 | Ga0163162_10550641 | Ga0163162_105506412 | 176 |
| 276 | 3300013306 | Ga0163162_10621464 | Ga0163162_106214642 | 176 |
| 277 | 3300013306 | Ga0163162_10670838 | Ga0163162_106708382 | 176 |
| 278 | 3300013306 | Ga0163162_10763602 | Ga0163162_107636022 | 176 |
| 279 | 3300013306 | Ga0163162_11712813 | Ga0163162_117128131 | 176 |
| 280 | 3300013307 | Ga0157372_11653391 | Ga0157372_116533911 | 176 |
| 281 | 3300014325 | Ga0163163_10081541 | Ga0163163_100815412 | 176 |
| 282 | 3300014325 | Ga0163163_10478401 | Ga0163163_104784012 | 176 |
| 283 | 3300014325 | Ga0163163_10914754 | Ga0163163_109147541 | 176 |
| 284 | 3300014325 | Ga0163163_11372648 | Ga0163163_113726481 | 176 |
| 285 | 3300014326 | Ga0157380_10797546 | Ga0157380_107975462 | 176 |
| 286 | 3300014745 | Ga0157377_10117811 | Ga0157377_101178112 | 176 |
| 287 | 3300014968 | Ga0157379_10378242 | Ga0157379_103782422 | 176 |
| 288 | 3300014968 | Ga0157379_10481907 | Ga0157379_104819072 | 176 |
| 289 | 3300014969 | Ga0157376_10137875 | Ga0157376_101378753 | 176 |
| 290 | 3300014969 | Ga0157376_10240032 | Ga0157376_102400323 | 176 |
| 291 | 3300014969 | Ga0157376_10320265 | Ga0157376_103202652 | 176 |
| 292 | 3300014969 | Ga0157376_10562992 | Ga0157376_105629922 | 176 |
| 293 | 3300014969 | Ga0157376_10833860 | Ga0157376_108338602 | 176 |
| 294 | 3300021441 | Ga0213871_10014132 | Ga0213871_100141323 | 176 |
| 295 | 3300025261 | Ga0209233_1018543 | Ga0209233_10185432 | 176 |
| 296 | 3300025297 | Ga0209758_1001013 | Ga0209758_100101310 | 176 |
| 297 | 3300025315 | Ga0207697_10068684 | Ga0207697_100686842 | 176 |
| 298 | 3300025315 | Ga0207697_10230004 | Ga0207697_102300041 | 176 |
| 299 | 3300025321 | Ga0207656_10022809 | Ga0207656_100228092 | 176 |
| 300 | 3300025321 | Ga0207656_10031168 | Ga0207656_100311682 | 176 |
| 301 | 3300025321 | Ga0207656_10223490 | Ga0207656_102234901 | 176 |
| 302 | 3300025711 | Ga0207696_1040275 | Ga0207696_10402752 | 176 |
| 303 | 3300025898 | Ga0207692_10006838 | Ga0207692_100068383 | 176 |
| 304 | 3300025899 | Ga0207642_10081164 | Ga0207642_100811642 | 176 |
| 305 | 3300025899 | Ga0207642_10366082 | Ga0207642_103660822 | 176 |
| 306 | 3300025900 | Ga0207710_10169861 | Ga0207710_101698611 | 176 |
| 307 | 3300025901 | Ga0207688_10439939 | Ga0207688_104399392 | 176 |
| 308 | 3300025904 | Ga0207647_10027240 | Ga0207647_100272404 | 176 |
| 309 | 3300025906 | Ga0207699_10042859 | Ga0207699_100428593 | 176 |
| 310 | 3300025907 | Ga0207645_10280161 | Ga0207645_102801611 | 176 |
| 311 | 3300025907 | Ga0207645_10329900 | Ga0207645_103299002 | 176 |
| 312 | 3300025907 | Ga0207645_10352424 | Ga0207645_103524242 | 176 |
| 313 | 3300025908 | Ga0207643_10070154 | Ga0207643_100701543 | 176 |
| 314 | 3300025908 | Ga0207643_10231242 | Ga0207643_102312421 | 176 |
| 315 | 3300025909 | Ga0207705_10071743 | Ga0207705_100717432 | 176 |
| 316 | 3300025909 | Ga0207705_10363006 | Ga0207705_103630062 | 176 |
| 317 | 3300025909 | Ga0207705_10843515 | Ga0207705_108435151 | 176 |
| 318 | 3300025910 | Ga0207684_10159090 | Ga0207684_101590902 | 176 |
| 319 | 3300025911 | Ga0207654_10001655 | Ga0207654_100016557 | 176 |
| 320 | 3300025911 | Ga0207654_10013803 | Ga0207654_100138034 | 176 |
| 321 | 3300025911 | Ga0207654_10385056 | Ga0207654_103850561 | 176 |
| 322 | 3300025911 | Ga0207654_10490580 | Ga0207654_104905802 | 176 |
| 323 | 3300025912 | Ga0207707_10017344 | Ga0207707_100173445 | 176 |
| 324 | 3300025913 | Ga0207695_10000387 | Ga0207695_1000038710 | 176 |
| 325 | 3300025913 | Ga0207695_10155099 | Ga0207695_101550991 | 176 |
| 326 | 3300025914 | Ga0207671_10018972 | Ga0207671_100189723 | 176 |
| 327 | 3300025914 | Ga0207671_10021648 | Ga0207671_100216485 | 176 |
| 328 | 3300025914 | Ga0207671_10624364 | Ga0207671_106243641 | 176 |
| 329 | 3300025915 | Ga0207693_10003895 | Ga0207693_1000389510 | 176 |
| 330 | 3300025915 | Ga0207693_10004610 | Ga0207693_1000461010 | 176 |
| 331 | 3300025916 | Ga0207663_10442873 | Ga0207663_104428731 | 176 |
| 332 | 3300025916 | Ga0207663_10650283 | Ga0207663_106502831 | 176 |
| 333 | 3300025917 | Ga0207660_10005223 | Ga0207660_100052233 | 176 |
| 334 | 3300025917 | Ga0207660_10024440 | Ga0207660_100244404 | 176 |
| 335 | 3300025917 | Ga0207660_10064187 | Ga0207660_100641872 | 176 |
| 336 | 3300025918 | Ga0207662_10407233 | Ga0207662_104072331 | 176 |
| 337 | 3300025919 | Ga0207657_10331115 | Ga0207657_103311152 | 176 |
| 338 | 3300025919 | Ga0207657_10550412 | Ga0207657_105504122 | 176 |
| 339 | 3300025921 | Ga0207652_10006970 | Ga0207652_100069705 | 176 |
| 340 | 3300025921 | Ga0207652_10456565 | Ga0207652_104565652 | 176 |
| 341 | 3300025921 | Ga0207652_10736488 | Ga0207652_107364881 | 176 |
| 342 | 3300025922 | Ga0207646_10425433 | Ga0207646_104254332 | 176 |
| 343 | 3300025923 | Ga0207681_10715308 | Ga0207681_107153082 | 176 |
| 344 | 3300025924 | Ga0207694_10000121 | Ga0207694_1000012122 | 176 |
| 345 | 3300025924 | Ga0207694_10016807 | Ga0207694_100168073 | 176 |
| 346 | 3300025924 | Ga0207694_10555966 | Ga0207694_105559661 | 176 |
| 347 | 3300025925 | Ga0207650_10098980 | Ga0207650_100989802 | 176 |
| 348 | 3300025925 | Ga0207650_10614928 | Ga0207650_106149281 | 176 |
| 349 | 3300025925 | Ga0207650_10798314 | Ga0207650_107983141 | 176 |
| 350 | 3300025926 | Ga0207659_10895741 | Ga0207659_108957411 | 176 |
