F482625

General Info

Members Datasets Scaffolds Average Seq Length
829 512 627 311

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0201710|Ga0501033_0201710_265_1200
Length 311
Sequence MAKSRKVIITCAVTGAIHTPTMSPYLPVTPQEIADAALGAAEAGAAVVHLHARNPKDGRPDQSPEAFLPFVKVIKQASNVVINLTSGGAPTMTVEERVQPAAKLKPEIASLNMGTMNFGLYPMIPRYKGKFKHDWEEPYLEGSRKNMFKNTLADIEYILTTCAENNTRFEIECYDIGHLYTLKHFLDRGVIKPPLFIQSVFGILGGIGPHPEDVIMMRRTADRLFGDQYHWSVLGAGQNQMRIAAQAAAMGGNVRVGLEDSLWIGPGQLAKSNAEQVKKVRQILEGLGLEIATPDDAREILSLKGGDKVGF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
13 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
14 2643221569 Achromobacter sp. Root565 Isolate Unclassified
15 2643221594 Achromobacter sp. Root170 Isolate Unclassified
16 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
17 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
18 2643221621 Achromobacter sp. Root83 Isolate Unclassified
19 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
20 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
21 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
22 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
23 2721755523 Delftia sp. HK171 Isolate Unclassified
24 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
25 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
26 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
27 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
28 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
29 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
30 2773857925 Microvirga vignae BR3299 Isolate Unclassified
31 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
32 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
33 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
34 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
35 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
36 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
37 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
38 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
39 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
40 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
41 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
42 2855730933 Achromobacter sp. HZ28 Isolate Nodule
43 2855767633 Achromobacter sp. HZ34 Isolate Nodule
44 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
45 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
46 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
47 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
48 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
49 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
50 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
51 2858950400 Achromobacter sp. K91 Isolate Unclassified
52 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
53 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
54 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
55 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
56 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
57 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
58 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
59 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
60 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
61 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
62 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
63 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
64 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
65 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
66 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
67 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
68 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
69 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
70 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
71 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
72 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
73 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
74 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
75 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
76 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
77 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
78 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
79 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
80 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
81 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
82 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
83 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
84 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
85 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
86 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
87 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
88 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
89 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
90 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
91 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
92 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
93 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
94 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
95 2904564687 Burkholderia sp. 571 Isolate Unclassified
96 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
97 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
98 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
99 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
100 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
101 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
102 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
103 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
104 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
105 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
106 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
107 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
108 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
109 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
110 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
111 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
112 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
113 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
114 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
115 2928163908 Burkholderia sp. 567 Isolate Unclassified
116 2928536128 Burkholderia sola 565 Isolate Unclassified
117 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
118 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
119 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
120 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
121 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
122 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
123 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
124 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
125 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
126 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
127 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
128 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
129 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
130 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
131 2941479691
132 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
133 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
134 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
135 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
136 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
137 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
138 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
139 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
140 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
141 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
142 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
143 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
144 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
145 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
146 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
147 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
148 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
149 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
150 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
151 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
152 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
153 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
154 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
155 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
156 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
157 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
158 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
159 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
160 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
161 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
162 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
163 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
164 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
165 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
166 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
167 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
168 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
169 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
170 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
171 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
172 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
173 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
174 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
175 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
176 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
177 3004167301 Mesorhizobium loti 582 Isolate Unclassified
178 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
179 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
180 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
181 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
182 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
183 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
184 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
185 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
186 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
187 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
188 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
189 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
190 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
191 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
192 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
193 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
194 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
195 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
196 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
197 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
198 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
199 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
200 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
201 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
202 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
203 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
204 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
205 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
206 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
207 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
208 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
209 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
210 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
211 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
212 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
213 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
214 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
215 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
216 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
217 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
218 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
219 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
220 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
221 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
