F482652

General Info

Members Datasets Scaffolds Average Seq Length
830 328 1660 111

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10967440|Ga0157378_109674402
Length 126
Sequence MSHLDNQDEYWQSAAVDKPTTDVIQGTLDLMILKTLSLEPMHGFGIQRRVEQISQGVFKVNPGSLLVALQRLERAGLVDAEWRQTPNARRARIYTLTRGGRKQLEFETSDWARRASAIARLLKAEA

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
189 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 1.45
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 29.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10967440 3300013297 Unclassified 884
2 JGI24746J21847_1006893 3300001977 Unclassified 1747
3 Ga0058863_11853956 3300004799 Bacteria 1483
4 Ga0065707_10606132 3300005295 Unclassified 687
5 Ga0070658_10235194 3300005327 Bacteria 1552
6 Ga0070658_10322461 3300005327 Bacteria 1319
7 Ga0070658_10728489 3300005327 Unclassified 861
8 Ga0070676_11431750 3300005328 Unclassified 531
9 Ga0070683_100025323 3300005329 Bacteria 5327
10 Ga0070683_100093319 3300005329 Bacteria 2828
11 Ga0070683_100143306 3300005329 Bacteria 2264
12 Ga0070690_100558148 3300005330 Unclassified 864
13 Ga0070690_100676377 3300005330 Bacteria 790
14 Ga0070670_100017262 3300005331 Bacteria 6190
15 Ga0070670_100031909 3300005331 Bacteria 4536
16 Ga0070670_100358342 3300005331 Bacteria 1282
17 Ga0070670_100359526 3300005331 Bacteria 1280
18 Ga0070670_100609741 3300005331 Bacteria 977
19 Ga0070670_101378872 3300005331 Unclassified 646
20 Ga0070677_10017111 3300005333 Bacteria 2590
21 Ga0068869_100010142 3300005334 Bacteria 6131
22 Ga0068869_100419313 3300005334 Bacteria 1104
23 Ga0068869_102088053 3300005334 Unclassified 509
24 Ga0070666_10067407 3300005335 Bacteria 2430
25 Ga0070680_100052362 3300005336 Bacteria 3332
26 Ga0070680_100065863 3300005336 Unclassified 2969
27 Ga0070680_100221513 3300005336 Unclassified 1597
28 Ga0070680_100334049 3300005336 Unclassified 1287
29 Ga0070680_101480069 3300005336 Unclassified 588
30 Ga0070682_100016274 3300005337 Bacteria 4322
31 Ga0068868_100125331 3300005338 Unclassified 2098
32 Ga0068868_101485312 3300005338 Bacteria 634
33 Ga0068868_101928179 3300005338 Bacteria 560
34 Ga0070660_100091812 3300005339 Bacteria 2396
35 Ga0070660_100215825 3300005339 Bacteria 1558
36 Ga0070660_100377768 3300005339 Unclassified 1170
37 Ga0070660_101221115 3300005339 Bacteria 637
38 Ga0070660_101888566 3300005339 Unclassified 509
39 Ga0070689_100046598 3300005340 Unclassified 3342
40 Ga0070689_100144351 3300005340 Bacteria 1916
41 Ga0070689_100163831 3300005340 Bacteria 1799
42 Ga0070691_10284657 3300005341 Unclassified 898
43 Ga0070687_100639446 3300005343 Unclassified 736
44 Ga0070687_101545940 3300005343 Unclassified 500
45 Ga0070661_100012770 3300005344 Bacteria 5880
46 Ga0070661_100227684 3300005344 Bacteria 1432
47 Ga0070661_100422010 3300005344 Bacteria 1057
48 Ga0070661_100530501 3300005344 Unclassified 945
49 Ga0070661_101910705 3300005344 Bacteria 505
50 Ga0070692_10041101 3300005345 Bacteria 2367
51 Ga0070692_10592648 3300005345 Unclassified 732
52 Ga0070668_100061927 3300005347 Bacteria 2899
53 Ga0070668_100131163 3300005347 Bacteria 2012
54 Ga0070669_100140292 3300005353 Bacteria 1863
55 Ga0070669_100211913 3300005353 Unclassified 1529
56 Ga0070669_100251255 3300005353 Unclassified 1408
57 Ga0070669_100305296 3300005353 Bacteria 1281
58 Ga0070669_100551600 3300005353 Unclassified 961
59 Ga0070669_101151551 3300005353 Unclassified 669
60 Ga0070669_101448279 3300005353 Bacteria 596
61 Ga0070669_102037520 3300005353 Unclassified 502
62 Ga0070675_100005154 3300005354 Bacteria 9969
63 Ga0070675_100009758 3300005354 Bacteria 7476
64 Ga0070675_100016942 3300005354 Bacteria 5787
65 Ga0070675_100136007 3300005354 Bacteria 2097
66 Ga0070675_100416199 3300005354 Bacteria 1201
67 Ga0070675_100536201 3300005354 Bacteria 1057
68 Ga0070675_101086249 3300005354 Bacteria 735
69 Ga0070675_101147217 3300005354 Bacteria 715
70 Ga0070675_101228976 3300005354 Bacteria 690
71 Ga0070671_100090354 3300005355 Unclassified 2564
72 Ga0070671_101160640 3300005355 Bacteria 679
73 Ga0070671_101588152 3300005355 Bacteria 580
74 Ga0070674_100140610 3300005356 Bacteria 1811
75 Ga0070674_100260198 3300005356 Unclassified 1367
76 Ga0070674_101349140 3300005356 Unclassified 637
77 Ga0070673_100285115 3300005364 Bacteria 1450
78 Ga0070673_100294538 3300005364 Bacteria 1427
79 Ga0070673_101827617 3300005364 Unclassified 576
80 Ga0070673_102332652 3300005364 Unclassified 509
81 Ga0070688_100197369 3300005365 Bacteria 1406
82 Ga0070659_100013308 3300005366 Bacteria 6120
83 Ga0070659_100170752 3300005366 Bacteria 1781
84 Ga0070659_101695517 3300005366 Bacteria 565
85 Ga0070667_101529269 3300005367 Unclassified 627
86 Ga0070667_101702272 3300005367 Unclassified 593
87 Ga0070667_102297602 3300005367 Unclassified 508
88 Ga0070709_10814436 3300005434 Bacteria 734
89 Ga0070714_100009319 3300005435 Bacteria 7713
90 Ga0070714_101534946 3300005435 Unclassified 651
91 Ga0070701_10581445 3300005438 Unclassified 739
92 Ga0070701_10977628 3300005438 Unclassified 589
93 Ga0070705_100351479 3300005440 Bacteria 1075
94 Ga0070700_100080212 3300005441 Bacteria 2105
95 Ga0070700_100695201 3300005441 Bacteria 808
96 Ga0070694_100316044 3300005444 Bacteria 1201
97 Ga0070694_100316964 3300005444 Bacteria 1199
98 Ga0070694_100514099 3300005444 Bacteria 954
99 Ga0070708_100117344 3300005445 Bacteria 2451
100 Ga0070708_100487278 3300005445 Unclassified 1163
101 Ga0070663_100003818 3300005455 Bacteria 8770
102 Ga0070663_101951461 3300005455 Bacteria 528
103 Ga0070678_100449817 3300005456 Unclassified 1128
104 Ga0070678_100528187 3300005456 Bacteria 1045
105 Ga0070662_100193852 3300005457 Unclassified 1609
106 Ga0070662_101122988 3300005457 Bacteria 675
107 Ga0070681_10048151 3300005458 Bacteria 4260
108 Ga0070681_10050155 3300005458 Bacteria 4165
109 Ga0070681_10095852 3300005458 Bacteria 2916
110 Ga0070681_10573763 3300005458 Unclassified 1042
111 Ga0070681_10584440 3300005458 Unclassified 1031
112 Ga0070681_10637791 3300005458 Unclassified 980
113 Ga0068867_100771120 3300005459 Bacteria 855
114 Ga0068867_100816839 3300005459 Bacteria 833
115 Ga0068867_100824406 3300005459 Unclassified 829
116 Ga0068867_101135309 3300005459 Bacteria 715
117 Ga0070685_10893321 3300005466 Unclassified 661
118 Ga0070706_100211143 3300005467 Bacteria 1813
119 Ga0070706_101000584 3300005467 Unclassified 771
120 Ga0070707_100252650 3300005468 Bacteria 1716
121 Ga0070698_100088835 3300005471 Bacteria 3075
122 Ga0070698_100163536 3300005471 Bacteria 2169
123 Ga0070698_100292531 3300005471 Bacteria 1560
124 Ga0070698_100451825 3300005471 Bacteria 1221
125 Ga0070698_100951725 3300005471 Bacteria 805
126 Ga0070698_101504239 3300005471 Bacteria 624
127 Ga0070699_100153774 3300005518 Bacteria 2036
128 Ga0070699_100158162 3300005518 Bacteria 2005
129 Ga0070699_100735051 3300005518 Unclassified 902
130 Ga0070699_100960918 3300005518 Bacteria 783
131 Ga0070699_101442546 3300005518 Unclassified 631
132 Ga0070679_100066408 3300005530 Bacteria 3595
133 Ga0070679_100129689 3300005530 Unclassified 2503
134 Ga0070684_100010116 3300005535 Bacteria 7459
135 Ga0070684_100017539 3300005535 Bacteria 5879
136 Ga0070684_100026705 3300005535 Bacteria 4867
137 Ga0070684_100130870 3300005535 Bacteria 2263
138 Ga0070684_100136455 3300005535 Unclassified 2216
139 Ga0070684_100680037 3300005535 Bacteria 959
140 Ga0070684_101885171 3300005535 Unclassified 564
141 Ga0070697_100557600 3300005536 Bacteria 1005
142 Ga0068853_100030839 3300005539 Bacteria 4530
143 Ga0068853_100039111 3300005539 Bacteria 4044
144 Ga0070672_100284158 3300005543 Bacteria 1400
145 Ga0070672_100602696 3300005543 Unclassified 957
146 Ga0070672_100603897 3300005543 Unclassified 956
147 Ga0070672_100677889 3300005543 Bacteria 902
148 Ga0070686_100000801 3300005544 Bacteria 18192