| 351 | 3300025927 | Ga0207687_10353901 | Ga0207687_103539012 | 176 |
| 352 | 3300025927 | Ga0207687_10385443 | Ga0207687_103854431 | 176 |
| 353 | 3300025927 | Ga0207687_10561005 | Ga0207687_105610051 | 176 |
| 354 | 3300025928 | Ga0207700_10037943 | Ga0207700_100379432 | 176 |
| 355 | 3300025932 | Ga0207690_10138871 | Ga0207690_101388713 | 176 |
| 356 | 3300025932 | Ga0207690_10305471 | Ga0207690_103054712 | 176 |
| 357 | 3300025932 | Ga0207690_10367308 | Ga0207690_103673081 | 176 |
| 358 | 3300025933 | Ga0207706_10272628 | Ga0207706_102726282 | 176 |
| 359 | 3300025933 | Ga0207706_10392382 | Ga0207706_103923822 | 176 |
| 360 | 3300025934 | Ga0207686_10262052 | Ga0207686_102620522 | 176 |
| 361 | 3300025935 | Ga0207709_10727289 | Ga0207709_107272891 | 176 |
| 362 | 3300025938 | Ga0207704_10121863 | Ga0207704_101218631 | 176 |
| 363 | 3300025938 | Ga0207704_10973754 | Ga0207704_109737541 | 176 |
| 364 | 3300025939 | Ga0207665_10006607 | Ga0207665_100066075 | 176 |
| 365 | 3300025940 | Ga0207691_10043997 | Ga0207691_100439974 | 176 |
| 366 | 3300025940 | Ga0207691_10441233 | Ga0207691_104412332 | 176 |
| 367 | 3300025941 | Ga0207711_10048929 | Ga0207711_100489292 | 176 |
| 368 | 3300025941 | Ga0207711_10250102 | Ga0207711_102501022 | 176 |
| 369 | 3300025941 | Ga0207711_10354486 | Ga0207711_103544862 | 176 |
| 370 | 3300025942 | Ga0207689_10098911 | Ga0207689_100989112 | 176 |
| 371 | 3300025944 | Ga0207661_10011150 | Ga0207661_100111505 | 176 |
| 372 | 3300025944 | Ga0207661_10528501 | Ga0207661_105285011 | 176 |
| 373 | 3300025945 | Ga0207679_10196054 | Ga0207679_101960542 | 176 |
| 374 | 3300025945 | Ga0207679_10269997 | Ga0207679_102699972 | 176 |
| 375 | 3300025949 | Ga0207667_10016621 | Ga0207667_100166213 | 176 |
| 376 | 3300025949 | Ga0207667_10022419 | Ga0207667_100224193 | 176 |
| 377 | 3300025949 | Ga0207667_10152080 | Ga0207667_101520803 | 176 |
| 378 | 3300025949 | Ga0207667_10582154 | Ga0207667_105821542 | 176 |
| 379 | 3300025960 | Ga0207651_10204727 | Ga0207651_102047271 | 176 |
| 380 | 3300025960 | Ga0207651_10446210 | Ga0207651_104462102 | 176 |
| 381 | 3300025961 | Ga0207712_10065403 | Ga0207712_100654032 | 176 |
| 382 | 3300025961 | Ga0207712_10286617 | Ga0207712_102866172 | 176 |
| 383 | 3300025961 | Ga0207712_10774398 | Ga0207712_107743982 | 176 |
| 384 | 3300025961 | Ga0207712_10787931 | Ga0207712_107879312 | 176 |
| 385 | 3300025972 | Ga0207668_10236505 | Ga0207668_102365052 | 176 |
| 386 | 3300025981 | Ga0207640_10015818 | Ga0207640_100158183 | 176 |
| 387 | 3300025981 | Ga0207640_10753416 | Ga0207640_107534161 | 176 |
| 388 | 3300025981 | Ga0207640_11053587 | Ga0207640_110535871 | 176 |
| 389 | 3300026023 | Ga0207677_10120722 | Ga0207677_101207222 | 176 |
| 390 | 3300026023 | Ga0207677_10556727 | Ga0207677_105567271 | 176 |
| 391 | 3300026035 | Ga0207703_10149148 | Ga0207703_101491482 | 176 |
| 392 | 3300026035 | Ga0207703_10165463 | Ga0207703_101654632 | 176 |
| 393 | 3300026035 | Ga0207703_10223960 | Ga0207703_102239602 | 176 |
| 394 | 3300026041 | Ga0207639_10024254 | Ga0207639_100242542 | 176 |
| 395 | 3300026041 | Ga0207639_10291502 | Ga0207639_102915022 | 176 |
| 396 | 3300026041 | Ga0207639_10494735 | Ga0207639_104947352 | 176 |
| 397 | 3300026041 | Ga0207639_10705210 | Ga0207639_107052101 | 176 |
| 398 | 3300026067 | Ga0207678_10037796 | Ga0207678_100377962 | 176 |
| 399 | 3300026067 | Ga0207678_10207968 | Ga0207678_102079682 | 176 |
| 400 | 3300026067 | Ga0207678_10412006 | Ga0207678_104120062 | 176 |
| 401 | 3300026067 | Ga0207678_10476937 | Ga0207678_104769372 | 176 |
| 402 | 3300026067 | Ga0207678_10590108 | Ga0207678_105901082 | 176 |
| 403 | 3300026067 | Ga0207678_10712880 | Ga0207678_107128802 | 176 |
| 404 | 3300026075 | Ga0207708_10330433 | Ga0207708_103304332 | 176 |
| 405 | 3300026075 | Ga0207708_10397591 | Ga0207708_103975912 | 176 |
| 406 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004102 | 176 |
| 407 | 3300026078 | Ga0207702_10000318 | Ga0207702_1000031823 | 176 |
| 408 | 3300026078 | Ga0207702_10286369 | Ga0207702_102863692 | 176 |
| 409 | 3300026078 | Ga0207702_10555193 | Ga0207702_105551931 | 176 |
| 410 | 3300026089 | Ga0207648_10243902 | Ga0207648_102439022 | 176 |
| 411 | 3300026095 | Ga0207676_10554519 | Ga0207676_105545192 | 176 |
| 412 | 3300026116 | Ga0207674_10005764 | Ga0207674_100057648 | 176 |
| 413 | 3300026116 | Ga0207674_10199148 | Ga0207674_101991483 | 176 |
| 414 | 3300026116 | Ga0207674_10441985 | Ga0207674_104419852 | 176 |
| 415 | 3300026116 | Ga0207674_10840680 | Ga0207674_108406802 | 176 |
| 416 | 3300026118 | Ga0207675_100059792 | Ga0207675_1000597922 | 176 |
| 417 | 3300026118 | Ga0207675_100289091 | Ga0207675_1002890912 | 176 |
| 418 | 3300026118 | Ga0207675_100429708 | Ga0207675_1004297082 | 176 |
| 419 | 3300026118 | Ga0207675_100889986 | Ga0207675_1008899862 | 176 |
| 420 | 3300026121 | Ga0207683_10036296 | Ga0207683_100362964 | 176 |
| 421 | 3300026121 | Ga0207683_10077838 | Ga0207683_100778383 | 176 |
| 422 | 3300026121 | Ga0207683_10088714 | Ga0207683_100887143 | 176 |
| 423 | 3300026121 | Ga0207683_10231570 | Ga0207683_102315702 | 176 |
| 424 | 3300026121 | Ga0207683_10634552 | Ga0207683_106345522 | 176 |
| 425 | 3300026142 | Ga0207698_10089767 | Ga0207698_100897673 | 176 |
| 426 | 3300026142 | Ga0207698_10296821 | Ga0207698_102968212 | 176 |
