F482641

General Info

Members Datasets Scaffolds Average Seq Length
830 506 644 526

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100008912|Ga0070707_1000089125
Length 565
Sequence VAVATRAAHHMVRLVTVLASALDTGSAEYAARRAAMLAKLEELNAEHAKALAGGGPKYVKRHRDRGKLTVRERVELLIDPDSPFLELSALAGYGTGFPVGGSGVNGIGVVSGTEVMISASDPTVRGGSTNPWSLRKSLRSMQIAIENRLPLVNLVESGGADLPTQKDIFIPGGQIFRDLTRMSAAGIPTIALVFGNSTAGGAYVPGMSDYVVMIEGRSKVFLAGPPLVKMATGEESDDESLGGASMHSRQSGLADFLAETEHDALRIGRSIVARLNWGKPGGGPVLAPAEPAHDADELLGIVPDDLKIPFDPREVIARIVDGSEFDEFKPLYGTSLVTGWAALHGYPVGILANARGILFSEESQKAAQFIQLANQIGVPLLFLQNTTGYMVGASYEQAGIIKHGAMMINAVSNSRVPHLTVVMGASYGAGNYGMCGRAYDPRFLFSWPSAKSAVMGPAQLAGVLSIVGRQAAAARGEAYDEDADAAMRKMVEEQIEAESQAFFLSGRIYDDGVIDPRDTRSVLGMCLSVIDGAPGRPAGADSGPGPGVAGATGVAGAGRYGVFRM

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2547132424 Nocardia nova SH22a Isolate Unclassified
8 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
9 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
10 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
11 2558860280 Kutzneria sp. 744 Isolate Unclassified
12 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
13 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
14 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
15 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
16 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
17 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
18 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
19 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
20 2643221548 Streptomyces sp. Root55 Isolate Unclassified
21 2643221578 Streptomyces sp. Root63 Isolate Unclassified
22 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
23 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
24 2643221670 Streptomyces sp. Root431 Isolate Unclassified
25 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
26 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
27 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
28 2643221692 Nocardia sp. Root136 Isolate Unclassified
29 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
30 2643221714 Streptomyces sp. Root264 Isolate Unclassified
31 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
32 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
33 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
34 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
35 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
36 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
37 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
38 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
39 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
40 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
41 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
42 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
43 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
44 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
45 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
46 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
47 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
48 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
49 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
50 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
51 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
52 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
53 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
54 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
55 2808606448 Streptomyces sp. 193411 Isolate Unclassified
56 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
57 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
58 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
59 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
60 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
61 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
62 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
63 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
64 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
65 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
66 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
67 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
68 2855683550 Micromonospora sp. RP3T Isolate Unclassified
69 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
70 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
71 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
72 2858868258 Micromonospora sp. MH33 Isolate Unclassified
73 2858882152 Micromonospora noduli MED15 Isolate Nodule
74 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
75 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
76 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
77 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
78 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
79 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
80 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
81 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
82 2862574272 Streptomyces sp. AcE210 Isolate Nodule
83 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
84 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
85 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
86 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
87 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
88 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
89 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
90 2867369537 Streptomyces sp. Z26 Isolate Unclassified
91 2867428634 Streptomyces sp. RP5T Isolate Unclassified
92 2867475112 Streptomyces sp. TM32 Isolate Unclassified
93 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
94 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
95 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
96 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
97 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
98 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
99 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
100 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
101 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
102 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
103 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
104 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
105 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
106 2891562705 Microbispora tritici MT50 Isolate Unclassified
107 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
108 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
109 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
110 2902582711 Micromonospora sp. AP08 Isolate Unclassified
111 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
112 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
113 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
114 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
115 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
116 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
117 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
118 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
119 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
120 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
121 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
122 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
123 2922554459 Rhodococcus sp. 66b Isolate Unclassified
124 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
125 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
126 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
127 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
128 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
129 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
130 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
131 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
132 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
133 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
134 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
135 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
136 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
137 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
138 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
139 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
140 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
141 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
142 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
143 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
144 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
145 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
146 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
147 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
148 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
149 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
150 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
151 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
152 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
153 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
154 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
155 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
156 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
157 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
158 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
161 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
162 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
163 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
164 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
165 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
166 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
167 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
168 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
169 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
170 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
173 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
174 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
175 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
176 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
177 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
178 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
179 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
180 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
181 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
182 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
183 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
184 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
185 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
186 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
187 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
188 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
189 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
190 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
191 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
192 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
193 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
194 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
195 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
196 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
197 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
198 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
199 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
200 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
201 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
202 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
203 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
204 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
205 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
206 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
207 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
208 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
209 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
210 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
211 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
212 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
213 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
214 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
215 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
216 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
217 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