149 Ga0070686_100379273 3300005544 Bacteria 1070
150 Ga0070686_100565981 3300005544 Bacteria 891
151 Ga0070686_101191699 3300005544 Unclassified 632
152 Ga0070695_100088694 3300005545 Unclassified 2060
153 Ga0070695_100413248 3300005545 Bacteria 1026
154 Ga0070696_100558379 3300005546 Bacteria 918
155 Ga0070693_100010447 3300005547 Bacteria 4652
156 Ga0070693_101120103 3300005547 Unclassified 601
157 Ga0070693_101505404 3300005547 Bacteria 526
158 Ga0070665_100347525 3300005548 Bacteria 1488
159 Ga0070665_100751376 3300005548 Unclassified 988
160 Ga0070665_100775807 3300005548 Bacteria 971
161 Ga0070704_100058433 3300005549 Bacteria 2747
162 Ga0070704_100199218 3300005549 Unclassified 1615
163 Ga0070704_102014048 3300005549 Bacteria 536
164 Ga0070704_102230930 3300005549 Bacteria 509
165 Ga0068855_100027282 3300005563 Bacteria 6833
166 Ga0068855_100110476 3300005563 Bacteria 3156
167 Ga0068855_100155127 3300005563 Bacteria 2602
168 Ga0068855_100959541 3300005563 Unclassified 900
169 Ga0068855_101021008 3300005563 Unclassified 868
170 Ga0068855_101066176 3300005563 Unclassified 846
171 Ga0070664_100022141 3300005564 Bacteria 5242
172 Ga0070664_100052838 3300005564 Unclassified 3442
173 Ga0070664_100252419 3300005564 Bacteria 1586
174 Ga0070664_100386554 3300005564 Bacteria 1278
175 Ga0070664_100847924 3300005564 Bacteria 855
176 Ga0068857_100023211 3300005577 Bacteria 5459
177 Ga0068857_100132709 3300005577 Bacteria 2247
178 Ga0068857_100916398 3300005577 Unclassified 841
179 Ga0068854_100034484 3300005578 Bacteria 3536
180 Ga0068854_100713902 3300005578 Bacteria 866
181 Ga0068856_100026619 3300005614 Bacteria 5639
182 Ga0068856_100153711 3300005614 Bacteria 2311
183 Ga0068856_100286669 3300005614 Bacteria 1664
184 Ga0068856_100392728 3300005614 Unclassified 1407
185 Ga0070702_100013796 3300005615 Bacteria 4087
186 Ga0070702_100934983 3300005615 Bacteria 681
187 Ga0068852_100056491 3300005616 Unclassified 3393
188 Ga0068852_100103105 3300005616 Bacteria 2579
189 Ga0068852_100437741 3300005616 Unclassified 1292
190 Ga0068852_100602467 3300005616 Unclassified 1103
191 Ga0068852_101134690 3300005616 Unclassified 802
192 Ga0068852_102519753 3300005616 Unclassified 534
193 Ga0068859_100000008 3300005617 Bacteria 383750
194 Ga0068859_100024324 3300005617 Bacteria 6077
195 Ga0068859_100719066 3300005617 Bacteria 1089
196 Ga0068864_100020790 3300005618 Bacteria 5492
197 Ga0068864_100194188 3300005618 Bacteria 1862
198 Ga0068866_10035300 3300005718 Unclassified 2441
199 Ga0068866_10072307 3300005718 Bacteria 1827
200 Ga0068866_10193969 3300005718 Unclassified 1209
201 Ga0068866_10454632 3300005718 Bacteria 838
202 Ga0068861_100096525 3300005719 Unclassified 2343
203 Ga0068861_101122057 3300005719 Bacteria 757
204 Ga0068870_10069894 3300005840 Bacteria 1912
205 Ga0068870_10143338 3300005840 Unclassified 1400
206 Ga0068870_10213033 3300005840 Bacteria 1178
207 Ga0068870_10767158 3300005840 Unclassified 671
208 Ga0068863_100040118 3300005841 Bacteria 4451
209 Ga0068858_100014567 3300005842 Bacteria 7409
210 Ga0068858_100644315 3300005842 Bacteria 1029
211 Ga0068858_101048808 3300005842 Unclassified 800
212 Ga0068858_102351699 3300005842 Bacteria 527
213 Ga0068860_100441529 3300005843 Bacteria 1293
214 Ga0068860_100667450 3300005843 Unclassified 1048
215 Ga0068860_102276660 3300005843 Unclassified 562
216 Ga0068860_102353091 3300005843 Bacteria 553
217 Ga0068862_100030643 3300005844 Bacteria 4534
218 Ga0068862_100075099 3300005844 Unclassified 2923
219 Ga0068862_100080283 3300005844 Unclassified 2828
220 Ga0068862_100417934 3300005844 Bacteria 1258
221 Ga0068862_100418322 3300005844 Bacteria 1257
222 Ga0075368_10039672 3300006042 Bacteria 1847
223 Ga0075363_100365242 3300006048 Bacteria 844
224 Ga0075364_10030296 3300006051 Bacteria 3472
225 Ga0075364_10415313 3300006051 Bacteria 918
226 Ga0070716_100778281 3300006173 Bacteria 739
227 Ga0075367_10010191 3300006178 Bacteria 4928
228 Ga0075366_10053165 3300006195 Bacteria 2406
229 Ga0097621_100036304 3300006237 Bacteria 3943
230 Ga0097621_100051841 3300006237 Unclassified 3340
231 Ga0097621_100083030 3300006237 Bacteria 2669
232 Ga0097621_100448072 3300006237 Bacteria 1162
233 Ga0097621_101190126 3300006237 Bacteria 717
234 Ga0075370_10039490 3300006353 Bacteria 2659
235 Ga0075370_10149954 3300006353 Bacteria 1366
236 Ga0068871_100030152 3300006358 Bacteria 4269
237 Ga0068871_100064683 3300006358 Unclassified 2995
238 Ga0068871_100084921 3300006358 Unclassified 2627
239 Ga0068871_102073402 3300006358 Unclassified 542
240 Ga0075428_100045026 3300006844 Bacteria 4848
241 Ga0075428_100127198 3300006844 Bacteria 2772
242 Ga0075428_100493630 3300006844 Unclassified 1310
243 Ga0075428_100677622 3300006844 Bacteria 1099
244 Ga0075430_100384520 3300006846 Bacteria 1158
245 Ga0075430_101105044 3300006846 Bacteria 653
246 Ga0075430_101348281 3300006846 Unclassified 587
247 Ga0075431_100541808 3300006847 Bacteria 1152
248 Ga0075431_101294221 3300006847 Bacteria 690
249 Ga0075433_10008219 3300006852 Bacteria 8314
250 Ga0075433_10208061 3300006852 Unclassified 1739
251 Ga0075433_10290337 3300006852 Unclassified 1448
252 Ga0075434_100010204 3300006871 Bacteria 8795
253 Ga0075434_100059485 3300006871 Bacteria 3799
254 Ga0075434_100120885 3300006871 Bacteria 2635
255 Ga0075434_100122076 3300006871 Bacteria 2621
256 Ga0075434_101360998 3300006871 Bacteria 720
257 Ga0075429_100143167 3300006880 Bacteria 2093
258 Ga0075429_100204981 3300006880 Bacteria 1728
259 Ga0075429_101249301 3300006880 Bacteria 648
260 Ga0068865_100639699 3300006881 Bacteria 903
261 Ga0068865_100898926 3300006881 Unclassified 770
262 Ga0068865_101602596 3300006881 Bacteria 585
263 Ga0075436_100021339 3300006914 Bacteria 4446
264 Ga0075436_100028027 3300006914 Bacteria 3876
265 Ga0075436_100098496 3300006914 Bacteria 2035
266 Ga0075436_100113531 3300006914 Bacteria 1892
267 Ga0075436_100737855 3300006914 Bacteria 731
268 Ga0097620_100000008 3300006931 Bacteria 383750
269 Ga0097620_100024324 3300006931 Bacteria 6077
270 Ga0097620_100719027 3300006931 Bacteria 1089
271 Ga0075435_100005556 3300007076 Bacteria 8822
272 Ga0075435_100086549 3300007076 Bacteria 2581
273 Ga0075435_100233514 3300007076 Bacteria 1563
274 Ga0075435_100862661 3300007076 Unclassified 789
275 Ga0075435_101042830 3300007076 Unclassified 714
276 Ga0075435_101592122 3300007076 Bacteria 573
277 Ga0105250_10410411 3300009092 Unclassified 602
278 Ga0105240_10040838 3300009093 Bacteria 5928
279 Ga0105240_10096489 3300009093 Bacteria 3603
280 Ga0105240_10220017 3300009093 Unclassified 2213
281 Ga0105240_10237983 3300009093 Unclassified 2112
282 Ga0105240_10507086 3300009093 Bacteria 1341
283 Ga0105240_10881579 3300009093 Unclassified 964
284 Ga0105240_11167403 3300009093 Unclassified 817
285 Ga0111539_10000226 3300009094 Bacteria 67584
286 Ga0111539_10019953 3300009094 Bacteria 8256
287 Ga0111539_10096653 3300009094 Bacteria 3469
288 Ga0111539_10155764 3300009094 Unclassified 2673
289 Ga0111539_10462309 3300009094 Bacteria 1478
290 Ga0111539_10865055 3300009094 Bacteria 1052
291 Ga0111539_10870949 3300009094 Unclassified 1048
292 Ga0111539_10909501 3300009094 Bacteria 1023
293 Ga0111539_10947498 3300009094 Bacteria 1001
294 Ga0111539_13143105 3300009094 Unclassified 533
295 Ga0105245_10020649 3300009098 Bacteria 5775
296 Ga0105245_10043830 3300009098 Unclassified 3992
297 Ga0105245_11285131 3300009098 Unclassified 780
298 Ga0105247_10046414 3300009101 Unclassified 2666
299 Ga0105247_10315295 3300009101 Unclassified 1089
300 Ga0114129_10041935 3300009147 Bacteria 6444
301 Ga0114129_10050163 3300009147 Bacteria 5862
302 Ga0114129_10362420 3300009147 Bacteria 1918
303 Ga0105243_10041471 3300009148 Unclassified 3600
304 Ga0105243_11336949 3300009148 Bacteria 735