| 427 | 3300026142 | Ga0207698_10528381 | Ga0207698_105283812 | 176 |
| 428 | 3300026142 | Ga0207698_11029131 | Ga0207698_110291311 | 176 |
| 429 | 3300027357 | Ga0209589_1000035 | Ga0209589_100003567 | 176 |
| 430 | 3300027361 | Ga0209489_100079 | Ga0209489_10007967 | 176 |
| 431 | 3300027363 | Ga0209700_100077 | Ga0209700_10007767 | 176 |
| 432 | 3300027866 | Ga0209813_10132321 | Ga0209813_101323212 | 176 |
| 433 | 3300028379 | Ga0268266_10001906 | Ga0268266_1000190615 | 176 |
| 434 | 3300028379 | Ga0268266_10203362 | Ga0268266_102033623 | 176 |
| 435 | 3300028379 | Ga0268266_10228389 | Ga0268266_102283892 | 176 |
| 436 | 3300028379 | Ga0268266_10434822 | Ga0268266_104348222 | 176 |
| 437 | 3300028379 | Ga0268266_11297274 | Ga0268266_112972741 | 176 |
| 438 | 3300028380 | Ga0268265_10096092 | Ga0268265_100960923 | 176 |
| 439 | 3300028380 | Ga0268265_10384998 | Ga0268265_103849982 | 176 |
| 440 | 3300028381 | Ga0268264_10633722 | Ga0268264_106337221 | 176 |
| 441 | 3300028573 | Ga0265334_10006202 | Ga0265334_100062023 | 176 |
| 442 | 3300028786 | Ga0307517_10138245 | Ga0307517_101382452 | 176 |
| 443 | 3300028794 | Ga0307515_10256975 | Ga0307515_102569752 | 176 |
| 444 | 3300028800 | Ga0265338_10365098 | Ga0265338_103650982 | 176 |
| 445 | 3300031235 | Ga0265330_10146619 | Ga0265330_101466192 | 176 |
| 446 | 3300031238 | Ga0265332_10006837 | Ga0265332_100068371 | 176 |
| 447 | 3300031239 | Ga0265328_10231538 | Ga0265328_102315381 | 176 |
| 448 | 3300031241 | Ga0265325_10032360 | Ga0265325_100323603 | 176 |
| 449 | 3300031247 | Ga0265340_10012805 | Ga0265340_100128053 | 176 |
| 450 | 3300031249 | Ga0265339_10054742 | Ga0265339_100547422 | 176 |
| 451 | 3300031250 | Ga0265331_10058682 | Ga0265331_100586822 | 176 |
| 452 | 3300031344 | Ga0265316_10235800 | Ga0265316_102358003 | 176 |
| 453 | 3300031616 | Ga0307508_10084039 | Ga0307508_100840394 | 176 |
| 454 | 3300031711 | Ga0265314_10077282 | Ga0265314_100772821 | 176 |
| 455 | 3300031712 | Ga0265342_10105236 | Ga0265342_101052362 | 176 |
| 456 | 3300031712 | Ga0265342_10111267 | Ga0265342_101112672 | 176 |
| 457 | 3300031712 | Ga0265342_10113343 | Ga0265342_101133433 | 176 |
| 458 | 3300031730 | Ga0307516_10029260 | Ga0307516_100292603 | 176 |
| 459 | 3300031730 | Ga0307516_10105054 | Ga0307516_101050542 | 176 |
| 460 | 3300031730 | Ga0307516_10132990 | Ga0307516_101329903 | 176 |
| 461 | 3300031731 | Ga0307405_10543836 | Ga0307405_105438361 | 176 |
| 462 | 3300031824 | Ga0307413_11058891 | Ga0307413_110588911 | 176 |
| 463 | 3300031911 | Ga0307412_10183578 | Ga0307412_101835782 | 176 |
| 464 | 3300031995 | Ga0307409_100301760 | Ga0307409_1003017602 | 176 |
| 465 | 3300031995 | Ga0307409_102298704 | Ga0307409_1022987041 | 176 |
| 466 | 3300032002 | Ga0307416_100991158 | Ga0307416_1009911582 | 176 |
| 467 | 3300032002 | Ga0307416_101018883 | Ga0307416_1010188832 | 176 |
| 468 | 3300032005 | Ga0307411_10287119 | Ga0307411_102871192 | 176 |
| 469 | 3300032005 | Ga0307411_10487544 | Ga0307411_104875442 | 176 |
| 470 | 3300032126 | Ga0307415_100729374 | Ga0307415_1007293741 | 176 |
| 471 | 3300033180 | Ga0307510_10024915 | Ga0307510_100249152 | 176 |
| 472 | 3300035086 | Ga0373934_0006674 | Ga0373934_0006674_247_777 | 176 |
| 473 | 3300035086 | Ga0373934_0030953 | Ga0373934_0030953_1370_1921 | 176 |
| 474 | 3300035089 | Ga0373944_0015410 | Ga0373944_0015410_68_619 | 176 |
| 475 | 3300035092 | Ga0373952_0076648 | Ga0373952_0076648_214_747 | 176 |
| 476 | 3300035111 | Ga0373923_0003012 | Ga0373923_0003012_2904_3434 | 176 |
| 477 | 3300035111 | Ga0373923_0100092 | Ga0373923_0100092_77_628 | 176 |
| 478 | 3300035112 | Ga0373932_0198358 | Ga0373932_0198358_146_679 | 176 |
| 479 | 3300035113 | Ga0373936_0041823 | Ga0373936_0041823_72_605 | 176 |
| 480 | 3300035113 | Ga0373936_0062817 | Ga0373936_0062817_721_1251 | 176 |
| 481 | 3300035115 | Ga0373941_0059088 | Ga0373941_0059088_155_688 | 176 |
| 482 | 3300035117 | Ga0373953_0003523 | Ga0373953_0003523_2363_2893 | 176 |
| 483 | 3300035118 | Ga0373954_0001251 | Ga0373954_0001251_2978_3508 | 176 |
| 484 | 3300035118 | Ga0373954_0098981 | Ga0373954_0098981_73_624 | 176 |
| 485 | 3300035118 | Ga0373954_0473317 | Ga0373954_0473317_10_561 | 176 |
| 486 | 3300035119 | Ga0373956_0002392 | Ga0373956_0002392_74_604 | 176 |
| 487 | 3300035120 | Ga0373957_0003300 | Ga0373957_0003300_4056_4586 | 176 |
| 488 | 3300035120 | Ga0373957_0181370 | Ga0373957_0181370_19_549 | 176 |
| 489 | 3300035170 | Ga0373943_0018879 | Ga0373943_0018879_312_863 | 176 |
| 490 | 3300035170 | Ga0373943_0057672 | Ga0373943_0057672_676_1209 | 176 |
| 491 | 3300035171 | Ga0373946_0032123 | Ga0373946_0032123_284_835 | 176 |
| 492 | 3300035172 | Ga0373955_0007575 | Ga0373955_0007575_3913_4443 | 176 |
| 493 | 3300035207 | Ga0373942_0127281 | Ga0373942_0127281_100_633 | 176 |
| 494 | 3300035241 | Ga0373961_0111746 | Ga0373961_0111746_87_617 | 176 |
| 495 | 3300035242 | Ga0373962_0085828 | Ga0373962_0085828_33_566 | 176 |
| 496 | 3300035410 | Ga0373924_0037044 | Ga0373924_0037044_854_1405 | 176 |
| 497 | 3300035691 | Ga0373931_0015889 | Ga0373931_0015889_2905_3438 | 176 |
| 498 | 3300035691 | Ga0373931_0057737 | Ga0373931_0057737_670_1203 | 176 |
| 499 | 3300035692 | Ga0373935_0011386 | Ga0373935_0011386_111_662 | 176 |
| 500 | 3300035695 | Ga0373927_0000766 | Ga0373927_0000766_23030_23581 | 176 |