218 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
220 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
221 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
222 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
223 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
224 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
228 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
229 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
230 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
234 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
235 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
236 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
237 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
238 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
239 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
240 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
241 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
242 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
243 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
244 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
245 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
246 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
248 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
292 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
295 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
296 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
297 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
298 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
299 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
300 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
301 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
302 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
303 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
304 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
305 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
306 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
311 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
312 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
315 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
316 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
317 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
318 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
319 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
320 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
321 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
322 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
323 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
324 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
325 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
326 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
332 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
333 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
334 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
335 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
338 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
339 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
340 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
341 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
342 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
343 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
344 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
345 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
346 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
347 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
348 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
354 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
355 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
356 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
357 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
358 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
362 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
363 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
366 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
367 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
368 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
369 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
385 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
386 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
387 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
395 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
403 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
453 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
454 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
455 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
456 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
457 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
458 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
459 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
464 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
465 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
466 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
467 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
468 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
469 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
470 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
471 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
472 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
473 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
478 649633069 Micromonospora sp. L5 Isolate Unclassified
479 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
480 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
481 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
482 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
483 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
484 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
485 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
486 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
487 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
488 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
489 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
490 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
491 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
492 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
493 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
494 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
495 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
496 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
497 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
498 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
499 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
500 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
501 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
502 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
503 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
504 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
505 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
506 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.99
Metatranscriptomes 0.6
Isolates 22.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 1.08
Rhizoplane 3.73
Rhizosphere 75.54
Stem 0
Stem Tuber 0.24
Unclassified 17.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1005689 3300003354 Bacteria 5149
2 JGI25407J50210_10007327 3300003373 Bacteria 2762
3 Ga0070658_10000239 3300005327 Bacteria 48737
4 Ga0070658_10001032 3300005327 Bacteria 23831
5 Ga0070658_10032497 3300005327 Bacteria 4194
6 Ga0070683_100011058 3300005329 Bacteria 7780
7 Ga0070683_100100794 3300005329 Bacteria 2719
8 Ga0068869_100025545 3300005334 Bacteria 4102
9 Ga0070680_100000215 3300005336 Bacteria 38142
10 Ga0070680_100053605 3300005336 Bacteria 3293
11 Ga0068868_100029923 3300005338 Bacteria 4173
12 Ga0070660_100002855 3300005339 Bacteria 11894
13 Ga0070691_10013375 3300005341 Bacteria 3759
14 Ga0070687_100037790 3300005343 Bacteria 2416
15 Ga0070661_100016157 3300005344 Bacteria 5270
16 Ga0070692_10013611 3300005345 Bacteria 3797
17 Ga0070668_100009578 3300005347 Bacteria 7190
18 Ga0070671_100043417 3300005355 Bacteria 3735
19 Ga0070673_100110141 3300005364 Bacteria 2282
20 Ga0070659_100002183 3300005366 Bacteria 13926
21 Ga0070659_100005517 3300005366 Bacteria 9086
22 Ga0070667_100021159 3300005367 Bacteria 5405
23 Ga0070667_100037185 3300005367 Bacteria 4081
24 Ga0070703_10009074 3300005406 Bacteria 2804
25 Ga0070714_100000036 3300005435 Bacteria 126916
26 Ga0070714_100001420 3300005435 Bacteria 17388
27 Ga0070713_100012044 3300005436 Bacteria 6332
28 Ga0070713_100053393 3300005436 Bacteria 3349
29 Ga0070710_10000119 3300005437 Bacteria 37136
30 Ga0070694_100005290 3300005444 Bacteria 7805
31 Ga0070663_100001714 3300005455 Bacteria 12172
32 Ga0070663_100001719 3300005455 Bacteria 12149
33 Ga0070663_100019964 3300005455 Bacteria 4426
34 Ga0070678_100059510 3300005456 Bacteria 2808
35 Ga0070678_100152224 3300005456 Bacteria 1864
36 Ga0070662_100001318 3300005457 Bacteria 15265
37 Ga0070681_10000019 3300005458 Bacteria 124774
38 Ga0070681_10008441 3300005458 Bacteria 10084
39 Ga0070681_10008548 3300005458 Bacteria 10028
40 Ga0070681_10031255 3300005458 Bacteria 5344
41 Ga0070681_10194761 3300005458 Bacteria 1946
42 Ga0070706_100045453 3300005467 Bacteria 4056
43 Ga0070706_100082924 3300005467 Bacteria 2970
44 Ga0070707_100004110 3300005468 Bacteria 13665
45 Ga0070707_100008912 3300005468 Bacteria 9307
46 Ga0070707_100014922 3300005468 Bacteria 7288
47 Ga0070707_100016487 3300005468 Bacteria 6933
48 Ga0070698_100002212 3300005471 Bacteria 21535
49 Ga0070698_100008761 3300005471 Bacteria 10893
50 Ga0070679_100006062 3300005530 Bacteria 11248
51 Ga0070679_100064924 3300005530 Bacteria 3639
52 Ga0070679_100154481 3300005530 Bacteria 2270
53 Ga0070679_100167829 3300005530 Bacteria 2168
54 Ga0070684_100035537 3300005535 Bacteria 4265
55 Ga0070684_100038823 3300005535 Bacteria 4093
56 Ga0068853_100013255 3300005539 Bacteria 6730
57 Ga0070695_100022048 3300005545 Bacteria 3903
58 Ga0070693_100031303 3300005547 Bacteria 2914
59 Ga0070665_100000272 3300005548 Bacteria 84677
60 Ga0070665_100017955 3300005548 Bacteria 7103
61 Ga0070665_100127158 3300005548 Bacteria 2551
62 Ga0068855_100005147 3300005563 Bacteria 15948
63 Ga0068855_100073364 3300005563 Bacteria 3976
64 Ga0068855_100100343 3300005563 Bacteria 3333
65 Ga0070664_100018962 3300005564 Bacteria 5656
66 Ga0068854_100033022 3300005578 Bacteria 3605
67 Ga0068856_100004823 3300005614 Bacteria 13367
68 Ga0068856_100045872 3300005614 Bacteria 4304
69 Ga0068856_100123473 3300005614 Bacteria 2592
70 Ga0068856_100128262 3300005614 Bacteria 2540
71 Ga0070702_100013632 3300005615 Bacteria 4108
72 Ga0068852_100107814 3300005616 Bacteria 2527
73 Ga0068859_100078400 3300005617 Bacteria 3344
74 Ga0068864_100035609 3300005618 Bacteria 4238
75 Ga0068861_100081881 3300005719 Bacteria 2528
76 Ga0068870_10001619 3300005840 Bacteria 9174
77 Ga0068863_100025826 3300005841 Bacteria 5604
78 Ga0068863_100054168 3300005841 Bacteria 3801
79 Ga0068860_100016025 3300005843 Bacteria 7312
80 Ga0068862_100174180 3300005844 Bacteria 1928
81 Ga0081455_10000273 3300005937 Bacteria 68345
82 Ga0081455_10000297 3300005937 Bacteria 65930
83 Ga0081455_10004121 3300005937 Bacteria 16438
84 Ga0081539_10021504 3300005985 Bacteria 4306
85 Ga0081539_10041737 3300005985 Bacteria 2679
86 Ga0070717_10090879 3300006028 Bacteria 2577
87 Ga0075363_100010647 3300006048 Bacteria 4377
88 Ga0075364_10023774 3300006051 Bacteria 3882
89 Ga0070715_10022657 3300006163 Bacteria 2451
90 Ga0070716_100005425 3300006173 Bacteria 6177
91 Ga0075428_100001814 3300006844 Bacteria 22856
92 Ga0075428_100012614 3300006844 Bacteria 9396
93 Ga0075430_100000279 3300006846 Bacteria 35927
94 Ga0075430_100010653 3300006846 Bacteria 7791
95 Ga0075430_100012560 3300006846 Bacteria 7210
96 Ga0075431_100017701 3300006847 Bacteria 7245
97 Ga0075431_100051500 3300006847 Bacteria 4245
98 Ga0075431_100089927 3300006847 Bacteria 3169
99 Ga0075433_10039657 3300006852 Bacteria 4073
100 Ga0075433_10085043 3300006852 Bacteria 2792
101 Ga0075434_100100490 3300006871 Bacteria 2898
102 Ga0075429_100001505 3300006880 Bacteria 19171
103 Ga0075429_100007070 3300006880 Bacteria 9743
104 Ga0075429_100028171 3300006880 Bacteria 4876
105 Ga0075436_100023901 3300006914 Bacteria 4200
106 Ga0097620_100078400 3300006931 Bacteria 3344