305 Ga0105243_11374926 3300009148 Unclassified 726
306 Ga0105241_10010067 3300009174 Bacteria 6942
307 Ga0105241_10109289 3300009174 Bacteria 2211
308 Ga0105241_10218927 3300009174 Bacteria 1599
309 Ga0105242_10017430 3300009176 Bacteria 5598
310 Ga0105242_10033188 3300009176 Bacteria 4132
311 Ga0105242_10084582 3300009176 Unclassified 2658
312 Ga0105242_10140600 3300009176 Bacteria 2094
313 Ga0105242_10482510 3300009176 Unclassified 1175
314 Ga0105242_10786469 3300009176 Bacteria 940
315 Ga0105242_11895284 3300009176 Unclassified 636
316 Ga0105242_12083573 3300009176 Bacteria 611
317 Ga0105248_10008633 3300009177 Bacteria 11192
318 Ga0105248_10041879 3300009177 Bacteria 5135
319 Ga0105248_10252097 3300009177 Unclassified 1987
320 Ga0105248_10405208 3300009177 Bacteria 1536
321 Ga0105248_10935973 3300009177 Bacteria 979
322 Ga0105237_10187068 3300009545 Unclassified 2071
323 Ga0105238_10009721 3300009551 Bacteria 9630
324 Ga0105249_10001911 3300009553 Bacteria 18050
325 Ga0105249_10025426 3300009553 Bacteria 5330
326 Ga0105249_10094080 3300009553 Bacteria 2808
327 Ga0105249_10732491 3300009553 Bacteria 1050
328 Ga0105249_10869234 3300009553 Unclassified 968
329 Ga0105249_11034494 3300009553 Unclassified 890
330 Ga0105249_11090407 3300009553 Bacteria 868
331 Ga0105249_12711682 3300009553 Unclassified 567
332 Ga0099796_10304205 3300010159 Unclassified 676
333 Ga0105239_10037659 3300010375 Bacteria 5300
334 Ga0105239_10173720 3300010375 Bacteria 2410
335 Ga0105246_10010795 3300011119 Bacteria 5662
336 Ga0105246_10121178 3300011119 Bacteria 1938
337 Ga0157373_10006033 3300013100 Bacteria 9057
338 Ga0157373_10048130 3300013100 Bacteria 3040
339 Ga0157371_10061511 3300013102 Archaea 2662
340 Ga0157371_11351161 3300013102 Bacteria 552
341 Ga0157370_10199003 3300013104 Bacteria 1859
342 Ga0157370_10706982 3300013104 Bacteria 920
343 Ga0157369_10080093 3300013105 Bacteria 3497
344 Ga0157369_10152307 3300013105 Bacteria 2444
345 Ga0157369_10188192 3300013105 Bacteria 2170
346 Ga0157369_11149432 3300013105 Unclassified 793
347 Ga0157369_12673751 3300013105 Bacteria 503
348 Ga0157374_10009437 3300013296 Bacteria 8376
349 Ga0157374_12267244 3300013296 Unclassified 570
350 Ga0157378_10188156 3300013297 Unclassified 1945
351 Ga0157378_10559740 3300013297 Bacteria 1150
352 Ga0157378_10560376 3300013297 Bacteria 1149
353 Ga0163162_10332709 3300013306 Bacteria 1651
354 Ga0163162_10428717 3300013306 Bacteria 1454
355 Ga0163162_10786522 3300013306 Bacteria 1069
356 Ga0163162_11965457 3300013306 Bacteria 670
357 Ga0163162_12039985 3300013306 Bacteria 657
358 Ga0157372_10012512 3300013307 Bacteria 9041
359 Ga0157372_10035519 3300013307 Bacteria 5487
360 Ga0157372_10100573 3300013307 Bacteria 3299
361 Ga0157372_10188196 3300013307 Bacteria 2390
362 Ga0157372_10220487 3300013307 Unclassified 2199
363 Ga0157372_10289053 3300013307 Bacteria 1906
364 Ga0157372_11373556 3300013307 Unclassified 815
365 Ga0157372_13344615 3300013307 Bacteria 510
366 Ga0157375_10015405 3300013308 Bacteria 6843
367 Ga0157375_10228984 3300013308 Bacteria 2017
368 Ga0157375_10968146 3300013308 Bacteria 992
369 Ga0157375_11148028 3300013308 Bacteria 910
370 Ga0163163_10111207 3300014325 Unclassified 2768
371 Ga0163163_11049371 3300014325 Unclassified 878
372 Ga0163163_11279616 3300014325 Unclassified 796
373 Ga0157380_10030686 3300014326 Bacteria 4119
374 Ga0157380_10153738 3300014326 Bacteria 1992
375 Ga0157380_10319285 3300014326 Unclassified 1439
376 Ga0157380_10448688 3300014326 Bacteria 1238
377 Ga0157380_10826342 3300014326 Unclassified 946
378 Ga0157380_11877404 3300014326 Unclassified 659
379 Ga0157380_12173600 3300014326 Unclassified 618
380 Ga0157380_13497082 3300014326 Bacteria 503
381 Ga0182008_10041351 3300014497 Unclassified 2299
382 Ga0157377_10000755 3300014745 Bacteria 13387
383 Ga0157377_10148874 3300014745 Bacteria 1445
384 Ga0157377_10440889 3300014745 Bacteria 897
385 Ga0157377_10485344 3300014745 Bacteria 860
386 Ga0157379_10029457 3300014968 Bacteria 4882
387 Ga0157379_10256393 3300014968 Unclassified 1589
388 Ga0157376_10029884 3300014969 Bacteria 4344
389 Ga0157376_10458622 3300014969 Unclassified 1245
390 Ga0157376_12271425 3300014969 Unclassified 582
391 Ga0182007_10174550 3300015262 Unclassified 741
392 Ga0163161_11717738 3300017792 Bacteria 556
393 Ga0206353_11696378 3300020082 Unclassified 1923
394 Ga0213875_10010624 3300021388 Bacteria 4608
395 Ga0207697_10204807 3300025315 Bacteria 868
396 Ga0207656_10112332 3300025321 Unclassified 1260
397 Ga0207642_10016648 3300025899 Bacteria 2775
398 Ga0207642_10162766 3300025899 Bacteria 1200
399 Ga0207680_10685026 3300025903 Bacteria 734
400 Ga0207647_10226922 3300025904 Unclassified 1075
401 Ga0207699_10590779 3300025906 Bacteria 808
402 Ga0207643_10030811 3300025908 Bacteria 2988
403 Ga0207643_10195911 3300025908 Bacteria 1228
404 Ga0207643_10218735 3300025908 Bacteria 1165
405 Ga0207705_10081943 3300025909 Bacteria 2352
406 Ga0207705_10240682 3300025909 Bacteria 1378
407 Ga0207705_10411605 3300025909 Unclassified 1046
408 Ga0207705_10593416 3300025909 Unclassified 861
409 Ga0207705_10817881 3300025909 Bacteria 723
410 Ga0207684_11211619 3300025910 Unclassified 625
411 Ga0207654_10054163 3300025911 Unclassified 2318
412 Ga0207654_10553613 3300025911 Bacteria 817
413 Ga0207707_10021432 3300025912 Bacteria 5649
414 Ga0207707_10857959 3300025912 Bacteria 753
415 Ga0207707_11172448 3300025912 Unclassified 623
416 Ga0207695_10025632 3300025913 Bacteria 6596
417 Ga0207695_10126332 3300025913 Bacteria 2519
418 Ga0207695_10155863 3300025913 Bacteria 2218
419 Ga0207695_10594809 3300025913 Unclassified 987
420 Ga0207695_10991010 3300025913 Unclassified 720
421 Ga0207660_10024077 3300025917 Bacteria 4118
422 Ga0207660_10095275 3300025917 Bacteria 2214
423 Ga0207660_10259446 3300025917 Unclassified 1374
424 Ga0207660_10738583 3300025917 Bacteria 803
425 Ga0207662_10533122 3300025918 Bacteria 812
426 Ga0207662_10733613 3300025918 Bacteria 694
427 Ga0207662_11165264 3300025918 Unclassified 548
428 Ga0207657_10037367 3300025919 Bacteria 4337
429 Ga0207657_10049916 3300025919 Bacteria 3643
430 Ga0207649_10016616 3300025920 Unclassified 4154
431 Ga0207649_10167256 3300025920 Bacteria 1528
432 Ga0207649_10868027 3300025920 Unclassified 706
433 Ga0207649_11543454 3300025920 Bacteria 526
434 Ga0207652_10100716 3300025921 Unclassified 2551
435 Ga0207652_10348524 3300025921 Bacteria 1336
436 Ga0207652_10587896 3300025921 Bacteria 999
437 Ga0207652_10644392 3300025921 Bacteria 948
438 Ga0207681_10017949 3300025923 Bacteria 4450
439 Ga0207681_10098648 3300025923 Unclassified 2102
440 Ga0207681_10292694 3300025923 Bacteria 1286
441 Ga0207681_11354238 3300025923 Unclassified 597
442 Ga0207694_10020136 3300025924 Bacteria 5045
443 Ga0207694_10429837 3300025924 Unclassified 1101
444 Ga0207650_10018660 3300025925 Bacteria 4869
445 Ga0207650_10198963 3300025925 Bacteria 1604
446 Ga0207650_10686617 3300025925 Bacteria 864
447 Ga0207650_10765020 3300025925 Bacteria 818
448 Ga0207650_11628800 3300025925 Unclassified 548
449 Ga0207659_10010450 3300025926 Bacteria 5835
450 Ga0207659_10022832 3300025926 Bacteria 4170
451 Ga0207659_10030208 3300025926 Bacteria 3700
452 Ga0207659_10756628 3300025926 Bacteria 834
453 Ga0207659_10970970 3300025926 Bacteria 731
454 Ga0207659_10995873 3300025926 Bacteria 721
455 Ga0207659_11419239 3300025926 Bacteria 595
456 Ga0207659_11608794 3300025926 Unclassified 554
457 Ga0207659_11701282 3300025926 Unclassified 537
458 Ga0207687_10025339 3300025927 Bacteria 3969
459 Ga0207687_10059132 3300025927 Unclassified 2699
460 Ga0207687_10437962 3300025927 Bacteria 1082
461 Ga0207687_11519041 3300025927 Unclassified 575
462 Ga0207664_10024810 3300025929 Bacteria 4509
463 Ga0207664_10399896 3300025929 Bacteria 1222
464 Ga0207644_10062460 3300025931 Unclassified 2702