222 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
223 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
228 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
229 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
230 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
231 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
232 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
233 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
234 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
235 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
236 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
237 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
238 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
239 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
240 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
241 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
242 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
243 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
244 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
245 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
246 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
247 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
248 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
249 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
250 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
251 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
252 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
253 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
254 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
255 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
258 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
259 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
260 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
261 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
262 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
263 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
264 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
265 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
266 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
267 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
268 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
269 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
270 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
271 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
277 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
325 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
327 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
328 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
330 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
331 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
332 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
333 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
334 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
335 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
336 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
337 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
338 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
342 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
348 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
349 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
350 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
351 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
352 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
353 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
354 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
355 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
360 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
361 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
362 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
366 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
367 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
373 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
374 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
375 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
376 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
377 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
378 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
379 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
380 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
381 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
382 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
383 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
384 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
385 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
389 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
390 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
391 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
392 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
398 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
405 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
406 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
407 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
408 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
409 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
410 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
411 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
417 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
418 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
421 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
427 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
428 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
429 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
433 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
434 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
435 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
436 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
437 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
438 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
477 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
478 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
479 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
481 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
482 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
483 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
484 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
487 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
488 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
489 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
492 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
495 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
496 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
497 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
498 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
499 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
500 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
501 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
502 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
503 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
504 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
505 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
506 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
507 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
508 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
509 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
510 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
511 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
512 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.63
Metatranscriptomes 0
Isolates 24.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.96
Nodule 16.53
Rhizoplane 6.03
Rhizosphere 57.78
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001964 3300001979 Bacteria 9382
2 JGI24739J22299_10001531 3300001989 Bacteria 8732
3 JGI24737J22298_10008759 3300001990 Bacteria 3377
4 JGI24737J22298_10012489 3300001990 Bacteria 2770
5 JGI24735J21928_10000021 3300002067 Bacteria 99198
6 JGI24735J21928_10000179 3300002067 Bacteria 22562
7 JGI24735J21928_10000466 3300002067 Bacteria 14220
8 JGI24738J21930_10003992 3300002075 Bacteria 3664
9 JGI25151J46595_10001622 3300003187 Bacteria 14871
10 JGI25151J46595_10001670 3300003187 Bacteria 14555
11 JGI25151J46595_10003677 3300003187 Bacteria 8351
12 JGI25151J46595_10003933 3300003187 Bacteria 8015
13 JGI25153J46596_10034452 3300003215 Bacteria 1655
14 rootH1_10048791 3300003316 Bacteria 2952
15 Ga0055527_1000335 3300003760 Bacteria 24237
16 Ga0055535_1000267 3300003761 Bacteria 54799
17 Ga0055542_1000175 3300003762 Bacteria 79760
18 Ga0055542_1001872 3300003762 Bacteria 8427
19 Ga0055529_1000131 3300003763 Bacteria 105530
20 Ga0055537_1000428 3300003773 Bacteria 27372
21 Ga0055537_1000433 3300003773 Bacteria 27034
22 Ga0055536_1003283 3300003781 Bacteria 8750
23 Ga0055536_1009944 3300003781 Bacteria 3853
24 Ga0055534_1000008 3300003784 Bacteria 211098
25 Ga0055528_1003161 3300003790 Bacteria 8429
26 Ga0055528_1003690 3300003790 Bacteria 7588
27 Ga0055540_1003300 3300003792 Bacteria 7869
28 Ga0055531_10002668 3300003794 Bacteria 11763
29 Ga0065714_10020982 3300005288 Bacteria 1340
30 Ga0070676_10016208 3300005328 Bacteria 4118
31 Ga0070683_100066990 3300005329 Bacteria 3344
32 Ga0070670_100089227 3300005331 Bacteria 2650
33 Ga0070666_10049415 3300005335 Bacteria 2827
34 Ga0070682_100043866 3300005337 Bacteria 2766
35 Ga0070660_100000060 3300005339 Bacteria 63781
36 Ga0070661_100212918 3300005344 Bacteria 1480
37 Ga0070668_100102032 3300005347 Bacteria 2274
38 Ga0070669_100022162 3300005353 Bacteria 4542
39 Ga0070675_100016920 3300005354 Bacteria 5791
40 Ga0070671_100189520 3300005355 Bacteria 1743
41 Ga0070673_100111890 3300005364 Bacteria 2266
42 Ga0070659_100000105 3300005366 Bacteria 61709
43 Ga0070659_100130274 3300005366 Bacteria 2042
44 Ga0070667_100163748 3300005367 Bacteria 1960
45 Ga0070663_100004136 3300005455 Bacteria 8481
46 Ga0070663_100038590 3300005455 Bacteria 3332
47 Ga0070663_100087873 3300005455 Bacteria 2298
48 Ga0070663_100090535 3300005455 Bacteria 2266
49 Ga0070678_100029470 3300005456 Bacteria 3758
50 Ga0070662_100001117 3300005457 Bacteria 16378
51 Ga0070684_100299612 3300005535 Bacteria 1475
52 Ga0068853_100003394 3300005539 Bacteria 12196
53 Ga0068853_100053084 3300005539 Bacteria 3491
54 Ga0068853_100140707 3300005539 Bacteria 2166
55 Ga0070665_100072894 3300005548 Bacteria 3441
56 Ga0070665_100155612 3300005548 Bacteria 2288
57 Ga0068855_100005206 3300005563 Bacteria 15863
58 Ga0068855_100192011 3300005563 Bacteria 2303
59 Ga0070664_100047047 3300005564 Bacteria 3644
60 Ga0068857_100001830 3300005577 Bacteria 17110
61 Ga0068854_100014116 3300005578 Bacteria 5258
62 Ga0068856_100005144 3300005614 Bacteria 12918
63 Ga0068852_100004727 3300005616 Bacteria 9663
64 Ga0068851_10004146 3300005834 Bacteria 6523
65 Ga0070717_10004861 3300006028 Bacteria 9772
66 Ga0075365_10010855 3300006038 Bacteria 5329
67 Ga0075364_10035320 3300006051 Bacteria 3230
68 Ga0075370_10002532 3300006353 Bacteria 8491
69 Ga0075370_10053986 3300006353 Bacteria 2281
70 Ga0075430_100240566 3300006846 Bacteria 1500
71 Ga0075433_10015205 3300006852 Bacteria 6307
72 Ga0075434_100013935 3300006871 Bacteria 7671
73 Ga0079104_1000007 3300006946 Bacteria 390531
74 Ga0099826_10000084 3300006948 Bacteria 46867
75 Ga0099795_10049754 3300007788 Bacteria 1522
76 Ga0105251_10000785 3300009011 Bacteria 28819
77 Ga0105251_10001106 3300009011 Bacteria 23423
78 Ga0105251_10017710 3300009011 Bacteria 3808
79 Ga0105244_10044711 3300009036 Bacteria 2280
80 Ga0105250_10008651 3300009092 Bacteria 4314
81 Ga0105250_10021604 3300009092 Bacteria 2597
82 Ga0105250_10073777 3300009092 Bacteria 1380
83 Ga0105240_10007552 3300009093 Bacteria 15757
84 Ga0105240_10047662 3300009093 Bacteria 5421
85 Ga0105240_10116246 3300009093 Bacteria 3228
86 Ga0105240_10154754 3300009093 Bacteria 2728
87 Ga0111539_10010305 3300009094 Bacteria 11766
88 Ga0111539_11118142 3300009094 Bacteria 915
89 Ga0105245_10046145 3300009098 Bacteria 3893
90 Ga0105245_10594039 3300009098 Bacteria 1133
91 Ga0105247_10014704 3300009101 Bacteria 4692