107 Ga0075435_100070920 3300007076 Bacteria 2845
108 Ga0105251_10007408 3300009011 Bacteria 6764
109 Ga0105251_10059475 3300009011 Bacteria 1801
110 Ga0105240_10087989 3300009093 Bacteria 3802
111 Ga0111539_10010479 3300009094 Bacteria 11662
112 Ga0105247_10011402 3300009101 Bacteria 5361
113 Ga0114129_10000012 3300009147 Bacteria 135523
114 Ga0114129_10004246 3300009147 Bacteria 20242
115 Ga0114129_10010464 3300009147 Bacteria 13231
116 Ga0114129_10312497 3300009147 Bacteria 2091
117 Ga0105243_10000721 3300009148 Bacteria 31750
118 Ga0105243_10172822 3300009148 Bacteria 1873
119 Ga0105241_10015603 3300009174 Bacteria 5566
120 Ga0105237_10146924 3300009545 Bacteria 2352
121 Ga0105239_10014073 3300010375 Bacteria 8882
122 Ga0105239_10167578 3300010375 Bacteria 2456
123 Ga0105239_10203905 3300010375 Bacteria 2216
124 Ga0105246_10000251 3300011119 Bacteria 27640
125 Ga0105246_10012458 3300011119 Bacteria 5309
126 Ga0157371_10010508 3300013102 Bacteria 7198
127 Ga0157370_10107566 3300013104 Bacteria 2608
128 Ga0157370_10130788 3300013104 Bacteria 2341
129 Ga0157369_10016036 3300013105 Bacteria 8431
130 Ga0157369_10048511 3300013105 Bacteria 4607
131 Ga0157369_10136326 3300013105 Bacteria 2599
132 Ga0157374_10030603 3300013296 Bacteria 4889
133 Ga0157372_10000769 3300013307 Bacteria 34731
134 Ga0157375_10094249 3300013308 Bacteria 3062
135 Ga0157375_10217005 3300013308 Bacteria 2071
136 Ga0163163_10043082 3300014325 Bacteria 4423
137 Ga0163163_10063699 3300014325 Bacteria 3657
138 Ga0182008_10018266 3300014497 Bacteria 3631
139 Ga0157379_10011753 3300014968 Bacteria 7645
140 Ga0157376_10074763 3300014969 Bacteria 2889
141 Ga0182007_10000488 3300015262 Bacteria 23798
142 Ga0183367_1005 3300015688 Bacteria 652063
143 Ga0206354_11360500 3300020081 Bacteria 1697
144 Ga0206353_10180729 3300020082 Bacteria 3830
145 Ga0206353_11192638 3300020082 Bacteria 5639
146 Ga0206353_11469396 3300020082 Bacteria 4633
147 Ga0213876_10004154 3300021384 Bacteria 8124
148 Ga0213875_10000443 3300021388 Bacteria 36140
149 Ga0224712_10004185 3300022467 Bacteria 3861
150 Ga0207426_1015913 3300025302 Bacteria 2716
151 Ga0207692_10000731 3300025898 Bacteria 11587
152 Ga0207688_10014915 3300025901 Bacteria 4216
153 Ga0207688_10016810 3300025901 Bacteria 3972
154 Ga0207680_10015325 3300025903 Bacteria 3999
155 Ga0207647_10009910 3300025904 Bacteria 6748
156 Ga0207647_10058487 3300025904 Bacteria 2361
157 Ga0207685_10024837 3300025905 Bacteria 2060
158 Ga0207699_10009386 3300025906 Bacteria 4869
159 Ga0207643_10013923 3300025908 Bacteria 4364
160 Ga0207705_10009793 3300025909 Bacteria 6974
161 Ga0207705_10054161 3300025909 Bacteria 2891
162 Ga0207684_10055211 3300025910 Bacteria 3370
163 Ga0207654_10018591 3300025911 Bacteria 3650
164 Ga0207707_10092339 3300025912 Bacteria 2645
165 Ga0207695_10014583 3300025913 Bacteria 9296
166 Ga0207671_10001186 3300025914 Bacteria 30947
167 Ga0207693_10002108 3300025915 Bacteria 17353
168 Ga0207693_10006282 3300025915 Bacteria 9856
169 Ga0207660_10002690 3300025917 Bacteria 11660
170 Ga0207660_10053787 3300025917 Bacteria 2871
171 Ga0207657_10007590 3300025919 Bacteria 11115
172 Ga0207657_10051787 3300025919 Bacteria 3567
173 Ga0207657_10065521 3300025919 Bacteria 3096
174 Ga0207657_10067324 3300025919 Bacteria 3045
175 Ga0207652_10000272 3300025921 Bacteria 53831
176 Ga0207652_10005200 3300025921 Bacteria 10573
177 Ga0207652_10128369 3300025921 Bacteria 2260
178 Ga0207646_10027018 3300025922 Bacteria 5233
179 Ga0207646_10058677 3300025922 Bacteria 3437
180 Ga0207646_10064676 3300025922 Bacteria 3265
181 Ga0207646_10124600 3300025922 Bacteria 2316
182 Ga0207694_10005070 3300025924 Bacteria 10185
183 Ga0207650_10006517 3300025925 Bacteria 7959
184 Ga0207664_10004590 3300025929 Bacteria 9359
185 Ga0207664_10021645 3300025929 Bacteria 4787
186 Ga0207690_10000089 3300025932 Bacteria 75740
187 Ga0207690_10021832 3300025932 Bacteria 3976
188 Ga0207706_10003161 3300025933 Bacteria 15812
189 Ga0207709_10008773 3300025935 Bacteria 5576
190 Ga0207709_10038642 3300025935 Bacteria 2845
191 Ga0207665_10001796 3300025939 Bacteria 14451
192 Ga0207691_10065653 3300025940 Bacteria 3284
193 Ga0207711_10076640 3300025941 Bacteria 2912
194 Ga0207689_10004333 3300025942 Bacteria 12926
195 Ga0207661_10001544 3300025944 Bacteria 15656
196 Ga0207661_10002407 3300025944 Bacteria 12885
197 Ga0207661_10025705 3300025944 Bacteria 4479
198 Ga0207661_10026141 3300025944 Bacteria 4444
199 Ga0207661_10045643 3300025944 Bacteria 3470
200 Ga0207679_10006520 3300025945 Bacteria 7379
201 Ga0207667_10151219 3300025949 Bacteria 2389
202 Ga0207668_10007311 3300025972 Bacteria 6562
203 Ga0207668_10017419 3300025972 Bacteria 4501
204 Ga0207703_10154207 3300026035 Bacteria 2005
205 Ga0207639_10029904 3300026041 Bacteria 3992
206 Ga0207678_10000555 3300026067 Bacteria 34090
207 Ga0207678_10001576 3300026067 Bacteria 20952
208 Ga0207678_10001805 3300026067 Bacteria 19601
209 Ga0207678_10021478 3300026067 Bacteria 5660
210 Ga0207708_10019277 3300026075 Bacteria 5140
211 Ga0207702_10001899 3300026078 Bacteria 20432
212 Ga0207702_10010161 3300026078 Bacteria 7881
213 Ga0207702_10120753 3300026078 Bacteria 2345
214 Ga0207641_10027400 3300026088 Bacteria 4705
215 Ga0207648_10003463 3300026089 Bacteria 16547
216 Ga0207676_10003219 3300026095 Bacteria 11637
217 Ga0207676_10028295 3300026095 Bacteria 4185
218 Ga0207674_10081916 3300026116 Bacteria 3229
219 Ga0207674_10096062 3300026116 Bacteria 2949
220 Ga0207683_10000758 3300026121 Bacteria 29348
221 Ga0207683_10089275 3300026121 Bacteria 2743
222 Ga0207698_10040566 3300026142 Bacteria 3461
223 Ga0207428_10042375 3300027907 Bacteria 3681
224 Ga0207428_10081711 3300027907 Bacteria 2523
225 Ga0268266_10000893 3300028379 Bacteria 38548
226 Ga0268266_10035393 3300028379 Bacteria 4248
227 Ga0268264_10130205 3300028381 Bacteria 2229
228 Ga0307517_10005656 3300028786 Bacteria 18747
229 Ga0307517_10063704 3300028786 Bacteria 3442
230 Ga0307515_10000229 3300028794 Bacteria 139040
231 Ga0307515_10000933 3300028794 Bacteria 67151
232 Ga0307515_10018851 3300028794 Bacteria 12458
233 Ga0307515_10022037 3300028794 Bacteria 11252
234 Ga0307515_10029011 3300028794 Bacteria 9377
235 Ga0307515_10037209 3300028794 Bacteria 7835
236 Ga0307511_10000996 3300030521 Bacteria 30109
237 Ga0307511_10002973 3300030521 Bacteria 17554
238 Ga0307512_10005910 3300030522 Bacteria 12577
239 Ga0307512_10007441 3300030522 Bacteria 10867
240 Ga0307512_10009763 3300030522 Bacteria 9218
241 Ga0316176_1014054 3300030732 Bacteria 2960
242 Ga0265325_10024676 3300031241 Bacteria 3268
243 Ga0265340_10000364 3300031247 Bacteria 24149
244 Ga0265340_10014405 3300031247 Bacteria 4130
245 Ga0265339_10010777 3300031249 Bacteria 5658
246 Ga0265327_10000004 3300031251 Bacteria 803973
247 Ga0265327_10002363 3300031251 Bacteria 20105
248 Ga0307513_10004004 3300031456 Bacteria 19775
249 Ga0307513_10006905 3300031456 Bacteria 14777
250 Ga0307513_10018179 3300031456 Bacteria 8411
251 Ga0307509_10030851 3300031507 Bacteria 5924
252 Ga0307509_10055799 3300031507 Bacteria 4195
253 Ga0307509_10114143 3300031507 Bacteria 2697
254 Ga0307508_10005976 3300031616 Bacteria 11480
255 Ga0307508_10016352 3300031616 Bacteria 6753
256 Ga0307508_10074323 3300031616 Bacteria 2975
257 Ga0307508_10095920 3300031616 Bacteria 2557
258 Ga0307508_10141115 3300031616 Bacteria 2013
259 Ga0307514_10007783 3300031649 Bacteria 9208
260 Ga0307516_10000185 3300031730 Bacteria 80941
261 Ga0307516_10007420 3300031730 Bacteria 12610
262 Ga0307516_10009305 3300031730 Bacteria 10978
263 Ga0307516_10058145 3300031730 Bacteria 3765
264 Ga0307405_10007322 3300031731 Bacteria 5505
265 Ga0307413_10009799 3300031824 Bacteria 4606
266 Ga0307518_10001260 3300031838 Bacteria 19022
267 Ga0307518_10089964 3300031838 Bacteria 2209
268 Ga0307409_100001174 3300031995 Bacteria 12512
269 Ga0307416_100036334 3300032002 Bacteria 3777
270 Ga0307416_100102518 3300032002 Bacteria 2495
271 Ga0307415_100000334 3300032126 Bacteria 20322
272 Ga0316580_10007766 3300032139 Bacteria 3200
273 Ga0307507_10000084 3300033179 Bacteria 145642
274 Ga0307507_10005078 3300033179 Bacteria 22158
275 Ga0307510_10004385 3300033180 Bacteria 16592
276 Ga0307510_10098952 3300033180 Bacteria 2717
277 Ga0373926_0000074 3300035083 Bacteria 18941
278 Ga0373928_0001680 3300035084 Bacteria 4293
279 Ga0373940_0000581 3300035088 Bacteria 5798
280 Ga0373949_0002135 3300035090 Bacteria 5195
281 Ga0373951_0000016 3300035091 Bacteria 66469
282 Ga0373952_0001301 3300035092 Bacteria 4569
283 Ga0373932_0000189 3300035112 Bacteria 17836
284 Ga0373941_0002732 3300035115 Bacteria 3916
285 Ga0373960_0002553 3300035121 Bacteria 4105
286 Ga0373962_0000380 3300035242 Bacteria 9699
287 Ga0373931_0000374 3300035691 Bacteria 18399
288 Ga0373933_0025340 3300035724 Bacteria 3401
289 Ga0373947_0000008 3300035725 Bacteria 182094
290 Ga0395898_0007495 3300037466 Bacteria 11591
291 Ga0395898_0108394 3300037466 Bacteria 2663
292 Ga0316581_0010764 3300037588 Bacteria 2543
293 Ga0436364_0936746 3300037853 Bacteria 31021
294 Ga0436364_1041493 3300037853 Bacteria 3155
295 Ga0436364_1487254 3300037853 Bacteria 5349
296 Ga0436365_1082193 3300039437 Bacteria 13609
297 Ga0436363_1126501 3300039450 Bacteria 4111
298 Ga0439439_0000340 3300041406 Bacteria 7571
299 Ga0451853_0096484 3300041512 Bacteria 7363
300 Ga0451853_0939096 3300041512 Bacteria 5400
301 Ga0451853_4081035 3300041512 Bacteria 2501
302 Ga0439433_0002739 3300041999 Bacteria 3755
303 Ga0439442_008703 3300042002 Bacteria 2049
304 Ga0439445_0011677 3300042004 Bacteria 2098
305 Ga0439457_001264 3300042014 Bacteria 7581
306 Ga0439457_008072 3300042014 Bacteria 2496
307 Ga0439462_0000793 3300042015 Bacteria 6567
308 Ga0439463_003762 3300042016 Bacteria 3822
309 Ga0450894_000158 3300042131 Bacteria 11965
310 Ga0450903_000953 3300042138 Bacteria 5552
311 Ga0439458_0005830 3300042157 Bacteria 2760
312 Ga0451577_0103744 3300042876 Bacteria 2541
313 Ga0466969_0008532 3300044656 Bacteria 5438
314 Ga0466969_0010386 3300044656 Bacteria 4937
315 Ga0466972_0016974 3300044658 Bacteria 3642
316 Ga0466972_0026595 3300044658 Bacteria 2868
317 Ga0466972_0035407 3300044658 Bacteria 2443
318 Ga0466965_0000282 3300044683 Bacteria 16749
319 Ga0466965_0009590 3300044683 Bacteria 4500
320 Ga0466965_0020629 3300044683 Bacteria 3169
321 Ga0466966_0010226 3300044684 Bacteria 6224
322 Ga0466966_0011509 3300044684 Bacteria 5868
323 Ga0466966_0022471 3300044684 Bacteria 4138
324 Ga0466966_0029333 3300044684 Bacteria 3580
325 Ga0466966_0072460 3300044684 Bacteria 2157
326 Ga0466966_0077872 3300044684 Bacteria 2068
327 Ga0466966_0098248 3300044684 Bacteria 1813
328 Ga0466961_0001684 3300044693 Bacteria 13757
329 Ga0466961_0001904 3300044693 Bacteria 13006
330 Ga0466961_0003108 3300044693 Bacteria 10335
331 Ga0466961_0006387 3300044693 Bacteria 7484
332 Ga0466961_0020718 3300044693 Bacteria 4232
333 Ga0466961_0060161 3300044693 Bacteria 2415
334 Ga0466961_0060398 3300044693 Bacteria 2410
335 Ga0466961_0060980 3300044693 Bacteria 2398
336 Ga0466963_0004036 3300044694 Bacteria 8493
337 Ga0466963_0004428 3300044694 Bacteria 8162
338 Ga0466963_0004601 3300044694 Bacteria 8035
339 Ga0466963_0007470 3300044694 Bacteria 6520
340 Ga0466963_0010175 3300044694 Bacteria 5687
341 Ga0466963_0010962 3300044694 Bacteria 5510
342 Ga0466963_0037926 3300044694 Bacteria 3150
343 Ga0466963_0040180 3300044694 Bacteria 3066
344 Ga0466963_0075706 3300044694 Bacteria 2272
345 Ga0466964_0001244 3300044706 Bacteria 8644
346 Ga0466964_0024055 3300044706 Bacteria 2371
347 Ga0453684_0031103 3300044712 Bacteria 7515
348 Ga0466971_0000735 3300044719 Bacteria 13130
349 Ga0466971_0007478 3300044719 Bacteria 4759
350 Ga0466971_0008144 3300044719 Bacteria 4570
351 Ga0466970_0000600 3300044765 Bacteria 17664
352 Ga0466970_0001072 3300044765 Bacteria 13252
353 Ga0466970_0008698 3300044765 Bacteria 5115
354 Ga0466970_0016593 3300044765 Bacteria 3800
355 Ga0466957_0001424 3300044842 Bacteria 12485
356 Ga0466957_0013453 3300044842 Bacteria 4745
357 Ga0466957_0016444 3300044842 Bacteria 4328
358 Ga0466957_0032737 3300044842 Bacteria 3114
359 Ga0466960_0000512 3300044901 Bacteria 13309
360 Ga0466960_0008100 3300044901 Bacteria 4293
361 Ga0466960_0031156 3300044901 Bacteria 2459
362 Ga0466959_0000556 3300045049 Bacteria 21663
363 Ga0466959_0001107 3300045049 Bacteria 16187
364 Ga0466959_0002716 3300045049 Bacteria 11371
365 Ga0466959_0010190 3300045049 Bacteria 6710
366 Ga0466959_0029088 3300045049 Bacteria 4093
367 Ga0466959_0078390 3300045049 Bacteria 2383
368 Ga0466958_0001433 3300045836 Bacteria 11303
369 Ga0466958_0015467 3300045836 Bacteria 4372
370 Ga0466958_0027713 3300045836 Bacteria 3354
371 Ga0466967_0011174 3300045976 Bacteria 6784