465 Ga0207644_10935210 3300025931 Bacteria 727
466 Ga0207690_10017724 3300025932 Bacteria 4354
467 Ga0207706_10080860 3300025933 Unclassified 2857
468 Ga0207706_11007571 3300025933 Bacteria 700
469 Ga0207686_10015199 3300025934 Bacteria 4300
470 Ga0207686_10015294 3300025934 Unclassified 4288
471 Ga0207686_10083103 3300025934 Bacteria 2095
472 Ga0207686_10214733 3300025934 Bacteria 1385
473 Ga0207686_10229653 3300025934 Bacteria 1344
474 Ga0207709_10721860 3300025935 Bacteria 799
475 Ga0207709_11113144 3300025935 Bacteria 649
476 Ga0207670_10038062 3300025936 Bacteria 3139
477 Ga0207670_10042326 3300025936 Bacteria 3001
478 Ga0207670_10160132 3300025936 Bacteria 1679
479 Ga0207670_10525253 3300025936 Unclassified 964
480 Ga0207669_10107790 3300025937 Bacteria 1859
481 Ga0207669_10730945 3300025937 Bacteria 816
482 Ga0207669_11377919 3300025937 Unclassified 600
483 Ga0207669_11555010 3300025937 Unclassified 564
484 Ga0207704_10252820 3300025938 Bacteria 1324
485 Ga0207704_11340366 3300025938 Bacteria 612
486 Ga0207665_10463697 3300025939 Bacteria 974
487 Ga0207665_10540276 3300025939 Unclassified 904
488 Ga0207691_10096280 3300025940 Bacteria 2646
489 Ga0207691_10174497 3300025940 Unclassified 1881
490 Ga0207691_10894906 3300025940 Bacteria 743
491 Ga0207691_11548030 3300025940 Bacteria 541
492 Ga0207711_10020229 3300025941 Bacteria 5546
493 Ga0207689_10008859 3300025942 Bacteria 8735
494 Ga0207661_10046839 3300025944 Unclassified 3429
495 Ga0207661_10351547 3300025944 Bacteria 1330
496 Ga0207661_10399968 3300025944 Bacteria 1245
497 Ga0207661_11057897 3300025944 Bacteria 747
498 Ga0207661_11252381 3300025944 Unclassified 682
499 Ga0207679_10014267 3300025945 Bacteria 5219
500 Ga0207679_10067571 3300025945 Bacteria 2682
501 Ga0207679_10303142 3300025945 Bacteria 1378
502 Ga0207679_10447918 3300025945 Unclassified 1144
503 Ga0207679_11174236 3300025945 Bacteria 704
504 Ga0207667_10077809 3300025949 Unclassified 3438
505 Ga0207667_10159170 3300025949 Bacteria 2323
506 Ga0207667_10267463 3300025949 Bacteria 1748
507 Ga0207667_10344133 3300025949 Bacteria 1521
508 Ga0207667_10388536 3300025949 Bacteria 1421
509 Ga0207667_10569864 3300025949 Bacteria 1144
510 Ga0207667_10819017 3300025949 Unclassified 927
511 Ga0207667_11543707 3300025949 Bacteria 634
512 Ga0207667_11874179 3300025949 Bacteria 562
513 Ga0207651_10246535 3300025960 Bacteria 1459
514 Ga0207651_11975789 3300025960 Unclassified 524
515 Ga0207712_10001179 3300025961 Bacteria 18090
516 Ga0207712_10097146 3300025961 Bacteria 2182
517 Ga0207712_10773190 3300025961 Bacteria 843
518 Ga0207712_11044654 3300025961 Bacteria 726
519 Ga0207640_10204248 3300025981 Bacteria 1500
520 Ga0207640_10230284 3300025981 Bacteria 1425
521 Ga0207658_11428378 3300025986 Unclassified 633
522 Ga0207677_10433324 3300026023 Bacteria 1123
523 Ga0207703_10013366 3300026035 Bacteria 6398
524 Ga0207703_10673975 3300026035 Bacteria 982
525 Ga0207639_10240839 3300026041 Bacteria 1572
526 Ga0207639_10776960 3300026041 Unclassified 892
527 Ga0207678_10003890 3300026067 Bacteria 13427
528 Ga0207678_10026801 3300026067 Bacteria 5027
529 Ga0207678_11069453 3300026067 Bacteria 714
530 Ga0207708_10414204 3300026075 Bacteria 1116
531 Ga0207708_10847405 3300026075 Bacteria 789
532 Ga0207708_11666691 3300026075 Unclassified 560
533 Ga0207702_10070860 3300026078 Unclassified 2999
534 Ga0207702_10758644 3300026078 Bacteria 958
535 Ga0207702_12402465 3300026078 Bacteria 514
536 Ga0207641_10037537 3300026088 Bacteria 4046
537 Ga0207641_10199535 3300026088 Bacteria 1844
538 Ga0207648_10797848 3300026089 Bacteria 879
539 Ga0207648_11020011 3300026089 Unclassified 775
540 Ga0207648_11137282 3300026089 Unclassified 733
541 Ga0207648_11400884 3300026089 Bacteria 657
542 Ga0207676_10019525 3300026095 Bacteria 4946
543 Ga0207676_10178279 3300026095 Bacteria 1858
544 Ga0207674_10000013 3300026116 Bacteria 187953
545 Ga0207674_10266604 3300026116 Bacteria 1660
546 Ga0207674_10417013 3300026116 Bacteria 1297
547 Ga0207675_100044698 3300026118 Bacteria 4140
548 Ga0207675_100273194 3300026118 Unclassified 1641
549 Ga0207675_100889518 3300026118 Unclassified 906
550 Ga0207683_10297550 3300026121 Bacteria 1476
551 Ga0207683_10359818 3300026121 Bacteria 1336
552 Ga0207698_10041379 3300026142 Bacteria 3433
553 Ga0207698_10080502 3300026142 Unclassified 2624
554 Ga0207698_10099505 3300026142 Bacteria 2405
555 Ga0207698_11193879 3300026142 Unclassified 775
556 Ga0207428_10054262 3300027907 Bacteria 3192
557 Ga0207428_10538360 3300027907 Unclassified 845
558 Ga0268266_10275093 3300028379 Bacteria 1564
559 Ga0268266_10371382 3300028379 Bacteria 1347
560 Ga0268265_10307471 3300028380 Bacteria 1430
561 Ga0268265_11040195 3300028380 Unclassified 810
562 Ga0268265_11713233 3300028380 Bacteria 634
563 Ga0268264_10058804 3300028381 Unclassified 3220
564 Ga0268264_10107555 3300028381 Bacteria 2437
565 Ga0268264_10197574 3300028381 Unclassified 1837
566 Ga0265318_10266683 3300028577 Unclassified 625
567 Ga0316182_1248738 3300030745 Bacteria 1236
568 Ga0265770_1033342 3300030878 Bacteria 873
569 Ga0307408_100022218 3300031548 Bacteria 4308
570 Ga0307408_100637908 3300031548 Bacteria 951
571 Ga0307408_100783670 3300031548 Bacteria 864
572 Ga0307408_101071948 3300031548 Unclassified 746
573 Ga0265314_10065391 3300031711 Bacteria 2456
574 Ga0307405_10111846 3300031731 Bacteria 1852
575 Ga0307405_10112204 3300031731 Bacteria 1849
576 Ga0307405_10411620 3300031731 Bacteria 1061
577 Ga0307405_10593304 3300031731 Bacteria 903
578 Ga0307405_11619859 3300031731 Bacteria 572
579 Ga0307405_11793766 3300031731 Bacteria 545
580 Ga0307413_10008357 3300031824 Bacteria 4882
581 Ga0307413_10202902 3300031824 Bacteria 1433
582 Ga0307413_10686904 3300031824 Unclassified 849
583 Ga0307410_10015350 3300031852 Bacteria 4540
584 Ga0307410_10244149 3300031852 Bacteria 1393
585 Ga0307410_10307892 3300031852 Bacteria 1252
586 Ga0307406_10026426 3300031901 Bacteria 3486
587 Ga0307406_10461574 3300031901 Bacteria 1021
588 Ga0307406_10760953 3300031901 Unclassified 814
589 Ga0307406_11185201 3300031901 Bacteria 663
590 Ga0307407_10119019 3300031903 Bacteria 1671
591 Ga0307407_10166290 3300031903 Bacteria 1448
592 Ga0307412_10040717 3300031911 Bacteria 3007
593 Ga0307412_10358081 3300031911 Bacteria 1174
594 Ga0307412_10799447 3300031911 Bacteria 819
595 Ga0307409_100032198 3300031995 Bacteria 3797
596 Ga0307409_100698090 3300031995 Bacteria 1014
597 Ga0307409_100774842 3300031995 Bacteria 965
598 Ga0307416_100011025 3300032002 Bacteria 6004
599 Ga0307416_100073761 3300032002 Bacteria 2847
600 Ga0307416_100153545 3300032002 Bacteria 2116
601 Ga0307416_100157092 3300032002 Bacteria 2096
602 Ga0307416_100168100 3300032002 Bacteria 2037
603 Ga0307416_100513987 3300032002 Bacteria 1264
604 Ga0307416_100521231 3300032002 Bacteria 1257
605 Ga0307416_100591148 3300032002 Unclassified 1188
606 Ga0307416_101478164 3300032002 Unclassified 785
607 Ga0307416_102241528 3300032002 Unclassified 647
608 Ga0307414_10197963 3300032004 Unclassified 1631
609 Ga0307414_11573512 3300032004 Bacteria 612
610 Ga0307411_10003697 3300032005 Bacteria 7165
611 Ga0307411_11352550 3300032005 Unclassified 650
612 Ga0307415_100028993 3300032126 Bacteria 3530
613 Ga0307415_101239777 3300032126 Bacteria 704
614 Ga0373930_0000672 3300034816 Bacteria 4785
615 Ga0373958_0026325 3300034819 Bacteria 1113
616 Ga0373938_0023467 3300034957 Bacteria 1268
617 Ga0373928_0001093 3300035084 Bacteria 5361
618 Ga0373940_0000665 3300035088 Bacteria 5493
619 Ga0373949_0002534 3300035090 Bacteria 4653
620 Ga0373932_0011775 3300035112 Bacteria 2143
621 Ga0373939_0449748 3300035114 Bacteria 542
622 Ga0373941_0002046 3300035115 Bacteria 4370
623 Ga0373941_0358441 3300035115 Bacteria 595
624 Ga0373960_0004415 3300035121 Bacteria 3220
625 Ga0373943_0121890 3300035170 Unclassified 1386
626 Ga0373943_0455864 3300035170 Bacteria 743
627 Ga0373946_0396506 3300035171 Bacteria 696
628 Ga0373955_0974401 3300035172 Bacteria 522
629 Ga0373942_0009270 3300035207 Bacteria 2300
630 Ga0373961_0000625 3300035241 Bacteria 12801
631 Ga0373962_0005239 3300035242 Bacteria 3134
632 Ga0373931_0010443 3300035691 Bacteria 4462
633 Ga0373931_0256162 3300035691 Bacteria 1066
634 Ga0373931_0265791 3300035691 Unclassified 1048
635 Ga0373931_0559936 3300035691 Bacteria 743
636 Ga0373935_0297949 3300035692 Archaea 1139
637 Ga0373935_0586746 3300035692 Bacteria 814
638 Ga0373927_0148858 3300035695 Bacteria 1533
639 Ga0373947_0194930 3300035725 Bacteria 1323
640 Ga0373947_0643049 3300035725 Unclassified 723
641 Ga0373937_0377631 3300036401 Bacteria 1344
642 Ga0373937_0604363 3300036401 Bacteria 1041
643 Ga0373937_1230741 3300036401 Bacteria 697
644 Ga0373925_0001278 3300037068 Bacteria 22200
645 Ga0373925_0154137 3300037068 Bacteria 1806
646 Ga0373925_0393785 3300037068 Bacteria 1129
647 Ga0395905_1727971 3300037471 Unclassified 531
648 Ga0436364_1399086 3300037853 Bacteria 6282
649 Ga0436365_1521767 3300039437 Unclassified 1214
650 Ga0439453_0150278 3300041408 Unclassified 552
651 Ga0451839_1423822 3300041496 Bacteria 618
652 Ga0439456_094028 3300042013 Bacteria 675
653 Ga0439446_0089939 3300042156 Bacteria 960
654 Ga0439434_0229600 3300042435 Bacteria 631
655 Ga0439435_0000768 3300042436 Bacteria 5383
656 Ga0439459_0244165 3300042438 Bacteria 505
657 Ga0439464_0173907 3300042439 Unclassified 680
658 Ga0439460_0045162 3300042461 Unclassified 1306
659 Ga0453683_0273279 3300044673 Unclassified 1079
660 Ga0451576_0015239 3300045051 Bacteria 8523
661 Ga0451576_0024320 3300045051 Bacteria 6543
662 Ga0451576_0432533 3300045051 Bacteria 1381
663 Ga0451576_2099399 3300045051 Bacteria 581
664 Ga0466958_1072880 3300045836 Bacteria 526
665 Ga0466967_0394015 3300045976 Unclassified 1346
666 Ga0466967_1094575 3300045976 Bacteria 794
667 Ga0466967_1634106 3300045976 Unclassified 642
668 Ga0495603_0328244 3300046455 Bacteria 878
669 Ga0495629_0078505 3300046459 Bacteria 2305
670 Ga0495580_0067113 3300046472 Bacteria 2510
671 Ga0495639_0107038 3300046475 Bacteria 1324
672 Ga0495594_0011764 3300046499 Bacteria 4548
673 Ga0495594_0014118 3300046499 Bacteria 4183
674 Ga0495594_0156593 3300046499 Unclassified 1294
675 Ga0495594_0483527 3300046499 Bacteria 704
676 Ga0495628_0217564 3300046516 Bacteria 1436
677 Ga0495666_0289867 3300046526 Bacteria 741
678 Ga0495652_0024226 3300046529 Bacteria 5374
679 Ga0495652_0977046 3300046529 Unclassified 555
680 Ga0495665_0102080 3300046531 Bacteria 1505
681 Ga0495640_0104366 3300046533 Bacteria 1858
682 Ga0495586_0334529 3300046535 Unclassified 869
683 Ga0495645_0901292 3300046543 Bacteria 525
684 Ga0495667_0155503 3300046559 Bacteria 1472
685 Ga0495635_0211346 3300046663 Unclassified 1314
686 Ga0495635_0969517 3300046663 Bacteria 542
687 Ga0495599_0310002 3300046678 Bacteria 952
688 Ga0495658_0932563 3300046683 Unclassified 555
689 Ga0495600_0449429 3300046809 Bacteria 797
690 Ga0495581_0103450 3300047315 Bacteria 1655
691 Ga0495636_0300112 3300047318 Bacteria 751
692 Ga0495636_0384513 3300047318 Bacteria 667
693 Ga0495676_0758510 3300047321 Bacteria 626
694 Ga0495684_0086748 3300047471 Bacteria 2372
695 Ga0495684_0468414 3300047471 Unclassified 872
696 Ga0495684_0768018 3300047471 Unclassified 633
697 Ga0496100_0189535 3300048903 Bacteria 1492
698 Ga0496101_0978391 3300048904 Unclassified 666
699 Ga0496102_0141546 3300048905 Bacteria 2256
700 Ga0496104_0082603 3300048907 Unclassified 3064
701 Ga0496105_0194834 3300048908 Unclassified 1656
702 Ga0496108_0301007 3300048911 Bacteria 1397
703 Ga0496109_1104023 3300048912 Bacteria 730
704 Ga0496110_0282389 3300048913 Unclassified 1512
705 Ga0496110_1068915 3300048913 Bacteria 715
706 Ga0496113_1365306 3300048916 Unclassified 550
707 Ga0496115_0058102 3300048918 Unclassified 3112
708 Ga0496115_0150612 3300048918 Bacteria 1921
709 Ga0501031_0007293 3300049568 Bacteria 7215
710 Ga0501032_0001778 3300049569 Bacteria 17010
711 Ga0501033_0007641 3300049570 Bacteria 8403
712 Ga0501034_0050037 3300049571 Bacteria 4215
713 Ga0501034_1670661 3300049571 Unclassified 509
714 Ga0501036_0013820 3300049572 Bacteria 6713
715 Ga0501036_0151769 3300049572 Bacteria 1954
716 Ga0501036_0441948 3300049572 Bacteria 1084
717 Ga0501037_0005744 3300049573 Bacteria 9057
718 Ga0501038_0003040 3300049574 Bacteria 15641
719 Ga0501038_0505062 3300049574 Bacteria 924
720 Ga0501038_0573706 3300049574 Bacteria 856
721 Ga0501039_0011294 3300049575 Bacteria 6802
722 Ga0501039_0184122 3300049575 Bacteria 1642
723 Ga0501039_0414274 3300049575 Bacteria 1058
724 Ga0501040_0160324 3300049576 Unclassified 1590
725 Ga0501040_0213169 3300049576 Bacteria 1373
726 Ga0501040_0280339 3300049576 Unclassified 1190
727 Ga0501041_0142796 3300049577 Bacteria 1493
728 Ga0501041_0302990 3300049577 Unclassified 1007
729 Ga0501042_0067648 3300049578 Bacteria 2554
730 Ga0501042_0200570 3300049578 Bacteria 1439
731 Ga0501042_0272227 3300049578 Bacteria 1223
732 Ga0501042_0457267 3300049578 Unclassified 926
733 Ga0501043_0002568 3300049579 Bacteria 15354
734 Ga0501043_0633407 3300049579 Bacteria 787
735 Ga0501046_0002656 3300049580 Bacteria 16682
736 Ga0501046_0350612 3300049580 Bacteria 1072
737 Ga0501047_0018469 3300049581 Bacteria 6686
738 Ga0501047_0234356 3300049581 Bacteria 1688
739 Ga0501048_0016488 3300049582 Bacteria 5447
740 Ga0501048_0121370 3300049582 Bacteria 1847
741 Ga0501067_0046677 3300049583 Unclassified 2403
742 Ga0501068_0000234 3300049584 Bacteria 26949
743 Ga0501068_0087570 3300049584 Bacteria 1918
744 Ga0501068_0383725 3300049584 Unclassified 905
745 Ga0501069_0005731 3300049585 Bacteria 6475
746 Ga0501070_0041650 3300049586 Unclassified 3825
747 Ga0501071_0010780 3300049587 Bacteria 6130
748 Ga0501072_0024024 3300049588 Unclassified 4738
749 Ga0501072_0032921 3300049588 Bacteria 4060
750 Ga0501073_0007833 3300049589 Bacteria 7930
751 Ga0501074_0031191 3300049590 Bacteria 3861
752 Ga0501075_0050470 3300049591 Bacteria 3127
753 Ga0501075_0702510 3300049591 Unclassified 770
754 Ga0501075_1010045 3300049591 Unclassified 632
755 Ga0501076_0007646 3300049592 Bacteria 7869
756 Ga0501076_0052981 3300049592 Bacteria 3215
757 Ga0501076_0097397 3300049592 Bacteria 2369
758 Ga0501076_1008182 3300049592 Bacteria 686
759 Ga0501077_0004233 3300049593 Bacteria 8674
760 Ga0501077_0187529 3300049593 Bacteria 1314
761 Ga0501249_066219 3300049679 Bacteria 841
762 Ga0501079_0047628 3300049741 Unclassified 3307
763 Ga0501079_1279128 3300049741 Unclassified 578
764 Ga0501080_0001468 3300049742 Bacteria 19844
765 Ga0501080_0309374 3300049742 Unclassified 1432
766 Ga0501081_0021191 3300049743 Unclassified 4338
767 Ga0501081_0157022 3300049743 Unclassified 1637
768 Ga0501083_0011583 3300049744 Bacteria 6184
769 Ga0501035_0081259 3300049822 Unclassified 2860
770 Ga0501035_0702331 3300049822 Unclassified 816
771 Ga0501044_0024234 3300049823 Bacteria 6447
772 Ga0501045_0110632 3300049824 Bacteria 2037
773 Ga0501045_0809631 3300049824 Bacteria 690
774 Ga0501200_02355 3300049849 Bacteria 773
775 nmdc:mga03n38_297348_c1 3300050490 Bacteria 866
776 nmdc:mga00v17_327325_c1 3300050491 Bacteria 996
777 nmdc:mga00v17_8829_c1 3300050491 Bacteria 5433
778 nmdc:mga0k408_20929_c1 3300050493 Bacteria 3671
779 nmdc:mga06z11_34090_c1 3300050494 Bacteria 2496
780 nmdc:mga04h51_222142_c1 3300050495 Bacteria 749
781 nmdc:mga07m45_190155_c1 3300050496 Bacteria 1194
782 nmdc:mga07m45_34478_c1 3300050496 Bacteria 2813
783 nmdc:mga05p37_286654_c1 3300050507 Bacteria 1961
784 nmdc:mga05p37_599028_c1 3300050507 Unclassified 1244
785 nmdc:mga05p37_609608_c1 3300050507 Bacteria 1231
786 nmdc:mga09592_1086908_c1 3300050508 Bacteria 665
787 nmdc:mga09592_1544507_c1 3300050508 Bacteria 539
788 nmdc:mga09592_282678_c1 3300050508 Bacteria 1439
789 nmdc:mga09592_861893_c1 3300050508 Unclassified 763
790 nmdc:mga0qj67_341367_c1 3300050509 Bacteria 1211
791 nmdc:mga0qj67_736308_c1 3300050509 Unclassified 783
792 nmdc:mga0qj67_737265_c1 3300050509 Bacteria 782
793 nmdc:mga06r32_1712472_c1 3300050510 Unclassified 565
794 nmdc:mga06r32_374917_c1 3300050510 Bacteria 1406
795 nmdc:mga08y16_184796_c1 3300050511 Bacteria 2164
796 nmdc:mga08y16_2169839_c1 3300050511 Unclassified 502
797 nmdc:mga08y16_369291_c1 3300050511 Bacteria 1472
798 nmdc:mga08y16_626511_c1 3300050511 Unclassified 1082
799 nmdc:mga08y16_73_c1 3300050511 Bacteria 84090
800 nmdc:mga08y16_823022_c1 3300050511 Unclassified 920
801 nmdc:mga0n895_160147_c1 3300050512 Bacteria 2282
802 nmdc:mga0n895_1825_c1 3300050512 Bacteria 16226
803 nmdc:mga0n895_3208_c1 3300050512 Bacteria 13091
804 nmdc:mga0n895_92923_c1 3300050512 Bacteria 3020
805 nmdc:mga0rr50_1006104_c1 3300050513 Unclassified 710
806 nmdc:mga0rr50_66503_c1 3300050513 Bacteria 2735
807 nmdc:mga0rr50_795731_c1 3300050513 Unclassified 807
808 nmdc:mga0rr50_804220_c1 3300050513 Bacteria 802
809 nmdc:mga08x19_1081243_c1 3300050514 Bacteria 569
810 nmdc:mga08x19_14882_c1 3300050514 Bacteria 4725
811 nmdc:mga08x19_275033_c1 3300050514 Bacteria 1166
812 nmdc:mga08x19_836913_c1 3300050514 Bacteria 654
813 nmdc:mga0a205_192639_c1 3300050515 Unclassified 1930
814 nmdc:mga0a205_800_c1 3300050515 Bacteria 25510
815 nmdc:mga0sz30_499275_c1 3300050516 Bacteria 547
816 Ga0495601_0119993 3300053077 Bacteria 1707
817 Ga0495601_0275449 3300053077 Bacteria 1097
818 Ga0495601_0395190 3300053077 Bacteria 897
819 Ga0495595_0431059 3300053084 Bacteria 669
820 Ga0495595_0490224 3300053084 Bacteria 626
821 Ga0500582_255046 3300053114 Bacteria 564
822 Ga0501084_0008170 3300054114 Bacteria 8630
823 Ga0501084_0228979 3300054114 Bacteria 1569
824 Ga0501084_0524065 3300054114 Bacteria 1002
825 Ga0501084_0649364 3300054114 Bacteria 891
826 Ga0501084_1771305 3300054114 Bacteria 516
827 Ga0501082_0017846 3300060353 Bacteria 6111
828 Ga0501082_0102192 3300060353 Unclassified 2480
829 Ga0501082_0122882 3300060353 Bacteria 2251
830 Ga0530510_0775428 3300061734 Unclassified 731
831 Ga0157378_10967440
832 JGI24746J21847_1006893
833 Ga0058863_11853956
834 Ga0065707_10606132
835 Ga0070658_10235194
836 Ga0070658_10322461
837 Ga0070658_10728489
838 Ga0070676_11431750
839 Ga0070683_100025323
840 Ga0070683_100093319
841 Ga0070683_100143306
842 Ga0070690_100558148
843 Ga0070690_100676377
844 Ga0070670_100017262
845 Ga0070670_100031909
846 Ga0070670_100358342
847 Ga0070670_100359526
848 Ga0070670_100609741
849 Ga0070670_101378872
850 Ga0070677_10017111
851 Ga0068869_100010142
852 Ga0068869_100419313
853 Ga0068869_102088053
854 Ga0070666_10067407
855 Ga0070680_100052362
856 Ga0070680_100065863
857 Ga0070680_100221513
858 Ga0070680_100334049
859 Ga0070680_101480069
860 Ga0070682_100016274
861 Ga0068868_100125331
862 Ga0068868_101485312
863 Ga0068868_101928179
864 Ga0070660_100091812
865 Ga0070660_100215825
866 Ga0070660_100377768
867 Ga0070660_101221115
868 Ga0070660_101888566
869 Ga0070689_100046598
870 Ga0070689_100144351
871 Ga0070689_100163831
872 Ga0070691_10284657
873 Ga0070687_100639446
874 Ga0070687_101545940
875 Ga0070661_100012770
876 Ga0070661_100227684
877 Ga0070661_100422010
878 Ga0070661_100530501
879 Ga0070661_101910705
880 Ga0070692_10041101
881 Ga0070692_10592648
882 Ga0070668_100061927
883 Ga0070668_100131163
884 Ga0070669_100140292
885 Ga0070669_100211913
886 Ga0070669_100251255
887 Ga0070669_100305296
888 Ga0070669_100551600
889 Ga0070669_101151551
890 Ga0070669_101448279
891 Ga0070669_102037520
892 Ga0070675_100005154
893 Ga0070675_100009758
894 Ga0070675_100016942
895 Ga0070675_100136007
896 Ga0070675_100416199
897 Ga0070675_100536201
898 Ga0070675_101086249
899 Ga0070675_101147217
900 Ga0070675_101228976
901 Ga0070671_100090354
902 Ga0070671_101160640
903 Ga0070671_101588152
904 Ga0070674_100140610
905 Ga0070674_100260198
906 Ga0070674_101349140
907 Ga0070673_100285115
908 Ga0070673_100294538
909 Ga0070673_101827617
910 Ga0070673_102332652
911 Ga0070688_100197369
912 Ga0070659_100013308
913 Ga0070659_100170752
914 Ga0070659_101695517
915 Ga0070667_101529269
916 Ga0070667_101702272
917 Ga0070667_102297602
918 Ga0070709_10814436
919 Ga0070714_100009319
920 Ga0070714_101534946
921 Ga0070701_10581445
922 Ga0070701_10977628
923 Ga0070705_100351479
924 Ga0070700_100080212
925 Ga0070700_100695201
926 Ga0070694_100316044
927 Ga0070694_100316964
928 Ga0070694_100514099
929 Ga0070708_100117344
930 Ga0070708_100487278
931 Ga0070663_100003818
932 Ga0070663_101951461
933 Ga0070678_100449817
934 Ga0070678_100528187
935 Ga0070662_100193852
936 Ga0070662_101122988
937 Ga0070681_10048151
938 Ga0070681_10050155
939 Ga0070681_10095852
940 Ga0070681_10573763
941 Ga0070681_10584440
942 Ga0070681_10637791
943 Ga0068867_100771120
944 Ga0068867_100816839
945 Ga0068867_100824406
946 Ga0068867_101135309
947 Ga0070685_10893321
948 Ga0070706_100211143
949 Ga0070706_101000584
950 Ga0070707_100252650
951 Ga0070698_100088835
952 Ga0070698_100163536
953 Ga0070698_100292531
954 Ga0070698_100451825
955 Ga0070698_100951725
956 Ga0070698_101504239
957 Ga0070699_100153774
958 Ga0070699_100158162
959 Ga0070699_100735051
960 Ga0070699_100960918
961 Ga0070699_101442546
962 Ga0070679_100066408
963 Ga0070679_100129689
964 Ga0070684_100010116
965 Ga0070684_100017539
966 Ga0070684_100026705
967 Ga0070684_100130870
968 Ga0070684_100136455
969 Ga0070684_100680037
970 Ga0070684_101885171
971 Ga0070697_100557600
972 Ga0068853_100030839
973 Ga0068853_100039111
974 Ga0070672_100284158
975 Ga0070672_100602696
976 Ga0070672_100603897
977 Ga0070672_100677889
978 Ga0070686_100000801
979 Ga0070686_100379273
980 Ga0070686_100565981
981 Ga0070686_101191699
982 Ga0070695_100088694
983 Ga0070695_100413248
984 Ga0070696_100558379
985 Ga0070693_100010447
986 Ga0070693_101120103
987 Ga0070693_101505404
988 Ga0070665_100347525
989 Ga0070665_100751376
990 Ga0070665_100775807
991 Ga0070704_100058433
992 Ga0070704_100199218
993 Ga0070704_102014048
994 Ga0070704_102230930
995 Ga0068855_100027282
996 Ga0068855_100110476
997 Ga0068855_100155127
998 Ga0068855_100959541
999 Ga0068855_101021008
1000 Ga0068855_101066176
1001 Ga0070664_100022141
1002 Ga0070664_100052838
1003 Ga0070664_100252419
1004 Ga0070664_100386554
1005 Ga0070664_100847924
1006 Ga0068857_100023211
1007 Ga0068857_100132709
1008 Ga0068857_100916398
1009 Ga0068854_100034484
1010 Ga0068854_100713902
1011 Ga0068856_100026619
1012 Ga0068856_100153711
1013 Ga0068856_100286669
1014 Ga0068856_100392728
1015 Ga0070702_100013796
1016 Ga0070702_100934983
1017 Ga0068852_100056491
1018 Ga0068852_100103105
1019 Ga0068852_100437741
1020 Ga0068852_100602467
1021 Ga0068852_101134690
1022 Ga0068852_102519753
1023 Ga0068859_100000008
1024 Ga0068859_100024324
1025 Ga0068859_100719066
1026 Ga0068864_100020790
1027 Ga0068864_100194188
1028 Ga0068866_10035300
1029 Ga0068866_10072307
1030 Ga0068866_10193969
1031 Ga0068866_10454632
1032 Ga0068861_100096525
1033 Ga0068861_101122057
1034 Ga0068870_10069894
1035 Ga0068870_10143338
1036 Ga0068870_10213033
1037 Ga0068870_10767158
1038 Ga0068863_100040118
1039 Ga0068858_100014567
1040 Ga0068858_100644315
1041 Ga0068858_101048808
1042 Ga0068858_102351699
1043 Ga0068860_100441529
1044 Ga0068860_100667450
1045 Ga0068860_102276660
1046 Ga0068860_102353091
1047 Ga0068862_100030643
1048 Ga0068862_100075099
1049 Ga0068862_100080283
1050 Ga0068862_100417934
1051 Ga0068862_100418322
1052 Ga0075368_10039672
1053 Ga0075363_100365242
1054 Ga0075364_10030296
1055 Ga0075364_10415313
1056 Ga0070716_100778281
1057 Ga0075367_10010191
1058 Ga0075366_10053165
1059 Ga0097621_100036304
1060 Ga0097621_100051841
1061 Ga0097621_100083030
1062 Ga0097621_100448072
1063 Ga0097621_101190126
1064 Ga0075370_10039490
1065 Ga0075370_10149954
1066 Ga0068871_100030152
1067 Ga0068871_100064683
1068 Ga0068871_100084921
1069 Ga0068871_102073402
1070 Ga0075428_100045026
1071 Ga0075428_100127198
1072 Ga0075428_100493630
1073 Ga0075428_100677622
1074 Ga0075430_100384520
1075 Ga0075430_101105044
1076 Ga0075430_101348281
1077 Ga0075431_100541808
1078 Ga0075431_101294221
1079 Ga0075433_10008219
1080 Ga0075433_10208061
1081 Ga0075433_10290337
1082 Ga0075434_100010204
1083 Ga0075434_100059485
1084 Ga0075434_100120885
1085 Ga0075434_100122076
1086 Ga0075434_101360998
1087 Ga0075429_100143167
1088 Ga0075429_100204981
1089 Ga0075429_101249301
1090 Ga0068865_100639699
1091 Ga0068865_100898926
1092 Ga0068865_101602596
1093 Ga0075436_100021339
1094 Ga0075436_100028027
1095 Ga0075436_100098496
1096 Ga0075436_100113531
1097 Ga0075436_100737855
1098 Ga0097620_100000008
1099 Ga0097620_100024324
1100 Ga0097620_100719027
1101 Ga0075435_100005556
1102 Ga0075435_100086549
1103 Ga0075435_100233514
1104 Ga0075435_100862661
1105 Ga0075435_101042830
1106 Ga0075435_101592122
1107 Ga0105250_10410411
1108 Ga0105240_10040838
1109 Ga0105240_10096489
1110 Ga0105240_10220017
1111 Ga0105240_10237983
1112 Ga0105240_10507086
1113 Ga0105240_10881579
1114 Ga0105240_11167403
1115 Ga0111539_10000226
1116 Ga0111539_10019953
1117 Ga0111539_10096653
1118 Ga0111539_10155764
1119 Ga0111539_10462309
1120 Ga0111539_10865055
1121 Ga0111539_10870949
1122 Ga0111539_10909501
1123 Ga0111539_10947498
1124 Ga0111539_13143105
1125 Ga0105245_10020649
1126 Ga0105245_10043830
1127 Ga0105245_11285131
1128 Ga0105247_10046414
1129 Ga0105247_10315295
1130 Ga0114129_10041935
1131 Ga0114129_10050163
1132 Ga0114129_10362420
1133 Ga0105243_10041471
1134 Ga0105243_11336949
1135 Ga0105243_11374926
1136 Ga0105241_10010067
1137 Ga0105241_10109289
1138 Ga0105241_10218927
1139 Ga0105242_10017430
1140 Ga0105242_10033188
1141 Ga0105242_10084582
1142 Ga0105242_10140600
1143 Ga0105242_10482510
1144 Ga0105242_10786469
1145 Ga0105242_11895284
1146 Ga0105242_12083573
1147 Ga0105248_10008633
1148 Ga0105248_10041879
1149 Ga0105248_10252097
1150 Ga0105248_10405208
1151 Ga0105248_10935973
1152 Ga0105237_10187068
1153 Ga0105238_10009721
1154 Ga0105249_10001911
1155 Ga0105249_10025426
1156 Ga0105249_10094080
1157 Ga0105249_10732491
1158 Ga0105249_10869234
1159 Ga0105249_11034494
1160 Ga0105249_11090407
1161 Ga0105249_12711682
1162 Ga0099796_10304205
1163 Ga0105239_10037659
1164 Ga0105239_10173720
1165 Ga0105246_10010795
1166 Ga0105246_10121178
1167 Ga0157373_10006033
1168 Ga0157373_10048130
1169 Ga0157371_10061511
1170 Ga0157371_11351161
1171 Ga0157370_10199003
1172 Ga0157370_10706982
1173 Ga0157369_10080093
1174 Ga0157369_10152307
1175 Ga0157369_10188192
1176 Ga0157369_11149432
1177 Ga0157369_12673751
1178 Ga0157374_10009437
1179 Ga0157374_12267244
1180 Ga0157378_10188156
1181 Ga0157378_10559740
1182 Ga0157378_10560376
1183 Ga0163162_10332709
1184 Ga0163162_10428717
1185 Ga0163162_10786522
1186 Ga0163162_11965457
1187 Ga0163162_12039985
1188 Ga0157372_10012512
1189 Ga0157372_10035519
1190 Ga0157372_10100573
1191 Ga0157372_10188196
1192 Ga0157372_10220487
1193 Ga0157372_10289053
1194 Ga0157372_11373556
1195 Ga0157372_13344615
1196 Ga0157375_10015405
1197 Ga0157375_10228984
1198 Ga0157375_10968146
1199 Ga0157375_11148028
1200 Ga0163163_10111207
1201 Ga0163163_11049371
1202 Ga0163163_11279616
1203 Ga0157380_10030686
1204 Ga0157380_10153738
1205 Ga0157380_10319285
1206 Ga0157380_10448688
1207 Ga0157380_10826342
1208 Ga0157380_11877404
1209 Ga0157380_12173600
1210 Ga0157380_13497082
1211 Ga0182008_10041351
1212 Ga0157377_10000755
1213 Ga0157377_10148874
1214 Ga0157377_10440889
1215 Ga0157377_10485344
1216 Ga0157379_10029457
1217 Ga0157379_10256393
1218 Ga0157376_10029884
1219 Ga0157376_10458622
1220 Ga0157376_12271425
1221 Ga0182007_10174550
1222 Ga0163161_11717738
1223 Ga0206353_11696378
1224 Ga0213875_10010624
1225 Ga0207697_10204807
1226 Ga0207656_10112332
1227 Ga0207642_10016648
1228 Ga0207642_10162766
1229 Ga0207680_10685026
1230 Ga0207647_10226922
1231 Ga0207699_10590779
1232 Ga0207643_10030811
1233 Ga0207643_10195911
1234 Ga0207643_10218735
1235 Ga0207705_10081943
1236 Ga0207705_10240682
1237 Ga0207705_10411605
1238 Ga0207705_10593416
1239 Ga0207705_10817881
1240 Ga0207684_11211619
1241 Ga0207654_10054163
1242 Ga0207654_10553613
1243 Ga0207707_10021432
1244 Ga0207707_10857959
1245 Ga0207707_11172448
1246 Ga0207695_10025632
1247 Ga0207695_10126332
1248 Ga0207695_10155863
1249 Ga0207695_10594809
1250 Ga0207695_10991010
1251 Ga0207660_10024077
1252 Ga0207660_10095275
1253 Ga0207660_10259446
1254 Ga0207660_10738583
1255 Ga0207662_10533122
1256 Ga0207662_10733613
1257 Ga0207662_11165264
1258 Ga0207657_10037367
1259 Ga0207657_10049916
1260 Ga0207649_10016616
1261 Ga0207649_10167256
1262 Ga0207649_10868027
1263 Ga0207649_11543454
1264 Ga0207652_10100716
1265 Ga0207652_10348524
1266 Ga0207652_10587896
1267 Ga0207652_10644392
1268 Ga0207681_10017949
1269 Ga0207681_10098648
1270 Ga0207681_10292694
1271 Ga0207681_11354238
1272 Ga0207694_10020136
1273 Ga0207694_10429837
1274 Ga0207650_10018660
1275 Ga0207650_10198963
1276 Ga0207650_10686617
1277 Ga0207650_10765020
1278 Ga0207650_11628800
1279 Ga0207659_10010450
1280 Ga0207659_10022832
1281 Ga0207659_10030208
1282 Ga0207659_10756628
1283 Ga0207659_10970970
1284 Ga0207659_10995873
1285 Ga0207659_11419239
1286 Ga0207659_11608794
1287 Ga0207659_11701282
1288 Ga0207687_10025339
1289 Ga0207687_10059132
1290 Ga0207687_10437962
1291 Ga0207687_11519041
1292 Ga0207664_10024810
1293 Ga0207664_10399896
1294 Ga0207644_10062460
1295 Ga0207644_10935210
1296 Ga0207690_10017724
1297 Ga0207706_10080860
1298 Ga0207706_11007571
1299 Ga0207686_10015199
1300 Ga0207686_10015294
1301 Ga0207686_10083103
1302 Ga0207686_10214733
1303 Ga0207686_10229653
1304 Ga0207709_10721860
1305 Ga0207709_11113144
1306 Ga0207670_10038062
1307 Ga0207670_10042326
1308 Ga0207670_10160132
1309 Ga0207670_10525253
1310 Ga0207669_10107790
1311 Ga0207669_10730945
1312 Ga0207669_11377919
1313 Ga0207669_11555010
1314 Ga0207704_10252820
1315 Ga0207704_11340366
1316 Ga0207665_10463697
1317 Ga0207665_10540276
1318 Ga0207691_10096280
1319 Ga0207691_10174497
1320 Ga0207691_10894906
1321 Ga0207691_11548030
1322 Ga0207711_10020229
1323 Ga0207689_10008859
1324 Ga0207661_10046839
1325 Ga0207661_10351547
1326 Ga0207661_10399968
1327 Ga0207661_11057897
1328 Ga0207661_11252381
1329 Ga0207679_10014267
1330 Ga0207679_10067571
1331 Ga0207679_10303142
1332 Ga0207679_10447918
1333 Ga0207679_11174236
1334 Ga0207667_10077809
1335 Ga0207667_10159170
1336 Ga0207667_10267463
1337 Ga0207667_10344133
1338 Ga0207667_10388536
1339 Ga0207667_10569864
1340 Ga0207667_10819017
1341 Ga0207667_11543707
1342 Ga0207667_11874179
1343 Ga0207651_10246535
1344 Ga0207651_11975789
1345 Ga0207712_10001179
1346 Ga0207712_10097146
1347 Ga0207712_10773190
1348 Ga0207712_11044654
1349 Ga0207640_10204248
1350 Ga0207640_10230284
1351 Ga0207658_11428378
1352 Ga0207677_10433324
1353 Ga0207703_10013366
1354 Ga0207703_10673975
1355 Ga0207639_10240839
1356 Ga0207639_10776960
1357 Ga0207678_10003890
1358 Ga0207678_10026801
1359 Ga0207678_11069453
1360 Ga0207708_10414204
1361 Ga0207708_10847405
1362 Ga0207708_11666691
1363 Ga0207702_10070860
1364 Ga0207702_10758644
1365 Ga0207702_12402465
1366 Ga0207641_10037537
1367 Ga0207641_10199535
1368 Ga0207648_10797848
1369 Ga0207648_11020011
1370 Ga0207648_11137282
1371 Ga0207648_11400884
1372 Ga0207676_10019525
1373 Ga0207676_10178279
1374 Ga0207674_10000013
1375 Ga0207674_10266604
1376 Ga0207674_10417013
1377 Ga0207675_100044698
1378 Ga0207675_100273194
1379 Ga0207675_100889518
1380 Ga0207683_10297550
1381 Ga0207683_10359818