| 501 | 3300035695 | Ga0373927_0006850 | Ga0373927_0006850_6357_6890 | 176 |
| 502 | 3300035724 | Ga0373933_0000218 | Ga0373933_0000218_1700_2251 | 176 |
| 503 | 3300035724 | Ga0373933_0006129 | Ga0373933_0006129_3850_4380 | 176 |
| 504 | 3300035724 | Ga0373933_0658781 | Ga0373933_0658781_17_562 | 176 |
| 505 | 3300035724 | Ga0373933_0802080 | Ga0373933_0802080_16_549 | 176 |
| 506 | 3300035725 | Ga0373947_0000310 | Ga0373947_0000310_24590_25141 | 176 |
| 507 | 3300035725 | Ga0373947_0020656 | Ga0373947_0020656_454_987 | 176 |
| 508 | 3300035725 | Ga0373947_0282245 | Ga0373947_0282245_522_1055 | 176 |
| 509 | 3300036401 | Ga0373937_0013830 | Ga0373937_0013830_3279_3809 | 176 |
| 510 | 3300036401 | Ga0373937_0101471 | Ga0373937_0101471_1251_1796 | 176 |
| 511 | 3300036401 | Ga0373937_0255663 | Ga0373937_0255663_865_1416 | 176 |
| 512 | 3300036401 | Ga0373937_0508729 | Ga0373937_0508729_10_561 | 176 |
| 513 | 3300037068 | Ga0373925_0002455 | Ga0373925_0002455_5887_6438 | 176 |
| 514 | 3300039438 | Ga0436360_1122847 | Ga0436360_1122847_92_622 | 176 |
| 515 | 3300039447 | Ga0436361_0042502 | Ga0436361_0042502_233_763 | 176 |
| 516 | 3300039450 | Ga0436363_0081426 | Ga0436363_0081426_101_646 | 176 |
| 517 | 3300039450 | Ga0436363_0802555 | Ga0436363_0802555_2037_2570 | 176 |
| 518 | 3300039453 | Ga0436362_0261438 | Ga0436362_0261438_27_557 | 176 |
| 519 | 3300042157 | Ga0439458_0071754 | Ga0439458_0071754_244_780 | 176 |
| 520 | 3300042438 | Ga0439459_0013441 | Ga0439459_0013441_267_803 | 176 |
| 521 | 3300044656 | Ga0466969_0282419 | Ga0466969_0282419_155_685 | 176 |
| 522 | 3300044684 | Ga0466966_0152331 | Ga0466966_0152331_752_1282 | 176 |
| 523 | 3300044694 | Ga0466963_0203223 | Ga0466963_0203223_706_1239 | 176 |
| 524 | 3300044719 | Ga0466971_0191701 | Ga0466971_0191701_36_566 | 176 |
| 525 | 3300044765 | Ga0466970_0382122 | Ga0466970_0382122_70_600 | 176 |
| 526 | 3300045049 | Ga0466959_0203327 | Ga0466959_0203327_651_1286 | 176 |
| 527 | 3300045976 | Ga0466967_0309991 | Ga0466967_0309991_387_932 | 176 |
| 528 | 3300045976 | Ga0466967_0504505 | Ga0466967_0504505_600_1130 | 176 |
| 529 | 3300045976 | Ga0466967_0852621 | Ga0466967_0852621_346_879 | 176 |
| 530 | 3300046452 | Ga0495617_083339 | Ga0495617_083339_230_763 | 176 |
| 531 | 3300046454 | Ga0495592_0004510 | Ga0495592_0004510_3548_4078 | 176 |
| 532 | 3300046454 | Ga0495592_0064253 | Ga0495592_0064253_1535_2086 | 176 |
| 533 | 3300046455 | Ga0495603_0000801 | Ga0495603_0000801_6927_7478 | 176 |
| 534 | 3300046455 | Ga0495603_0043798 | Ga0495603_0043798_1785_2318 | 176 |
| 535 | 3300046455 | Ga0495603_0087655 | Ga0495603_0087655_505_1038 | 176 |
| 536 | 3300046459 | Ga0495629_0003266 | Ga0495629_0003266_2159_2689 | 176 |
| 537 | 3300046459 | Ga0495629_0007739 | Ga0495629_0007739_5076_5627 | 176 |
| 538 | 3300046459 | Ga0495629_0202273 | Ga0495629_0202273_517_1050 | 176 |
| 539 | 3300046461 | Ga0495641_0002198 | Ga0495641_0002198_6851_7402 | 176 |
| 540 | 3300046462 | Ga0495651_0009476 | Ga0495651_0009476_5144_5674 | 176 |
| 541 | 3300046462 | Ga0495651_0097928 | Ga0495651_0097928_821_1357 | 176 |
| 542 | 3300046463 | Ga0495653_0008190 | Ga0495653_0008190_7604_8134 | 176 |
| 543 | 3300046472 | Ga0495580_0583448 | Ga0495580_0583448_189_722 | 176 |
| 544 | 3300046473 | Ga0495582_0000855 | Ga0495582_0000855_1143_1694 | 176 |
| 545 | 3300046473 | Ga0495582_0364597 | Ga0495582_0364597_187_726 | 176 |
| 546 | 3300046475 | Ga0495639_0000072 | Ga0495639_0000072_30055_30606 | 176 |
| 547 | 3300046476 | Ga0495662_0000572 | Ga0495662_0000572_3885_4436 | 176 |
| 548 | 3300046477 | Ga0495664_0011398 | Ga0495664_0011398_1805_2356 | 176 |
| 549 | 3300046477 | Ga0495664_0070216 | Ga0495664_0070216_1452_1988 | 176 |
| 550 | 3300046477 | Ga0495664_0284032 | Ga0495664_0284032_250_780 | 176 |
| 551 | 3300046492 | Ga0495585_0066657 | Ga0495585_0066657_826_1356 | 176 |
| 552 | 3300046492 | Ga0495585_0129040 | Ga0495585_0129040_107_706 | 176 |
| 553 | 3300046499 | Ga0495594_0000046 | Ga0495594_0000046_40865_41416 | 176 |
| 554 | 3300046499 | Ga0495594_0130994 | Ga0495594_0130994_461_994 | 176 |
| 555 | 3300046499 | Ga0495594_0635827 | Ga0495594_0635827_18_551 | 176 |
| 556 | 3300046507 | Ga0495606_0005524 | Ga0495606_0005524_197_739 | 176 |
| 557 | 3300046507 | Ga0495606_0182001 | Ga0495606_0182001_152_694 | 176 |
| 558 | 3300046511 | Ga0495608_0004196 | Ga0495608_0004196_4177_4707 | 176 |
| 559 | 3300046514 | Ga0495618_0162499 | Ga0495618_0162499_635_1186 | 176 |
| 560 | 3300046516 | Ga0495628_0011819 | Ga0495628_0011819_759_1289 | 176 |
| 561 | 3300046517 | Ga0495630_0011525 | Ga0495630_0011525_2032_2583 | 176 |
| 562 | 3300046520 | Ga0495637_0079586 | Ga0495637_0079586_675_1208 | 176 |
| 563 | 3300046523 | Ga0495644_0057427 | Ga0495644_0057427_427_957 | 176 |
| 564 | 3300046526 | Ga0495666_0003632 | Ga0495666_0003632_3632_4183 | 176 |
| 565 | 3300046526 | Ga0495666_0098996 | Ga0495666_0098996_261_812 | 176 |
| 566 | 3300046529 | Ga0495652_0234622 | Ga0495652_0234622_169_699 | 176 |
| 567 | 3300046529 | Ga0495652_0252270 | Ga0495652_0252270_339_875 | 176 |
| 568 | 3300046531 | Ga0495665_0000128 | Ga0495665_0000128_8446_8997 | 176 |
| 569 | 3300046533 | Ga0495640_0036663 | Ga0495640_0036663_654_1205 | 176 |
| 570 | 3300046533 | Ga0495640_0094813 | Ga0495640_0094813_891_1421 | 176 |