372 Ga0466967_0025149 3300045976 Bacteria 4906
373 Ga0466967_0038976 3300045976 Bacteria 4080
374 Ga0466967_0041982 3300045976 Bacteria 3949
375 Ga0466967_0063466 3300045976 Bacteria 3282
376 Ga0466967_0105019 3300045976 Bacteria 2587
377 Ga0466967_0121838 3300045976 Bacteria 2411
378 Ga0466967_0124818 3300045976 Bacteria 2383
379 Ga0495592_0000781 3300046454 Bacteria 22116
380 Ga0495592_0019076 3300046454 Bacteria 5220
381 Ga0495592_0024547 3300046454 Bacteria 4582
382 Ga0495603_0001078 3300046455 Bacteria 15811
383 Ga0495603_0009798 3300046455 Bacteria 5797
384 Ga0495603_0012852 3300046455 Bacteria 5062
385 Ga0495629_0000980 3300046459 Bacteria 22904
386 Ga0495629_0004080 3300046459 Bacteria 10963
387 Ga0495629_0004831 3300046459 Bacteria 10106
388 Ga0495629_0027514 3300046459 Bacteria 4037
389 Ga0495629_0043422 3300046459 Bacteria 3156
390 Ga0495629_0060746 3300046459 Bacteria 2641
391 Ga0495651_0000280 3300046462 Bacteria 39649
392 Ga0495651_0000447 3300046462 Bacteria 31798
393 Ga0495651_0010009 3300046462 Bacteria 7288
394 Ga0495651_0023687 3300046462 Bacteria 4773
395 Ga0495651_0053192 3300046462 Bacteria 3118
396 Ga0495662_0001878 3300046476 Bacteria 10525
397 Ga0495662_0031189 3300046476 Bacteria 2574
398 Ga0495664_0001126 3300046477 Bacteria 13862
399 Ga0495585_0075266 3300046492 Bacteria 1836
400 Ga0495594_0022746 3300046499 Bacteria 3354
401 Ga0495594_0028156 3300046499 Bacteria 3030
402 Ga0495606_0003316 3300046507 Bacteria 17184
403 Ga0495608_0050767 3300046511 Bacteria 2751
404 Ga0495618_0012539 3300046514 Bacteria 5149
405 Ga0495620_0004136 3300046515 Bacteria 8234
406 Ga0495630_0011381 3300046517 Bacteria 6443
407 Ga0495631_0006948 3300046518 Bacteria 5797
408 Ga0495632_0016290 3300046519 Bacteria 4141
409 Ga0495632_0035577 3300046519 Bacteria 2540
410 Ga0495643_0004189 3300046522 Bacteria 10224
411 Ga0495643_0007007 3300046522 Bacteria 7324
412 Ga0495652_0001343 3300046529 Bacteria 27403
413 Ga0495652_0002727 3300046529 Bacteria 17906
414 Ga0495652_0071612 3300046529 Bacteria 2892
415 Ga0495640_0018099 3300046533 Bacteria 5234
416 Ga0495587_0037767 3300046536 Bacteria 2898
417 Ga0495645_0068241 3300046543 Bacteria 2567
418 Ga0495633_0026847 3300046558 Bacteria 2820
419 Ga0495668_0000265 3300046616 Bacteria 73791
420 Ga0495668_0000407 3300046616 Bacteria 56229
421 Ga0495668_0007126 3300046616 Bacteria 7202
422 Ga0495634_0004167 3300046642 Bacteria 11416
423 Ga0495625_0001241 3300046660 Bacteria 32179
424 Ga0495635_0005594 3300046663 Bacteria 8754
425 Ga0495635_0010779 3300046663 Bacteria 6404
426 Ga0495635_0041942 3300046663 Bacteria 3161
427 Ga0495661_0031812 3300046665 Bacteria 3341
428 Ga0495588_0001876 3300046674 Bacteria 8955
429 Ga0495588_0025801 3300046674 Bacteria 2931
430 Ga0495657_0088881 3300046675 Bacteria 1985
431 Ga0495623_0041803 3300046679 Bacteria 2922
432 Ga0495646_0000479 3300046680 Bacteria 21264
433 Ga0495613_0001734 3300046689 Bacteria 16583
434 Ga0495613_0002401 3300046689 Bacteria 14166
435 Ga0495613_0023905 3300046689 Bacteria 4552
436 Ga0495613_0055320 3300046689 Bacteria 2915
437 Ga0495624_0035420 3300046690 Bacteria 3223
438 Ga0495670_0027588 3300046691 Bacteria 2814
439 Ga0495670_0029142 3300046691 Bacteria 2739
440 Ga0495589_0009885 3300046794 Bacteria 4954
441 Ga0495589_0043131 3300046794 Bacteria 2246
442 Ga0495600_0002333 3300046809 Bacteria 10827
443 Ga0495600_0020440 3300046809 Bacteria 4233
444 Ga0495581_0010503 3300047315 Bacteria 5351
445 Ga0495581_0020967 3300047315 Bacteria 3791
446 Ga0495604_0001421 3300047317 Bacteria 19651
447 Ga0495604_0015027 3300047317 Bacteria 6176
448 Ga0495604_0023434 3300047317 Bacteria 4924
449 Ga0495636_0004695 3300047318 Bacteria 5359
450 Ga0495636_0005294 3300047318 Bacteria 5067
451 Ga0495676_0001080 3300047321 Bacteria 23085
452 Ga0495676_0001331 3300047321 Bacteria 21198
453 Ga0495676_0019126 3300047321 Bacteria 6029
454 Ga0495676_0029804 3300047321 Bacteria 4640
455 Ga0495676_0068743 3300047321 Bacteria 2735
456 Ga0495680_0009349 3300047322 Bacteria 8824
457 Ga0495683_0048182 3300047323 Bacteria 2137
458 Ga0495687_000974 3300047443 Bacteria 29055
459 Ga0495687_002761 3300047443 Bacteria 13603
460 Ga0495675_0004687 3300047444 Bacteria 8309
461 Ga0495685_000956 3300047447 Bacteria 8745
462 Ga0495685_001536 3300047447 Bacteria 7085
463 Ga0495685_004406 3300047447 Bacteria 4550
464 Ga0495681_0024771 3300047470 Bacteria 3150
465 Ga0495684_0030418 3300047471 Bacteria 4145
466 Ga0495684_0041509 3300047471 Bacteria 3526
467 Ga0495602_0082807 3300048088 Bacteria 2691
468 Ga0495614_0003335 3300048089 Bacteria 7180
469 Ga0495614_0009654 3300048089 Bacteria 4263
470 Ga0495626_0000052 3300048091 Bacteria 156421
471 Ga0495626_0010348 3300048091 Bacteria 4983
472 Ga0496100_0003327 3300048903 Bacteria 8370
473 Ga0496101_0147658 3300048904 Bacteria 1796
474 Ga0496102_0000263 3300048905 Bacteria 67095
475 Ga0496102_0010801 3300048905 Bacteria 7865
476 Ga0496102_0023254 3300048905 Bacteria 5501
477 Ga0496102_0124985 3300048905 Bacteria 2404
478 Ga0496103_0003434 3300048906 Bacteria 9683
479 Ga0496104_0007406 3300048907 Bacteria 9696
480 Ga0496105_0001205 3300048908 Bacteria 18016
481 Ga0496105_0016074 3300048908 Bacteria 5971
482 Ga0496105_0018806 3300048908 Bacteria 5563
483 Ga0496107_0006565 3300048910 Bacteria 8003
484 Ga0496107_0103655 3300048910 Bacteria 2087
485 Ga0496108_0000078 3300048911 Bacteria 104086
486 Ga0496108_0003614 3300048911 Bacteria 12383
487 Ga0496108_0007707 3300048911 Bacteria 8722
488 Ga0496109_0001430 3300048912 Bacteria 19793
489 Ga0496109_0017569 3300048912 Bacteria 6272
490 Ga0496109_0035045 3300048912 Bacteria 4525
491 Ga0496109_0082299 3300048912 Bacteria 2967
492 Ga0496109_0133805 3300048912 Bacteria 2316
493 Ga0496109_0185850 3300048912 Bacteria 1952
494 Ga0496110_0042074 3300048913 Bacteria 3988
495 Ga0496110_0196603 3300048913 Bacteria 1831
496 Ga0496111_0004243 3300048914 Bacteria 9031
497 Ga0496111_0070058 3300048914 Bacteria 2550
498 Ga0496113_0001255 3300048916 Bacteria 13985
499 Ga0496113_0049392 3300048916 Bacteria 3132
500 Ga0496115_0001996 3300048918 Bacteria 14585
501 Ga0496115_0028757 3300048918 Bacteria 4359
502 Ga0496125_0034058 3300048928 Bacteria 4495
503 Ga0496126_0000055 3300048929 Bacteria 297958
504 Ga0501031_0002119 3300049568 Bacteria 12517
505 Ga0501031_0002990 3300049568 Bacteria 10818
506 Ga0501031_0033920 3300049568 Bacteria 3331
507 Ga0501031_0078960 3300049568 Bacteria 2144
508 Ga0501032_0003217 3300049569 Bacteria 12560
509 Ga0501032_0010941 3300049569 Bacteria 6524
510 Ga0501032_0028217 3300049569 Bacteria 3857
511 Ga0501033_0001790 3300049570 Bacteria 18761
512 Ga0501033_0003586 3300049570 Bacteria 12687
513 Ga0501033_0070985 3300049570 Bacteria 2558
514 Ga0501033_0073716 3300049570 Bacteria 2506
515 Ga0501034_0006420 3300049571 Bacteria 12661
516 Ga0501034_0007920 3300049571 Bacteria 11288
517 Ga0501034_0015114 3300049571 Bacteria 7934
518 Ga0501034_0031587 3300049571 Bacteria 5379
519 Ga0501034_0032681 3300049571 Bacteria 5284
520 Ga0501034_0034253 3300049571 Bacteria 5149
521 Ga0501034_0082034 3300049571 Bacteria 3227
522 Ga0501034_0097966 3300049571 Bacteria 2928
523 Ga0501036_0003532 3300049572 Bacteria 12509
524 Ga0501036_0003712 3300049572 Bacteria 12240
525 Ga0501036_0026125 3300049572 Bacteria 4929
526 Ga0501036_0031085 3300049572 Bacteria 4512
527 Ga0501036_0035568 3300049572 Bacteria 4214
528 Ga0501037_0000120 3300049573 Bacteria 73352
529 Ga0501037_0015217 3300049573 Bacteria 5660
530 Ga0501037_0077070 3300049573 Bacteria 2419
531 Ga0501037_0088042 3300049573 Bacteria 2247
532 Ga0501038_0001063 3300049574 Bacteria 24793
533 Ga0501038_0005557 3300049574 Bacteria 11705
534 Ga0501038_0008089 3300049574 Bacteria 9677
535 Ga0501038_0015541 3300049574 Bacteria 6920
536 Ga0501038_0017286 3300049574 Bacteria 6518
537 Ga0501038_0020079 3300049574 Bacteria 6012
538 Ga0501038_0035335 3300049574 Bacteria 4388
539 Ga0501039_0011440 3300049575 Bacteria 6757
540 Ga0501039_0058724 3300049575 Bacteria 2980
541 Ga0501039_0116236 3300049575 Bacteria 2094
542 Ga0501042_0003694 3300049578 Bacteria 9663
543 Ga0501042_0021299 3300049578 Bacteria 4515
544 Ga0501042_0031604 3300049578 Bacteria 3745
545 Ga0501043_0003741 3300049579 Bacteria 12505
546 Ga0501043_0004366 3300049579 Bacteria 11507
547 Ga0501043_0018856 3300049579 Bacteria 5415
548 Ga0501043_0034863 3300049579 Bacteria 3958
549 Ga0501043_0050347 3300049579 Bacteria 3274
550 Ga0501046_0004569 3300049580 Bacteria 12528
551 Ga0501046_0044043 3300049580 Bacteria 3550
552 Ga0501047_0004816 3300049581 Bacteria 12687
553 Ga0501047_0005424 3300049581 Bacteria 11996
554 Ga0501047_0014290 3300049581 Bacteria 7549
555 Ga0501047_0030194 3300049581 Bacteria 5226
556 Ga0501047_0036836 3300049581 Bacteria 4728
557 Ga0501047_0040318 3300049581 Bacteria 4516
558 Ga0501047_0050408 3300049581 Bacteria 4020
559 Ga0501047_0094339 3300049581 Bacteria 2871
560 Ga0501048_0001054 3300049582 Bacteria 20657
561 Ga0501048_0002774 3300049582 Bacteria 13371
562 Ga0501048_0003059 3300049582 Bacteria 12750
563 Ga0501048_0003539 3300049582 Bacteria 11876
564 Ga0501068_0063562 3300049584 Bacteria 2245
565 Ga0501069_0011159 3300049585 Bacteria 4767
566 Ga0501070_0000752 3300049586 Bacteria 29593
567 Ga0501070_0000790 3300049586 Bacteria 28768
568 Ga0501070_0003299 3300049586 Bacteria 14007
569 Ga0501070_0010116 3300049586 Bacteria 7984
570 Ga0501070_0022024 3300049586 Bacteria 5338
571 Ga0501070_0041164 3300049586 Bacteria 3849
572 Ga0501070_0125831 3300049586 Bacteria 2118
573 Ga0501070_0168956 3300049586 Bacteria 1802
574 Ga0501071_0013355 3300049587 Bacteria 5595
575 Ga0501073_0065730 3300049589 Bacteria 2529
576 Ga0501074_0003609 3300049590 Bacteria 10989
577 Ga0501074_0033904 3300049590 Bacteria 3701
578 Ga0501079_0000991 3300049741 Bacteria 19598
579 Ga0501079_0037358 3300049741 Bacteria 3743
580 Ga0501080_0000830 3300049742 Bacteria 25229
581 Ga0501080_0023320 3300049742 Bacteria 5738
582 Ga0501080_0033952 3300049742 Bacteria 4763
583 Ga0501080_0121038 3300049742 Bacteria 2425
584 Ga0501080_0193494 3300049742 Bacteria 1868
585 Ga0501035_0005033 3300049822 Bacteria 12519
586 Ga0501035_0008849 3300049822 Bacteria 9367
587 Ga0501035_0038018 3300049822 Bacteria 4358
588 Ga0501035_0049942 3300049822 Bacteria 3749
589 Ga0501044_0000276 3300049823 Bacteria 65263
590 Ga0501044_0003579 3300049823 Bacteria 17486
591 Ga0501044_0004033 3300049823 Bacteria 16468
592 Ga0501044_0018538 3300049823 Bacteria 7457
593 Ga0501044_0025514 3300049823 Bacteria 6266
594 Ga0501044_0060824 3300049823 Bacteria 3865
595 Ga0501044_0099163 3300049823 Bacteria 2932
596 Ga0501044_0204776 3300049823 Bacteria 1930
597 Ga0501044_0225935 3300049823 Bacteria 1821
598 Ga0501045_0063965 3300049824 Bacteria 2700
599 nmdc:mga03n38_4768_c1 3300050490 Bacteria 4534
600 nmdc:mga00v17_91909_c1 3300050491 Bacteria 1907
601 nmdc:mga07m45_18127_c1 3300050496 Bacteria 3794
602 nmdc:mga05p37_112222_c1 3300050507 Bacteria 3352
603 nmdc:mga05p37_1195_c1 3300050507 Bacteria 30001
604 nmdc:mga05p37_4810_c1 3300050507 Bacteria 15794
605 nmdc:mga05p37_62159_c1 3300050507 Bacteria 4596
606 nmdc:mga05p37_86847_c1 3300050507 Bacteria 3856
607 nmdc:mga09592_21809_c1 3300050508 Bacteria 5282
608 nmdc:mga09592_231_c1 3300050508 Bacteria 40378
609 nmdc:mga09592_5853_c1 3300050508 Bacteria 10029
610 nmdc:mga0qj67_10028_c1 3300050509 Bacteria 7066
611 nmdc:mga0qj67_1247_c1 3300050509 Bacteria 17793
612 nmdc:mga0qj67_26641_c1 3300050509 Bacteria 4476
613 nmdc:mga06r32_41263_c1 3300050510 Bacteria 4384
614 nmdc:mga06r32_999_c1 3300050510 Bacteria 25338
615 nmdc:mga08y16_4730_c1 3300050511 Bacteria 14196
616 nmdc:mga0n895_26127_c1 3300050512 Bacteria 5525
617 nmdc:mga0n895_58457_c1 3300050512 Bacteria 3802
618 nmdc:mga0rr50_32186_c1 3300050513 Bacteria 3734
619 nmdc:mga0rr50_45072_c1 3300050513 Bacteria 3239
620 nmdc:mga08x19_31226_c1 3300050514 Bacteria 3350
621 nmdc:mga08x19_48986_c1 3300050514 Bacteria 2708
622 nmdc:mga0a205_13761_c1 3300050515 Bacteria 7540
623 nmdc:mga0a205_55165_c1 3300050515 Bacteria 3839
624 Ga0495601_0003830 3300053077 Bacteria 8654
625 Ga0495612_0001733 3300053078 Bacteria 8947
626 Ga0495655_0012000 3300053083 Bacteria 1755
627 Ga0500644_0010412 3300053088 Bacteria 2518
628 Ga0500646_0000613 3300053090 Bacteria 10196
629 Ga0500566_0000593 3300053094 Bacteria 20272
630 Ga0500641_0002575 3300053096 Bacteria 6412
631 Ga0500641_0010321 3300053096 Bacteria 3372
632 Ga0500660_031947 3300053100 Bacteria 2741
633 Ga0500652_016512 3300053131 Bacteria 2688
634 Ga0500658_0014830 3300053134 Bacteria 2888
635 Ga0500559_0047985 3300053136 Bacteria 1876
636 Ga0500561_0009230 3300053137 Bacteria 1994
637 Ga0500616_0066387 3300053153 Bacteria 1852