1382 Ga0207698_10041379
1383 Ga0207698_10080502
1384 Ga0207698_10099505
1385 Ga0207698_11193879
1386 Ga0207428_10054262
1387 Ga0207428_10538360
1388 Ga0268266_10275093
1389 Ga0268266_10371382
1390 Ga0268265_10307471
1391 Ga0268265_11040195
1392 Ga0268265_11713233
1393 Ga0268264_10058804
1394 Ga0268264_10107555
1395 Ga0268264_10197574
1396 Ga0265318_10266683
1397 Ga0316182_1248738
1398 Ga0265770_1033342
1399 Ga0307408_100022218
1400 Ga0307408_100637908
1401 Ga0307408_100783670
1402 Ga0307408_101071948
1403 Ga0265314_10065391
1404 Ga0307405_10111846
1405 Ga0307405_10112204
1406 Ga0307405_10411620
1407 Ga0307405_10593304
1408 Ga0307405_11619859
1409 Ga0307405_11793766
1410 Ga0307413_10008357
1411 Ga0307413_10202902
1412 Ga0307413_10686904
1413 Ga0307410_10015350
1414 Ga0307410_10244149
1415 Ga0307410_10307892
1416 Ga0307406_10026426
1417 Ga0307406_10461574
1418 Ga0307406_10760953
1419 Ga0307406_11185201
1420 Ga0307407_10119019
1421 Ga0307407_10166290
1422 Ga0307412_10040717
1423 Ga0307412_10358081
1424 Ga0307412_10799447
1425 Ga0307409_100032198
1426 Ga0307409_100698090
1427 Ga0307409_100774842
1428 Ga0307416_100011025
1429 Ga0307416_100073761
1430 Ga0307416_100153545
1431 Ga0307416_100157092
1432 Ga0307416_100168100
1433 Ga0307416_100513987
1434 Ga0307416_100521231
1435 Ga0307416_100591148
1436 Ga0307416_101478164
1437 Ga0307416_102241528
1438 Ga0307414_10197963
1439 Ga0307414_11573512
1440 Ga0307411_10003697
1441 Ga0307411_11352550
1442 Ga0307415_100028993
1443 Ga0307415_101239777
1444 Ga0373930_0000672
1445 Ga0373958_0026325
1446 Ga0373938_0023467
1447 Ga0373928_0001093
1448 Ga0373940_0000665
1449 Ga0373949_0002534
1450 Ga0373932_0011775
1451 Ga0373939_0449748
1452 Ga0373941_0002046
1453 Ga0373941_0358441
1454 Ga0373960_0004415
1455 Ga0373943_0121890
1456 Ga0373943_0455864
1457 Ga0373946_0396506
1458 Ga0373955_0974401
1459 Ga0373942_0009270
1460 Ga0373961_0000625
1461 Ga0373962_0005239
1462 Ga0373931_0010443
1463 Ga0373931_0256162
1464 Ga0373931_0265791
1465 Ga0373931_0559936
1466 Ga0373935_0297949
1467 Ga0373935_0586746
1468 Ga0373927_0148858
1469 Ga0373947_0194930
1470 Ga0373947_0643049
1471 Ga0373937_0377631
1472 Ga0373937_0604363
1473 Ga0373937_1230741
1474 Ga0373925_0001278
1475 Ga0373925_0154137
1476 Ga0373925_0393785
1477 Ga0395905_1727971
1478 Ga0436364_1399086
1479 Ga0436365_1521767
1480 Ga0439453_0150278
1481 Ga0451839_1423822
1482 Ga0439456_094028
1483 Ga0439446_0089939
1484 Ga0439434_0229600
1485 Ga0439435_0000768
1486 Ga0439459_0244165
1487 Ga0439464_0173907
1488 Ga0439460_0045162
1489 Ga0453683_0273279
1490 Ga0451576_0015239
1491 Ga0451576_0024320
1492 Ga0451576_0432533
1493 Ga0451576_2099399
1494 Ga0466958_1072880
1495 Ga0466967_0394015
1496 Ga0466967_1094575
1497 Ga0466967_1634106
1498 Ga0495603_0328244
1499 Ga0495629_0078505
1500 Ga0495580_0067113
1501 Ga0495639_0107038
1502 Ga0495594_0011764
1503 Ga0495594_0014118
1504 Ga0495594_0156593
1505 Ga0495594_0483527
1506 Ga0495628_0217564
1507 Ga0495666_0289867
1508 Ga0495652_0024226
1509 Ga0495652_0977046
1510 Ga0495665_0102080
1511 Ga0495640_0104366
1512 Ga0495586_0334529
1513 Ga0495645_0901292
1514 Ga0495667_0155503
1515 Ga0495635_0211346
1516 Ga0495635_0969517
1517 Ga0495599_0310002
1518 Ga0495658_0932563
1519 Ga0495600_0449429
1520 Ga0495581_0103450
1521 Ga0495636_0300112
1522 Ga0495636_0384513
1523 Ga0495676_0758510
1524 Ga0495684_0086748
1525 Ga0495684_0468414
1526 Ga0495684_0768018
1527 Ga0496100_0189535
1528 Ga0496101_0978391
1529 Ga0496102_0141546
1530 Ga0496104_0082603
1531 Ga0496105_0194834
1532 Ga0496108_0301007
1533 Ga0496109_1104023
1534 Ga0496110_0282389
1535 Ga0496110_1068915
1536 Ga0496113_1365306
1537 Ga0496115_0058102
1538 Ga0496115_0150612
1539 Ga0501031_0007293
1540 Ga0501032_0001778
1541 Ga0501033_0007641
1542 Ga0501034_0050037
1543 Ga0501034_1670661
1544 Ga0501036_0013820
1545 Ga0501036_0151769
1546 Ga0501036_0441948
1547 Ga0501037_0005744
1548 Ga0501038_0003040
1549 Ga0501038_0505062
1550 Ga0501038_0573706
1551 Ga0501039_0011294
1552 Ga0501039_0184122
1553 Ga0501039_0414274
1554 Ga0501040_0160324
1555 Ga0501040_0213169
1556 Ga0501040_0280339
1557 Ga0501041_0142796
1558 Ga0501041_0302990
1559 Ga0501042_0067648
1560 Ga0501042_0200570
1561 Ga0501042_0272227
1562 Ga0501042_0457267
1563 Ga0501043_0002568
1564 Ga0501043_0633407
1565 Ga0501046_0002656
1566 Ga0501046_0350612
1567 Ga0501047_0018469
1568 Ga0501047_0234356
1569 Ga0501048_0016488
1570 Ga0501048_0121370
1571 Ga0501067_0046677
1572 Ga0501068_0000234
1573 Ga0501068_0087570
1574 Ga0501068_0383725
1575 Ga0501069_0005731
1576 Ga0501070_0041650
1577 Ga0501071_0010780
1578 Ga0501072_0024024
1579 Ga0501072_0032921
1580 Ga0501073_0007833
1581 Ga0501074_0031191
1582 Ga0501075_0050470
1583 Ga0501075_0702510
1584 Ga0501075_1010045
1585 Ga0501076_0007646
1586 Ga0501076_0052981
1587 Ga0501076_0097397
1588 Ga0501076_1008182
1589 Ga0501077_0004233
1590 Ga0501077_0187529
1591 Ga0501249_066219
1592 Ga0501079_0047628
1593 Ga0501079_1279128
1594 Ga0501080_0001468
1595 Ga0501080_0309374
1596 Ga0501081_0021191
1597 Ga0501081_0157022
1598 Ga0501083_0011583
1599 Ga0501035_0081259
1600 Ga0501035_0702331
1601 Ga0501044_0024234
1602 Ga0501045_0110632
1603 Ga0501045_0809631
1604 Ga0501200_02355
1605 nmdc:mga03n38_297348_c1
1606 nmdc:mga00v17_327325_c1
1607 nmdc:mga00v17_8829_c1
1608 nmdc:mga0k408_20929_c1
1609 nmdc:mga06z11_34090_c1
1610 nmdc:mga04h51_222142_c1
1611 nmdc:mga07m45_190155_c1
1612 nmdc:mga07m45_34478_c1
1613 nmdc:mga05p37_286654_c1
1614 nmdc:mga05p37_599028_c1
1615 nmdc:mga05p37_609608_c1
1616 nmdc:mga09592_1086908_c1
1617 nmdc:mga09592_1544507_c1
1618 nmdc:mga09592_282678_c1
1619 nmdc:mga09592_861893_c1
1620 nmdc:mga0qj67_341367_c1
1621 nmdc:mga0qj67_736308_c1
1622 nmdc:mga0qj67_737265_c1
1623 nmdc:mga06r32_1712472_c1
1624 nmdc:mga06r32_374917_c1
1625 nmdc:mga08y16_184796_c1
1626 nmdc:mga08y16_2169839_c1
1627 nmdc:mga08y16_369291_c1
1628 nmdc:mga08y16_626511_c1
1629 nmdc:mga08y16_73_c1
1630 nmdc:mga08y16_823022_c1
1631 nmdc:mga0n895_160147_c1
1632 nmdc:mga0n895_1825_c1
1633 nmdc:mga0n895_3208_c1
1634 nmdc:mga0n895_92923_c1
1635 nmdc:mga0rr50_1006104_c1
1636 nmdc:mga0rr50_66503_c1
1637 nmdc:mga0rr50_795731_c1
1638 nmdc:mga0rr50_804220_c1
1639 nmdc:mga08x19_1081243_c1
1640 nmdc:mga08x19_14882_c1
1641 nmdc:mga08x19_275033_c1
1642 nmdc:mga08x19_836913_c1
1643 nmdc:mga0a205_192639_c1
1644 nmdc:mga0a205_800_c1
1645 nmdc:mga0sz30_499275_c1
1646 Ga0495601_0119993
1647 Ga0495601_0275449
1648 Ga0495601_0395190
1649 Ga0495595_0431059
1650 Ga0495595_0490224
1651 Ga0500582_255046
1652 Ga0501084_0008170
1653 Ga0501084_0228979
1654 Ga0501084_0524065
1655 Ga0501084_0649364
1656 Ga0501084_1771305
1657 Ga0501082_0017846
1658 Ga0501082_0102192
1659 Ga0501082_0122882
1660 Ga0530510_0775428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9404 10 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9381 8 104
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9301 6 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9258 8 104
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9241 10 107
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9396 8 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9331 10 102 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9258 8 104 1.10.10.10
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9208 9 94 1.10.10.10
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 10 104 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4S967-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9975 10 108
AF-A0A4R1L5U4-F1-model_v4 PadR family transcriptional regulator 0.9967 10 107
AF-A0A2V8HL98-F1-model_v4 PadR family transcriptional regulator 0.9941 11 106
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.993 11 106
AF-A0A4V2G1F2-F1-model_v4 PadR family transcriptional regulator 0.9925 10 106

Map