92 Ga0114129_10009151 3300009147 Bacteria 14120
93 Ga0114129_10288691 3300009147 Bacteria 2190
94 Ga0105243_10000538 3300009148 Bacteria 38381
95 Ga0105243_10001515 3300009148 Bacteria 20296
96 Ga0105243_10126952 3300009148 Bacteria 2159
97 Ga0105241_10001889 3300009174 Bacteria 15869
98 Ga0105241_10046629 3300009174 Bacteria 3292
99 Ga0105241_10067474 3300009174 Bacteria 2769
100 Ga0105248_10069030 3300009177 Bacteria 3968
101 Ga0105237_10004677 3300009545 Bacteria 15755
102 Ga0105237_10011794 3300009545 Bacteria 9246
103 Ga0105237_10116335 3300009545 Bacteria 2667
104 Ga0105237_10123587 3300009545 Bacteria 2582
105 Ga0105237_10514138 3300009545 Bacteria 1204
106 Ga0105238_10003442 3300009551 Bacteria 15757
107 Ga0105238_10055515 3300009551 Bacteria 3975
108 Ga0105238_10095371 3300009551 Bacteria 2962
109 Ga0105239_10014965 3300010375 Bacteria 8600
110 Ga0105239_10037516 3300010375 Bacteria 5310
111 Ga0105239_10047873 3300010375 Bacteria 4686
112 Ga0157373_10021715 3300013100 Bacteria 4658
113 Ga0157371_10051329 3300013102 Bacteria 2931
114 Ga0157370_10001878 3300013104 Bacteria 25891
115 Ga0157370_10007059 3300013104 Bacteria 12263
116 Ga0157370_10112212 3300013104 Bacteria 2548
117 Ga0157370_10196210 3300013104 Bacteria 1873
118 Ga0157369_10003126 3300013105 Bacteria 19790
119 Ga0157369_10006744 3300013105 Bacteria 13250
120 Ga0157369_10150209 3300013105 Bacteria 2462
121 Ga0157369_10383251 3300013105 Bacteria 1459
122 Ga0157369_10424536 3300013105 Bacteria 1378
123 Ga0157374_10017267 3300013296 Bacteria 6351
124 Ga0157374_10031859 3300013296 Bacteria 4796
125 Ga0157374_10069147 3300013296 Bacteria 3324
126 Ga0157374_10201179 3300013296 Bacteria 1951
127 Ga0157378_10017744 3300013297 Bacteria 6249
128 Ga0163162_10008134 3300013306 Bacteria 10234
129 Ga0163162_10412841 3300013306 Bacteria 1482
130 Ga0163162_10446331 3300013306 Bacteria 1425
131 Ga0157372_10004099 3300013307 Bacteria 15628
132 Ga0157372_10139241 3300013307 Bacteria 2795
133 Ga0157372_10780717 3300013307 Bacteria 1110
134 Ga0157375_10108186 3300013308 Bacteria 2874
135 Ga0182008_10079704 3300014497 Bacteria 1611
136 Ga0157376_10276879 3300014969 Bacteria 1579
137 Ga0182005_1008866 3300015265 Bacteria 2951
138 Ga0163161_10001698 3300017792 Bacteria 16165
139 Ga0213876_10001668 3300021384 Bacteria 13546
140 Ga0209672_100031 3300025228 Bacteria 332889
141 Ga0209672_100158 3300025228 Bacteria 58904
142 Ga0209147_100040 3300025229 Bacteria 307612
143 Ga0209258_100061 3300025242 Bacteria 313501
144 Ga0209646_1016612 3300025246 Bacteria 1090
145 Ga0209148_1000050 3300025254 Bacteria 413178
146 Ga0209148_1000070 3300025254 Bacteria 332889
147 Ga0209148_1004490 3300025254 Bacteria 3428
148 Ga0209759_1017860 3300025256 Bacteria 1733
149 Ga0209565_1000042 3300025263 Bacteria 239712
150 Ga0209565_1006273 3300025263 Bacteria 3358
151 Ga0209455_1000069 3300025272 Bacteria 308247
152 Ga0209455_1000183 3300025272 Bacteria 99952
153 Ga0209673_1000026 3300025273 Bacteria 373739
154 Ga0209673_1000071 3300025273 Bacteria 239966
155 Ga0209675_1000041 3300025291 Bacteria 239712
156 Ga0209676_1000301 3300025292 Bacteria 99952
157 Ga0209676_1001163 3300025292 Bacteria 28546
158 Ga0209676_1021223 3300025292 Bacteria 2186
159 Ga0209025_1000026 3300025294 Bacteria 519850
160 Ga0209025_1000073 3300025294 Bacteria 282133
161 Ga0209025_1000113 3300025294 Bacteria 218943
162 Ga0209025_1000307 3300025294 Bacteria 108704
163 Ga0209025_1000387 3300025294 Bacteria 91323
164 Ga0209025_1014274 3300025294 Bacteria 4905
165 Ga0209564_1030464 3300025295 Bacteria 1671
166 Ga0209758_1000573 3300025297 Bacteria 57583
167 Ga0209050_1004017 3300025298 Bacteria 10357
168 Ga0207426_1000965 3300025302 Bacteria 28363
169 Ga0207426_1000982 3300025302 Bacteria 28021
170 Ga0209051_1001159 3300025303 Bacteria 23972
171 Ga0209051_1002220 3300025303 Bacteria 14326
172 Ga0209051_1036907 3300025303 Bacteria 1799
173 Ga0209257_1004548 3300025304 Bacteria 10621
174 Ga0207697_10003124 3300025315 Bacteria 8277
175 Ga0207656_10001956 3300025321 Bacteria 6852
176 Ga0207696_1022993 3300025711 Bacteria 1972
177 Ga0207655_1013437 3300025728 Bacteria 4701
178 Ga0207713_1003488 3300025735 Bacteria 10687
179 Ga0207713_1059249 3300025735 Bacteria 1470
180 Ga0207647_10017310 3300025904 Bacteria 4900
181 Ga0207647_10033801 3300025904 Bacteria 3270
182 Ga0207647_10038780 3300025904 Bacteria 3010
183 Ga0207647_10079244 3300025904 Bacteria 1972
184 Ga0207645_10003783 3300025907 Bacteria 11364
185 Ga0207705_10000642 3300025909 Bacteria 29173
186 Ga0207705_10051673 3300025909 Bacteria 2958
187 Ga0207654_10000275 3300025911 Bacteria 31294
188 Ga0207695_10001242 3300025913 Bacteria 43591
189 Ga0207695_10004197 3300025913 Bacteria 19798
190 Ga0207695_10055858 3300025913 Bacteria 4112
191 Ga0207671_10039829 3300025914 Bacteria 3480
192 Ga0207671_10052049 3300025914 Bacteria 3034
193 Ga0207671_10258967 3300025914 Bacteria 1369
194 Ga0207657_10001165 3300025919 Bacteria 27919
195 Ga0207657_10054794 3300025919 Bacteria 3446
196 Ga0207657_10198049 3300025919 Bacteria 1617
197 Ga0207694_10001514 3300025924 Bacteria 19795
198 Ga0207694_10036123 3300025924 Bacteria 3791
199 Ga0207694_10090521 3300025924 Bacteria 2414
200 Ga0207650_10118614 3300025925 Bacteria 2057
201 Ga0207687_10048287 3300025927 Bacteria 2954
202 Ga0207690_10000115 3300025932 Bacteria 65817
203 Ga0207690_10127777 3300025932 Bacteria 1856
204 Ga0207690_10184197 3300025932 Bacteria 1574
205 Ga0207706_10004093 3300025933 Bacteria 13778
206 Ga0207709_10000112 3300025935 Bacteria 127357
207 Ga0207709_10001057 3300025935 Bacteria 20345
208 Ga0207691_10020459 3300025940 Bacteria 6255
209 Ga0207711_10094670 3300025941 Bacteria 2633
210 Ga0207661_10038278 3300025944 Bacteria 3758
211 Ga0207679_10031808 3300025945 Bacteria 3697
212 Ga0207667_10023159 3300025949 Bacteria 6840
213 Ga0207667_10032826 3300025949 Bacteria 5588
214 Ga0207651_10180080 3300025960 Bacteria 1676
215 Ga0207668_10233462 3300025972 Bacteria 1484
216 Ga0207640_10012604 3300025981 Bacteria 4821
217 Ga0207658_10099880 3300025986 Bacteria 2271
218 Ga0207703_10365850 3300026035 Bacteria 1331
219 Ga0207639_10000210 3300026041 Bacteria 44226
220 Ga0207639_10000280 3300026041 Bacteria 36724
221 Ga0207639_10081456 3300026041 Bacteria 2564
222 Ga0207678_10000576 3300026067 Bacteria 33612
223 Ga0207678_10006339 3300026067 Bacteria 10500
224 Ga0207678_10007574 3300026067 Bacteria 9596
225 Ga0207678_10233532 3300026067 Bacteria 1575
226 Ga0207702_10002988 3300026078 Bacteria 15741
227 Ga0207676_10016766 3300026095 Bacteria 5304
228 Ga0207674_10001961 3300026116 Bacteria 26062
229 Ga0207674_10323883 3300026116 Bacteria 1491
230 Ga0207683_10009519 3300026121 Bacteria 8282
231 Ga0207683_10586703 3300026121 Bacteria 1031
232 Ga0207698_10004738 3300026142 Bacteria 8321
233 Ga0207698_10004765 3300026142 Bacteria 8300
234 Ga0209281_1000020 3300027111 Bacteria 575972
235 Ga0209371_1000971 3300027312 Bacteria 22220
236 Ga0209282_1000112 3300027666 Bacteria 53120
237 Ga0207428_10019979 3300027907 Bacteria 5705
238 Ga0207428_10272570 3300027907 Bacteria 1258
239 Ga0268266_10256433 3300028379 Bacteria 1619
240 Ga0268266_10382919 3300028379 Bacteria 1327
241 Ga0268256_1000821 3300030500 Bacteria 22220
242 Ga0265340_10008869 3300031247 Bacteria 5419
243 Ga0265327_10000108 3300031251 Bacteria 183209
244 Ga0307408_100008944 3300031548 Bacteria 6615
245 Ga0307408_100092161 3300031548 Bacteria 2290
246 Ga0307408_100107285 3300031548 Bacteria 2138
247 Ga0307408_100203985 3300031548 Bacteria 1602
248 Ga0307405_10009497 3300031731 Bacteria 4991
249 Ga0307405_10125375 3300031731 Bacteria 1765
250 Ga0307410_10096878 3300031852 Bacteria 2106
251 Ga0307410_10188106 3300031852 Bacteria 1568
252 Ga0307410_10304433 3300031852 Bacteria 1259
253 Ga0307406_10090619 3300031901 Bacteria 2058
254 Ga0307407_10107651 3300031903 Bacteria 1744
255 Ga0307412_10000021 3300031911 Bacteria 250629
256 Ga0307412_10000199 3300031911 Bacteria 41000
257 Ga0307412_10003193 3300031911 Bacteria 9106
258 Ga0307412_10429829 3300031911 Bacteria 1082
259 Ga0307409_100010499 3300031995 Bacteria 5764
260 Ga0307416_100003033 3300032002 Bacteria 9815
261 Ga0307416_100079069 3300032002 Bacteria 2770
262 Ga0307416_100082414 3300032002 Bacteria 2725
263 Ga0307416_100204781 3300032002 Bacteria 1876
264 Ga0307414_10135370 3300032004 Bacteria 1920
265 Ga0307414_10251577 3300032004 Bacteria 1469
266 Ga0307414_10332183 3300032004 Bacteria 1298
267 Ga0307411_10018647 3300032005 Bacteria 3987
268 Ga0307411_10029169 3300032005 Bacteria 3365
269 Ga0316584_0220605 3300036712 Bacteria 1393
270 Ga0395899_0001350 3300037312 Bacteria 21128
271 Ga0395900_0003263 3300037418 Bacteria 17573
272 Ga0395898_0002587 3300037466 Bacteria 21139
273 Ga0395898_0003486 3300037466 Bacteria 17573
274 Ga0395905_0002203 3300037471 Bacteria 22010
275 Ga0395905_0003218 3300037471 Bacteria 17573
276 Ga0395905_0070959 3300037471 Bacteria 3265
277 Ga0395905_0167754 3300037471 Bacteria 2063
278 Ga0436364_1500701 3300037853 Bacteria 2848
279 Ga0395901_0002823 3300038443 Bacteria 17545
280 Ga0395901_0011955 3300038443 Bacteria 8802
281 Ga0395901_0024390 3300038443 Bacteria 6207
282 Ga0395901_0437589 3300038443 Bacteria 1339
283 Ga0436365_0781525 3300039437 Bacteria 13622
284 Ga0436365_1641635 3300039437 Bacteria 5698
285 Ga0439466_0043955 3300041411 Bacteria 1482
286 Ga0466969_0002785 3300044656 Bacteria 9338
287 Ga0453683_0004282 3300044673 Bacteria 10176
288 Ga0466965_0083609 3300044683 Bacteria 1616
289 Ga0466961_0042674 3300044693 Bacteria 2907
290 Ga0466970_0042166 3300044765 Bacteria 2427
291 Ga0466959_0014112 3300045049 Bacteria 5797
292 Ga0451576_0002450 3300045051 Bacteria 27662
293 Ga0466967_0039385 3300045976 Bacteria 4063
294 Ga0466967_0417448 3300045976 Bacteria 1307
295 Ga0495592_0035395 3300046454 Bacteria 3762
296 Ga0495603_0000115 3300046455 Bacteria 38890
297 Ga0495603_0008106 3300046455 Bacteria 6346
298 Ga0495590_0008645 3300046457 Bacteria 3879
299 Ga0495591_019786 3300046458 Bacteria 2244
300 Ga0495629_0000111 3300046459 Bacteria 73381
301 Ga0495629_0000432 3300046459 Bacteria 34964
302 Ga0495629_0002672 3300046459 Bacteria 13643
303 Ga0495629_0006729 3300046459 Bacteria 8497
304 Ga0495629_0007141 3300046459 Bacteria 8230
305 Ga0495638_0123038 3300046460 Bacteria 1531
306 Ga0495651_0068251 3300046462 Bacteria 2710
307 Ga0495653_0002714 3300046463 Bacteria 14102
308 Ga0495653_0008865 3300046463 Bacteria 8231
309 Ga0495653_0018434 3300046463 Bacteria 5668
310 Ga0495653_0098639 3300046463 Bacteria 2121
311 Ga0495653_0140474 3300046463 Bacteria 1699
312 Ga0495650_0000681 3300046471 Bacteria 44150
313 Ga0495650_0001326 3300046471 Bacteria 24868
314 Ga0495580_0006962 3300046472 Bacteria 9119
315 Ga0495580_0014713 3300046472 Bacteria 5930
316 Ga0495580_0015632 3300046472 Bacteria 5718
317 Ga0495580_0057681 3300046472 Bacteria 2732
318 Ga0495580_0105299 3300046472 Bacteria 1960
319 Ga0495582_0009528 3300046473 Bacteria 5350
320 Ga0495605_0014058 3300046474 Bacteria 4391
321 Ga0495639_0016256 3300046475 Bacteria 3229
322 Ga0495662_0003788 3300046476 Bacteria 7623
323 Ga0495664_0000813 3300046477 Bacteria 15979
324 Ga0495664_0057303 3300046477 Bacteria 2318
325 Ga0495664_0122947 3300046477 Bacteria 1569
326 Ga0495584_0026184 3300046491 Bacteria 2955
327 Ga0495584_0043016 3300046491 Bacteria 2280
328 Ga0495584_0121309 3300046491 Bacteria 1324
329 Ga0495585_0195100 3300046492 Bacteria 1034
330 Ga0495594_0066459 3300046499 Bacteria 2000
331 Ga0495594_0109974 3300046499 Bacteria 1554
332 Ga0495594_0159051 3300046499 Bacteria 1284
333 Ga0495596_0005232 3300046500 Bacteria 6164
334 Ga0495596_0010986 3300046500 Bacteria 3922
335 Ga0495596_0023330 3300046500 Bacteria 2511
336 Ga0495596_0105394 3300046500 Bacteria 1095
337 Ga0495583_0015739 3300046506 Bacteria 4098
338 Ga0495583_0016468 3300046506 Bacteria 3971
339 Ga0495606_0003045 3300046507 Bacteria 18275
340 Ga0495606_0003625 3300046507 Bacteria 16226
341 Ga0495606_0052837 3300046507 Bacteria 2639
342 Ga0495608_0001030 3300046511 Bacteria 19558
343 Ga0495608_0026577 3300046511 Bacteria 3944
344 Ga0495608_0063302 3300046511 Bacteria 2428
345 Ga0495610_0001663 3300046512 Bacteria 19543
346 Ga0495618_0023948 3300046514 Bacteria 3780
347 Ga0495618_0090660 3300046514 Bacteria 1954
348 Ga0495618_0117790 3300046514 Bacteria 1701
349 Ga0495620_0000640 3300046515 Bacteria 21757
350 Ga0495628_0019402 3300046516 Bacteria 5622
351 Ga0495628_0021726 3300046516 Bacteria 5274
352 Ga0495630_0003995 3300046517 Bacteria 10320