638 Ga0501082_0004276 3300060353 Bacteria 12485
639 Ga0466962_0000057 3300061719 Bacteria 46351
640 Ga0466962_0002533 3300061719 Bacteria 8682
641 Ga0466962_0005710 3300061719 Bacteria 5978
642 Ga0466962_0015834 3300061719 Bacteria 3639
643 Ga0466962_0023580 3300061719 Bacteria 2957
644 Ga0530510_0135329 3300061734 Bacteria 1814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031507 Ga0307509_10114143 Ga0307509_101141432 428
2 3300044684 Ga0466966_0077872 Ga0466966_0077872_746_2038 429
3 3300049586 Ga0501070_0168956 Ga0501070_0168956_26_1321 430
4 iso_pu_bacteria 2946045630 2946048840 434
5 3300025919 Ga0207657_10007590 Ga0207657_100075902 444
6 3300053153 Ga0500616_0066387 Ga0500616_0066387_15_1352 444
7 3300046674 Ga0495588_0001876 Ga0495588_0001876_24_1370 448
8 3300020081 Ga0206354_11360500 Ga0206354_113605002 453
9 3300044694 Ga0466963_0075706 Ga0466963_0075706_850_2262 469
10 3300025940 Ga0207691_10065653 Ga0207691_100656533 470
11 3300049742 Ga0501080_0193494 Ga0501080_0193494_415_1836 472
12 3300005471 Ga0070698_100008761 Ga0070698_1000087612 484
13 3300044842 Ga0466957_0032737 Ga0466957_0032737_175_1806 489
14 3300044901 Ga0466960_0031156 Ga0466960_0031156_455_2068 491
15 3300005444 Ga0070694_100005290 Ga0070694_1000052905 492
16 3300005545 Ga0070695_100022048 Ga0070695_1000220485 492
17 3300060353 Ga0501082_0004276 Ga0501082_0004276_8702_10261 494
18 3300006163 Ga0070715_10022657 Ga0070715_100226573 495
19 3300050507 nmdc:mga05p37_86847_c1 nmdc:mga05p37_86847_c1_2304_3839 496
20 3300044658 Ga0466972_0026595 Ga0466972_0026595_1178_2776 498
21 3300035084 Ga0373928_0001680 Ga0373928_0001680_943_2481 499
22 3300035088 Ga0373940_0000581 Ga0373940_0000581_3402_4940 499
23 3300035090 Ga0373949_0002135 Ga0373949_0002135_757_2295 499
24 3300035092 Ga0373952_0001301 Ga0373952_0001301_409_1947 499
25 3300035115 Ga0373941_0002732 Ga0373941_0002732_1640_3178 499
26 3300035121 Ga0373960_0002553 Ga0373960_0002553_1813_3351 499
27 3300035242 Ga0373962_0000380 Ga0373962_0000380_7478_9016 499
28 3300035691 Ga0373931_0000374 Ga0373931_0000374_5442_6980 499
29 3300042876 Ga0451577_0103744 Ga0451577_0103744_679_2271 499
30 3300044712 Ga0453684_0031103 Ga0453684_0031103_231_1823 499
31 3300048903 Ga0496100_0003327 Ga0496100_0003327_3319_4857 499
32 3300048905 Ga0496102_0010801 Ga0496102_0010801_2704_4242 499
33 3300048906 Ga0496103_0003434 Ga0496103_0003434_1503_3041 499
34 3300048907 Ga0496104_0007406 Ga0496104_0007406_6338_7876 499
35 3300048908 Ga0496105_0001205 Ga0496105_0001205_5131_6669 499
36 3300048910 Ga0496107_0006565 Ga0496107_0006565_3752_5290 499
37 3300048911 Ga0496108_0007707 Ga0496108_0007707_1432_2970 499
38 3300048912 Ga0496109_0017569 Ga0496109_0017569_1937_3475 499
39 3300048913 Ga0496110_0042074 Ga0496110_0042074_1649_3187 499
40 3300048916 Ga0496113_0001255 Ga0496113_0001255_9872_11410 499
41 3300048918 Ga0496115_0001996 Ga0496115_0001996_10343_11881 499
42 3300049568 Ga0501031_0002119 Ga0501031_0002119_2253_3827 499
43 3300049569 Ga0501032_0003217 Ga0501032_0003217_8746_10320 499
44 3300049570 Ga0501033_0003586 Ga0501033_0003586_2241_3815 499
45 3300049571 Ga0501034_0006420 Ga0501034_0006420_2241_3815 499
46 3300049572 Ga0501036_0003532 Ga0501036_0003532_2233_3807 499
47 3300049573 Ga0501037_0000120 Ga0501037_0000120_710_2284 499
48 3300049574 Ga0501038_0005557 Ga0501038_0005557_374_1948 499
49 3300049579 Ga0501043_0003741 Ga0501043_0003741_8736_10310 499
50 3300049580 Ga0501046_0004569 Ga0501046_0004569_2253_3827 499
51 3300049581 Ga0501047_0004816 Ga0501047_0004816_8864_10438 499
52 3300049582 Ga0501048_0003539 Ga0501048_0003539_8754_10328 499
53 3300049584 Ga0501068_0063562 Ga0501068_0063562_624_2198 499
54 3300049585 Ga0501069_0011159 Ga0501069_0011159_3089_4663 499
55 3300049586 Ga0501070_0000790 Ga0501070_0000790_25661_27235 499
56 3300049587 Ga0501071_0013355 Ga0501071_0013355_624_2198 499
57 3300049741 Ga0501079_0037358 Ga0501079_0037358_2113_3687 499
58 3300049822 Ga0501035_0005033 Ga0501035_0005033_2241_3815 499
59 3300049823 Ga0501044_0003579 Ga0501044_0003579_2241_3815 499
60 3300049824 Ga0501045_0063965 Ga0501045_0063965_44_1618 499
61 3300050507 nmdc:mga05p37_62159_c1 nmdc:mga05p37_62159_c1_161_1699 499
62 3300050513 nmdc:mga0rr50_45072_c1 nmdc:mga0rr50_45072_c1_318_1856 499
63 3300050515 nmdc:mga0a205_55165_c1 nmdc:mga0a205_55165_c1_409_1947 499
64 3300006844 Ga0075428_100001814 Ga0075428_10000181412 501
65 3300006880 Ga0075429_100001505 Ga0075429_10000150512 501
66 3300009094 Ga0111539_10010479 Ga0111539_100104792 501
67 3300009147 Ga0114129_10010464 Ga0114129_100104646 501
68 3300027907 Ga0207428_10042375 Ga0207428_100423752 501
69 3300050507 nmdc:mga05p37_4810_c1 nmdc:mga05p37_4810_c1_5954_7558 501
70 3300050508 nmdc:mga09592_231_c1 nmdc:mga09592_231_c1_25953_27557 501
71 3300050509 nmdc:mga0qj67_10028_c1 nmdc:mga0qj67_10028_c1_2338_3942 501
72 3300050510 nmdc:mga06r32_999_c1 nmdc:mga06r32_999_c1_3882_5486 501
73 3300050511 nmdc:mga08y16_4730_c1 nmdc:mga08y16_4730_c1_1319_2923 501
74 3300050507 nmdc:mga05p37_112222_c1 nmdc:mga05p37_112222_c1_1056_2612 504
75 3300031251 Ga0265327_10000004 Ga0265327_10000004704 505
76 3300041512 Ga0451853_4081035 Ga0451853_4081035_133_1707 505
77 3300049581 Ga0501047_0050408 Ga0501047_0050408_1464_3059 505
78 3300049586 Ga0501070_0125831 Ga0501070_0125831_30_1625 505
79 3300005406 Ga0070703_10009074 Ga0070703_100090744 506
80 3300005467 Ga0070706_100082924 Ga0070706_1000829242 506
81 3300006852 Ga0075433_10085043 Ga0075433_100850431 506
82 3300007076 Ga0075435_100070920 Ga0075435_1000709203 506
83 3300010375 Ga0105239_10167578 Ga0105239_101675784 506
84 3300022467 Ga0224712_10004185 Ga0224712_100041852 506
85 3300025915 Ga0207693_10006282 Ga0207693_100062828 506
86 3300025922 Ga0207646_10064676 Ga0207646_100646764 506
87 3300035112 Ga0373932_0000189 Ga0373932_0000189_8898_10457 506
88 3300044706 Ga0466964_0001244 Ga0466964_0001244_3243_4802 506
89 3300045976 Ga0466967_0011174 Ga0466967_0011174_4948_6507 506
90 3300046454 Ga0495592_0019076 Ga0495592_0019076_340_1929 506
91 3300046459 Ga0495629_0060746 Ga0495629_0060746_997_2586 506
92 3300046462 Ga0495651_0010009 Ga0495651_0010009_2754_4343 506
93 3300046675 Ga0495657_0088881 Ga0495657_0088881_144_1733 506
94 3300046689 Ga0495613_0055320 Ga0495613_0055320_1049_2638 506
95 3300046690 Ga0495624_0035420 Ga0495624_0035420_1038_2627 506
96 3300047321 Ga0495676_0019126 Ga0495676_0019126_848_2437 506
97 3300048905 Ga0496102_0124985 Ga0496102_0124985_441_2000 506
98 3300048910 Ga0496107_0103655 Ga0496107_0103655_91_1650 506
99 3300050512 nmdc:mga0n895_26127_c1 nmdc:mga0n895_26127_c1_1792_3351 506
100 3300050514 nmdc:mga08x19_48986_c1 nmdc:mga08x19_48986_c1_14_1573 506
101 3300005329 Ga0070683_100100794 Ga0070683_1001007943 507
102 3300005468 Ga0070707_100016487 Ga0070707_1000164877 507
103 3300025915 Ga0207693_10002108 Ga0207693_1000210818 507
104 3300025944 Ga0207661_10026141 Ga0207661_100261413 507
105 3300005435 Ga0070714_100000036 Ga0070714_10000003676 508
106 3300046459 Ga0495629_0027514 Ga0495629_0027514_1157_2686 508
107 3300048088 Ga0495602_0082807 Ga0495602_0082807_1135_2670 508
108 3300048911 Ga0496108_0000078 Ga0496108_0000078_94153_95685 508
109 3300049570 Ga0501033_0070985 Ga0501033_0070985_22_1611 508
110 3300049571 Ga0501034_0097966 Ga0501034_0097966_757_2346 508
111 3300053096 Ga0500641_0010321 Ga0500641_0010321_1003_2613 508
112 3300025922 Ga0207646_10058677 Ga0207646_100586773 509
113 3300045049 Ga0466959_0001107 Ga0466959_0001107_14285_15823 509
114 3300049581 Ga0501047_0036836 Ga0501047_0036836_666_2264 509
115 3300005530 Ga0070679_100167829 Ga0070679_1001678292 510
116 3300041512 Ga0451853_0939096 Ga0451853_0939096_1218_2816 510
117 3300044684 Ga0466966_0072460 Ga0466966_0072460_408_2039 510
118 3300045836 Ga0466958_0027713 Ga0466958_0027713_1389_2924 510
119 3300046462 Ga0495651_0000280 Ga0495651_0000280_1237_2838 510
120 3300046529 Ga0495652_0001343 Ga0495652_0001343_5155_6756 510
121 3300048904 Ga0496101_0147658 Ga0496101_0147658_216_1781 510
122 3300048905 Ga0496102_0023254 Ga0496102_0023254_2877_4442 510
123 3300053136 Ga0500559_0047985 Ga0500559_0047985_22_1557 510
124 3300028786 Ga0307517_10005656 Ga0307517_100056562 511
125 3300031730 Ga0307516_10058145 Ga0307516_100581452 511
126 3300037853 Ga0436364_1041493 Ga0436364_1041493_1390_2988 511
127 3300044765 Ga0466970_0001072 Ga0466970_0001072_793_2328 511
128 3300046492 Ga0495585_0075266 Ga0495585_0075266_198_1736 511
129 3300046519 Ga0495632_0016290 Ga0495632_0016290_1835_3373 511
130 3300046522 Ga0495643_0004189 Ga0495643_0004189_6788_8326 511
131 3300046691 Ga0495670_0029142 Ga0495670_0029142_1102_2640 511
132 3300047323 Ga0495683_0048182 Ga0495683_0048182_20_1558 511
133 3300047447 Ga0495685_000956 Ga0495685_000956_4632_6170 511
134 3300047470 Ga0495681_0024771 Ga0495681_0024771_313_1851 511
135 3300049575 Ga0501039_0116236 Ga0501039_0116236_49_1584 511
136 3300053083 Ga0495655_0012000 Ga0495655_0012000_135_1673 511
137 3300053100 Ga0500660_031947 Ga0500660_031947_1079_2617 511
138 3300053134 Ga0500658_0014830 Ga0500658_0014830_164_1702 511
139 3300053137 Ga0500561_0009230 Ga0500561_0009230_112_1650 511
140 3300005327 Ga0070658_10032497 Ga0070658_100324972 512
141 3300013308 Ga0157375_10094249 Ga0157375_100942492 513
142 3300020082 Ga0206353_11469396 Ga0206353_114693963 513
143 3300025909 Ga0207705_10054161 Ga0207705_100541611 513
144 3300025917 Ga0207660_10053787 Ga0207660_100537872 513
145 3300025944 Ga0207661_10025705 Ga0207661_100257051 513
146 3300026067 Ga0207678_10021478 Ga0207678_100214782 513
147 3300048908 Ga0496105_0018806 Ga0496105_0018806_2838_4412 513
148 3300049569 Ga0501032_0028217 Ga0501032_0028217_1528_3117 513
149 3300049571 Ga0501034_0082034 Ga0501034_0082034_1535_3124 513
150 3300049579 Ga0501043_0050347 Ga0501043_0050347_540_2129 513
151 3300049581 Ga0501047_0030194 Ga0501047_0030194_609_2198 513
152 3300049822 Ga0501035_0049942 Ga0501035_0049942_1985_3574 513
153 3300005336 Ga0070680_100053605 Ga0070680_1000536052 514
154 3300005458 Ga0070681_10008441 Ga0070681_100084416 514
155 3300005530 Ga0070679_100006062 Ga0070679_1000060627 514
156 3300025919 Ga0207657_10067324 Ga0207657_100673242 514
157 3300025921 Ga0207652_10005200 Ga0207652_100052006 514
158 3300053090 Ga0500646_0000613 Ga0500646_0000613_5604_7214 514
159 3300005437 Ga0070710_10000119 Ga0070710_1000011912 515
160 3300005614 Ga0068856_100123473 Ga0068856_1001234732 515
161 3300025898 Ga0207692_10000731 Ga0207692_100007319 515
162 3300030732 Ga0316176_1014054 Ga0316176_10140542 515
163 3300044683 Ga0466965_0009590 Ga0466965_0009590_1728_3278 515
164 3300005563 Ga0068855_100073364 Ga0068855_1000733643 516
165 3300025904 Ga0207647_10009910 Ga0207647_100099105 516
166 3300025949 Ga0207667_10151219 Ga0207667_101512191 516
167 3300031731 Ga0307405_10007322 Ga0307405_100073224 516
168 3300031995 Ga0307409_100001174 Ga0307409_1000011742 516
169 3300032002 Ga0307416_100102518 Ga0307416_1001025182 516
170 3300032126 Ga0307415_100000334 Ga0307415_1000003347 516
171 3300037466 Ga0395898_0108394 Ga0395898_0108394_826_2415 516
172 3300050509 nmdc:mga0qj67_1247_c1 nmdc:mga0qj67_1247_c1_15048_16676 516
173 iso_pu_bacteria 2816332119 2816422393 516
174 3300005343 Ga0070687_100037790 Ga0070687_1000377902 517
175 3300005458 Ga0070681_10194761 Ga0070681_101947612 517
176 3300005535 Ga0070684_100038823 Ga0070684_1000388233 517
177 3300005844 Ga0068862_100174180 Ga0068862_1001741802 517
178 3300006846 Ga0075430_100010653 Ga0075430_1000106534 517
179 3300006847 Ga0075431_100051500 Ga0075431_1000515002 517
180 3300006880 Ga0075429_100028171 Ga0075429_1000281712 517
181 3300013308 Ga0157375_10217005 Ga0157375_102170052 517
182 3300025901 Ga0207688_10014915 Ga0207688_100149155 517
183 3300025912 Ga0207707_10092339 Ga0207707_100923392 517
184 3300025944 Ga0207661_10045643 Ga0207661_100456432 517
185 3300026116 Ga0207674_10081916 Ga0207674_100819162 517
186 3300031507 Ga0307509_10030851 Ga0307509_100308512 517
187 3300031616 Ga0307508_10074323 Ga0307508_100743233 517
188 3300049568 Ga0501031_0002990 Ga0501031_0002990_7629_9209 517
189 3300049572 Ga0501036_0035568 Ga0501036_0035568_1852_3432 517
190 3300049573 Ga0501037_0015217 Ga0501037_0015217_2636_4216 517
191 3300049574 Ga0501038_0035335 Ga0501038_0035335_1223_2803 517
192 3300049575 Ga0501039_0011440 Ga0501039_0011440_4144_5724 517
193 3300049579 Ga0501043_0034863 Ga0501043_0034863_103_1683 517
194 3300049581 Ga0501047_0094339 Ga0501047_0094339_359_1939 517
195 3300049582 Ga0501048_0002774 Ga0501048_0002774_9595_11175 517
196 3300049586 Ga0501070_0041164 Ga0501070_0041164_1062_2642 517
197 3300049742 Ga0501080_0033952 Ga0501080_0033952_1599_3179 517