| 571 | 3300046535 | Ga0495586_0041802 | Ga0495586_0041802_1321_1872 | 176 |
| 572 | 3300046536 | Ga0495587_0009812 | Ga0495587_0009812_3913_4443 | 176 |
| 573 | 3300046538 | Ga0495609_0252334 | Ga0495609_0252334_180_713 | 176 |
| 574 | 3300046543 | Ga0495645_0018687 | Ga0495645_0018687_385_915 | 176 |
| 575 | 3300046557 | Ga0495622_0001328 | Ga0495622_0001328_356_907 | 176 |
| 576 | 3300046559 | Ga0495667_0003525 | Ga0495667_0003525_7688_8218 | 176 |
| 577 | 3300046559 | Ga0495667_0028206 | Ga0495667_0028206_2393_2944 | 176 |
| 578 | 3300046615 | Ga0495656_0028598 | Ga0495656_0028598_1120_1650 | 176 |
| 579 | 3300046615 | Ga0495656_0070558 | Ga0495656_0070558_401_1000 | 176 |
| 580 | 3300046616 | Ga0495668_0274126 | Ga0495668_0274126_262_792 | 176 |
| 581 | 3300046616 | Ga0495668_0329825 | Ga0495668_0329825_188_745 | 176 |
| 582 | 3300046642 | Ga0495634_0003037 | Ga0495634_0003037_755_1306 | 176 |
| 583 | 3300046642 | Ga0495634_0022125 | Ga0495634_0022125_2190_2720 | 176 |
| 584 | 3300046642 | Ga0495634_0278345 | Ga0495634_0278345_265_804 | 176 |
| 585 | 3300046660 | Ga0495625_0550984 | Ga0495625_0550984_103_633 | 176 |
| 586 | 3300046663 | Ga0495635_0002038 | Ga0495635_0002038_2264_2815 | 176 |
| 587 | 3300046663 | Ga0495635_0007778 | Ga0495635_0007778_5279_5809 | 176 |
| 588 | 3300046674 | Ga0495588_0010612 | Ga0495588_0010612_1274_1825 | 176 |
| 589 | 3300046675 | Ga0495657_0004913 | Ga0495657_0004913_7819_8349 | 176 |
| 590 | 3300046675 | Ga0495657_0350970 | Ga0495657_0350970_18_551 | 176 |
| 591 | 3300046675 | Ga0495657_0661098 | Ga0495657_0661098_45_581 | 176 |
| 592 | 3300046678 | Ga0495599_0010423 | Ga0495599_0010423_954_1484 | 176 |
| 593 | 3300046679 | Ga0495623_0011237 | Ga0495623_0011237_3947_4477 | 176 |
| 594 | 3300046680 | Ga0495646_0007134 | Ga0495646_0007134_6059_6589 | 176 |
| 595 | 3300046680 | Ga0495646_0049702 | Ga0495646_0049702_1733_2284 | 176 |
| 596 | 3300046681 | Ga0495647_0002474 | Ga0495647_0002474_4898_5449 | 176 |
| 597 | 3300046683 | Ga0495658_0004429 | Ga0495658_0004429_3539_4090 | 176 |
| 598 | 3300046683 | Ga0495658_0449462 | Ga0495658_0449462_201_740 | 176 |
| 599 | 3300046684 | Ga0495669_0026349 | Ga0495669_0026349_242_775 | 176 |
| 600 | 3300046684 | Ga0495669_0097292 | Ga0495669_0097292_211_813 | 176 |
| 601 | 3300046684 | Ga0495669_0117820 | Ga0495669_0117820_697_1230 | 176 |
| 602 | 3300046689 | Ga0495613_0003702 | Ga0495613_0003702_2252_2803 | 176 |
| 603 | 3300046690 | Ga0495624_0000795 | Ga0495624_0000795_3906_4457 | 176 |
| 604 | 3300046691 | Ga0495670_0017082 | Ga0495670_0017082_186_785 | 176 |
| 605 | 3300046691 | Ga0495670_0530277 | Ga0495670_0530277_44_577 | 176 |
| 606 | 3300046692 | Ga0495671_0141140 | Ga0495671_0141140_64_594 | 176 |
| 607 | 3300046809 | Ga0495600_0004657 | Ga0495600_0004657_2929_3459 | 176 |
| 608 | 3300047315 | Ga0495581_0000030 | Ga0495581_0000030_32408_32959 | 176 |
| 609 | 3300047315 | Ga0495581_0076482 | Ga0495581_0076482_416_955 | 176 |
| 610 | 3300047315 | Ga0495581_0076953 | Ga0495581_0076953_856_1389 | 176 |
| 611 | 3300047315 | Ga0495581_0638923 | Ga0495581_0638923_32_574 | 176 |
| 612 | 3300047317 | Ga0495604_0002900 | Ga0495604_0002900_8416_8946 | 176 |
| 613 | 3300047317 | Ga0495604_0263011 | Ga0495604_0263011_382_933 | 176 |
| 614 | 3300047319 | Ga0495674_0001230 | Ga0495674_0001230_9481_10032 | 176 |
| 615 | 3300047320 | Ga0495672_0047254 | Ga0495672_0047254_60_611 | 176 |
| 616 | 3300047321 | Ga0495676_0017129 | Ga0495676_0017129_2547_3098 | 176 |
| 617 | 3300047322 | Ga0495680_0027947 | Ga0495680_0027947_3579_4109 | 176 |
| 618 | 3300047444 | Ga0495675_0019998 | Ga0495675_0019998_2771_3301 | 176 |
| 619 | 3300047447 | Ga0495685_048884 | Ga0495685_048884_825_1355 | 176 |
| 620 | 3300047469 | Ga0495673_0033929 | Ga0495673_0033929_1602_2135 | 176 |
| 621 | 3300047469 | Ga0495673_0102910 | Ga0495673_0102910_98_628 | 176 |
| 622 | 3300047471 | Ga0495684_0005221 | Ga0495684_0005221_8220_8750 | 176 |
| 623 | 3300047471 | Ga0495684_0043185 | Ga0495684_0043185_2078_2629 | 176 |
| 624 | 3300047472 | Ga0495686_0074493 | Ga0495686_0074493_781_1317 | 176 |
| 625 | 3300047673 | Ga0495593_0000470 | Ga0495593_0000470_5835_6386 | 176 |
| 626 | 3300047673 | Ga0495593_0002684 | Ga0495593_0002684_784_1314 | 176 |
| 627 | 3300048088 | Ga0495602_0024305 | Ga0495602_0024305_4162_4692 | 176 |
| 628 | 3300048089 | Ga0495614_0022266 | Ga0495614_0022266_1009_1560 | 176 |
| 629 | 3300048090 | Ga0495615_0147762 | Ga0495615_0147762_43_573 | 176 |
| 630 | 3300048903 | Ga0496100_0011102 | Ga0496100_0011102_4350_4892 | 176 |
| 631 | 3300048903 | Ga0496100_0045464 | Ga0496100_0045464_1577_2119 | 176 |
| 632 | 3300048903 | Ga0496100_0835453 | Ga0496100_0835453_67_597 | 176 |
| 633 | 3300048904 | Ga0496101_0007163 | Ga0496101_0007163_160_702 | 176 |
| 634 | 3300048904 | Ga0496101_0213659 | Ga0496101_0213659_592_1122 | 176 |
| 635 | 3300048904 | Ga0496101_0268680 | Ga0496101_0268680_351_881 | 176 |
| 636 | 3300048904 | Ga0496101_0364407 | Ga0496101_0364407_392_934 | 176 |
| 637 | 3300048905 | Ga0496102_0222278 | Ga0496102_0222278_255_788 | 176 |
| 638 | 3300048905 | Ga0496102_0260354 | Ga0496102_0260354_12_554 | 176 |
| 639 | 3300048905 | Ga0496102_0372279 | Ga0496102_0372279_116_658 | 176 |
| 640 | 3300048905 | Ga0496102_0552397 | Ga0496102_0552397_267_797 | 176 |
| 641 | 3300048906 | Ga0496103_0448749 | Ga0496103_0448749_287_817 | 176 |