353 Ga0495630_0004112 3300046517 Bacteria 10187
354 Ga0495631_0030935 3300046518 Bacteria 2426
355 Ga0495631_0059173 3300046518 Bacteria 1665
356 Ga0495632_0002605 3300046519 Bacteria 13596
357 Ga0495648_0005165 3300046524 Bacteria 10924
358 Ga0495648_0123824 3300046524 Bacteria 1385
359 Ga0495666_0000120 3300046526 Bacteria 32561
360 Ga0495642_0003281 3300046528 Bacteria 6397
361 Ga0495642_0005435 3300046528 Bacteria 4894
362 Ga0495642_0026586 3300046528 Bacteria 2299
363 Ga0495652_0010011 3300046529 Bacteria 8593
364 Ga0495652_0011966 3300046529 Bacteria 7845
365 Ga0495652_0102931 3300046529 Bacteria 2312
366 Ga0495654_0041467 3300046530 Bacteria 2289
367 Ga0495665_0000183 3300046531 Bacteria 31950
368 Ga0495665_0000239 3300046531 Bacteria 27614
369 Ga0495665_0019318 3300046531 Bacteria 3664
370 Ga0495665_0020982 3300046531 Bacteria 3510
371 Ga0495640_0001503 3300046533 Bacteria 18377
372 Ga0495586_0012104 3300046535 Bacteria 4580
373 Ga0495586_0038960 3300046535 Bacteria 2554
374 Ga0495586_0067089 3300046535 Bacteria 1956
375 Ga0495586_0071134 3300046535 Bacteria 1900
376 Ga0495587_0019682 3300046536 Bacteria 4174
377 Ga0495587_0029061 3300046536 Bacteria 3358
378 Ga0495587_0054743 3300046536 Bacteria 2351
379 Ga0495587_0061191 3300046536 Bacteria 2206
380 Ga0495597_0001163 3300046542 Bacteria 19763
381 Ga0495597_0027457 3300046542 Bacteria 2610
382 Ga0495645_0000928 3300046543 Bacteria 19942
383 Ga0495645_0002267 3300046543 Bacteria 13087
384 Ga0495645_0025722 3300046543 Bacteria 4273
385 Ga0495645_0101234 3300046543 Bacteria 2048
386 Ga0495645_0110359 3300046543 Bacteria 1947
387 Ga0495622_0000115 3300046557 Bacteria 69111
388 Ga0495667_0026792 3300046559 Bacteria 3884
389 Ga0495656_0001038 3300046615 Bacteria 8987
390 Ga0495668_0046342 3300046616 Bacteria 2415
391 Ga0495634_0031592 3300046642 Bacteria 3645
392 Ga0495634_0158610 3300046642 Bacteria 1427
393 Ga0495611_0049910 3300046648 Bacteria 1884
394 Ga0495625_0000052 3300046660 Bacteria 190656
395 Ga0495635_0004416 3300046663 Bacteria 9739
396 Ga0495635_0025633 3300046663 Bacteria 4108
397 Ga0495635_0037716 3300046663 Bacteria 3345
398 Ga0495659_0008926 3300046664 Bacteria 3194
399 Ga0495661_0001916 3300046665 Bacteria 16560
400 Ga0495588_0001274 3300046674 Bacteria 10806
401 Ga0495588_0010138 3300046674 Bacteria 4371
402 Ga0495588_0059157 3300046674 Bacteria 1982
403 Ga0495588_0067791 3300046674 Bacteria 1852
404 Ga0495588_0072867 3300046674 Bacteria 1787
405 Ga0495623_0000735 3300046679 Bacteria 21966
406 Ga0495623_0002004 3300046679 Bacteria 13669
407 Ga0495623_0002295 3300046679 Bacteria 12744
408 Ga0495623_0021196 3300046679 Bacteria 4198
409 Ga0495623_0236671 3300046679 Bacteria 1033
410 Ga0495646_0012933 3300046680 Bacteria 5305
411 Ga0495646_0021705 3300046680 Bacteria 4055
412 Ga0495646_0050989 3300046680 Bacteria 2506
413 Ga0495646_0052044 3300046680 Bacteria 2475
414 Ga0495646_0061254 3300046680 Bacteria 2241
415 Ga0495646_0152262 3300046680 Bacteria 1285
416 Ga0495669_0002555 3300046684 Bacteria 7431
417 Ga0495669_0007805 3300046684 Bacteria 4491
418 Ga0495669_0049849 3300046684 Bacteria 1876
419 Ga0495613_0002707 3300046689 Bacteria 13299
420 Ga0495613_0028567 3300046689 Bacteria 4148
421 Ga0495613_0101470 3300046689 Bacteria 2078
422 Ga0495613_0156474 3300046689 Bacteria 1623
423 Ga0495624_0000471 3300046690 Bacteria 31497
424 Ga0495624_0007388 3300046690 Bacteria 7715
425 Ga0495624_0046645 3300046690 Bacteria 2755
426 Ga0495670_0004902 3300046691 Bacteria 6574
427 Ga0495670_0036872 3300046691 Bacteria 2437
428 Ga0495670_0106382 3300046691 Bacteria 1449
429 Ga0495671_0019792 3300046692 Bacteria 3554
430 Ga0495671_0051755 3300046692 Bacteria 2042
431 Ga0495671_0089623 3300046692 Bacteria 1506
432 Ga0495649_0009639 3300046694 Bacteria 5725
433 Ga0495649_0025354 3300046694 Bacteria 3302
434 Ga0495589_0014903 3300046794 Bacteria 4000
435 Ga0495589_0031066 3300046794 Bacteria 2689
436 Ga0495589_0079778 3300046794 Bacteria 1592
437 Ga0495600_0004212 3300046809 Bacteria 8585
438 Ga0495600_0016957 3300046809 Bacteria 4630
439 Ga0495660_0039725 3300046810 Bacteria 2612
440 Ga0495581_0001779 3300047315 Bacteria 12038
441 Ga0495581_0003591 3300047315 Bacteria 8921
442 Ga0495581_0013691 3300047315 Bacteria 4702
443 Ga0495581_0018957 3300047315 Bacteria 3993
444 Ga0495581_0029023 3300047315 Bacteria 3208
445 Ga0495604_0003479 3300047317 Bacteria 12558
446 Ga0495604_0039011 3300047317 Bacteria 3734
447 Ga0495604_0092092 3300047317 Bacteria 2246
448 Ga0495604_0101326 3300047317 Bacteria 2115
449 Ga0495636_0023272 3300047318 Bacteria 2507
450 Ga0495674_0004653 3300047319 Bacteria 13191
451 Ga0495674_0006385 3300047319 Bacteria 11304
452 Ga0495674_0030150 3300047319 Bacteria 4934
453 Ga0495674_0056536 3300047319 Bacteria 3435
454 Ga0495672_0002500 3300047320 Bacteria 16819
455 Ga0495680_0036140 3300047322 Bacteria 3970
456 Ga0495680_0037536 3300047322 Bacteria 3879
457 Ga0495680_0055439 3300047322 Bacteria 3074
458 Ga0495683_0002608 3300047323 Bacteria 10820
459 Ga0495683_0003057 3300047323 Bacteria 9829
460 Ga0495683_0003168 3300047323 Bacteria 9611
461 Ga0495683_0010823 3300047323 Bacteria 4811
462 Ga0495683_0039615 3300047323 Bacteria 2381
463 Ga0495683_0110483 3300047323 Bacteria 1313
464 Ga0495687_000020 3300047443 Bacteria 337717
465 Ga0495687_009870 3300047443 Bacteria 5290
466 Ga0495687_010401 3300047443 Bacteria 5105
467 Ga0495675_0001188 3300047444 Bacteria 15769
468 Ga0495675_0029177 3300047444 Bacteria 3517
469 Ga0495675_0035095 3300047444 Bacteria 3204
470 Ga0495675_0046368 3300047444 Bacteria 2767
471 Ga0495675_0078003 3300047444 Bacteria 2086
472 Ga0495673_0001172 3300047469 Bacteria 22155
473 Ga0495673_0072563 3300047469 Bacteria 1444
474 Ga0495681_0039813 3300047470 Bacteria 2292
475 Ga0495681_0099252 3300047470 Bacteria 1275
476 Ga0495686_0000002 3300047472 Bacteria 1050777
477 Ga0495686_0097466 3300047472 Bacteria 1777
478 Ga0495593_0000414 3300047673 Bacteria 23743
479 Ga0495593_0002167 3300047673 Bacteria 11742
480 Ga0495593_0013364 3300047673 Bacteria 4684
481 Ga0495593_0015994 3300047673 Bacteria 4236
482 Ga0495602_0001650 3300048088 Bacteria 22204
483 Ga0495602_0004155 3300048088 Bacteria 15080
484 Ga0495602_0013684 3300048088 Bacteria 8277
485 Ga0495602_0035833 3300048088 Bacteria 4623
486 Ga0495602_0056734 3300048088 Bacteria 3441
487 Ga0495602_0137068 3300048088 Bacteria 1942
488 Ga0495614_0001485 3300048089 Bacteria 10155
489 Ga0495614_0008753 3300048089 Bacteria 4495
490 Ga0495626_0004820 3300048091 Bacteria 8134
491 Ga0495626_0028454 3300048091 Bacteria 2709
492 Ga0496100_0002614 3300048903 Bacteria 9178
493 Ga0496100_0013067 3300048903 Bacteria 4778
494 Ga0496100_0319151 3300048903 Bacteria 1167
495 Ga0496101_0004570 3300048904 Bacteria 8738
496 Ga0496101_0065794 3300048904 Bacteria 2642
497 Ga0496101_0090448 3300048904 Bacteria 2276
498 Ga0496101_0129159 3300048904 Bacteria 1917
499 Ga0496102_0014642 3300048905 Bacteria 6817
500 Ga0496102_0025174 3300048905 Bacteria 5294
501 Ga0496102_0032534 3300048905 Bacteria 4685
502 Ga0496102_0188842 3300048905 Bacteria 1941
503 Ga0496103_0000812 3300048906 Bacteria 22911
504 Ga0496103_0015039 3300048906 Bacteria 4600
505 Ga0496104_0011962 3300048907 Bacteria 7787
506 Ga0496104_0128458 3300048907 Bacteria 2434
507 Ga0496104_0202761 3300048907 Bacteria 1895
508 Ga0496106_0000036 3300048909 Bacteria 124990
509 Ga0496106_0004044 3300048909 Bacteria 10947
510 Ga0496106_0062694 3300048909 Bacteria 2823
511 Ga0496107_0002435 3300048910 Bacteria 12061
512 Ga0496107_0010747 3300048910 Bacteria 6367
513 Ga0496108_0125184 3300048911 Bacteria 2206
514 Ga0496109_0014927 3300048912 Bacteria 6762
515 Ga0496109_0089435 3300048912 Bacteria 2846
516 Ga0496109_0544190 3300048912 Bacteria 1095
517 Ga0496110_0012080 3300048913 Bacteria 7094
518 Ga0496110_0226277 3300048913 Bacteria 1701
519 Ga0496110_0229640 3300048913 Bacteria 1687
520 Ga0496110_0404040 3300048913 Bacteria 1245
521 Ga0496111_0002196 3300048914 Bacteria 11698
522 Ga0496111_0022147 3300048914 Bacteria 4445
523 Ga0496112_0005803 3300048915 Bacteria 10741
524 Ga0496112_0020914 3300048915 Bacteria 6212
525 Ga0496112_0039023 3300048915 Bacteria 4638
526 Ga0496112_0094058 3300048915 Bacteria 2968
527 Ga0496112_0181995 3300048915 Bacteria 2065
528 Ga0496113_0012187 3300048916 Bacteria 5770
529 Ga0496113_0036749 3300048916 Bacteria 3590
530 Ga0496113_0049560 3300048916 Bacteria 3127
531 Ga0496113_0207556 3300048916 Bacteria 1559
532 Ga0496113_0485575 3300048916 Bacteria 992
533 Ga0496114_0004527 3300048917 Bacteria 10791
534 Ga0496114_0008761 3300048917 Bacteria 8014
535 Ga0496114_0057947 3300048917 Bacteria 3234
536 Ga0496114_0075813 3300048917 Bacteria 2833
537 Ga0496114_0079862 3300048917 Bacteria 2762
538 Ga0496115_0201454 3300048918 Bacteria 1644
539 Ga0496115_0279636 3300048918 Bacteria 1370
540 Ga0496115_0392060 3300048918 Bacteria 1128
541 Ga0496116_0003463 3300048919 Bacteria 15558
542 Ga0496116_0005958 3300048919 Bacteria 11180
543 Ga0496116_0032012 3300048919 Bacteria 3754
544 Ga0496117_0002393 3300048920 Bacteria 23847
545 Ga0496117_0004328 3300048920 Bacteria 15790
546 Ga0496117_0007634 3300048920 Bacteria 10492
547 Ga0496117_0012902 3300048920 Bacteria 7325
548 Ga0496117_0016363 3300048920 Bacteria 6261
549 Ga0496117_0170749 3300048920 Bacteria 1262
550 Ga0496118_0003472 3300048921 Bacteria 19786
551 Ga0496118_0016037 3300048921 Bacteria 6897
552 Ga0496118_0019210 3300048921 Bacteria 6116
553 Ga0496119_0004110 3300048922 Bacteria 14670
554 Ga0496119_0048986 3300048922 Bacteria 2616
555 Ga0496120_0002947 3300048923 Bacteria 16215
556 Ga0496120_0026908 3300048923 Bacteria 3546
557 Ga0496121_0000140 3300048924 Bacteria 162689
558 Ga0496121_0002763 3300048924 Bacteria 26034
559 Ga0496121_0003313 3300048924 Bacteria 23134
560 Ga0496121_0018671 3300048924 Bacteria 6979
561 Ga0496121_0084290 3300048924 Bacteria 2506
562 Ga0496121_0086673 3300048924 Bacteria 2460
563 Ga0496122_0000582 3300048925 Bacteria 74845
564 Ga0496122_0026241 3300048925 Bacteria 5030
565 Ga0496122_0096881 3300048925 Bacteria 1987
566 Ga0496123_0000479 3300048926 Bacteria 69250
567 Ga0496123_0007721 3300048926 Bacteria 10044
568 Ga0496124_0000004 3300048927 Bacteria 976131
569 Ga0496124_0000724 3300048927 Bacteria 54104
570 Ga0496124_0014560 3300048927 Bacteria 7597
571 Ga0496124_0024203 3300048927 Bacteria 5527
572 Ga0496124_0127340 3300048927 Bacteria 2027
573 Ga0496125_0000190 3300048928 Bacteria 132540
574 Ga0496125_0010697 3300048928 Bacteria 9254
575 Ga0496126_0000105 3300048929 Bacteria 198893
576 Ga0496126_0000924 3300048929 Bacteria 50766
577 Ga0496126_0010554 3300048929 Bacteria 9665
578 Ga0496126_0153914 3300048929 Bacteria 1969
579 Ga0496126_0303608 3300048929 Bacteria 1316
580 Ga0496126_0362662 3300048929 Bacteria 1183
581 Ga0495682_0019454 3300049460 Bacteria 2553
582 Ga0501033_0011303 3300049570 Bacteria 6836
583 Ga0501033_0201710 3300049570 Bacteria 1420
584 Ga0501034_0000124 3300049571 Bacteria 142890
585 Ga0501034_0000331 3300049571 Bacteria 82931
586 Ga0501034_0016407 3300049571 Bacteria 7603
587 Ga0501034_0047017 3300049571 Bacteria 4359
588 Ga0501036_0067743 3300049572 Bacteria 3020
589 Ga0501037_0042520 3300049573 Bacteria 3338
590 Ga0501037_0164987 3300049573 Bacteria 1578
591 Ga0501038_0188327 3300049574 Bacteria 1661
592 Ga0501039_0064693 3300049575 Bacteria 2835
593 Ga0501043_0054854 3300049579 Bacteria 3130
594 Ga0501046_0056040 3300049580 Bacteria 3095
595 Ga0501047_0014752 3300049581 Bacteria 7435
596 Ga0501047_0365833 3300049581 Bacteria 1277
597 Ga0501067_0070777 3300049583 Bacteria 1931
598 Ga0501068_0035576 3300049584 Bacteria 2973
599 Ga0501070_0118527 3300049586 Bacteria 2187
600 Ga0501074_0383184 3300049590 Bacteria 997
601 Ga0501079_0130516 3300049741 Bacteria 1955
602 Ga0501080_0038273 3300049742 Bacteria 4478
603 Ga0501080_0166414 3300049742 Bacteria 2034
604 Ga0501035_0015361 3300049822 Bacteria 7066
605 Ga0501035_0233384 3300049822 Bacteria 1567
606 Ga0501044_0011583 3300049823 Bacteria 9558
607 Ga0501044_0015770 3300049823 Bacteria 8136
608 Ga0501044_0140341 3300049823 Bacteria 2405
609 nmdc:mga00v17_21394_c1 3300050491 Bacteria 3718
610 nmdc:mga0yw44_44450_c1 3300050492 Bacteria 2657
611 nmdc:mga06z11_20818_c1 3300050494 Bacteria 3037
612 nmdc:mga07m45_127633_c1 3300050496 Bacteria 1471
613 nmdc:mga07m45_17966_c1 3300050496 Bacteria 2485
614 nmdc:mga05p37_268551_c2 3300050507 Bacteria 1383
615 nmdc:mga05p37_645595_c1 3300050507 Bacteria 1186
616 nmdc:mga09592_112179_c1 3300050508 Bacteria 2339
617 nmdc:mga06r32_9922_c1 3300050510 Bacteria 8594