198 3300049823 Ga0501044_0060824 Ga0501044_0060824_1093_2673 517
199 3300050508 nmdc:mga09592_21809_c1 nmdc:mga09592_21809_c1_637_2235 517
200 3300006846 Ga0075430_100000279 Ga0075430_10000027913 518
201 3300031247 Ga0265340_10000364 Ga0265340_1000036412 518
202 3300050507 nmdc:mga05p37_1195_c1 nmdc:mga05p37_1195_c1_17840_19408 518
203 3300009174 Ga0105241_10015603 Ga0105241_100156034 519
204 3300009545 Ga0105237_10146924 Ga0105237_101469242 519
205 3300011119 Ga0105246_10012458 Ga0105246_100124583 519
206 3300028794 Ga0307515_10000229 Ga0307515_1000022965 519
207 3300032139 Ga0316580_10007766 Ga0316580_100077661 519
208 3300037588 Ga0316581_0010764 Ga0316581_0010764_568_2166 519
209 3300044694 Ga0466963_0004601 Ga0466963_0004601_6346_7944 519
210 3300048913 Ga0496110_0196603 Ga0496110_0196603_163_1728 519
211 3300005344 Ga0070661_100016157 Ga0070661_1000161572 520
212 3300005436 Ga0070713_100012044 Ga0070713_1000120444 520
213 3300005455 Ga0070663_100019964 Ga0070663_1000199642 520
214 3300005456 Ga0070678_100152224 Ga0070678_1001522242 520
215 3300005614 Ga0068856_100004823 Ga0068856_1000048238 520
216 3300005615 Ga0070702_100013632 Ga0070702_1000136322 520
217 3300005841 Ga0068863_100054168 Ga0068863_1000541682 520
218 3300014968 Ga0157379_10011753 Ga0157379_100117536 520
219 3300025903 Ga0207680_10015325 Ga0207680_100153252 520
220 3300025906 Ga0207699_10009386 Ga0207699_100093864 520
221 3300025908 Ga0207643_10013923 Ga0207643_100139232 520
222 3300025941 Ga0207711_10076640 Ga0207711_100766402 520
223 3300026067 Ga0207678_10001576 Ga0207678_100015762 520
224 3300026075 Ga0207708_10019277 Ga0207708_100192772 520
225 3300026078 Ga0207702_10010161 Ga0207702_100101618 520
226 3300026088 Ga0207641_10027400 Ga0207641_100274004 520
227 3300026121 Ga0207683_10000758 Ga0207683_100007582 520
228 3300039450 Ga0436363_1126501 Ga0436363_1126501_2412_4010 520
229 3300044693 Ga0466961_0060980 Ga0466961_0060980_657_2255 520
230 3300045049 Ga0466959_0010190 Ga0466959_0010190_5099_6697 520
231 3300049568 Ga0501031_0033920 Ga0501031_0033920_806_2425 520
232 3300049823 Ga0501044_0099163 Ga0501044_0099163_1055_2653 520
233 3300037853 Ga0436364_1487254 Ga0436364_1487254_106_1719 521
234 3300003373 JGI25407J50210_10007327 JGI25407J50210_100073272 522
235 3300005339 Ga0070660_100002855 Ga0070660_1000028554 522
236 3300005455 Ga0070663_100001714 Ga0070663_1000017145 522
237 3300005457 Ga0070662_100001318 Ga0070662_10000131810 522
238 3300005564 Ga0070664_100018962 Ga0070664_1000189621 522
239 3300006051 Ga0075364_10023774 Ga0075364_100237742 522
240 3300009011 Ga0105251_10059475 Ga0105251_100594751 522
241 3300009101 Ga0105247_10011402 Ga0105247_100114023 522
242 3300009147 Ga0114129_10312497 Ga0114129_103124972 522
243 3300010375 Ga0105239_10014073 Ga0105239_100140733 522
244 3300014969 Ga0157376_10074763 Ga0157376_100747632 522
245 3300025933 Ga0207706_10003161 Ga0207706_1000316111 522
246 3300025945 Ga0207679_10006520 Ga0207679_100065204 522
247 3300026067 Ga0207678_10001805 Ga0207678_1000180510 522
248 3300031241 Ga0265325_10024676 Ga0265325_100246762 522
249 3300031247 Ga0265340_10014405 Ga0265340_100144052 522
250 3300031249 Ga0265339_10010777 Ga0265339_100107773 522
251 3300031251 Ga0265327_10002363 Ga0265327_1000236310 522
252 3300042016 Ga0439463_003762 Ga0439463_003762_64_1638 522
253 3300042157 Ga0439458_0005830 Ga0439458_0005830_581_2155 522
254 3300048912 Ga0496109_0185850 Ga0496109_0185850_364_1941 522
255 3300048914 Ga0496111_0004243 Ga0496111_0004243_1175_2749 522
256 3300048916 Ga0496113_0049392 Ga0496113_0049392_1386_2960 522
257 3300048929 Ga0496126_0000055 Ga0496126_0000055_94294_95892 522
258 3300050512 nmdc:mga0n895_58457_c1 nmdc:mga0n895_58457_c1_1034_2608 522
259 3300050513 nmdc:mga0rr50_32186_c1 nmdc:mga0rr50_32186_c1_1216_2790 522
260 3300050514 nmdc:mga08x19_31226_c1 nmdc:mga08x19_31226_c1_1060_2634 522
261 3300050515 nmdc:mga0a205_13761_c1 nmdc:mga0a205_13761_c1_1847_3421 522
262 3300005937 Ga0081455_10004121 Ga0081455_100041212 523
263 3300021384 Ga0213876_10004154 Ga0213876_100041542 523
264 3300026095 Ga0207676_10028295 Ga0207676_100282953 523
265 3300026116 Ga0207674_10096062 Ga0207674_100960622 523
266 3300039437 Ga0436365_1082193 Ga0436365_1082193_5980_7578 523
267 iso_pu_bacteria 2887478801 2887485195 523
268 3300005455 Ga0070663_100001719 Ga0070663_1000017192 524
269 3300046533 Ga0495640_0018099 Ga0495640_0018099_229_1803 524
270 iso_pu_bacteria 2643221697 2644539487 524
271 iso_pu_bacteria 2643221961 2645721328 524
272 iso_pu_bacteria 2643221962 2645724669 524
273 iso_pu_bacteria 2675903060 2676490993 524
274 iso_pu_bacteria 2873314349 2873319040 524
275 iso_pu_bacteria 3006321560 3006328221 524
276 iso_pu_bacteria 8001781756 8001787249 524
277 iso_pu_bacteria 8055066027 8055067487 524
278 3300005719 Ga0068861_100081881 Ga0068861_1000818812 525
279 3300009147 Ga0114129_10000012 Ga0114129_1000001227 525
280 3300035091 Ga0373951_0000016 Ga0373951_0000016_2323_3909 525
281 3300047318 Ga0495636_0004695 Ga0495636_0004695_3075_4652 525
282 3300047443 Ga0495687_002761 Ga0495687_002761_2070_3647 525
283 3300061734 Ga0530510_0135329 Ga0530510_0135329_116_1723 525
284 iso_pu_bacteria 2751185782 2753265613 525
285 iso_pu_bacteria 3001889506 3001891178 525
286 iso_pu_bacteria 3002998708 3003005918 525
287 3300014325 Ga0163163_10043082 Ga0163163_100430823 526
288 3300025932 Ga0207690_10021832 Ga0207690_100218323 526
289 iso_pu_bacteria 2515154088 2515497661 526
290 iso_pu_bacteria 2515154129 2515720418 526
291 iso_pu_bacteria 2515154137 2515757773 526
292 iso_pu_bacteria 2515154202 2516084525 526
293 iso_pu_bacteria 2515154203 2516091581 526
294 iso_pu_bacteria 2622736626 2623585474 526
295 iso_pu_bacteria 2675903059 2676486102 526
296 iso_pu_bacteria 2738541274 2738705723 526
297 iso_pu_bacteria 2738543028 2739332588 526
298 iso_pu_bacteria 2751185734 2753071334 526
299 iso_pu_bacteria 2772190715 2772645256 526
300 iso_pu_bacteria 2831935698 2831938709 526
301 iso_pu_bacteria 2832004796 2832005863 526
302 iso_pu_bacteria 2855670206 2855672440 526
303 iso_pu_bacteria 2855676851 2855680030 526
304 iso_pu_bacteria 2855683550 2855686272 526
305 iso_pu_bacteria 2857288857 2857289145 526
306 iso_pu_bacteria 2858848962 2858850361 526
307 iso_pu_bacteria 2858868258 2858875700 526
308 iso_pu_bacteria 2858882152 2858884675 526
309 iso_pu_bacteria 2858888857 2858893372 526
310 iso_pu_bacteria 2858895516 2858898295 526
311 iso_pu_bacteria 2858902515 2858902556 526
312 iso_pu_bacteria 2866065130 2866071093 526
313 iso_pu_bacteria 2867302475 2867306277 526
314 iso_pu_bacteria 2867312974 2867317086 526
315 iso_pu_bacteria 2867319477 2867322908 526
316 iso_pu_bacteria 2867507094 2867510506 526
317 iso_pu_bacteria 2869048445 2869051306 526
318 iso_pu_bacteria 2869061728 2869068279 526
319 iso_pu_bacteria 2869068681 2869073544 526
320 iso_pu_bacteria 2870721527 2870721861 526
321 iso_pu_bacteria 2880489317 2880494749 526
322 iso_pu_bacteria 2880495981 2880497566 526
323 iso_pu_bacteria 2891562705 2891564331 526
324 iso_pu_bacteria 2895427314 2895436110 526
325 iso_pu_bacteria 2902582711 2902584308 526
326 iso_pu_bacteria 2929219909 2929226130 526
327 iso_pu_bacteria 2929226422 2929232792 526
328 iso_pu_bacteria 2996221748 2996228117 526
329 iso_pu_bacteria 3001889506 3001892379 526
330 iso_pu_bacteria 8003830390 8003835230 526
331 iso_pu_bacteria 8003870546 8003873398 526
332 iso_pu_bacteria 8047710418 8047716742 526
333 iso_pu_bacteria 8054704163 8054710716 526
334 iso_pu_bacteria 8054727385 8054732416 526
335 iso_pu_bacteria 8054734606 8054738760 526
336 iso_pu_bacteria 8055172936 8055176088 526
337 iso_pu_bacteria 8055412473 8055412595 526
338 3300005329 Ga0070683_100011058 Ga0070683_1000110581 527
339 3300005435 Ga0070714_100001420 Ga0070714_10000142014 527
340 3300005535 Ga0070684_100035537 Ga0070684_1000355372 527
341 3300025929 Ga0207664_10004590 Ga0207664_100045903 527
342 3300025944 Ga0207661_10001544 Ga0207661_100015444 527
343 3300031616 Ga0307508_10095920 Ga0307508_100959202 527
344 3300046459 Ga0495629_0043422 Ga0495629_0043422_1220_2812 527
345 3300046507 Ga0495606_0003316 Ga0495606_0003316_3953_5548 527
346 3300046616 Ga0495668_0000265 Ga0495668_0000265_45239_46834 527
347 3300046660 Ga0495625_0001241 Ga0495625_0001241_3671_5266 527
348 3300048091 Ga0495626_0000052 Ga0495626_0000052_25643_27238 527
349 iso_pu_bacteria 2547132424 2548699451 527
350 iso_pu_bacteria 2551306166 2552111281 527
351 iso_pu_bacteria 2558860112 2558910250 527
352 iso_pu_bacteria 2558860280 2559424652 527
353 iso_pu_bacteria 2565956761 2566992558 527
354 iso_pu_bacteria 2585427649 2586062208 527
355 iso_pu_bacteria 2643221601 2644016913 527
356 iso_pu_bacteria 2643221631 2644177955 527
357 iso_pu_bacteria 2643221692 2644514339 527
358 iso_pu_bacteria 2738541308 2738887551 527
359 iso_pu_bacteria 2738543005 2739202719 527
360 iso_pu_bacteria 2738543011 2739236763 527
361 iso_pu_bacteria 2738543034 2739366274 527
362 iso_pu_bacteria 2744054611 2744954490 527
363 iso_pu_bacteria 2795385470 2795782616 527
364 iso_pu_bacteria 2795385472 2795793120 527
365 iso_pu_bacteria 2808606522 2809588623 527
366 iso_pu_bacteria 2818991463 2819695374 527
367 iso_pu_bacteria 2818991472 2819746718 527
368 iso_pu_bacteria 2862290372 2862295484 527
369 iso_pu_bacteria 2866552031 2866552363 527
370 iso_pu_bacteria 2866612099 2866614614 527
371 iso_pu_bacteria 2889300758 2889305656 527
372 iso_pu_bacteria 2899359706 2899368221 527
373 iso_pu_bacteria 2899370129 2899370255 527
374 iso_pu_bacteria 2899370129 2899372836 527
375 iso_pu_bacteria 2904535858 2904541580 527
376 iso_pu_bacteria 2904765812 2904767429 527
377 iso_pu_bacteria 2904770941 2904774775 527
378 iso_pu_bacteria 2908811453 2908813080 527
379 iso_pu_bacteria 2915768154 2915775324 527
380 iso_pu_bacteria 2917736166 2917739418 527
381 iso_pu_bacteria 2919420072 2919423951 527
382 iso_pu_bacteria 2919432681 2919436597 527
383 iso_pu_bacteria 2922554459 2922560043 527
384 iso_pu_bacteria 2928142448 2928143063 527
385 iso_pu_bacteria 2939743619 2939743791 527
386 iso_pu_bacteria 2956939328 2956940954 527
387 iso_pu_bacteria 2966598605 2966601613 527
388 iso_pu_bacteria 2997600082 2997600407 527
389 iso_pu_bacteria 3001119090 3001121932 527
390 iso_pu_bacteria 8003314358 8003323797 527
391 iso_pu_bacteria 8056667051 8056669627 527
392 3300005436 Ga0070713_100053393 Ga0070713_1000533932 528
393 3300005468 Ga0070707_100014922 Ga0070707_1000149227 528
394 3300013104 Ga0157370_10107566 Ga0157370_101075662 528
395 3300013307 Ga0157372_10000769 Ga0157372_1000076922 528
396 3300025929 Ga0207664_10021645 Ga0207664_100216454 528
397 3300045976 Ga0466967_0105019 Ga0466967_0105019_966_2555 528
398 3300053094 Ga0500566_0000593 Ga0500566_0000593_6385_7977 528
399 3300053096 Ga0500641_0002575 Ga0500641_0002575_2460_4049 528
400 iso_pu_bacteria 2501939600 2501941883 528
401 iso_pu_bacteria 2554235005 2554257862 528
402 iso_pu_bacteria 2582581312 2585299330 528
403 iso_pu_bacteria 2582581313 2585308797 528
404 iso_pu_bacteria 2582581314 2585313494 528
405 iso_pu_bacteria 2616644814 2616695068 528
406 iso_pu_bacteria 2616644941 2616902157 528
407 iso_pu_bacteria 2643221548 2643764924 528
408 iso_pu_bacteria 2643221578 2643902632 528
409 iso_pu_bacteria 2643221670 2644389850 528
410 iso_pu_bacteria 2643221673 2644404860 528
411 iso_pu_bacteria 2643221678 2644437171 528
412 iso_pu_bacteria 2643221682 2644461236 528
413 iso_pu_bacteria 2643221714 2644628909 528
414 iso_pu_bacteria 2784132148 2784588572 528
415 iso_pu_bacteria 2784746763 2785343298 528
416 iso_pu_bacteria 2784746768 2785369506 528
417 iso_pu_bacteria 2786546132 2786670611 528
418 iso_pu_bacteria 2791355406 2793980060 528
419 iso_pu_bacteria 2802429296 2804847052 528
420 iso_pu_bacteria 2808606359 2808842067 528
421 iso_pu_bacteria 2808606375 2808920581 528
422 iso_pu_bacteria 2808606448 2809232185 528
423 iso_pu_bacteria 2808606982 2811849052 528
424 iso_pu_bacteria 2811994879 2812358101 528
425 iso_pu_bacteria 2811994917 2812480520 528
426 iso_pu_bacteria 2852635781 2852636667 528
427 iso_pu_bacteria 2856858025 2856859385 528
428 iso_pu_bacteria 2862178590 2862180166 528
429 iso_pu_bacteria 2862281513 2862285660 528
430 iso_pu_bacteria 2862382967 2862383920 528
431 iso_pu_bacteria 2862507626 2862511810 528
432 iso_pu_bacteria 2862574272 2862579245 528
433 iso_pu_bacteria 2863404153 2863404606 528
434 iso_pu_bacteria 2867428634 2867435638 528
435 iso_pu_bacteria 2867475112 2867480619 528
436 iso_pu_bacteria 2873151551 2873155724 528
437 iso_pu_bacteria 2875391855 2875395781 528
438 iso_pu_bacteria 2877676314 2877681103 528
439 iso_pu_bacteria 2912715099 2912719951 528
440 iso_pu_bacteria 2912723979 2912724338 528