| 642 | 3300048906 | Ga0496103_0459363 | Ga0496103_0459363_100_642 | 176 |
| 643 | 3300048907 | Ga0496104_0022374 | Ga0496104_0022374_2233_2775 | 176 |
| 644 | 3300048907 | Ga0496104_0115657 | Ga0496104_0115657_564_1106 | 176 |
| 645 | 3300048907 | Ga0496104_0828287 | Ga0496104_0828287_187_717 | 176 |
| 646 | 3300048908 | Ga0496105_0027959 | Ga0496105_0027959_297_839 | 176 |
| 647 | 3300048908 | Ga0496105_0125981 | Ga0496105_0125981_808_1341 | 176 |
| 648 | 3300048908 | Ga0496105_0379627 | Ga0496105_0379627_425_958 | 176 |
| 649 | 3300048909 | Ga0496106_0119067 | Ga0496106_0119067_1259_1789 | 176 |
| 650 | 3300048909 | Ga0496106_0131471 | Ga0496106_0131471_564_1097 | 176 |
| 651 | 3300048909 | Ga0496106_0239605 | Ga0496106_0239605_48_578 | 176 |
| 652 | 3300048909 | Ga0496106_0322287 | Ga0496106_0322287_548_1078 | 176 |
| 653 | 3300048909 | Ga0496106_0528178 | Ga0496106_0528178_250_792 | 176 |
| 654 | 3300048910 | Ga0496107_0007455 | Ga0496107_0007455_6589_7131 | 176 |
| 655 | 3300048910 | Ga0496107_0019166 | Ga0496107_0019166_3967_4509 | 176 |
| 656 | 3300048910 | Ga0496107_0046717 | Ga0496107_0046717_1527_2060 | 176 |
| 657 | 3300048910 | Ga0496107_0677466 | Ga0496107_0677466_168_698 | 176 |
| 658 | 3300048911 | Ga0496108_0000927 | Ga0496108_0000927_169_711 | 176 |
| 659 | 3300048911 | Ga0496108_0075422 | Ga0496108_0075422_190_720 | 176 |
| 660 | 3300048911 | Ga0496108_0265614 | Ga0496108_0265614_70_612 | 176 |
| 661 | 3300048911 | Ga0496108_0456112 | Ga0496108_0456112_541_1074 | 176 |
| 662 | 3300048912 | Ga0496109_0053221 | Ga0496109_0053221_2912_3454 | 176 |
| 663 | 3300048912 | Ga0496109_0095265 | Ga0496109_0095265_520_1053 | 176 |
| 664 | 3300048912 | Ga0496109_0108132 | Ga0496109_0108132_238_771 | 176 |
| 665 | 3300048912 | Ga0496109_0528669 | Ga0496109_0528669_243_806 | 176 |
| 666 | 3300048913 | Ga0496110_0017143 | Ga0496110_0017143_5245_5787 | 176 |
| 667 | 3300048913 | Ga0496110_0018413 | Ga0496110_0018413_5144_5686 | 176 |
| 668 | 3300048913 | Ga0496110_0134209 | Ga0496110_0134209_1604_2137 | 176 |
| 669 | 3300048913 | Ga0496110_0248654 | Ga0496110_0248654_17_550 | 176 |
| 670 | 3300048913 | Ga0496110_0444848 | Ga0496110_0444848_43_576 | 176 |
| 671 | 3300048914 | Ga0496111_0023210 | Ga0496111_0023210_760_1302 | 176 |
| 672 | 3300048914 | Ga0496111_0122082 | Ga0496111_0122082_952_1485 | 176 |
| 673 | 3300048914 | Ga0496111_0166487 | Ga0496111_0166487_205_735 | 176 |
| 674 | 3300048914 | Ga0496111_0208434 | Ga0496111_0208434_802_1335 | 176 |
| 675 | 3300048915 | Ga0496112_0004583 | Ga0496112_0004583_32_565 | 176 |
| 676 | 3300048915 | Ga0496112_0039976 | Ga0496112_0039976_143_685 | 176 |
| 677 | 3300048915 | Ga0496112_0146271 | Ga0496112_0146271_1154_1699 | 176 |
| 678 | 3300048915 | Ga0496112_0298540 | Ga0496112_0298540_304_837 | 176 |
| 679 | 3300048915 | Ga0496112_0960033 | Ga0496112_0960033_22_555 | 176 |
| 680 | 3300048916 | Ga0496113_0007783 | Ga0496113_0007783_5229_5771 | 176 |
| 681 | 3300048916 | Ga0496113_0215444 | Ga0496113_0215444_594_1136 | 176 |
| 682 | 3300048916 | Ga0496113_0244403 | Ga0496113_0244403_24_557 | 176 |
| 683 | 3300048916 | Ga0496113_0673005 | Ga0496113_0673005_141_671 | 176 |
| 684 | 3300048916 | Ga0496113_0893946 | Ga0496113_0893946_27_566 | 176 |
| 685 | 3300048917 | Ga0496114_0096307 | Ga0496114_0096307_1195_1728 | 176 |
| 686 | 3300048917 | Ga0496114_0107180 | Ga0496114_0107180_178_708 | 176 |
| 687 | 3300048917 | Ga0496114_0382569 | Ga0496114_0382569_488_1087 | 176 |
| 688 | 3300048918 | Ga0496115_0003360 | Ga0496115_0003360_781_1323 | 176 |
| 689 | 3300048918 | Ga0496115_0044258 | Ga0496115_0044258_2115_2648 | 176 |
| 690 | 3300048918 | Ga0496115_0221729 | Ga0496115_0221729_847_1380 | 176 |
| 691 | 3300048918 | Ga0496115_0316381 | Ga0496115_0316381_503_1036 | 176 |
| 692 | 3300048918 | Ga0496115_0671389 | Ga0496115_0671389_152_682 | 176 |
| 693 | 3300048922 | Ga0496119_0073501 | Ga0496119_0073501_1082_1615 | 176 |
| 694 | 3300048922 | Ga0496119_0079090 | Ga0496119_0079090_314_850 | 176 |
| 695 | 3300048924 | Ga0496121_0000278 | Ga0496121_0000278_38024_38635 | 176 |
| 696 | 3300048924 | Ga0496121_0054019 | Ga0496121_0054019_1294_1827 | 176 |
| 697 | 3300048924 | Ga0496121_0153536 | Ga0496121_0153536_292_822 | 176 |
| 698 | 3300048924 | Ga0496121_0242695 | Ga0496121_0242695_208_753 | 176 |
| 699 | 3300048924 | Ga0496121_0312171 | Ga0496121_0312171_313_843 | 176 |
| 700 | 3300048924 | Ga0496121_0571402 | Ga0496121_0571402_31_630 | 176 |
| 701 | 3300048927 | Ga0496124_0161433 | Ga0496124_0161433_514_1044 | 176 |
| 702 | 3300048928 | Ga0496125_0489269 | Ga0496125_0489269_69_599 | 176 |
| 703 | 3300048929 | Ga0496126_0006001 | Ga0496126_0006001_5292_5822 | 176 |
| 704 | 3300048929 | Ga0496126_0013876 | Ga0496126_0013876_3052_3597 | 176 |
| 705 | 3300048929 | Ga0496126_0026105 | Ga0496126_0026105_892_1422 | 176 |
| 706 | 3300048929 | Ga0496126_0064657 | Ga0496126_0064657_2068_2601 | 176 |
| 707 | 3300048929 | Ga0496126_0150631 | Ga0496126_0150631_728_1264 | 176 |
| 708 | 3300048929 | Ga0496126_0176929 | Ga0496126_0176929_579_1109 | 176 |
| 709 | 3300048929 | Ga0496126_0178961 | Ga0496126_0178961_542_1075 | 176 |
| 710 | 3300048929 | Ga0496126_0413044 | Ga0496126_0413044_479_1009 | 176 |
| 711 | 3300048929 | Ga0496126_0527297 | Ga0496126_0527297_204_734 | 176 |