618 nmdc:mga08y16_151548_c1 3300050511 Bacteria 2410
619 nmdc:mga0n895_10480_c1 3300050512 Bacteria 8194
620 nmdc:mga0a205_13584_c1 3300050515 Bacteria 7586
621 Ga0500610_0000014 3300053079 Bacteria 84868
622 Ga0500643_000389 3300053087 Bacteria 33994
623 Ga0500643_001441 3300053087 Bacteria 13716
624 Ga0500658_0046565 3300053134 Bacteria 1757
625 Ga0500577_0019339 3300053142 Bacteria 2207
626 Ga0500645_007970 3300053730 Bacteria 3650
627 Ga0501084_0043258 3300054114 Bacteria 3768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2901300506 2901308597 277
2 3300038443 Ga0395901_0437589 Ga0395901_0437589_460_1329 281
3 iso_pu_bacteria 2965102966 2965103184 286
4 3300009094 Ga0111539_11118142 Ga0111539_111181421 289
5 3300009098 Ga0105245_10046145 Ga0105245_100461454 289
6 3300009147 Ga0114129_10288691 Ga0114129_102886912 289
7 3300013104 Ga0157370_10196210 Ga0157370_101962102 289
8 3300046474 Ga0495605_0014058 Ga0495605_0014058_43_912 289
9 3300046500 Ga0495596_0010986 Ga0495596_0010986_46_915 289
10 3300046535 Ga0495586_0012104 Ga0495586_0012104_3665_4534 289
11 3300046679 Ga0495623_0236671 Ga0495623_0236671_139_1008 289
12 3300046691 Ga0495670_0036872 Ga0495670_0036872_13_882 289
13 3300047319 Ga0495674_0030150 Ga0495674_0030150_4029_4898 289
14 3300047443 Ga0495687_010401 Ga0495687_010401_1586_2455 289
15 3300047444 Ga0495675_0046368 Ga0495675_0046368_11_880 289
16 3300048091 Ga0495626_0028454 Ga0495626_0028454_105_974 289
17 3300048917 Ga0496114_0075813 Ga0496114_0075813_818_1687 289
18 3300048929 Ga0496126_0362662 Ga0496126_0362662_35_904 289
19 3300049571 Ga0501034_0000124 Ga0501034_0000124_28258_29127 289
20 3300050507 nmdc:mga05p37_268551_c2 nmdc:mga05p37_268551_c2_487_1356 289
21 3300050507 nmdc:mga05p37_645595_c1 nmdc:mga05p37_645595_c1_52_921 289
22 3300048916 Ga0496113_0485575 Ga0496113_0485575_12_908 298
23 3300044673 Ga0453683_0004282 Ga0453683_0004282_2556_3488 301
24 3300045051 Ga0451576_0002450 Ga0451576_0002450_1088_2020 301
25 iso_pu_bacteria 2508501050 2508728247 304
26 iso_pu_bacteria 2773857925 2774868904 304
27 iso_pu_bacteria 2775506901 2776263903 304
28 iso_pu_bacteria 2882456835 2882463287 304
29 iso_pu_bacteria 2995392953 2995393968 304
30 iso_pu_bacteria 2675903060 2676489213 305
31 iso_pu_bacteria 2899275550 2899277715 305
32 iso_pu_bacteria 8048746797 8048747486 305
33 3300014969 Ga0157376_10276879 Ga0157376_102768792 306
34 3300025927 Ga0207687_10048287 Ga0207687_100482872 306
35 3300031731 Ga0307405_10125375 Ga0307405_101253752 306
36 3300031852 Ga0307410_10188106 Ga0307410_101881062 306
37 3300031901 Ga0307406_10090619 Ga0307406_100906192 306
38 3300031903 Ga0307407_10107651 Ga0307407_101076511 306
39 3300031995 Ga0307409_100010499 Ga0307409_1000104994 306
40 3300032004 Ga0307414_10135370 Ga0307414_101353702 306
41 3300032005 Ga0307411_10018647 Ga0307411_100186473 306
42 3300036712 Ga0316584_0220605 Ga0316584_0220605_384_1310 306
43 3300037312 Ga0395899_0001350 Ga0395899_0001350_7817_8749 306
44 3300037418 Ga0395900_0003263 Ga0395900_0003263_7841_8773 306
45 3300037466 Ga0395898_0003486 Ga0395898_0003486_7841_8773 306
46 3300037471 Ga0395905_0003218 Ga0395905_0003218_8801_9733 306
47 3300038443 Ga0395901_0002823 Ga0395901_0002823_7841_8773 306
48 3300048913 Ga0496110_0404040 Ga0496110_0404040_74_1000 306
49 3300048917 Ga0496114_0057947 Ga0496114_0057947_1595_2521 306
50 3300053087 Ga0500643_000389 Ga0500643_000389_14981_15901 306
51 iso_pu_bacteria 2513237150 2513956296 306
52 iso_pu_bacteria 2537561592 2537899306 306
53 iso_pu_bacteria 2600255067 2600813599 306
54 iso_pu_bacteria 2643221569 2643863406 306
55 iso_pu_bacteria 2643221594 2643982756 306
56 iso_pu_bacteria 2643221605 2644040122 306
57 iso_pu_bacteria 2643221621 2644120819 306
58 iso_pu_bacteria 2654587600 2655033214 306
59 iso_pu_bacteria 2721755523 2722883316 306
60 iso_pu_bacteria 2738541296 2738818528 306
61 iso_pu_bacteria 2738541298 2738831315 306
62 iso_pu_bacteria 2738541306 2738872843 306
63 iso_pu_bacteria 2738543002 2739184473 306
64 iso_pu_bacteria 2738543008 2739219442 306
65 iso_pu_bacteria 2791355137 2792838907 306
66 iso_pu_bacteria 2808606366 2808877287 306
67 iso_pu_bacteria 2808606384 2808969505 306
68 iso_pu_bacteria 2808606390 2809004336 306
69 iso_pu_bacteria 2808606391 2809012914 306
70 iso_pu_bacteria 2808606395 2809034865 306
71 iso_pu_bacteria 2839138175 2839140093 306
72 iso_pu_bacteria 2855730933 2855732241 306
73 iso_pu_bacteria 2855767633 2855768949 306
74 iso_pu_bacteria 2857537821 2857542033 306
75 iso_pu_bacteria 2857542790 2857546092 306
76 iso_pu_bacteria 2858950400 2858956777 306
77 iso_pu_bacteria 2863421361 2863422402 306
78 iso_pu_bacteria 2866552031 2866556477 306
79 iso_pu_bacteria 2870068957 2870072625 306
80 iso_pu_bacteria 2881412998 2881415106 306
81 iso_pu_bacteria 2881665667 2881672776 306
82 iso_pu_bacteria 2894023352 2894026142 306
83 iso_pu_bacteria 2904479285 2904479956 306
84 iso_pu_bacteria 2904541872 2904548186 306
85 iso_pu_bacteria 2904564687 2904564897 306
86 iso_pu_bacteria 2904571731 2904572407 306
87 iso_pu_bacteria 2904615490 2904616781 306
88 iso_pu_bacteria 2906427513 2906429011 306
89 iso_pu_bacteria 2928157003 2928157110 306
90 iso_pu_bacteria 2928163908 2928168936 306
91 iso_pu_bacteria 2928536128 2928537733 306
92 iso_pu_bacteria 2929160207 2929163115 306
93 iso_pu_bacteria 2935648319 2935656678 306
94 iso_pu_bacteria 2935656913 2935665488 306
95 iso_pu_bacteria 2935984226 2935989230 306
96 iso_pu_bacteria 2936011229 2936019541 306
97 iso_pu_bacteria 2936019824 2936028165 306
98 iso_pu_bacteria 2936028420 2936037038 306
99 iso_pu_bacteria 2936046547 2936055014 306
100 iso_pu_bacteria 2941479691 2941480667 306
101 iso_pu_bacteria 2945934425 2945937243 306
102 iso_pu_bacteria 2981990288 2981994955 306
103 iso_pu_bacteria 2990703756 2990706022 306
104 iso_pu_bacteria 641736151 642425758 306
105 iso_pu_bacteria 641736154 642417383 306
106 iso_pu_bacteria 8016583857 8016584198 306
107 iso_pu_bacteria 8020938398 8020939720 306
108 iso_pu_bacteria 8020953355 8020957339 306
109 iso_pu_bacteria 8056207758 8056212993 306
110 3300001979 JGI24740J21852_10001964 JGI24740J21852_100019642 307
111 3300001989 JGI24739J22299_10001531 JGI24739J22299_100015313 307
112 3300001990 JGI24737J22298_10008759 JGI24737J22298_100087593 307
113 3300001990 JGI24737J22298_10012489 JGI24737J22298_100124893 307
114 3300002067 JGI24735J21928_10000021 JGI24735J21928_1000002180 307
115 3300002067 JGI24735J21928_10000179 JGI24735J21928_100001795 307
116 3300002067 JGI24735J21928_10000466 JGI24735J21928_1000046613 307
117 3300002075 JGI24738J21930_10003992 JGI24738J21930_100039923 307
118 3300003187 JGI25151J46595_10001622 JGI25151J46595_100016224 307
119 3300003187 JGI25151J46595_10001670 JGI25151J46595_100016709 307
120 3300003187 JGI25151J46595_10003677 JGI25151J46595_100036775 307
121 3300003187 JGI25151J46595_10003933 JGI25151J46595_100039338 307
122 3300003215 JGI25153J46596_10034452 JGI25153J46596_100344522 307
123 3300003316 rootH1_10048791 rootH1_100487914 307
124 3300003760 Ga0055527_1000335 Ga0055527_100033510 307
125 3300003761 Ga0055535_1000267 Ga0055535_100026717 307
126 3300003762 Ga0055542_1000175 Ga0055542_100017544 307
127 3300003762 Ga0055542_1001872 Ga0055542_10018723 307
128 3300003763 Ga0055529_1000131 Ga0055529_100013117 307
129 3300003773 Ga0055537_1000428 Ga0055537_10004288 307
130 3300003773 Ga0055537_1000433 Ga0055537_10004338 307
131 3300003781 Ga0055536_1003283 Ga0055536_10032835 307
132 3300003781 Ga0055536_1009944 Ga0055536_10099442 307
133 3300003784 Ga0055534_1000008 Ga0055534_100000856 307
134 3300003790 Ga0055528_1003161 Ga0055528_10031612 307
135 3300003790 Ga0055528_1003690 Ga0055528_10036905 307
136 3300003792 Ga0055540_1003300 Ga0055540_10033005 307
137 3300003794 Ga0055531_10002668 Ga0055531_100026682 307
138 3300005288 Ga0065714_10020982 Ga0065714_100209821 307
139 3300005328 Ga0070676_10016208 Ga0070676_100162083 307
140 3300005329 Ga0070683_100066990 Ga0070683_1000669904 307
141 3300005331 Ga0070670_100089227 Ga0070670_1000892272 307
142 3300005335 Ga0070666_10049415 Ga0070666_100494152 307
143 3300005337 Ga0070682_100043866 Ga0070682_1000438662 307
144 3300005339 Ga0070660_100000060 Ga0070660_1000000606 307
145 3300005344 Ga0070661_100212918 Ga0070661_1002129182 307
146 3300005347 Ga0070668_100102032 Ga0070668_1001020322 307
147 3300005353 Ga0070669_100022162 Ga0070669_1000221623 307
148 3300005354 Ga0070675_100016920 Ga0070675_1000169204 307
149 3300005355 Ga0070671_100189520 Ga0070671_1001895202 307
150 3300005364 Ga0070673_100111890 Ga0070673_1001118902 307
151 3300005366 Ga0070659_100000105 Ga0070659_1000001056 307
152 3300005366 Ga0070659_100130274 Ga0070659_1001302742 307
153 3300005367 Ga0070667_100163748 Ga0070667_1001637482 307
154 3300005455 Ga0070663_100004136 Ga0070663_1000041365 307
155 3300005455 Ga0070663_100038590 Ga0070663_1000385902 307
156 3300005455 Ga0070663_100087873 Ga0070663_1000878732 307
157 3300005455 Ga0070663_100090535 Ga0070663_1000905352 307
158 3300005456 Ga0070678_100029470 Ga0070678_1000294703 307
159 3300005457 Ga0070662_100001117 Ga0070662_1000011178 307
160 3300005535 Ga0070684_100299612 Ga0070684_1002996122 307
161 3300005539 Ga0068853_100003394 Ga0068853_1000033948 307
162 3300005539 Ga0068853_100053084 Ga0068853_1000530842 307
163 3300005539 Ga0068853_100140707 Ga0068853_1001407072 307
164 3300005548 Ga0070665_100072894 Ga0070665_1000728942 307
165 3300005548 Ga0070665_100155612 Ga0070665_1001556122 307
166 3300005563 Ga0068855_100005206 Ga0068855_1000052068 307
167 3300005563 Ga0068855_100192011 Ga0068855_1001920112 307
168 3300005564 Ga0070664_100047047 Ga0070664_1000470473 307
169 3300005577 Ga0068857_100001830 Ga0068857_1000018308 307
170 3300005578 Ga0068854_100014116 Ga0068854_1000141161 307
171 3300005614 Ga0068856_100005144 Ga0068856_1000051448 307
172 3300005616 Ga0068852_100004727 Ga0068852_1000047278 307
173 3300005834 Ga0068851_10004146 Ga0068851_100041462 307
174 3300006028 Ga0070717_10004861 Ga0070717_100048618 307
175 3300006038 Ga0075365_10010855 Ga0075365_100108556 307
176 3300006051 Ga0075364_10035320 Ga0075364_100353203 307
177 3300006353 Ga0075370_10002532 Ga0075370_100025326 307
178 3300006353 Ga0075370_10053986 Ga0075370_100539862 307
179 3300006846 Ga0075430_100240566 Ga0075430_1002405662 307
180 3300006852 Ga0075433_10015205 Ga0075433_100152053 307
181 3300006871 Ga0075434_100013935 Ga0075434_1000139358 307
182 3300006946 Ga0079104_1000007 Ga0079104_1000007219 307
183 3300006948 Ga0099826_10000084 Ga0099826_1000008434 307
184 3300007788 Ga0099795_10049754 Ga0099795_100497542 307
185 3300009011 Ga0105251_10000785 Ga0105251_1000078510 307
186 3300009011 Ga0105251_10001106 Ga0105251_1000110615 307
187 3300009011 Ga0105251_10017710 Ga0105251_100177103 307
188 3300009036 Ga0105244_10044711 Ga0105244_100447113 307
189 3300009092 Ga0105250_10008651 Ga0105250_100086513 307
190 3300009092 Ga0105250_10021604 Ga0105250_100216043 307
191 3300009092 Ga0105250_10073777 Ga0105250_100737772 307
192 3300009093 Ga0105240_10007552 Ga0105240_100075527 307
193 3300009093 Ga0105240_10047662 Ga0105240_100476624 307
194 3300009093 Ga0105240_10116246 Ga0105240_101162463 307
195 3300009093 Ga0105240_10154754 Ga0105240_101547542 307
196 3300009094 Ga0111539_10010305 Ga0111539_100103055 307
197 3300009098 Ga0105245_10594039 Ga0105245_105940392 307
198 3300009101 Ga0105247_10014704 Ga0105247_100147044 307
199 3300009147 Ga0114129_10009151 Ga0114129_100091514 307
200 3300009148 Ga0105243_10000538 Ga0105243_100005388 307
201 3300009148 Ga0105243_10001515 Ga0105243_1000151518 307
202 3300009148 Ga0105243_10126952 Ga0105243_101269521 307
203 3300009174 Ga0105241_10001889 Ga0105241_100018897 307
204 3300009174 Ga0105241_10046629 Ga0105241_100466292 307
205 3300009174 Ga0105241_10067474 Ga0105241_100674742 307
206 3300009177 Ga0105248_10069030 Ga0105248_100690302 307
207 3300009545 Ga0105237_10004677 Ga0105237_100046777 307
208 3300009545 Ga0105237_10011794 Ga0105237_100117943 307
209 3300009545 Ga0105237_10116335 Ga0105237_101163352 307
210 3300009545 Ga0105237_10123587 Ga0105237_101235872 307
211 3300009545 Ga0105237_10514138 Ga0105237_105141381 307
212 3300009551 Ga0105238_10003442 Ga0105238_100034427 307
213 3300009551 Ga0105238_10055515 Ga0105238_100555152 307
214 3300009551 Ga0105238_10095371 Ga0105238_100953713 307
215 3300010375 Ga0105239_10014965 Ga0105239_100149652 307
216 3300010375 Ga0105239_10037516 Ga0105239_100375162 307
217 3300010375 Ga0105239_10047873 Ga0105239_100478734 307