441 iso_pu_bacteria 2912757875 2912760792 528
442 iso_pu_bacteria 2919468124 2919469504 528
443 iso_pu_bacteria 2935390628 2935393408 528
444 iso_pu_bacteria 2946072368 2946075923 528
445 iso_pu_bacteria 2947224130 2947229225 528
446 iso_pu_bacteria 2954380949 2954386236 528
447 iso_pu_bacteria 2954673503 2954676932 528
448 iso_pu_bacteria 2954682443 2954687226 528
449 iso_pu_bacteria 2954691527 2954696870 528
450 iso_pu_bacteria 2954711539 2954716244 528
451 iso_pu_bacteria 2954721474 2954726186 528
452 iso_pu_bacteria 2954731030 2954735625 528
453 iso_pu_bacteria 2954740390 2954745111 528
454 iso_pu_bacteria 2954749733 2954754480 528
455 iso_pu_bacteria 2954759201 2954764085 528
456 iso_pu_bacteria 2990059506 2990066421 528
457 iso_pu_bacteria 2990088156 2990092625 528
458 iso_pu_bacteria 2995463766 2995467551 528
459 iso_pu_bacteria 2997451912 2997457840 528
460 iso_pu_bacteria 3006393351 3006397611 528
461 iso_pu_bacteria 3006493962 3006500767 528
462 iso_pu_bacteria 649633069 649812750 528
463 iso_pu_bacteria 8008558824 8008567301 528
464 iso_pu_bacteria 8008574985 8008578882 528
465 iso_pu_bacteria 8023623736 8023630782 528
466 iso_pu_bacteria 8025413630 8025417694 528
467 iso_pu_bacteria 8025478263 8025480350 528
468 iso_pu_bacteria 8025530807 8025538029 528
469 iso_pu_bacteria 8033684223 8033690431 528
470 iso_pu_bacteria 8047893842 8047898094 528
471 iso_pu_bacteria 8048127548 8048136802 528
472 iso_pu_bacteria 8048356638 8048360799 528
473 iso_pu_bacteria 8048369669 8048375057 528
474 iso_pu_bacteria 8048379754 8048383149 528
475 iso_pu_bacteria 8048406513 8048412746 528
476 iso_pu_bacteria 8054160619 8054166068 528
477 iso_pu_bacteria 8056447290 8056452967 528
478 iso_pu_bacteria 8056829672 8056831692 528
479 3300005334 Ga0068869_100025545 Ga0068869_1000255452 529
480 3300005341 Ga0070691_10013375 Ga0070691_100133752 529
481 3300005345 Ga0070692_10013611 Ga0070692_100136112 529
482 3300005347 Ga0070668_100009578 Ga0070668_1000095786 529
483 3300005355 Ga0070671_100043417 Ga0070671_1000434172 529
484 3300005364 Ga0070673_100110141 Ga0070673_1001101412 529
485 3300005367 Ga0070667_100021159 Ga0070667_1000211593 529
486 3300005367 Ga0070667_100037185 Ga0070667_1000371853 529
487 3300005458 Ga0070681_10031255 Ga0070681_100312552 529
488 3300005530 Ga0070679_100154481 Ga0070679_1001544812 529
489 3300005547 Ga0070693_100031303 Ga0070693_1000313032 529
490 3300005548 Ga0070665_100127158 Ga0070665_1001271581 529
491 3300005563 Ga0068855_100100343 Ga0068855_1001003432 529
492 3300005578 Ga0068854_100033022 Ga0068854_1000330222 529
493 3300005616 Ga0068852_100107814 Ga0068852_1001078142 529
494 3300005617 Ga0068859_100078400 Ga0068859_1000784002 529
495 3300005618 Ga0068864_100035609 Ga0068864_1000356092 529
496 3300005840 Ga0068870_10001619 Ga0068870_100016192 529
497 3300005841 Ga0068863_100025826 Ga0068863_1000258263 529
498 3300005843 Ga0068860_100016025 Ga0068860_1000160258 529
499 3300005937 Ga0081455_10000273 Ga0081455_1000027311 529
500 3300005937 Ga0081455_10000297 Ga0081455_1000029718 529
501 3300006847 Ga0075431_100089927 Ga0075431_1000899272 529
502 3300006852 Ga0075433_10039657 Ga0075433_100396572 529
503 3300006871 Ga0075434_100100490 Ga0075434_1001004902 529
504 3300006914 Ga0075436_100023901 Ga0075436_1000239012 529
505 3300006931 Ga0097620_100078400 Ga0097620_1000784002 529
506 3300013105 Ga0157369_10136326 Ga0157369_101363262 529
507 3300025901 Ga0207688_10016810 Ga0207688_100168102 529
508 3300025911 Ga0207654_10018591 Ga0207654_100185912 529
509 3300025919 Ga0207657_10051787 Ga0207657_100517872 529
510 3300025925 Ga0207650_10006517 Ga0207650_100065172 529
511 3300025942 Ga0207689_10004333 Ga0207689_100043336 529
512 3300025944 Ga0207661_10002407 Ga0207661_100024076 529
513 3300025972 Ga0207668_10007311 Ga0207668_100073116 529
514 3300026035 Ga0207703_10154207 Ga0207703_101542072 529
515 3300026078 Ga0207702_10001899 Ga0207702_100018992 529
516 3300026095 Ga0207676_10003219 Ga0207676_100032194 529
517 3300027907 Ga0207428_10081711 Ga0207428_100817112 529
518 3300031616 Ga0307508_10016352 Ga0307508_100163526 529
519 3300031730 Ga0307516_10000185 Ga0307516_1000018517 529
520 3300035083 Ga0373926_0000074 Ga0373926_0000074_9902_11563 529
521 3300035725 Ga0373947_0000008 Ga0373947_0000008_92907_94568 529
522 3300042004 Ga0439445_0011677 Ga0439445_0011677_133_1725 529
523 3300046454 Ga0495592_0024547 Ga0495592_0024547_1451_3049 529
524 3300046462 Ga0495651_0000447 Ga0495651_0000447_20982_22580 529
525 3300046529 Ga0495652_0002727 Ga0495652_0002727_13094_14692 529
526 3300046663 Ga0495635_0005594 Ga0495635_0005594_202_1800 529
527 3300046809 Ga0495600_0002333 Ga0495600_0002333_7116_8714 529
528 3300048912 Ga0496109_0035045 Ga0496109_0035045_2061_3656 529
529 3300049581 Ga0501047_0040318 Ga0501047_0040318_768_2360 529
530 3300053077 Ga0495601_0003830 Ga0495601_0003830_3214_4812 529
531 3300053078 Ga0495612_0001733 Ga0495612_0001733_4314_5912 529
532 3300005548 Ga0070665_100000272 Ga0070665_10000027261 530
533 3300005985 Ga0081539_10021504 Ga0081539_100215042 530
534 3300005985 Ga0081539_10041737 Ga0081539_100417372 530
535 3300014325 Ga0163163_10063699 Ga0163163_100636992 530
536 3300026089 Ga0207648_10003463 Ga0207648_100034636 530
537 3300026121 Ga0207683_10089275 Ga0207683_100892752 530
538 3300028379 Ga0268266_10000893 Ga0268266_100008936 530
539 3300028381 Ga0268264_10130205 Ga0268264_101302052 530
540 3300033179 Ga0307507_10000084 Ga0307507_1000008431 530
541 3300044683 Ga0466965_0020629 Ga0466965_0020629_1517_3115 530
542 3300044694 Ga0466963_0010962 Ga0466963_0010962_799_2394 530
543 3300044694 Ga0466963_0037926 Ga0466963_0037926_119_1717 530
544 3300044719 Ga0466971_0008144 Ga0466971_0008144_1408_3003 530
545 3300044765 Ga0466970_0008698 Ga0466970_0008698_428_2023 530
546 3300044901 Ga0466960_0000512 Ga0466960_0000512_758_2356 530
547 3300045976 Ga0466967_0121838 Ga0466967_0121838_194_1789 530
548 3300048908 Ga0496105_0016074 Ga0496105_0016074_668_2266 530
549 3300048912 Ga0496109_0133805 Ga0496109_0133805_341_1939 530
550 3300048918 Ga0496115_0028757 Ga0496115_0028757_765_2369 530
551 3300049571 Ga0501034_0007920 Ga0501034_0007920_3459_5060 530
552 3300049571 Ga0501034_0031587 Ga0501034_0031587_1729_3333 530
553 3300049571 Ga0501034_0034253 Ga0501034_0034253_3248_4891 530
554 3300049572 Ga0501036_0003712 Ga0501036_0003712_2370_3971 530
555 3300049573 Ga0501037_0088042 Ga0501037_0088042_308_1909 530
556 3300049574 Ga0501038_0017286 Ga0501038_0017286_1257_2858 530
557 3300049574 Ga0501038_0020079 Ga0501038_0020079_120_1763 530
558 3300049578 Ga0501042_0031604 Ga0501042_0031604_1908_3509 530
559 3300049579 Ga0501043_0004366 Ga0501043_0004366_2621_4222 530
560 3300049582 Ga0501048_0003059 Ga0501048_0003059_7307_8908 530
561 3300049589 Ga0501073_0065730 Ga0501073_0065730_225_1817 530
562 3300049590 Ga0501074_0003609 Ga0501074_0003609_7563_9164 530
563 3300049742 Ga0501080_0121038 Ga0501080_0121038_600_2192 530
564 3300049823 Ga0501044_0018538 Ga0501044_0018538_4937_6529 530
565 3300005327 Ga0070658_10000239 Ga0070658_100002392 531
566 3300005327 Ga0070658_10001032 Ga0070658_100010323 531
567 3300005336 Ga0070680_100000215 Ga0070680_10000021529 531
568 3300005338 Ga0068868_100029923 Ga0068868_1000299232 531
569 3300005366 Ga0070659_100002183 Ga0070659_1000021839 531
570 3300005366 Ga0070659_100005517 Ga0070659_1000055178 531
571 3300005456 Ga0070678_100059510 Ga0070678_1000595102 531
572 3300005458 Ga0070681_10000019 Ga0070681_1000001922 531
573 3300005458 Ga0070681_10008548 Ga0070681_100085487 531
574 3300005468 Ga0070707_100004110 Ga0070707_1000041109 531
575 3300005471 Ga0070698_100002212 Ga0070698_1000022127 531
576 3300005530 Ga0070679_100064924 Ga0070679_1000649242 531
577 3300005539 Ga0068853_100013255 Ga0068853_1000132553 531
578 3300005548 Ga0070665_100017955 Ga0070665_1000179556 531
579 3300005563 Ga0068855_100005147 Ga0068855_1000051472 531
580 3300005614 Ga0068856_100045872 Ga0068856_1000458723 531
581 3300005614 Ga0068856_100128262 Ga0068856_1001282621 531
582 3300006028 Ga0070717_10090879 Ga0070717_100908792 531
583 3300006173 Ga0070716_100005425 Ga0070716_1000054252 531
584 3300009093 Ga0105240_10087989 Ga0105240_100879893 531
585 3300009148 Ga0105243_10000721 Ga0105243_1000072126 531
586 3300010375 Ga0105239_10203905 Ga0105239_102039052 531
587 3300013102 Ga0157371_10010508 Ga0157371_100105085 531
588 3300013104 Ga0157370_10130788 Ga0157370_101307881 531
589 3300013105 Ga0157369_10016036 Ga0157369_100160364 531
590 3300013105 Ga0157369_10048511 Ga0157369_100485114 531
591 3300013296 Ga0157374_10030603 Ga0157374_100306033 531
592 3300020082 Ga0206353_10180729 Ga0206353_101807292 531
593 3300020082 Ga0206353_11192638 Ga0206353_111926383 531
594 3300021388 Ga0213875_10000443 Ga0213875_1000044311 531
595 3300025904 Ga0207647_10058487 Ga0207647_100584871 531
596 3300025905 Ga0207685_10024837 Ga0207685_100248372 531
597 3300025909 Ga0207705_10009793 Ga0207705_100097933 531
598 3300025913 Ga0207695_10014583 Ga0207695_100145837 531
599 3300025914 Ga0207671_10001186 Ga0207671_1000118621 531
600 3300025919 Ga0207657_10065521 Ga0207657_100655212 531
601 3300025921 Ga0207652_10000272 Ga0207652_1000027243 531
602 3300025921 Ga0207652_10128369 Ga0207652_101283692 531
603 3300025924 Ga0207694_10005070 Ga0207694_100050704 531
604 3300025932 Ga0207690_10000089 Ga0207690_1000008960 531
605 3300025935 Ga0207709_10008773 Ga0207709_100087734 531
606 3300025939 Ga0207665_10001796 Ga0207665_1000179612 531
607 3300025972 Ga0207668_10017419 Ga0207668_100174192 531
608 3300026041 Ga0207639_10029904 Ga0207639_100299042 531
609 3300026067 Ga0207678_10000555 Ga0207678_1000055531 531
610 3300026078 Ga0207702_10120753 Ga0207702_101207532 531
611 3300026142 Ga0207698_10040566 Ga0207698_100405662 531
612 3300028379 Ga0268266_10035393 Ga0268266_100353933 531
613 3300028794 Ga0307515_10018851 Ga0307515_100188515 531
614 3300028794 Ga0307515_10022037 Ga0307515_100220375 531
615 3300028794 Ga0307515_10029011 Ga0307515_100290116 531
616 3300028794 Ga0307515_10037209 Ga0307515_100372093 531
617 3300030521 Ga0307511_10000996 Ga0307511_1000099614 531
618 3300030522 Ga0307512_10007441 Ga0307512_100074416 531
619 3300030522 Ga0307512_10009763 Ga0307512_100097633 531
620 3300031456 Ga0307513_10006905 Ga0307513_100069054 531
621 3300031456 Ga0307513_10018179 Ga0307513_100181792 531
622 3300031616 Ga0307508_10141115 Ga0307508_101411152 531
623 3300031824 Ga0307413_10009799 Ga0307413_100097992 531
624 3300031838 Ga0307518_10001260 Ga0307518_1000126012 531
625 3300035724 Ga0373933_0025340 Ga0373933_0025340_669_2288 531
626 3300037853 Ga0436364_0936746 Ga0436364_0936746_9606_11204 531
627 3300044656 Ga0466969_0008532 Ga0466969_0008532_3434_5038 531
628 3300044656 Ga0466969_0010386 Ga0466969_0010386_2292_3893 531
629 3300044658 Ga0466972_0016974 Ga0466972_0016974_1854_3452 531
630 3300044684 Ga0466966_0010226 Ga0466966_0010226_4471_6072 531
631 3300044684 Ga0466966_0022471 Ga0466966_0022471_1142_2746 531
632 3300044684 Ga0466966_0029333 Ga0466966_0029333_497_2095 531
633 3300044684 Ga0466966_0098248 Ga0466966_0098248_13_1611 531
634 3300044693 Ga0466961_0001684 Ga0466961_0001684_1309_2913 531
635 3300044693 Ga0466961_0001904 Ga0466961_0001904_255_1853 531
636 3300044693 Ga0466961_0006387 Ga0466961_0006387_4098_5696 531
637 3300044693 Ga0466961_0020718 Ga0466961_0020718_1061_2659 531
638 3300044693 Ga0466961_0060398 Ga0466961_0060398_189_1787 531
639 3300044694 Ga0466963_0004428 Ga0466963_0004428_3194_4792 531
640 3300044694 Ga0466963_0010175 Ga0466963_0010175_2831_4429 531
641 3300044694 Ga0466963_0040180 Ga0466963_0040180_744_2342 531
642 3300044706 Ga0466964_0024055 Ga0466964_0024055_271_1869 531
643 3300044719 Ga0466971_0000735 Ga0466971_0000735_10318_11922 531
644 3300044719 Ga0466971_0007478 Ga0466971_0007478_1298_2896 531
645 3300044765 Ga0466970_0016593 Ga0466970_0016593_801_2402 531
646 3300044842 Ga0466957_0013453 Ga0466957_0013453_1025_2623 531
647 3300044842 Ga0466957_0016444 Ga0466957_0016444_645_2243 531
648 3300045049 Ga0466959_0002716 Ga0466959_0002716_8795_10396 531
649 3300045049 Ga0466959_0029088 Ga0466959_0029088_1864_3462 531
650 3300045049 Ga0466959_0078390 Ga0466959_0078390_159_1757 531
651 3300045836 Ga0466958_0001433 Ga0466958_0001433_6534_8132 531
652 3300045836 Ga0466958_0015467 Ga0466958_0015467_1329_2927 531
653 3300045976 Ga0466967_0038976 Ga0466967_0038976_1298_2896 531
654 3300045976 Ga0466967_0041982 Ga0466967_0041982_1446_3044 531
655 3300045976 Ga0466967_0063466 Ga0466967_0063466_486_2084 531
656 3300045976 Ga0466967_0124818 Ga0466967_0124818_185_1783 531
657 3300046462 Ga0495651_0053192 Ga0495651_0053192_1354_2973 531