| 712 | 3300048929 | Ga0496126_0654778 | Ga0496126_0654778_44_574 | 176 |
| 713 | 3300048929 | Ga0496126_0731711 | Ga0496126_0731711_163_708 | 176 |
| 714 | 3300048929 | Ga0496126_1068211 | Ga0496126_1068211_13_546 | 176 |
| 715 | 3300049460 | Ga0495682_0226558 | Ga0495682_0226558_16_546 | 176 |
| 716 | 3300049568 | Ga0501031_0242922 | Ga0501031_0242922_132_662 | 176 |
| 717 | 3300049569 | Ga0501032_0066349 | Ga0501032_0066349_1787_2326 | 176 |
| 718 | 3300049569 | Ga0501032_0067608 | Ga0501032_0067608_20_571 | 176 |
| 719 | 3300049569 | Ga0501032_0228323 | Ga0501032_0228323_429_959 | 176 |
| 720 | 3300049570 | Ga0501033_0047330 | Ga0501033_0047330_145_684 | 176 |
| 721 | 3300049571 | Ga0501034_0098555 | Ga0501034_0098555_2270_2821 | 176 |
| 722 | 3300049571 | Ga0501034_0190783 | Ga0501034_0190783_1320_1859 | 176 |
| 723 | 3300049571 | Ga0501034_0281447 | Ga0501034_0281447_614_1165 | 176 |
| 724 | 3300049571 | Ga0501034_0862002 | Ga0501034_0862002_221_751 | 176 |
| 725 | 3300049571 | Ga0501034_1029229 | Ga0501034_1029229_145_684 | 176 |
| 726 | 3300049571 | Ga0501034_1290183 | Ga0501034_1290183_36_587 | 176 |
| 727 | 3300049572 | Ga0501036_0028417 | Ga0501036_0028417_2299_2850 | 176 |
| 728 | 3300049572 | Ga0501036_0138795 | Ga0501036_0138795_1388_1927 | 176 |
| 729 | 3300049572 | Ga0501036_0154070 | Ga0501036_0154070_143_694 | 176 |
| 730 | 3300049572 | Ga0501036_0930954 | Ga0501036_0930954_103_654 | 176 |
| 731 | 3300049573 | Ga0501037_0101501 | Ga0501037_0101501_899_1450 | 176 |
| 732 | 3300049574 | Ga0501038_0001610 | Ga0501038_0001610_7615_8166 | 176 |
| 733 | 3300049574 | Ga0501038_0102330 | Ga0501038_0102330_951_1481 | 176 |
| 734 | 3300049574 | Ga0501038_0202255 | Ga0501038_0202255_475_1014 | 176 |
| 735 | 3300049575 | Ga0501039_0071309 | Ga0501039_0071309_1736_2266 | 176 |
| 736 | 3300049575 | Ga0501039_0086766 | Ga0501039_0086766_177_728 | 176 |
| 737 | 3300049575 | Ga0501039_0228591 | Ga0501039_0228591_213_764 | 176 |
| 738 | 3300049575 | Ga0501039_0440318 | Ga0501039_0440318_284_814 | 176 |
| 739 | 3300049576 | Ga0501040_0355026 | Ga0501040_0355026_170_709 | 176 |
| 740 | 3300049578 | Ga0501042_0096738 | Ga0501042_0096738_1025_1564 | 176 |
| 741 | 3300049579 | Ga0501043_0030435 | Ga0501043_0030435_3405_3956 | 176 |
| 742 | 3300049579 | Ga0501043_0046321 | Ga0501043_0046321_2084_2635 | 176 |
| 743 | 3300049579 | Ga0501043_0256981 | Ga0501043_0256981_28_558 | 176 |
| 744 | 3300049579 | Ga0501043_0287262 | Ga0501043_0287262_218_748 | 176 |
| 745 | 3300049580 | Ga0501046_0072186 | Ga0501046_0072186_117_656 | 176 |
| 746 | 3300049581 | Ga0501047_0031515 | Ga0501047_0031515_3828_4358 | 176 |
| 747 | 3300049581 | Ga0501047_0098605 | Ga0501047_0098605_1895_2446 | 176 |
| 748 | 3300049581 | Ga0501047_0472745 | Ga0501047_0472745_391_921 | 176 |
| 749 | 3300049581 | Ga0501047_0621439 | Ga0501047_0621439_79_624 | 176 |
| 750 | 3300049583 | Ga0501067_0018457 | Ga0501067_0018457_491_1036 | 176 |
| 751 | 3300049583 | Ga0501067_0043030 | Ga0501067_0043030_1816_2346 | 176 |
| 752 | 3300049584 | Ga0501068_0154274 | Ga0501068_0154274_238_789 | 176 |
| 753 | 3300049584 | Ga0501068_0782468 | Ga0501068_0782468_23_562 | 176 |
| 754 | 3300049585 | Ga0501069_0195420 | Ga0501069_0195420_191_730 | 176 |
| 755 | 3300049586 | Ga0501070_0058568 | Ga0501070_0058568_1896_2435 | 176 |
| 756 | 3300049586 | Ga0501070_0105463 | Ga0501070_0105463_1699_2250 | 176 |
| 757 | 3300049588 | Ga0501072_0122136 | Ga0501072_0122136_1007_1546 | 176 |
| 758 | 3300049589 | Ga0501073_0023122 | Ga0501073_0023122_198_737 | 176 |
| 759 | 3300049589 | Ga0501073_0105242 | Ga0501073_0105242_68_598 | 176 |
| 760 | 3300049589 | Ga0501073_0131464 | Ga0501073_0131464_211_762 | 176 |
| 761 | 3300049590 | Ga0501074_0192633 | Ga0501074_0192633_259_798 | 176 |
| 762 | 3300049590 | Ga0501074_0422208 | Ga0501074_0422208_349_879 | 176 |
| 763 | 3300049592 | Ga0501076_0195023 | Ga0501076_0195023_756_1295 | 176 |
| 764 | 3300049741 | Ga0501079_0034413 | Ga0501079_0034413_3137_3676 | 176 |
| 765 | 3300049741 | Ga0501079_0202434 | Ga0501079_0202434_623_1153 | 176 |
| 766 | 3300049742 | Ga0501080_0083493 | Ga0501080_0083493_2214_2753 | 176 |
| 767 | 3300049742 | Ga0501080_0843041 | Ga0501080_0843041_120_722 | 176 |
| 768 | 3300049822 | Ga0501035_0060571 | Ga0501035_0060571_810_1349 | 176 |
| 769 | 3300049822 | Ga0501035_0206710 | Ga0501035_0206710_69_599 | 176 |
| 770 | 3300049822 | Ga0501035_0503731 | Ga0501035_0503731_115_645 | 176 |
| 771 | 3300049822 | Ga0501035_0770832 | Ga0501035_0770832_118_648 | 176 |
| 772 | 3300049823 | Ga0501044_0012055 | Ga0501044_0012055_599_1150 | 176 |
| 773 | 3300049823 | Ga0501044_0101594 | Ga0501044_0101594_1446_1976 | 176 |
| 774 | 3300049823 | Ga0501044_0505495 | Ga0501044_0505495_316_873 | 176 |
| 775 | 3300049823 | Ga0501044_0725571 | Ga0501044_0725571_223_753 | 176 |
| 776 | 3300049823 | Ga0501044_0796512 | Ga0501044_0796512_215_754 | 176 |
| 777 | 3300049823 | Ga0501044_0957539 | Ga0501044_0957539_68_601 | 176 |
| 778 | 3300049823 | Ga0501044_1065663 | Ga0501044_1065663_45_596 | 176 |
| 779 | 3300049824 | Ga0501045_0362568 | Ga0501045_0362568_529_1068 | 176 |
| 780 | 3300049824 | Ga0501045_0982581 | Ga0501045_0982581_54_605 | 176 |
| 781 | 3300050489 | nmdc:mga03683_61226_c1 | nmdc:mga03683_61226_c1_342_872 | 176 |