218 3300013100 Ga0157373_10021715 Ga0157373_100217152 307
219 3300013102 Ga0157371_10051329 Ga0157371_100513292 307
220 3300013104 Ga0157370_10001878 Ga0157370_100018789 307
221 3300013104 Ga0157370_10007059 Ga0157370_100070594 307
222 3300013104 Ga0157370_10112212 Ga0157370_101122122 307
223 3300013105 Ga0157369_10003126 Ga0157369_1000312610 307
224 3300013105 Ga0157369_10006744 Ga0157369_100067441 307
225 3300013105 Ga0157369_10150209 Ga0157369_101502093 307
226 3300013105 Ga0157369_10383251 Ga0157369_103832512 307
227 3300013105 Ga0157369_10424536 Ga0157369_104245362 307
228 3300013296 Ga0157374_10017267 Ga0157374_100172675 307
229 3300013296 Ga0157374_10031859 Ga0157374_100318593 307
230 3300013296 Ga0157374_10069147 Ga0157374_100691472 307
231 3300013296 Ga0157374_10201179 Ga0157374_102011792 307
232 3300013297 Ga0157378_10017744 Ga0157378_100177443 307
233 3300013306 Ga0163162_10008134 Ga0163162_100081348 307
234 3300013306 Ga0163162_10412841 Ga0163162_104128411 307
235 3300013306 Ga0163162_10446331 Ga0163162_104463311 307
236 3300013307 Ga0157372_10004099 Ga0157372_100040997 307
237 3300013307 Ga0157372_10139241 Ga0157372_101392412 307
238 3300013307 Ga0157372_10780717 Ga0157372_107807172 307
239 3300013308 Ga0157375_10108186 Ga0157375_101081862 307
240 3300014497 Ga0182008_10079704 Ga0182008_100797041 307
241 3300015265 Ga0182005_1008866 Ga0182005_10088662 307
242 3300017792 Ga0163161_10001698 Ga0163161_100016986 307
243 3300021384 Ga0213876_10001668 Ga0213876_100016684 307
244 3300025228 Ga0209672_100031 Ga0209672_10003181 307
245 3300025228 Ga0209672_100158 Ga0209672_10015821 307
246 3300025229 Ga0209147_100040 Ga0209147_100040197 307
247 3300025242 Ga0209258_100061 Ga0209258_100061201 307
248 3300025246 Ga0209646_1016612 Ga0209646_10166121 307
249 3300025254 Ga0209148_1000050 Ga0209148_1000050106 307
250 3300025254 Ga0209148_1000070 Ga0209148_1000070218 307
251 3300025254 Ga0209148_1004490 Ga0209148_10044903 307
252 3300025256 Ga0209759_1017860 Ga0209759_10178602 307
253 3300025263 Ga0209565_1000042 Ga0209565_100004256 307
254 3300025263 Ga0209565_1006273 Ga0209565_10062732 307
255 3300025272 Ga0209455_1000069 Ga0209455_100006961 307
256 3300025272 Ga0209455_1000183 Ga0209455_10001839 307
257 3300025273 Ga0209673_1000026 Ga0209673_1000026198 307
258 3300025273 Ga0209673_1000071 Ga0209673_1000071171 307
259 3300025291 Ga0209675_1000041 Ga0209675_1000041170 307
260 3300025292 Ga0209676_1000301 Ga0209676_100030118 307
261 3300025292 Ga0209676_1001163 Ga0209676_10011632 307
262 3300025292 Ga0209676_1021223 Ga0209676_10212232 307
263 3300025294 Ga0209025_1000026 Ga0209025_1000026261 307
264 3300025294 Ga0209025_1000073 Ga0209025_1000073104 307
265 3300025294 Ga0209025_1000113 Ga0209025_1000113168 307
266 3300025294 Ga0209025_1000307 Ga0209025_100030775 307
267 3300025294 Ga0209025_1000387 Ga0209025_100038760 307
268 3300025294 Ga0209025_1014274 Ga0209025_10142742 307
269 3300025295 Ga0209564_1030464 Ga0209564_10304642 307
270 3300025297 Ga0209758_1000573 Ga0209758_100057355 307
271 3300025298 Ga0209050_1004017 Ga0209050_100401710 307
272 3300025302 Ga0207426_1000965 Ga0207426_100096513 307
273 3300025302 Ga0207426_1000982 Ga0207426_100098214 307
274 3300025303 Ga0209051_1001159 Ga0209051_100115910 307
275 3300025303 Ga0209051_1002220 Ga0209051_10022202 307
276 3300025303 Ga0209051_1036907 Ga0209051_10369072 307
277 3300025304 Ga0209257_1004548 Ga0209257_10045482 307
278 3300025315 Ga0207697_10003124 Ga0207697_100031244 307
279 3300025321 Ga0207656_10001956 Ga0207656_100019567 307
280 3300025711 Ga0207696_1022993 Ga0207696_10229932 307
281 3300025728 Ga0207655_1013437 Ga0207655_10134372 307
282 3300025735 Ga0207713_1003488 Ga0207713_10034884 307
283 3300025735 Ga0207713_1059249 Ga0207713_10592491 307
284 3300025904 Ga0207647_10017310 Ga0207647_100173104 307
285 3300025904 Ga0207647_10033801 Ga0207647_100338013 307
286 3300025904 Ga0207647_10038780 Ga0207647_100387802 307
287 3300025904 Ga0207647_10079244 Ga0207647_100792442 307
288 3300025907 Ga0207645_10003783 Ga0207645_100037832 307
289 3300025909 Ga0207705_10000642 Ga0207705_1000064228 307
290 3300025909 Ga0207705_10051673 Ga0207705_100516732 307
291 3300025911 Ga0207654_10000275 Ga0207654_1000027513 307
292 3300025913 Ga0207695_10001242 Ga0207695_1000124233 307
293 3300025913 Ga0207695_10004197 Ga0207695_100041979 307
294 3300025913 Ga0207695_10055858 Ga0207695_100558585 307
295 3300025914 Ga0207671_10039829 Ga0207671_100398293 307
296 3300025914 Ga0207671_10052049 Ga0207671_100520492 307
297 3300025914 Ga0207671_10258967 Ga0207671_102589672 307
298 3300025919 Ga0207657_10001165 Ga0207657_1000116522 307
299 3300025919 Ga0207657_10054794 Ga0207657_100547943 307
300 3300025919 Ga0207657_10198049 Ga0207657_101980492 307
301 3300025924 Ga0207694_10001514 Ga0207694_100015149 307
302 3300025924 Ga0207694_10036123 Ga0207694_100361232 307
303 3300025924 Ga0207694_10090521 Ga0207694_100905212 307
304 3300025925 Ga0207650_10118614 Ga0207650_101186142 307
305 3300025932 Ga0207690_10000115 Ga0207690_100001157 307
306 3300025932 Ga0207690_10127777 Ga0207690_101277772 307
307 3300025932 Ga0207690_10184197 Ga0207690_101841972 307
308 3300025933 Ga0207706_10004093 Ga0207706_100040937 307
309 3300025935 Ga0207709_10000112 Ga0207709_1000011266 307
310 3300025935 Ga0207709_10001057 Ga0207709_100010576 307
311 3300025940 Ga0207691_10020459 Ga0207691_100204594 307
312 3300025941 Ga0207711_10094670 Ga0207711_100946703 307
313 3300025944 Ga0207661_10038278 Ga0207661_100382784 307
314 3300025945 Ga0207679_10031808 Ga0207679_100318083 307
315 3300025949 Ga0207667_10023159 Ga0207667_100231597 307
316 3300025949 Ga0207667_10032826 Ga0207667_100328264 307
317 3300025960 Ga0207651_10180080 Ga0207651_101800802 307
318 3300025972 Ga0207668_10233462 Ga0207668_102334622 307
319 3300025981 Ga0207640_10012604 Ga0207640_100126045 307
320 3300025986 Ga0207658_10099880 Ga0207658_100998802 307
321 3300026035 Ga0207703_10365850 Ga0207703_103658502 307
322 3300026041 Ga0207639_10000210 Ga0207639_1000021029 307
323 3300026041 Ga0207639_10000280 Ga0207639_1000028031 307
324 3300026041 Ga0207639_10081456 Ga0207639_100814562 307
325 3300026067 Ga0207678_10000576 Ga0207678_100005763 307
326 3300026067 Ga0207678_10006339 Ga0207678_100063396 307
327 3300026067 Ga0207678_10007574 Ga0207678_100075748 307
328 3300026067 Ga0207678_10233532 Ga0207678_102335322 307
329 3300026078 Ga0207702_10002988 Ga0207702_100029889 307
330 3300026095 Ga0207676_10016766 Ga0207676_100167664 307
331 3300026116 Ga0207674_10001961 Ga0207674_1000196115 307
332 3300026116 Ga0207674_10323883 Ga0207674_103238831 307
333 3300026121 Ga0207683_10009519 Ga0207683_100095194 307
334 3300026121 Ga0207683_10586703 Ga0207683_105867031 307
335 3300026142 Ga0207698_10004738 Ga0207698_100047383 307
336 3300026142 Ga0207698_10004765 Ga0207698_100047658 307
337 3300027111 Ga0209281_1000020 Ga0209281_1000020279 307
338 3300027312 Ga0209371_1000971 Ga0209371_100097110 307
339 3300027666 Ga0209282_1000112 Ga0209282_100011234 307
340 3300027907 Ga0207428_10019979 Ga0207428_100199793 307
341 3300027907 Ga0207428_10272570 Ga0207428_102725701 307
342 3300028379 Ga0268266_10256433 Ga0268266_102564331 307
343 3300028379 Ga0268266_10382919 Ga0268266_103829192 307
344 3300030500 Ga0268256_1000821 Ga0268256_100082112 307
345 3300031247 Ga0265340_10008869 Ga0265340_100088691 307
346 3300031251 Ga0265327_10000108 Ga0265327_10000108141 307
347 3300031548 Ga0307408_100008944 Ga0307408_1000089442 307
348 3300031548 Ga0307408_100092161 Ga0307408_1000921612 307
349 3300031548 Ga0307408_100107285 Ga0307408_1001072852 307
350 3300031548 Ga0307408_100203985 Ga0307408_1002039852 307
351 3300031731 Ga0307405_10009497 Ga0307405_100094975 307
352 3300031852 Ga0307410_10096878 Ga0307410_100968782 307
353 3300031852 Ga0307410_10304433 Ga0307410_103044331 307
354 3300031911 Ga0307412_10000021 Ga0307412_1000002166 307
355 3300031911 Ga0307412_10000199 Ga0307412_1000019927 307
356 3300031911 Ga0307412_10003193 Ga0307412_100031938 307
357 3300031911 Ga0307412_10429829 Ga0307412_104298292 307
358 3300032002 Ga0307416_100003033 Ga0307416_1000030332 307
359 3300032002 Ga0307416_100079069 Ga0307416_1000790693 307
360 3300032002 Ga0307416_100082414 Ga0307416_1000824142 307
361 3300032002 Ga0307416_100204781 Ga0307416_1002047811 307
362 3300032004 Ga0307414_10251577 Ga0307414_102515771 307
363 3300032004 Ga0307414_10332183 Ga0307414_103321831 307
364 3300032005 Ga0307411_10029169 Ga0307411_100291692 307
365 3300037466 Ga0395898_0002587 Ga0395898_0002587_1171_2103 307
366 3300037471 Ga0395905_0002203 Ga0395905_0002203_8640_9584 307
367 3300037471 Ga0395905_0070959 Ga0395905_0070959_602_1534 307
368 3300037471 Ga0395905_0167754 Ga0395905_0167754_1118_2047 307
369 3300037853 Ga0436364_1500701 Ga0436364_1500701_1113_2045 307
370 3300038443 Ga0395901_0011955 Ga0395901_0011955_4788_5762 307
371 3300038443 Ga0395901_0024390 Ga0395901_0024390_4001_4933 307
372 3300039437 Ga0436365_0781525 Ga0436365_0781525_4534_5466 307
373 3300039437 Ga0436365_1641635 Ga0436365_1641635_3547_4479 307
374 3300041411 Ga0439466_0043955 Ga0439466_0043955_19_951 307
375 3300044656 Ga0466969_0002785 Ga0466969_0002785_4033_4974 307
376 3300044683 Ga0466965_0083609 Ga0466965_0083609_461_1393 307
377 3300044693 Ga0466961_0042674 Ga0466961_0042674_356_1288 307
378 3300044765 Ga0466970_0042166 Ga0466970_0042166_1373_2305 307
379 3300045049 Ga0466959_0014112 Ga0466959_0014112_2730_3671 307
380 3300045976 Ga0466967_0039385 Ga0466967_0039385_466_1398 307
381 3300045976 Ga0466967_0417448 Ga0466967_0417448_259_1221 307
382 3300046454 Ga0495592_0035395 Ga0495592_0035395_177_1109 307
383 3300046455 Ga0495603_0000115 Ga0495603_0000115_5836_6768 307
384 3300046455 Ga0495603_0008106 Ga0495603_0008106_5310_6242 307
385 3300046457 Ga0495590_0008645 Ga0495590_0008645_2283_3215 307
386 3300046458 Ga0495591_019786 Ga0495591_019786_1249_2181 307
387 3300046459 Ga0495629_0000111 Ga0495629_0000111_69857_70789 307
388 3300046459 Ga0495629_0000432 Ga0495629_0000432_2039_2971 307
389 3300046459 Ga0495629_0002672 Ga0495629_0002672_4168_5100 307
390 3300046459 Ga0495629_0006729 Ga0495629_0006729_7019_7951 307
391 3300046459 Ga0495629_0007141 Ga0495629_0007141_5203_6135 307
392 3300046460 Ga0495638_0123038 Ga0495638_0123038_140_1069 307
393 3300046462 Ga0495651_0068251 Ga0495651_0068251_823_1755 307
394 3300046463 Ga0495653_0002714 Ga0495653_0002714_499_1431 307
395 3300046463 Ga0495653_0008865 Ga0495653_0008865_5642_6574 307
396 3300046463 Ga0495653_0018434 Ga0495653_0018434_2060_2992 307
397 3300046463 Ga0495653_0098639 Ga0495653_0098639_594_1526 307
398 3300046463 Ga0495653_0140474 Ga0495653_0140474_208_1140 307
399 3300046471 Ga0495650_0000681 Ga0495650_0000681_29400_30332 307
400 3300046471 Ga0495650_0001326 Ga0495650_0001326_9581_10513 307
401 3300046472 Ga0495580_0006962 Ga0495580_0006962_6057_6989 307
402 3300046472 Ga0495580_0014713 Ga0495580_0014713_4376_5308 307
403 3300046472 Ga0495580_0015632 Ga0495580_0015632_1059_1991 307
404 3300046472 Ga0495580_0057681 Ga0495580_0057681_1465_2397 307
405 3300046472 Ga0495580_0105299 Ga0495580_0105299_197_1129 307
406 3300046473 Ga0495582_0009528 Ga0495582_0009528_1129_2061 307
407 3300046475 Ga0495639_0016256 Ga0495639_0016256_1617_2549 307
408 3300046476 Ga0495662_0003788 Ga0495662_0003788_5500_6432 307
409 3300046477 Ga0495664_0000813 Ga0495664_0000813_3864_4796 307
410 3300046477 Ga0495664_0057303 Ga0495664_0057303_1251_2183 307
411 3300046477 Ga0495664_0122947 Ga0495664_0122947_240_1172 307
412 3300046491 Ga0495584_0026184 Ga0495584_0026184_591_1523 307
413 3300046491 Ga0495584_0043016 Ga0495584_0043016_748_1680 307
414 3300046491 Ga0495584_0121309 Ga0495584_0121309_101_1033 307
415 3300046492 Ga0495585_0195100 Ga0495585_0195100_11_943 307
416 3300046499 Ga0495594_0066459 Ga0495594_0066459_419_1351 307
417 3300046499 Ga0495594_0109974 Ga0495594_0109974_328_1260 307
418 3300046499 Ga0495594_0159051 Ga0495594_0159051_237_1169 307
419 3300046500 Ga0495596_0005232 Ga0495596_0005232_1465_2397 307
420 3300046500 Ga0495596_0023330 Ga0495596_0023330_927_1859 307
421 3300046500 Ga0495596_0105394 Ga0495596_0105394_61_993 307
422 3300046506 Ga0495583_0015739 Ga0495583_0015739_626_1558 307
423 3300046506 Ga0495583_0016468 Ga0495583_0016468_1125_2057 307
424 3300046507 Ga0495606_0003045 Ga0495606_0003045_15403_16335 307
425 3300046507 Ga0495606_0003625 Ga0495606_0003625_11039_11971 307
426 3300046507 Ga0495606_0052837 Ga0495606_0052837_136_1068 307
427 3300046511 Ga0495608_0001030 Ga0495608_0001030_7703_8635 307
428 3300046511 Ga0495608_0026577 Ga0495608_0026577_851_1783 307
429 3300046511 Ga0495608_0063302 Ga0495608_0063302_1103_2035 307
430 3300046512 Ga0495610_0001663 Ga0495610_0001663_18283_19215 307
431 3300046514 Ga0495618_0023948 Ga0495618_0023948_2519_3451 307
432 3300046514 Ga0495618_0090660 Ga0495618_0090660_335_1267 307
433 3300046514 Ga0495618_0117790 Ga0495618_0117790_334_1266 307
434 3300046515 Ga0495620_0000640 Ga0495620_0000640_3255_4184 307
435 3300046516 Ga0495628_0019402 Ga0495628_0019402_244_1176 307
436 3300046516 Ga0495628_0021726 Ga0495628_0021726_2752_3684 307
437 3300046517 Ga0495630_0003995 Ga0495630_0003995_6647_7579 307
438 3300046517 Ga0495630_0004112 Ga0495630_0004112_7765_8697 307
439 3300046518 Ga0495631_0030935 Ga0495631_0030935_1454_2386 307
440 3300046518 Ga0495631_0059173 Ga0495631_0059173_556_1488 307
441 3300046519 Ga0495632_0002605 Ga0495632_0002605_9402_10331 307
442 3300046524 Ga0495648_0005165 Ga0495648_0005165_9657_10589 307
443 3300046524 Ga0495648_0123824 Ga0495648_0123824_171_1103 307
444 3300046526 Ga0495666_0000120 Ga0495666_0000120_2431_3363 307
445 3300046528 Ga0495642_0003281 Ga0495642_0003281_4833_5765 307
446 3300046528 Ga0495642_0005435 Ga0495642_0005435_661_1593 307
447 3300046528 Ga0495642_0026586 Ga0495642_0026586_754_1686 307
448 3300046529 Ga0495652_0010011 Ga0495652_0010011_1482_2414 307
449 3300046529 Ga0495652_0011966 Ga0495652_0011966_2816_3748 307
450 3300046529 Ga0495652_0102931 Ga0495652_0102931_1368_2300 307
451 3300046530 Ga0495654_0041467 Ga0495654_0041467_711_1643 307
452 3300046531 Ga0495665_0000183 Ga0495665_0000183_13940_14872 307
453 3300046531 Ga0495665_0000239 Ga0495665_0000239_5943_6875 307
454 3300046531 Ga0495665_0019318 Ga0495665_0019318_1228_2160 307
455 3300046531 Ga0495665_0020982 Ga0495665_0020982_2508_3440 307
456 3300046533 Ga0495640_0001503 Ga0495640_0001503_11333_12265 307
457 3300046535 Ga0495586_0038960 Ga0495586_0038960_743_1675 307
458 3300046535 Ga0495586_0067089 Ga0495586_0067089_920_1852 307
459 3300046535 Ga0495586_0071134 Ga0495586_0071134_194_1126 307
460 3300046536 Ga0495587_0019682 Ga0495587_0019682_930_1862 307
461 3300046536 Ga0495587_0029061 Ga0495587_0029061_478_1410 307
462 3300046536 Ga0495587_0054743 Ga0495587_0054743_1115_2047 307
463 3300046536 Ga0495587_0061191 Ga0495587_0061191_541_1473 307
464 3300046542 Ga0495597_0001163 Ga0495597_0001163_8039_8971 307
465 3300046542 Ga0495597_0027457 Ga0495597_0027457_78_1010 307
466 3300046543 Ga0495645_0000928 Ga0495645_0000928_5168_6100 307
467 3300046543 Ga0495645_0002267 Ga0495645_0002267_7988_8920 307
468 3300046543 Ga0495645_0025722 Ga0495645_0025722_654_1586 307
469 3300046543 Ga0495645_0101234 Ga0495645_0101234_930_1862 307
470 3300046543 Ga0495645_0110359 Ga0495645_0110359_1004_1936 307
471 3300046557 Ga0495622_0000115 Ga0495622_0000115_57589_58521 307
472 3300046559 Ga0495667_0026792 Ga0495667_0026792_1784_2716 307
473 3300046615 Ga0495656_0001038 Ga0495656_0001038_2607_3539 307
474 3300046616 Ga0495668_0046342 Ga0495668_0046342_1319_2251 307
475 3300046642 Ga0495634_0031592 Ga0495634_0031592_1611_2543 307
476 3300046642 Ga0495634_0158610 Ga0495634_0158610_336_1268 307
477 3300046648 Ga0495611_0049910 Ga0495611_0049910_320_1249 307
478 3300046660 Ga0495625_0000052 Ga0495625_0000052_151622_152554 307
479 3300046663 Ga0495635_0004416 Ga0495635_0004416_2006_2938 307
480 3300046663 Ga0495635_0025633 Ga0495635_0025633_2465_3397 307
481 3300046663 Ga0495635_0037716 Ga0495635_0037716_1768_2700 307
482 3300046664 Ga0495659_0008926 Ga0495659_0008926_762_1694 307
483 3300046665 Ga0495661_0001916 Ga0495661_0001916_3449_4381 307
484 3300046674 Ga0495588_0001274 Ga0495588_0001274_5642_6574 307
485 3300046674 Ga0495588_0010138 Ga0495588_0010138_193_1125 307
486 3300046674 Ga0495588_0059157 Ga0495588_0059157_86_1018 307
487 3300046674 Ga0495588_0067791 Ga0495588_0067791_119_1051 307
488 3300046674 Ga0495588_0072867 Ga0495588_0072867_777_1709 307
489 3300046679 Ga0495623_0000735 Ga0495623_0000735_12608_13540 307
490 3300046679 Ga0495623_0002004 Ga0495623_0002004_6418_7350 307
491 3300046679 Ga0495623_0002295 Ga0495623_0002295_8035_8967 307
492 3300046679 Ga0495623_0021196 Ga0495623_0021196_2825_3757 307
493 3300046680 Ga0495646_0012933 Ga0495646_0012933_688_1620 307
494 3300046680 Ga0495646_0021705 Ga0495646_0021705_2468_3400 307
495 3300046680 Ga0495646_0050989 Ga0495646_0050989_1390_2322 307
496 3300046680 Ga0495646_0052044 Ga0495646_0052044_498_1430 307
497 3300046680 Ga0495646_0061254 Ga0495646_0061254_771_1703 307
498 3300046680 Ga0495646_0152262 Ga0495646_0152262_135_1067 307
499 3300046684 Ga0495669_0002555 Ga0495669_0002555_2263_3195 307
500 3300046684 Ga0495669_0007805 Ga0495669_0007805_914_1846 307
501 3300046684 Ga0495669_0049849 Ga0495669_0049849_928_1860 307
502 3300046689 Ga0495613_0002707 Ga0495613_0002707_5566_6498 307
503 3300046689 Ga0495613_0028567 Ga0495613_0028567_903_1835 307
504 3300046689 Ga0495613_0101470 Ga0495613_0101470_673_1605 307
505 3300046689 Ga0495613_0156474 Ga0495613_0156474_559_1491 307
506 3300046690 Ga0495624_0000471 Ga0495624_0000471_17105_18037 307
507 3300046690 Ga0495624_0007388 Ga0495624_0007388_5760_6692 307
508 3300046690 Ga0495624_0046645 Ga0495624_0046645_170_1102 307
509 3300046691 Ga0495670_0004902 Ga0495670_0004902_52_984 307
510 3300046691 Ga0495670_0106382 Ga0495670_0106382_247_1179 307
511 3300046692 Ga0495671_0019792 Ga0495671_0019792_159_1091 307
512 3300046692 Ga0495671_0051755 Ga0495671_0051755_67_999 307
513 3300046692 Ga0495671_0089623 Ga0495671_0089623_296_1228 307
514 3300046694 Ga0495649_0009639 Ga0495649_0009639_1683_2615 307
515 3300046694 Ga0495649_0025354 Ga0495649_0025354_2000_2932 307
516 3300046794 Ga0495589_0014903 Ga0495589_0014903_1304_2236 307
517 3300046794 Ga0495589_0031066 Ga0495589_0031066_1650_2582 307
518 3300046794 Ga0495589_0079778 Ga0495589_0079778_74_1006 307
519 3300046809 Ga0495600_0004212 Ga0495600_0004212_1136_2068 307
520 3300046809 Ga0495600_0016957 Ga0495600_0016957_611_1543 307
521 3300046810 Ga0495660_0039725 Ga0495660_0039725_804_1736 307
522 3300047315 Ga0495581_0001779 Ga0495581_0001779_7603_8535 307
523 3300047315 Ga0495581_0003591 Ga0495581_0003591_5812_6744 307
524 3300047315 Ga0495581_0013691 Ga0495581_0013691_3100_4032 307
525 3300047315 Ga0495581_0018957 Ga0495581_0018957_1551_2483 307
526 3300047315 Ga0495581_0029023 Ga0495581_0029023_1610_2542 307
527 3300047317 Ga0495604_0003479 Ga0495604_0003479_7905_8837 307
528 3300047317 Ga0495604_0039011 Ga0495604_0039011_547_1479 307
529 3300047317 Ga0495604_0092092 Ga0495604_0092092_228_1160 307
530 3300047317 Ga0495604_0101326 Ga0495604_0101326_160_1092 307
531 3300047318 Ga0495636_0023272 Ga0495636_0023272_512_1444 307
532 3300047319 Ga0495674_0004653 Ga0495674_0004653_3002_3934 307
533 3300047319 Ga0495674_0006385 Ga0495674_0006385_5610_6542 307
534 3300047319 Ga0495674_0056536 Ga0495674_0056536_1062_1994 307
535 3300047320 Ga0495672_0002500 Ga0495672_0002500_5086_6018 307
536 3300047322 Ga0495680_0036140 Ga0495680_0036140_1799_2731 307
537 3300047322 Ga0495680_0037536 Ga0495680_0037536_2361_3293 307
538 3300047322 Ga0495680_0055439 Ga0495680_0055439_165_1097 307
539 3300047323 Ga0495683_0002608 Ga0495683_0002608_7482_8414 307
540 3300047323 Ga0495683_0003057 Ga0495683_0003057_6387_7319 307
541 3300047323 Ga0495683_0003168 Ga0495683_0003168_4481_5413 307
542 3300047323 Ga0495683_0010823 Ga0495683_0010823_2744_3676 307
543 3300047323 Ga0495683_0039615 Ga0495683_0039615_827_1759 307
544 3300047323 Ga0495683_0110483 Ga0495683_0110483_258_1190 307
545 3300047443 Ga0495687_000020 Ga0495687_000020_213140_214072 307
546 3300047443 Ga0495687_009870 Ga0495687_009870_1647_2579 307
547 3300047444 Ga0495675_0001188 Ga0495675_0001188_12345_13277 307
548 3300047444 Ga0495675_0029177 Ga0495675_0029177_307_1239 307
549 3300047444 Ga0495675_0035095 Ga0495675_0035095_575_1507 307
550 3300047444 Ga0495675_0078003 Ga0495675_0078003_294_1226 307
551 3300047469 Ga0495673_0001172 Ga0495673_0001172_19033_19965 307
552 3300047469 Ga0495673_0072563 Ga0495673_0072563_131_1063 307
553 3300047470 Ga0495681_0039813 Ga0495681_0039813_1008_1940 307
554 3300047470 Ga0495681_0099252 Ga0495681_0099252_124_1056 307
555 3300047472 Ga0495686_0000002 Ga0495686_0000002_1040725_1041657 307
556 3300047472 Ga0495686_0097466 Ga0495686_0097466_728_1660 307
557 3300047673 Ga0495593_0000414 Ga0495593_0000414_6574_7506 307
558 3300047673 Ga0495593_0002167 Ga0495593_0002167_5019_5951 307
559 3300047673 Ga0495593_0013364 Ga0495593_0013364_1008_1940 307
560 3300047673 Ga0495593_0015994 Ga0495593_0015994_666_1598 307
561 3300048088 Ga0495602_0001650 Ga0495602_0001650_3652_4584 307
562 3300048088 Ga0495602_0004155 Ga0495602_0004155_7014_7946 307
563 3300048088 Ga0495602_0013684 Ga0495602_0013684_1465_2397 307
564 3300048088 Ga0495602_0035833 Ga0495602_0035833_1545_2477 307
565 3300048088 Ga0495602_0056734 Ga0495602_0056734_1064_1996 307
566 3300048088 Ga0495602_0137068 Ga0495602_0137068_323_1255 307
567 3300048089 Ga0495614_0001485 Ga0495614_0001485_8041_8973 307
568 3300048089 Ga0495614_0008753 Ga0495614_0008753_2663_3595 307
569 3300048091 Ga0495626_0004820 Ga0495626_0004820_4280_5212 307
570 3300048903 Ga0496100_0002614 Ga0496100_0002614_1634_2566 307
571 3300048903 Ga0496100_0013067 Ga0496100_0013067_439_1371 307
572 3300048903 Ga0496100_0319151 Ga0496100_0319151_79_1011 307
573 3300048904 Ga0496101_0004570 Ga0496101_0004570_1532_2464 307
574 3300048904 Ga0496101_0065794 Ga0496101_0065794_709_1641 307
575 3300048904 Ga0496101_0090448 Ga0496101_0090448_721_1653 307
576 3300048904 Ga0496101_0129159 Ga0496101_0129159_514_1446 307
577 3300048905 Ga0496102_0014642 Ga0496102_0014642_2998_3930 307
578 3300048905 Ga0496102_0025174 Ga0496102_0025174_2729_3661 307
579 3300048905 Ga0496102_0032534 Ga0496102_0032534_2875_3807 307
580 3300048905 Ga0496102_0188842 Ga0496102_0188842_923_1855 307
581 3300048906 Ga0496103_0000812 Ga0496103_0000812_10621_11553 307
582 3300048906 Ga0496103_0015039 Ga0496103_0015039_3015_3947 307
583 3300048907 Ga0496104_0011962 Ga0496104_0011962_1977_2909 307
584 3300048907 Ga0496104_0128458 Ga0496104_0128458_17_949 307
585 3300048907 Ga0496104_0202761 Ga0496104_0202761_125_1057 307
586 3300048909 Ga0496106_0000036 Ga0496106_0000036_104892_105824 307
587 3300048909 Ga0496106_0004044 Ga0496106_0004044_6462_7394 307
588 3300048909 Ga0496106_0062694 Ga0496106_0062694_1764_2696 307
589 3300048910 Ga0496107_0002435 Ga0496107_0002435_3436_4368 307
590 3300048910 Ga0496107_0010747 Ga0496107_0010747_3194_4126 307
591 3300048911 Ga0496108_0125184 Ga0496108_0125184_1118_2080 307
592 3300048912 Ga0496109_0014927 Ga0496109_0014927_2265_3197 307
593 3300048912 Ga0496109_0089435 Ga0496109_0089435_987_1919 307
594 3300048912 Ga0496109_0544190 Ga0496109_0544190_74_1006 307
595 3300048913 Ga0496110_0012080 Ga0496110_0012080_2755_3687 307
596 3300048913 Ga0496110_0226277 Ga0496110_0226277_339_1271 307
597 3300048913 Ga0496110_0229640 Ga0496110_0229640_645_1577 307
598 3300048914 Ga0496111_0002196 Ga0496111_0002196_6373_7305 307
599 3300048914 Ga0496111_0022147 Ga0496111_0022147_3498_4430 307
600 3300048915 Ga0496112_0005803 Ga0496112_0005803_6280_7242 307
601 3300048915 Ga0496112_0020914 Ga0496112_0020914_3526_4458 307
602 3300048915 Ga0496112_0039023 Ga0496112_0039023_3442_4374 307
603 3300048915 Ga0496112_0094058 Ga0496112_0094058_943_1905 307
604 3300048915 Ga0496112_0181995 Ga0496112_0181995_656_1588 307
605 3300048916 Ga0496113_0012187 Ga0496113_0012187_4165_5097 307
606 3300048916 Ga0496113_0036749 Ga0496113_0036749_2106_3038 307
607 3300048916 Ga0496113_0049560 Ga0496113_0049560_657_1589 307
608 3300048916 Ga0496113_0207556 Ga0496113_0207556_289_1221 307
609 3300048917 Ga0496114_0004527 Ga0496114_0004527_1436_2368 307
610 3300048917 Ga0496114_0008761 Ga0496114_0008761_6980_7912 307
611 3300048917 Ga0496114_0079862 Ga0496114_0079862_683_1615 307
612 3300048918 Ga0496115_0201454 Ga0496115_0201454_673_1605 307
613 3300048918 Ga0496115_0279636 Ga0496115_0279636_260_1192 307
614 3300048918 Ga0496115_0392060 Ga0496115_0392060_20_952 307
615 3300048919 Ga0496116_0003463 Ga0496116_0003463_9268_10203 307
616 3300048919 Ga0496116_0005958 Ga0496116_0005958_2252_3184 307
617 3300048919 Ga0496116_0032012 Ga0496116_0032012_1594_2526 307
618 3300048920 Ga0496117_0002393 Ga0496117_0002393_12957_13889 307
619 3300048920 Ga0496117_0004328 Ga0496117_0004328_11759_12691 307
620 3300048920 Ga0496117_0007634 Ga0496117_0007634_505_1437 307
621 3300048920 Ga0496117_0012902 Ga0496117_0012902_3770_4702 307
622 3300048920 Ga0496117_0016363 Ga0496117_0016363_81_1013 307
623 3300048920 Ga0496117_0170749 Ga0496117_0170749_289_1221 307
624 3300048921 Ga0496118_0003472 Ga0496118_0003472_12896_13828 307
625 3300048921 Ga0496118_0016037 Ga0496118_0016037_3921_4853 307
626 3300048921 Ga0496118_0019210 Ga0496118_0019210_4198_5133 307
627 3300048922 Ga0496119_0004110 Ga0496119_0004110_9102_10037 307
628 3300048922 Ga0496119_0048986 Ga0496119_0048986_225_1157 307
629 3300048923 Ga0496120_0002947 Ga0496120_0002947_89_1024 307
630 3300048923 Ga0496120_0026908 Ga0496120_0026908_739_1701 307
631 3300048924 Ga0496121_0000140 Ga0496121_0000140_26712_27647 307
632 3300048924 Ga0496121_0002763 Ga0496121_0002763_12696_13628 307
633 3300048924 Ga0496121_0003313 Ga0496121_0003313_12002_12934 307
634 3300048924 Ga0496121_0018671 Ga0496121_0018671_4307_5239 307
635 3300048924 Ga0496121_0084290 Ga0496121_0084290_1316_2278 307
636 3300048924 Ga0496121_0086673 Ga0496121_0086673_873_1820 307
637 3300048925 Ga0496122_0000582 Ga0496122_0000582_46999_47934 307
638 3300048925 Ga0496122_0026241 Ga0496122_0026241_3262_4194 307
639 3300048925 Ga0496122_0096881 Ga0496122_0096881_136_1071 307
640 3300048926 Ga0496123_0000479 Ga0496123_0000479_26411_27346 307
641 3300048926 Ga0496123_0007721 Ga0496123_0007721_2860_3792 307
642 3300048927 Ga0496124_0000004 Ga0496124_0000004_565550_566485 307
643 3300048927 Ga0496124_0000724 Ga0496124_0000724_35715_36656 307
644 3300048927 Ga0496124_0014560 Ga0496124_0014560_2504_3439 307
645 3300048927 Ga0496124_0024203 Ga0496124_0024203_433_1365 307
646 3300048927 Ga0496124_0127340 Ga0496124_0127340_130_1062 307
647 3300048928 Ga0496125_0000190 Ga0496125_0000190_110281_111216 307
648 3300048928 Ga0496125_0010697 Ga0496125_0010697_1924_2856 307
649 3300048929 Ga0496126_0000105 Ga0496126_0000105_49377_50309 307
650 3300048929 Ga0496126_0000924 Ga0496126_0000924_17786_18799 307
651 3300048929 Ga0496126_0010554 Ga0496126_0010554_8276_9211 307
652 3300048929 Ga0496126_0153914 Ga0496126_0153914_357_1289 307
653 3300048929 Ga0496126_0303608 Ga0496126_0303608_340_1302 307
654 3300049460 Ga0495682_0019454 Ga0495682_0019454_85_1008 307
655 3300049570 Ga0501033_0011303 Ga0501033_0011303_176_1111 307
656 3300049570 Ga0501033_0201710 Ga0501033_0201710_265_1200 307
657 3300049571 Ga0501034_0000331 Ga0501034_0000331_35569_36501 307
658 3300049571 Ga0501034_0016407 Ga0501034_0016407_244_1179 307
659 3300049571 Ga0501034_0047017 Ga0501034_0047017_3148_4080 307
660 3300049572 Ga0501036_0067743 Ga0501036_0067743_1877_2812 307
661 3300049573 Ga0501037_0042520 Ga0501037_0042520_707_1642 307
662 3300049573 Ga0501037_0164987 Ga0501037_0164987_577_1512 307
663 3300049574 Ga0501038_0188327 Ga0501038_0188327_209_1144 307
664 3300049575 Ga0501039_0064693 Ga0501039_0064693_1690_2625 307
665 3300049579 Ga0501043_0054854 Ga0501043_0054854_716_1651 307
666 3300049580 Ga0501046_0056040 Ga0501046_0056040_559_1494 307
667 3300049581 Ga0501047_0014752 Ga0501047_0014752_474_1409 307
668 3300049581 Ga0501047_0365833 Ga0501047_0365833_134_1069 307
669 3300049583 Ga0501067_0070777 Ga0501067_0070777_576_1511 307
670 3300049584 Ga0501068_0035576 Ga0501068_0035576_598_1533 307
671 3300049586 Ga0501070_0118527 Ga0501070_0118527_347_1282 307
672 3300049590 Ga0501074_0383184 Ga0501074_0383184_33_968 307
673 3300049741 Ga0501079_0130516 Ga0501079_0130516_247_1182 307
674 3300049742 Ga0501080_0038273 Ga0501080_0038273_2209_3144 307
675 3300049742 Ga0501080_0166414 Ga0501080_0166414_207_1139 307
676 3300049822 Ga0501035_0015361 Ga0501035_0015361_3577_4506 307
677 3300049822 Ga0501035_0233384 Ga0501035_0233384_304_1239 307
678 3300049823 Ga0501044_0011583 Ga0501044_0011583_3925_4854 307
679 3300049823 Ga0501044_0015770 Ga0501044_0015770_7119_8054 307
680 3300049823 Ga0501044_0140341 Ga0501044_0140341_1438_2373 307
681 3300050491 nmdc:mga00v17_21394_c1 nmdc:mga00v17_21394_c1_1505_2467 307
682 3300050492 nmdc:mga0yw44_44450_c1 nmdc:mga0yw44_44450_c1_339_1301 307
683 3300050494 nmdc:mga06z11_20818_c1 nmdc:mga06z11_20818_c1_952_1914 307
684 3300050496 nmdc:mga07m45_127633_c1 nmdc:mga07m45_127633_c1_72_1004 307
685 3300050496 nmdc:mga07m45_17966_c1 nmdc:mga07m45_17966_c1_972_1934 307
686 3300050508 nmdc:mga09592_112179_c1 nmdc:mga09592_112179_c1_89_1024 307
687 3300050510 nmdc:mga06r32_9922_c1 nmdc:mga06r32_9922_c1_2952_3884 307
688 3300050511 nmdc:mga08y16_151548_c1 nmdc:mga08y16_151548_c1_1090_2022 307
689 3300050512 nmdc:mga0n895_10480_c1 nmdc:mga0n895_10480_c1_2406_3338 307
690 3300050515 nmdc:mga0a205_13584_c1 nmdc:mga0a205_13584_c1_5736_6668 307
691 3300053079 Ga0500610_0000014 Ga0500610_0000014_60658_61608 307
692 3300053087 Ga0500643_001441 Ga0500643_001441_8103_9035 307
693 3300053134 Ga0500658_0046565 Ga0500658_0046565_570_1499 307
694 3300053142 Ga0500577_0019339 Ga0500577_0019339_421_1350 307
695 3300053730 Ga0500645_007970 Ga0500645_007970_1692_2618 307
696 3300054114 Ga0501084_0043258 Ga0501084_0043258_1774_2709 307
697 iso_pu_bacteria 2503198000 2503202056 307
698 iso_pu_bacteria 2508501127 2509141270 307
699 iso_pu_bacteria 2509276018 2509369200 307
700 iso_pu_bacteria 2510065059 2510316908 307
701 iso_pu_bacteria 2512875016 2512931047 307
702 iso_pu_bacteria 2512875024 2512958775 307
703 iso_pu_bacteria 2513237164 2514037670 307
704 iso_pu_bacteria 2588253730 2588516802 307
705 iso_pu_bacteria 2597489875 2597815492 307
706 iso_pu_bacteria 2643221595 2643986375 307
707 iso_pu_bacteria 2643221627 2644152607 307
708 iso_pu_bacteria 2687453392 2688600702 307
709 iso_pu_bacteria 2756170246 2756672702 307
710 iso_pu_bacteria 2841734538 2841735436 307
711 iso_pu_bacteria 2844002411 2844005158 307
712 iso_pu_bacteria 2844009547 2844016052 307
713 iso_pu_bacteria 2856320880 2856323192 307
714 iso_pu_bacteria 2856328259 2856330167 307
715 iso_pu_bacteria 2856334872 2856339572 307
716 iso_pu_bacteria 2856342000 2856347597 307
717 iso_pu_bacteria 2857367948 2857374627 307
718 iso_pu_bacteria 2869162929 2869166482 307
719 iso_pu_bacteria 2869169390 2869174217 307
720 iso_pu_bacteria 2869234852 2869234923 307
721 iso_pu_bacteria 2869242130 2869242460 307
722 iso_pu_bacteria 2869249662 2869255254 307
723 iso_pu_bacteria 2869256925 2869259150 307
724 iso_pu_bacteria 2869264136 2869265074 307
725 iso_pu_bacteria 2869271264 2869274886 307
726 iso_pu_bacteria 2869278585 2869282742 307
727 iso_pu_bacteria 2871435913 2871437335 307
728 iso_pu_bacteria 2871451962 2871455790 307
729 iso_pu_bacteria 2871459585 2871461826 307
730 iso_pu_bacteria 2871466892 2871473441 307
731 iso_pu_bacteria 2871474448 2871479685 307
732 iso_pu_bacteria 2871481445 2871485096 307
733 iso_pu_bacteria 2874109183 2874115625 307
734 iso_pu_bacteria 2874116593 2874117257 307
735 iso_pu_bacteria 2874131515 2874135397 307
736 iso_pu_bacteria 2874139085 2874142400 307
737 iso_pu_bacteria 2874162495 2874167927 307
738 iso_pu_bacteria 2876363079 2876365700 307
739 iso_pu_bacteria 2876386047 2876388654 307
740 iso_pu_bacteria 2876399893 2876401808 307
741 iso_pu_bacteria 2876406927 2876409808 307
742 iso_pu_bacteria 2876420981 2876423670 307
743 iso_pu_bacteria 2878738818 2878744415 307
744 iso_pu_bacteria 2878774303 2878775521 307
745 iso_pu_bacteria 2888337043 2888338413 307
746 iso_pu_bacteria 2888343758 2888349403 307
747 iso_pu_bacteria 2903448605 2903455488 307
748 iso_pu_bacteria 2903521522 2903523629 307
749 iso_pu_bacteria 2903528002 2903534263 307
750 iso_pu_bacteria 2906363423 2906370088 307
751 iso_pu_bacteria 2906370794 2906371407 307
752 iso_pu_bacteria 2906378014 2906386033 307
753 iso_pu_bacteria 2906386501 2906390261 307
754 iso_pu_bacteria 2906393657 2906394916 307
755 iso_pu_bacteria 2906408224 2906409837 307
756 iso_pu_bacteria 2922151315 2922153130 307
757 iso_pu_bacteria 2922172374 2922176258 307
758 iso_pu_bacteria 2922178524 2922183070 307
759 iso_pu_bacteria 2924710171 2924710469 307
760 iso_pu_bacteria 2924733363 2924737530 307
761 iso_pu_bacteria 2924741084 2924745091 307
762 iso_pu_bacteria 2924748358 2924752472 307
763 iso_pu_bacteria 2924754689 2924762502 307
764 iso_pu_bacteria 2924776078 2924782445 307
765 iso_pu_bacteria 2937836603 2937842253 307
766 iso_pu_bacteria 2937861824 2937866979 307
767 iso_pu_bacteria 2937868953 2937873544 307
768 iso_pu_bacteria 2937877337 2937881086 307
769 iso_pu_bacteria 2937972304 2937977180 307
770 iso_pu_bacteria 2937980651 2937986511 307
771 iso_pu_bacteria 2958034702 2958039525 307
772 iso_pu_bacteria 2958041894 2958052846 307
773 iso_pu_bacteria 2958071322 2958075568 307
774 iso_pu_bacteria 2958084443 2958088357 307
775 iso_pu_bacteria 2958092219 2958093958 307
776 iso_pu_bacteria 2958122699 2958128415 307
777 iso_pu_bacteria 2958158011 2958160865 307
778 iso_pu_bacteria 2961136820 2961141463 307
779 iso_pu_bacteria 2961183825 2961186198 307
780 iso_pu_bacteria 2963644680 2963648175 307
781 iso_pu_bacteria 2965025482 2965027407 307
782 iso_pu_bacteria 2965032056 2965035066 307
783 iso_pu_bacteria 2965040258 2965044059 307
784 iso_pu_bacteria 2965047637 2965048479 307
785 iso_pu_bacteria 2965089291 2965089913 307
786 iso_pu_bacteria 2965110997 2965113097 307
787 iso_pu_bacteria 2968016561 2968020852 307
788 iso_pu_bacteria 2968083720 2968090998 307
789 iso_pu_bacteria 2968138860 2968138882 307
790 iso_pu_bacteria 2970469710 2970474149 307
791 iso_pu_bacteria 2970489779 2970491807 307
792 iso_pu_bacteria 2970510686 2970511014 307
793 iso_pu_bacteria 2970524798 2970531012 307
794 iso_pu_bacteria 2970532167 2970534646 307
795 iso_pu_bacteria 2970540015 2970543277 307
796 iso_pu_bacteria 2970547951 2970549662 307
797 iso_pu_bacteria 2970593180 2970597351 307
798 iso_pu_bacteria 2977851361 2977855592 307
799 iso_pu_bacteria 2977872689 2977879930 307
800 iso_pu_bacteria 2977915119 2977919161 307
801 iso_pu_bacteria 2977922695 2977929301 307
802 iso_pu_bacteria 2977935797 2977937375 307
803 iso_pu_bacteria 2977950692 2977951209 307
804 iso_pu_bacteria 2977986579 2977992782 307
805 iso_pu_bacteria 2979764755 2979767294 307
806 iso_pu_bacteria 2979772303 2979774161 307
807 iso_pu_bacteria 2987645492 2987650623 307
808 iso_pu_bacteria 2987673487 2987676148 307
809 iso_pu_bacteria 2996348954 2996352530 307
810 iso_pu_bacteria 2996386984 2996391183 307
811 iso_pu_bacteria 3004167301 3004171589 307
812 iso_pu_bacteria 3004195979 3004196951 307
813 iso_pu_bacteria 3004211236 3004211843 307
814 iso_pu_bacteria 3004218560 3004219090 307
815 iso_pu_bacteria 3004232784 3004234454 307
816 iso_pu_bacteria 3004248173 3004251203 307
817 iso_pu_bacteria 3004268573 3004270201 307
818 iso_pu_bacteria 3004275668 3004279212 307
819 iso_pu_bacteria 3004289098 3004293305 307
820 iso_pu_bacteria 3004334049 3004341216 307
821 iso_pu_bacteria 637000159 637074152 307
822 iso_pu_bacteria 649633066 649875154 307
823 iso_pu_bacteria 8004300914 8004307038 307
824 iso_pu_bacteria 8004312739 8004315691 307
825 iso_pu_bacteria 8004361976 8004366193 307
826 iso_pu_bacteria 8004633249 8004635270 307
827 iso_pu_bacteria 8004640170 8004640300 307
828 iso_pu_bacteria 8004727605 8004728263 307
829 iso_pu_bacteria 8055617313 8055623817 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

6

303

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9939 3 307
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9917 3 307
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9876 3 307
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9821 3 307
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9781 3 307
ID Description Score Start End Superfamily
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9914 3 307 3.20.20.70
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9815 3 307 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9754 3 301 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9648 3 301 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 3 298 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A530BE36-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9994 78 252 GO:0043720
GO:0046872
AF-A0A357CK18-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9979 15 91 GO:0043720
GO:0046872
AF-A0A528TNE6-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9976 42 188 GO:0043720
GO:0046872
AF-A0A434H308-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9974 4 307 GO:0043720
GO:0046872
AF-A0A527I4L6-F1-model_v4 deleted 0.9974 45 226

Feature Viewer

pLDDT pTM Quality
96.12 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map