658 3300046511 Ga0495608_0050767 Ga0495608_0050767_810_2414 531
659 3300046514 Ga0495618_0012539 Ga0495618_0012539_638_2257 531
660 3300046536 Ga0495587_0037767 Ga0495587_0037767_729_2333 531
661 3300046543 Ga0495645_0068241 Ga0495645_0068241_873_2471 531
662 3300046616 Ga0495668_0000407 Ga0495668_0000407_45616_47214 531
663 3300046663 Ga0495635_0041942 Ga0495635_0041942_54_1658 531
664 3300046674 Ga0495588_0025801 Ga0495588_0025801_710_2308 531
665 3300047317 Ga0495604_0015027 Ga0495604_0015027_3294_4892 531
666 3300047444 Ga0495675_0004687 Ga0495675_0004687_1264_2862 531
667 3300047471 Ga0495684_0030418 Ga0495684_0030418_747_2366 531
668 3300048905 Ga0496102_0000263 Ga0496102_0000263_10172_11770 531
669 3300048911 Ga0496108_0003614 Ga0496108_0003614_2144_3742 531
670 3300048912 Ga0496109_0001430 Ga0496109_0001430_11687_13285 531
671 3300048914 Ga0496111_0070058 Ga0496111_0070058_909_2507 531
672 3300048928 Ga0496125_0034058 Ga0496125_0034058_2008_3606 531
673 3300049586 Ga0501070_0000752 Ga0501070_0000752_20314_21912 531
674 3300049586 Ga0501070_0003299 Ga0501070_0003299_7172_8770 531
675 3300049586 Ga0501070_0022024 Ga0501070_0022024_1085_2683 531
676 3300049590 Ga0501074_0033904 Ga0501074_0033904_547_2145 531
677 3300049741 Ga0501079_0000991 Ga0501079_0000991_16002_17600 531
678 3300049742 Ga0501080_0000830 Ga0501080_0000830_17999_19597 531
679 3300049742 Ga0501080_0023320 Ga0501080_0023320_423_2021 531
680 3300049823 Ga0501044_0025514 Ga0501044_0025514_2892_4490 531
681 3300050491 nmdc:mga00v17_91909_c1 nmdc:mga00v17_91909_c1_73_1671 531
682 3300050496 nmdc:mga07m45_18127_c1 nmdc:mga07m45_18127_c1_1389_2987 531
683 3300053088 Ga0500644_0010412 Ga0500644_0010412_250_1848 531
684 3300053131 Ga0500652_016512 Ga0500652_016512_492_2090 531
685 3300061719 Ga0466962_0002533 Ga0466962_0002533_4212_5810 531
686 3300061719 Ga0466962_0005710 Ga0466962_0005710_2672_4276 531
687 3300061719 Ga0466962_0015834 Ga0466962_0015834_785_2383 531
688 3300061719 Ga0466962_0023580 Ga0466962_0023580_531_2129 531
689 3300005467 Ga0070706_100045453 Ga0070706_1000454532 532
690 3300005468 Ga0070707_100008912 Ga0070707_1000089125 532
691 3300006048 Ga0075363_100010647 Ga0075363_1000106472 532
692 3300006844 Ga0075428_100012614 Ga0075428_1000126142 532
693 3300006846 Ga0075430_100012560 Ga0075430_1000125604 532
694 3300006847 Ga0075431_100017701 Ga0075431_1000177012 532
695 3300006880 Ga0075429_100007070 Ga0075429_1000070704 532
696 3300009011 Ga0105251_10007408 Ga0105251_100074081 532
697 3300009147 Ga0114129_10004246 Ga0114129_1000424610 532
698 3300009148 Ga0105243_10172822 Ga0105243_101728222 532
699 3300011119 Ga0105246_10000251 Ga0105246_100002513 532
700 3300014497 Ga0182008_10018266 Ga0182008_100182663 532
701 3300015262 Ga0182007_10000488 Ga0182007_100004889 532
702 3300015688 Ga0183367_1005 Ga0183367_1005237 532
703 3300025302 Ga0207426_1015913 Ga0207426_10159132 532
704 3300025910 Ga0207684_10055211 Ga0207684_100552112 532
705 3300025917 Ga0207660_10002690 Ga0207660_100026902 532
706 3300025922 Ga0207646_10027018 Ga0207646_100270181 532
707 3300025922 Ga0207646_10124600 Ga0207646_101246001 532
708 3300025935 Ga0207709_10038642 Ga0207709_100386422 532
709 3300028786 Ga0307517_10063704 Ga0307517_100637042 532
710 3300028794 Ga0307515_10000933 Ga0307515_1000093357 532
711 3300030521 Ga0307511_10002973 Ga0307511_1000297313 532
712 3300030522 Ga0307512_10005910 Ga0307512_100059106 532
713 3300031456 Ga0307513_10004004 Ga0307513_100040049 532
714 3300031507 Ga0307509_10055799 Ga0307509_100557993 532
715 3300031616 Ga0307508_10005976 Ga0307508_100059762 532
716 3300031649 Ga0307514_10007783 Ga0307514_100077835 532
717 3300031730 Ga0307516_10007420 Ga0307516_100074207 532
718 3300031730 Ga0307516_10009305 Ga0307516_100093053 532
719 3300031838 Ga0307518_10089964 Ga0307518_100899642 532
720 3300032002 Ga0307416_100036334 Ga0307416_1000363342 532
721 3300033179 Ga0307507_10005078 Ga0307507_100050789 532
722 3300033180 Ga0307510_10004385 Ga0307510_1000438510 532
723 3300033180 Ga0307510_10098952 Ga0307510_100989523 532
724 3300037466 Ga0395898_0007495 Ga0395898_0007495_8405_10003 532
725 3300041406 Ga0439439_0000340 Ga0439439_0000340_4396_5994 532
726 3300041512 Ga0451853_0096484 Ga0451853_0096484_5477_7075 532
727 3300041999 Ga0439433_0002739 Ga0439433_0002739_1635_3233 532
728 3300042002 Ga0439442_008703 Ga0439442_008703_386_1984 532
729 3300042014 Ga0439457_001264 Ga0439457_001264_1080_2678 532
730 3300042014 Ga0439457_008072 Ga0439457_008072_823_2421 532
731 3300042015 Ga0439462_0000793 Ga0439462_0000793_3957_5555 532
732 3300042131 Ga0450894_000158 Ga0450894_000158_10276_11874 532
733 3300042138 Ga0450903_000953 Ga0450903_000953_560_2158 532
734 3300044658 Ga0466972_0035407 Ga0466972_0035407_382_1980 532
735 3300044683 Ga0466965_0000282 Ga0466965_0000282_4219_5817 532
736 3300044684 Ga0466966_0011509 Ga0466966_0011509_2429_4027 532
737 3300044693 Ga0466961_0003108 Ga0466961_0003108_6862_8460 532
738 3300044693 Ga0466961_0060161 Ga0466961_0060161_797_2395 532
739 3300044694 Ga0466963_0004036 Ga0466963_0004036_1340_2938 532
740 3300044694 Ga0466963_0007470 Ga0466963_0007470_4178_5776 532
741 3300044765 Ga0466970_0000600 Ga0466970_0000600_2163_3761 532
742 3300044842 Ga0466957_0001424 Ga0466957_0001424_6784_8382 532
743 3300044901 Ga0466960_0008100 Ga0466960_0008100_1671_3269 532
744 3300045049 Ga0466959_0000556 Ga0466959_0000556_12154_13752 532
745 3300045976 Ga0466967_0025149 Ga0466967_0025149_3169_4767 532
746 3300046454 Ga0495592_0000781 Ga0495592_0000781_2605_4203 532
747 3300046455 Ga0495603_0001078 Ga0495603_0001078_8804_10402 532
748 3300046455 Ga0495603_0009798 Ga0495603_0009798_3604_5202 532
749 3300046455 Ga0495603_0012852 Ga0495603_0012852_1782_3380 532
750 3300046459 Ga0495629_0000980 Ga0495629_0000980_12374_13972 532
751 3300046459 Ga0495629_0004080 Ga0495629_0004080_2351_3949 532
752 3300046459 Ga0495629_0004831 Ga0495629_0004831_2930_4528 532
753 3300046462 Ga0495651_0023687 Ga0495651_0023687_2505_4103 532
754 3300046476 Ga0495662_0001878 Ga0495662_0001878_5973_7571 532
755 3300046476 Ga0495662_0031189 Ga0495662_0031189_934_2532 532
756 3300046477 Ga0495664_0001126 Ga0495664_0001126_1841_3439 532
757 3300046499 Ga0495594_0022746 Ga0495594_0022746_610_2208 532
758 3300046499 Ga0495594_0028156 Ga0495594_0028156_585_2183 532
759 3300046515 Ga0495620_0004136 Ga0495620_0004136_3833_5431 532
760 3300046517 Ga0495630_0011381 Ga0495630_0011381_3968_5566 532
761 3300046518 Ga0495631_0006948 Ga0495631_0006948_179_1777 532
762 3300046519 Ga0495632_0035577 Ga0495632_0035577_292_1890 532
763 3300046522 Ga0495643_0007007 Ga0495643_0007007_2805_4403 532
764 3300046529 Ga0495652_0071612 Ga0495652_0071612_170_1768 532
765 3300046558 Ga0495633_0026847 Ga0495633_0026847_624_2222 532
766 3300046616 Ga0495668_0007126 Ga0495668_0007126_3264_4862 532
767 3300046642 Ga0495634_0004167 Ga0495634_0004167_6854_8452 532
768 3300046663 Ga0495635_0010779 Ga0495635_0010779_3997_5595 532
769 3300046665 Ga0495661_0031812 Ga0495661_0031812_662_2260 532
770 3300046679 Ga0495623_0041803 Ga0495623_0041803_1199_2797 532
771 3300046680 Ga0495646_0000479 Ga0495646_0000479_3248_4846 532
772 3300046689 Ga0495613_0001734 Ga0495613_0001734_7010_8608 532
773 3300046689 Ga0495613_0002401 Ga0495613_0002401_6667_8265 532
774 3300046689 Ga0495613_0023905 Ga0495613_0023905_1129_2727 532
775 3300046691 Ga0495670_0027588 Ga0495670_0027588_384_1982 532
776 3300046794 Ga0495589_0009885 Ga0495589_0009885_74_1672 532
777 3300046794 Ga0495589_0043131 Ga0495589_0043131_112_1710 532
778 3300046809 Ga0495600_0020440 Ga0495600_0020440_1089_2687 532
779 3300047315 Ga0495581_0010503 Ga0495581_0010503_1854_3452 532
780 3300047315 Ga0495581_0020967 Ga0495581_0020967_654_2252 532
781 3300047317 Ga0495604_0001421 Ga0495604_0001421_2958_4556 532
782 3300047317 Ga0495604_0023434 Ga0495604_0023434_67_1665 532
783 3300047318 Ga0495636_0005294 Ga0495636_0005294_2270_3868 532
784 3300047321 Ga0495676_0001080 Ga0495676_0001080_8125_9723 532
785 3300047321 Ga0495676_0001331 Ga0495676_0001331_16147_17745 532
786 3300047321 Ga0495676_0029804 Ga0495676_0029804_872_2479 532
787 3300047321 Ga0495676_0068743 Ga0495676_0068743_100_1698 532
788 3300047322 Ga0495680_0009349 Ga0495680_0009349_4552_6150 532
789 3300047443 Ga0495687_000974 Ga0495687_000974_3537_5135 532
790 3300047447 Ga0495685_001536 Ga0495685_001536_1092_2690 532
791 3300047447 Ga0495685_004406 Ga0495685_004406_2233_3831 532
792 3300047471 Ga0495684_0041509 Ga0495684_0041509_961_2559 532
793 3300048089 Ga0495614_0003335 Ga0495614_0003335_4175_5773 532
794 3300048089 Ga0495614_0009654 Ga0495614_0009654_1666_3264 532
795 3300048091 Ga0495626_0010348 Ga0495626_0010348_419_2017 532
796 3300048912 Ga0496109_0082299 Ga0496109_0082299_280_1878 532
797 3300049568 Ga0501031_0078960 Ga0501031_0078960_29_1627 532
798 3300049569 Ga0501032_0010941 Ga0501032_0010941_3582_5180 532
799 3300049570 Ga0501033_0001790 Ga0501033_0001790_13928_15526 532
800 3300049570 Ga0501033_0073716 Ga0501033_0073716_643_2241 532
801 3300049571 Ga0501034_0015114 Ga0501034_0015114_4864_6462 532
802 3300049571 Ga0501034_0032681 Ga0501034_0032681_1261_2859 532
803 3300049572 Ga0501036_0026125 Ga0501036_0026125_1837_3435 532
804 3300049572 Ga0501036_0031085 Ga0501036_0031085_2082_3680 532
805 3300049573 Ga0501037_0077070 Ga0501037_0077070_296_1894 532
806 3300049574 Ga0501038_0001063 Ga0501038_0001063_13192_14802 532
807 3300049574 Ga0501038_0008089 Ga0501038_0008089_7251_8849 532
808 3300049574 Ga0501038_0015541 Ga0501038_0015541_2459_4057 532
809 3300049575 Ga0501039_0058724 Ga0501039_0058724_175_1785 532
810 3300049578 Ga0501042_0003694 Ga0501042_0003694_1006_2676 532
811 3300049578 Ga0501042_0021299 Ga0501042_0021299_750_2348 532
812 3300049579 Ga0501043_0018856 Ga0501043_0018856_110_1708 532
813 3300049580 Ga0501046_0044043 Ga0501046_0044043_1309_2907 532
814 3300049581 Ga0501047_0005424 Ga0501047_0005424_2615_4225 532
815 3300049581 Ga0501047_0014290 Ga0501047_0014290_298_1896 532
816 3300049582 Ga0501048_0001054 Ga0501048_0001054_3150_4760 532
817 3300049586 Ga0501070_0010116 Ga0501070_0010116_3245_4855 532
818 3300049822 Ga0501035_0008849 Ga0501035_0008849_2906_4504 532
819 3300049822 Ga0501035_0038018 Ga0501035_0038018_1070_2680 532
820 3300049823 Ga0501044_0000276 Ga0501044_0000276_36780_38378 532
821 3300049823 Ga0501044_0004033 Ga0501044_0004033_7300_8898 532
822 3300049823 Ga0501044_0204776 Ga0501044_0204776_12_1622 532
823 3300049823 Ga0501044_0225935 Ga0501044_0225935_26_1624 532
824 3300050490 nmdc:mga03n38_4768_c1 nmdc:mga03n38_4768_c1_1453_3051 532
825 3300050508 nmdc:mga09592_5853_c1 nmdc:mga09592_5853_c1_1207_2817 532
826 3300050509 nmdc:mga0qj67_26641_c1 nmdc:mga0qj67_26641_c1_590_2200 532
827 3300050510 nmdc:mga06r32_41263_c1 nmdc:mga06r32_41263_c1_1811_3421 532
828 3300061719 Ga0466962_0000057 Ga0466962_0000057_14307_15905 532
829 3300003354 JGI25160J50197_1005689 JGI25160J50197_10056893 533
830 iso_pu_bacteria 2867369537 2867371892 533

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

61

536

0.95

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

24

220

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u9s-assembly1.cif.gz_L crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex 0.9689 4 532
3u9s-assembly1.cif.gz_L crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex 0.9618 4 532
3u9t-assembly1.cif.gz_B crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme 0.9593 3 532
3u9t-assembly1.cif.gz_B crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme 0.9571 3 532
4q0g-assembly1.cif.gz_C crystal structure of beta subunit of acyl-coa carboxylase accd1 from mycobacterium tuberculosis 0.9563 19 532
ID Description Score Start End Superfamily
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9877 5 265 3.90.226.10
af_O86318_267_524_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9843 270 526 3.90.226.10
af_O86318_267_524_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9768 270 526 3.90.226.10
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9692 5 265 3.90.226.10
af_A4HUX0_21_275_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9647 44 262 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2Z5YL44-F1-model_v4 deleted 0.9904 3 524
AF-K0F8C4-F1-model_v4 Acetyl/propionyl-CoA carboxylase subunit beta 0.9895 3 532 GO:0016874
AF-D9UP45-F1-model_v4 Acetyl/propionyl CoA carboxylase 0.9892 96 532 GO:0016874
AF-A0A1Q4H6F2-F1-model_v4 Acyl-CoA carboxylase subunit beta 0.9882 3 532 GO:0016740
GO:0016874
AF-A0A1Q4H6F2-F1-model_v4 Acyl-CoA carboxylase subunit beta 0.9845 3 532 GO:0016740
GO:0016874

Feature Viewer

pLDDT pTM Quality
93.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map