| 782 | 3300050490 | nmdc:mga03n38_7962_c1 | nmdc:mga03n38_7962_c1_2899_3429 | 176 |
| 783 | 3300050490 | nmdc:mga03n38_95480_c1 | nmdc:mga03n38_95480_c1_474_1004 | 176 |
| 784 | 3300050491 | nmdc:mga00v17_116481_c1 | nmdc:mga00v17_116481_c1_896_1426 | 176 |
| 785 | 3300050491 | nmdc:mga00v17_201058_c1 | nmdc:mga00v17_201058_c1_600_1130 | 176 |
| 786 | 3300050492 | nmdc:mga0yw44_63003_c1 | nmdc:mga0yw44_63003_c1_411_941 | 176 |
| 787 | 3300050493 | nmdc:mga0k408_233891_c1 | nmdc:mga0k408_233891_c1_187_717 | 176 |
| 788 | 3300050493 | nmdc:mga0k408_269890_c1 | nmdc:mga0k408_269890_c1_211_741 | 176 |
| 789 | 3300050493 | nmdc:mga0k408_85432_c1 | nmdc:mga0k408_85432_c1_372_902 | 176 |
| 790 | 3300050494 | nmdc:mga06z11_15583_c1 | nmdc:mga06z11_15583_c1_2399_2929 | 176 |
| 791 | 3300050494 | nmdc:mga06z11_85331_c1 | nmdc:mga06z11_85331_c1_106_639 | 176 |
| 792 | 3300050495 | nmdc:mga04h51_116248_c1 | nmdc:mga04h51_116248_c1_57_587 | 176 |
| 793 | 3300050496 | nmdc:mga07m45_104203_c1 | nmdc:mga07m45_104203_c1_367_897 | 176 |
| 794 | 3300050496 | nmdc:mga07m45_313946_c1 | nmdc:mga07m45_313946_c1_355_885 | 176 |
| 795 | 3300050507 | nmdc:mga05p37_73784_c1 | nmdc:mga05p37_73784_c1_792_1406 | 176 |
| 796 | 3300050515 | nmdc:mga0a205_1205897_c1 | nmdc:mga0a205_1205897_c1_47_577 | 176 |
| 797 | 3300050516 | nmdc:mga0sz30_7031_c1 | nmdc:mga0sz30_7031_c1_913_1527 | 176 |
| 798 | 3300053077 | Ga0495601_0211795 | Ga0495601_0211795_652_1203 | 176 |
| 799 | 3300053077 | Ga0495601_0255016 | Ga0495601_0255016_555_1085 | 176 |
| 800 | 3300053078 | Ga0495612_0049565 | Ga0495612_0049565_354_887 | 176 |
| 801 | 3300053084 | Ga0495595_0001339 | Ga0495595_0001339_1733_2263 | 176 |
| 802 | 3300053085 | Ga0495619_0005596 | Ga0495619_0005596_4362_4892 | 176 |
| 803 | 3300053091 | Ga0500647_0014493 | Ga0500647_0014493_2305_2835 | 176 |
| 804 | 3300053091 | Ga0500647_0183660 | Ga0500647_0183660_164_706 | 176 |
| 805 | 3300053094 | Ga0500566_0003437 | Ga0500566_0003437_3183_3713 | 176 |
| 806 | 3300053094 | Ga0500566_0015200 | Ga0500566_0015200_587_1129 | 176 |
| 807 | 3300053102 | Ga0500554_006966 | Ga0500554_006966_584_1126 | 176 |
| 808 | 3300053102 | Ga0500554_007220 | Ga0500554_007220_186_737 | 176 |
| 809 | 3300053111 | Ga0500572_086015 | Ga0500572_086015_394_924 | 176 |
| 810 | 3300053119 | Ga0500595_001016 | Ga0500595_001016_4543_5085 | 176 |
| 811 | 3300053119 | Ga0500595_006629 | Ga0500595_006629_787_1326 | 176 |
| 812 | 3300053119 | Ga0500595_117096 | Ga0500595_117096_10_546 | 176 |
| 813 | 3300053139 | Ga0500568_0016453 | Ga0500568_0016453_854_1507 | 176 |
| 814 | 3300053147 | Ga0500589_143328 | Ga0500589_143328_237_767 | 176 |
| 815 | 3300053148 | Ga0500590_025848 | Ga0500590_025848_2334_2864 | 176 |
| 816 | 3300053150 | Ga0500603_000630 | Ga0500603_000630_7078_7629 | 176 |
| 817 | 3300053159 | Ga0500630_091455 | Ga0500630_091455_680_1210 | 176 |
| 818 | 3300053162 | Ga0500638_000160 | Ga0500638_000160_6511_7053 | 176 |
| 819 | 3300053163 | Ga0500639_026342 | Ga0500639_026342_1450_1980 | 176 |
| 820 | 3300053178 | Ga0500637_0000180 | Ga0500637_0000180_21400_21942 | 176 |
| 821 | 3300053735 | Ga0500596_001070 | Ga0500596_001070_3223_3753 | 176 |
| 822 | 3300054114 | Ga0501084_0086802 | Ga0501084_0086802_708_1247 | 176 |
| 823 | 3300055283 | Ga0500661_010018 | Ga0500661_010018_740_1282 | 176 |
| 824 | 3300060353 | Ga0501082_0146982 | Ga0501082_0146982_89_628 | 176 |
| 825 | 3300061734 | Ga0530510_0494819 | Ga0530510_0494819_240_770 | 176 |
| 826 | iso_pu_bacteria | 2791355197 | 2793072720 | 176 |
| 827 | iso_pu_bacteria | 2791355199 | 2793078314 | 176 |
| 828 | iso_pu_bacteria | 2922425934 | 2922434020 | 176 |
| 829 | iso_pu_bacteria | 8019555841 | 8019562642 | 176 |
| 830 | iso_pu_bacteria | 8019565922 | 8019572721 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dwn-assembly2.cif.gz_C | crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = | 0.9938 | 4 | 174 |
| 1yr0-assembly2.cif.gz_D | crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens | 0.9825 | 3 | 166 |
| 4j3g-assembly2.cif.gz_C | crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis | 0.9779 | 5 | 166 |
| 1yr0-assembly2.cif.gz_D | crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens | 0.9766 | 3 | 166 |
| 4jxr-assembly1.cif.gz_B | crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa | 0.9753 | 2 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dwmA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9918 | 4 | 174 | 3.40.630.30 |
| 4mbuB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9803 | 5 | 167 | 3.40.630.30 |
| 4mbuB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9744 | 5 | 167 | 3.40.630.30 |
| 6m7gE00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9641 | 4 | 170 | 3.40.630.30 |
| 5dwmA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9583 | 4 | 174 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523F9T1-F1-model_v4 | N-acetyltransferase family protein | 0.9978 | 4 | 115 |
GO:0016747
|
| AF-A0A537T1M5-F1-model_v4 | N-acetyltransferase family protein | 0.9958 | 66 | 174 |
GO:0016747
|
| AF-A0A7W4PBU3-F1-model_v4 | N-acetyltransferase | 0.9945 | 4 | 176 |
GO:0016747
|
| AF-A0A244EGG1-F1-model_v4 | GCN5 family acetyltransferase | 0.9933 | 4 | 175 |
GO:0016747
|
| AF-A0A192IM53-F1-model_v4 | deleted | 0.9929 | 2 | 165 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar