F482625
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 829 | 512 | 627 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0201710|Ga0501033_0201710_265_1200 |
| Length | 311 |
| Sequence | MAKSRKVIITCAVTGAIHTPTMSPYLPVTPQEIADAALGAAEAGAAVVHLHARNPKDGRPDQSPEAFLPFVKVIKQASNVVINLTSGGAPTMTVEERVQPAAKLKPEIASLNMGTMNFGLYPMIPRYKGKFKHDWEEPYLEGSRKNMFKNTLADIEYILTTCAENNTRFEIECYDIGHLYTLKHFLDRGVIKPPLFIQSVFGILGGIGPHPEDVIMMRRTADRLFGDQYHWSVLGAGQNQMRIAAQAAAMGGNVRVGLEDSLWIGPGQLAKSNAEQVKKVRQILEGLGLEIATPDDAREILSLKGGDKVGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 9 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 10 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 11 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 12 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 13 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 14 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 15 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 16 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 17 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 18 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 19 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 20 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 21 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 22 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 23 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 24 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 25 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 26 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 27 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 28 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 29 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 30 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 31 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 32 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 33 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 34 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 35 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 36 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 37 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 38 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 39 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 40 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 41 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 42 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 43 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 44 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 45 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 46 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 47 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 48 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 49 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 50 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 51 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 52 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 53 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 54 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 55 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 56 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 57 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 58 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 59 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 60 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 61 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 62 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 63 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 64 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 65 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 66 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 67 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 68 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 69 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 70 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 71 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 72 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 73 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 74 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 75 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 76 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 77 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 78 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 79 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 80 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 81 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 82 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 83 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 84 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 85 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 86 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 87 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 88 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 89 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 90 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 91 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 92 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 93 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 94 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 95 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 96 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 97 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 98 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 99 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 100 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 101 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 102 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 103 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 104 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 105 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 106 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 107 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 108 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 109 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 110 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 111 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 112 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 113 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 114 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 115 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 116 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 117 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 118 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 119 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 120 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 121 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 122 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 123 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 124 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 125 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 126 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 127 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 128 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 129 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 130 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 131 | 2941479691 | |||
| 132 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 133 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 134 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 135 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 136 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 137 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 138 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 139 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 140 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 141 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 142 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 143 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 144 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 145 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 146 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 147 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 148 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 149 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 150 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 151 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 152 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 153 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 154 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 155 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 156 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 157 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 158 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 159 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 160 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 161 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 162 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 163 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 164 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 165 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 166 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 167 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 168 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 169 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 170 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 171 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 172 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 173 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 174 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 175 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 176 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 177 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 178 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 179 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 180 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 181 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 182 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 183 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 184 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 185 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 186 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 187 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 188 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 189 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 190 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 191 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 192 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 193 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 194 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 195 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 196 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 197 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 198 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 200 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 201 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 202 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 203 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 204 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 205 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 206 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 208 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 211 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 227 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 229 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 230 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 231 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 232 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 233 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 235 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 236 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 237 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 238 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 239 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 240 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 241 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 242 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 243 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 267 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 269 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 271 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 275 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 277 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 280 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 325 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 328 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 330 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 331 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 332 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 333 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 334 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 335 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 336 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 337 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 338 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 339 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 340 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 341 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 342 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 343 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 344 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 345 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 346 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 347 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 348 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 349 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 350 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 351 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 352 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 353 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 354 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 355 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 356 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 357 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 440 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 441 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 442 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 443 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 444 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 447 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 448 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 449 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 450 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 451 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 452 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 453 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 454 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 455 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 456 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 457 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 458 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 459 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 460 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 461 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 462 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 463 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 483 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 485 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 496 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 498 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 499 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 500 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 501 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 502 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 503 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 504 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 505 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 506 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 507 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 508 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 509 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 510 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 511 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 512 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.63 |
| Metatranscriptomes | 0 |
| Isolates | 24.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.96 |
| Nodule | 16.53 |
| Rhizoplane | 6.03 |
| Rhizosphere | 57.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001964 | 3300001979 | Bacteria | 9382 |
| 2 | JGI24739J22299_10001531 | 3300001989 | Bacteria | 8732 |
| 3 | JGI24737J22298_10008759 | 3300001990 | Bacteria | 3377 |
| 4 | JGI24737J22298_10012489 | 3300001990 | Bacteria | 2770 |
| 5 | JGI24735J21928_10000021 | 3300002067 | Bacteria | 99198 |
| 6 | JGI24735J21928_10000179 | 3300002067 | Bacteria | 22562 |
| 7 | JGI24735J21928_10000466 | 3300002067 | Bacteria | 14220 |
| 8 | JGI24738J21930_10003992 | 3300002075 | Bacteria | 3664 |
| 9 | JGI25151J46595_10001622 | 3300003187 | Bacteria | 14871 |
| 10 | JGI25151J46595_10001670 | 3300003187 | Bacteria | 14555 |
| 11 | JGI25151J46595_10003677 | 3300003187 | Bacteria | 8351 |
| 12 | JGI25151J46595_10003933 | 3300003187 | Bacteria | 8015 |
| 13 | JGI25153J46596_10034452 | 3300003215 | Bacteria | 1655 |
| 14 | rootH1_10048791 | 3300003316 | Bacteria | 2952 |
| 15 | Ga0055527_1000335 | 3300003760 | Bacteria | 24237 |
| 16 | Ga0055535_1000267 | 3300003761 | Bacteria | 54799 |
| 17 | Ga0055542_1000175 | 3300003762 | Bacteria | 79760 |
| 18 | Ga0055542_1001872 | 3300003762 | Bacteria | 8427 |
| 19 | Ga0055529_1000131 | 3300003763 | Bacteria | 105530 |
| 20 | Ga0055537_1000428 | 3300003773 | Bacteria | 27372 |
| 21 | Ga0055537_1000433 | 3300003773 | Bacteria | 27034 |
| 22 | Ga0055536_1003283 | 3300003781 | Bacteria | 8750 |
| 23 | Ga0055536_1009944 | 3300003781 | Bacteria | 3853 |
| 24 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 25 | Ga0055528_1003161 | 3300003790 | Bacteria | 8429 |
| 26 | Ga0055528_1003690 | 3300003790 | Bacteria | 7588 |
| 27 | Ga0055540_1003300 | 3300003792 | Bacteria | 7869 |
| 28 | Ga0055531_10002668 | 3300003794 | Bacteria | 11763 |
| 29 | Ga0065714_10020982 | 3300005288 | Bacteria | 1340 |
| 30 | Ga0070676_10016208 | 3300005328 | Bacteria | 4118 |
| 31 | Ga0070683_100066990 | 3300005329 | Bacteria | 3344 |
| 32 | Ga0070670_100089227 | 3300005331 | Bacteria | 2650 |
| 33 | Ga0070666_10049415 | 3300005335 | Bacteria | 2827 |
| 34 | Ga0070682_100043866 | 3300005337 | Bacteria | 2766 |
| 35 | Ga0070660_100000060 | 3300005339 | Bacteria | 63781 |
| 36 | Ga0070661_100212918 | 3300005344 | Bacteria | 1480 |
| 37 | Ga0070668_100102032 | 3300005347 | Bacteria | 2274 |
| 38 | Ga0070669_100022162 | 3300005353 | Bacteria | 4542 |
| 39 | Ga0070675_100016920 | 3300005354 | Bacteria | 5791 |
| 40 | Ga0070671_100189520 | 3300005355 | Bacteria | 1743 |
| 41 | Ga0070673_100111890 | 3300005364 | Bacteria | 2266 |
| 42 | Ga0070659_100000105 | 3300005366 | Bacteria | 61709 |
| 43 | Ga0070659_100130274 | 3300005366 | Bacteria | 2042 |
| 44 | Ga0070667_100163748 | 3300005367 | Bacteria | 1960 |
| 45 | Ga0070663_100004136 | 3300005455 | Bacteria | 8481 |
| 46 | Ga0070663_100038590 | 3300005455 | Bacteria | 3332 |
| 47 | Ga0070663_100087873 | 3300005455 | Bacteria | 2298 |
| 48 | Ga0070663_100090535 | 3300005455 | Bacteria | 2266 |
| 49 | Ga0070678_100029470 | 3300005456 | Bacteria | 3758 |
| 50 | Ga0070662_100001117 | 3300005457 | Bacteria | 16378 |
| 51 | Ga0070684_100299612 | 3300005535 | Bacteria | 1475 |
| 52 | Ga0068853_100003394 | 3300005539 | Bacteria | 12196 |
| 53 | Ga0068853_100053084 | 3300005539 | Bacteria | 3491 |
| 54 | Ga0068853_100140707 | 3300005539 | Bacteria | 2166 |
| 55 | Ga0070665_100072894 | 3300005548 | Bacteria | 3441 |
| 56 | Ga0070665_100155612 | 3300005548 | Bacteria | 2288 |
| 57 | Ga0068855_100005206 | 3300005563 | Bacteria | 15863 |
| 58 | Ga0068855_100192011 | 3300005563 | Bacteria | 2303 |
| 59 | Ga0070664_100047047 | 3300005564 | Bacteria | 3644 |
| 60 | Ga0068857_100001830 | 3300005577 | Bacteria | 17110 |
| 61 | Ga0068854_100014116 | 3300005578 | Bacteria | 5258 |
| 62 | Ga0068856_100005144 | 3300005614 | Bacteria | 12918 |
| 63 | Ga0068852_100004727 | 3300005616 | Bacteria | 9663 |
| 64 | Ga0068851_10004146 | 3300005834 | Bacteria | 6523 |
| 65 | Ga0070717_10004861 | 3300006028 | Bacteria | 9772 |
| 66 | Ga0075365_10010855 | 3300006038 | Bacteria | 5329 |
| 67 | Ga0075364_10035320 | 3300006051 | Bacteria | 3230 |
| 68 | Ga0075370_10002532 | 3300006353 | Bacteria | 8491 |
| 69 | Ga0075370_10053986 | 3300006353 | Bacteria | 2281 |
| 70 | Ga0075430_100240566 | 3300006846 | Bacteria | 1500 |
| 71 | Ga0075433_10015205 | 3300006852 | Bacteria | 6307 |
| 72 | Ga0075434_100013935 | 3300006871 | Bacteria | 7671 |
| 73 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 74 | Ga0099826_10000084 | 3300006948 | Bacteria | 46867 |
| 75 | Ga0099795_10049754 | 3300007788 | Bacteria | 1522 |
| 76 | Ga0105251_10000785 | 3300009011 | Bacteria | 28819 |
| 77 | Ga0105251_10001106 | 3300009011 | Bacteria | 23423 |
| 78 | Ga0105251_10017710 | 3300009011 | Bacteria | 3808 |
| 79 | Ga0105244_10044711 | 3300009036 | Bacteria | 2280 |
| 80 | Ga0105250_10008651 | 3300009092 | Bacteria | 4314 |
| 81 | Ga0105250_10021604 | 3300009092 | Bacteria | 2597 |
| 82 | Ga0105250_10073777 | 3300009092 | Bacteria | 1380 |
| 83 | Ga0105240_10007552 | 3300009093 | Bacteria | 15757 |
| 84 | Ga0105240_10047662 | 3300009093 | Bacteria | 5421 |
| 85 | Ga0105240_10116246 | 3300009093 | Bacteria | 3228 |
| 86 | Ga0105240_10154754 | 3300009093 | Bacteria | 2728 |
| 87 | Ga0111539_10010305 | 3300009094 | Bacteria | 11766 |
| 88 | Ga0111539_11118142 | 3300009094 | Bacteria | 915 |
| 89 | Ga0105245_10046145 | 3300009098 | Bacteria | 3893 |
| 90 | Ga0105245_10594039 | 3300009098 | Bacteria | 1133 |
| 91 | Ga0105247_10014704 | 3300009101 | Bacteria | 4692 |
| 92 | Ga0114129_10009151 | 3300009147 | Bacteria | 14120 |
| 93 | Ga0114129_10288691 | 3300009147 | Bacteria | 2190 |
| 94 | Ga0105243_10000538 | 3300009148 | Bacteria | 38381 |
| 95 | Ga0105243_10001515 | 3300009148 | Bacteria | 20296 |
| 96 | Ga0105243_10126952 | 3300009148 | Bacteria | 2159 |
| 97 | Ga0105241_10001889 | 3300009174 | Bacteria | 15869 |
| 98 | Ga0105241_10046629 | 3300009174 | Bacteria | 3292 |
| 99 | Ga0105241_10067474 | 3300009174 | Bacteria | 2769 |
| 100 | Ga0105248_10069030 | 3300009177 | Bacteria | 3968 |
| 101 | Ga0105237_10004677 | 3300009545 | Bacteria | 15755 |
| 102 | Ga0105237_10011794 | 3300009545 | Bacteria | 9246 |
| 103 | Ga0105237_10116335 | 3300009545 | Bacteria | 2667 |
| 104 | Ga0105237_10123587 | 3300009545 | Bacteria | 2582 |
| 105 | Ga0105237_10514138 | 3300009545 | Bacteria | 1204 |
| 106 | Ga0105238_10003442 | 3300009551 | Bacteria | 15757 |
| 107 | Ga0105238_10055515 | 3300009551 | Bacteria | 3975 |
| 108 | Ga0105238_10095371 | 3300009551 | Bacteria | 2962 |
| 109 | Ga0105239_10014965 | 3300010375 | Bacteria | 8600 |
| 110 | Ga0105239_10037516 | 3300010375 | Bacteria | 5310 |
| 111 | Ga0105239_10047873 | 3300010375 | Bacteria | 4686 |
| 112 | Ga0157373_10021715 | 3300013100 | Bacteria | 4658 |
| 113 | Ga0157371_10051329 | 3300013102 | Bacteria | 2931 |
| 114 | Ga0157370_10001878 | 3300013104 | Bacteria | 25891 |
| 115 | Ga0157370_10007059 | 3300013104 | Bacteria | 12263 |
| 116 | Ga0157370_10112212 | 3300013104 | Bacteria | 2548 |
| 117 | Ga0157370_10196210 | 3300013104 | Bacteria | 1873 |
| 118 | Ga0157369_10003126 | 3300013105 | Bacteria | 19790 |
| 119 | Ga0157369_10006744 | 3300013105 | Bacteria | 13250 |
| 120 | Ga0157369_10150209 | 3300013105 | Bacteria | 2462 |
| 121 | Ga0157369_10383251 | 3300013105 | Bacteria | 1459 |
| 122 | Ga0157369_10424536 | 3300013105 | Bacteria | 1378 |
| 123 | Ga0157374_10017267 | 3300013296 | Bacteria | 6351 |
| 124 | Ga0157374_10031859 | 3300013296 | Bacteria | 4796 |
| 125 | Ga0157374_10069147 | 3300013296 | Bacteria | 3324 |
| 126 | Ga0157374_10201179 | 3300013296 | Bacteria | 1951 |
| 127 | Ga0157378_10017744 | 3300013297 | Bacteria | 6249 |
| 128 | Ga0163162_10008134 | 3300013306 | Bacteria | 10234 |
| 129 | Ga0163162_10412841 | 3300013306 | Bacteria | 1482 |
| 130 | Ga0163162_10446331 | 3300013306 | Bacteria | 1425 |
| 131 | Ga0157372_10004099 | 3300013307 | Bacteria | 15628 |
| 132 | Ga0157372_10139241 | 3300013307 | Bacteria | 2795 |
| 133 | Ga0157372_10780717 | 3300013307 | Bacteria | 1110 |
| 134 | Ga0157375_10108186 | 3300013308 | Bacteria | 2874 |
| 135 | Ga0182008_10079704 | 3300014497 | Bacteria | 1611 |
| 136 | Ga0157376_10276879 | 3300014969 | Bacteria | 1579 |
| 137 | Ga0182005_1008866 | 3300015265 | Bacteria | 2951 |
| 138 | Ga0163161_10001698 | 3300017792 | Bacteria | 16165 |
| 139 | Ga0213876_10001668 | 3300021384 | Bacteria | 13546 |
| 140 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 141 | Ga0209672_100158 | 3300025228 | Bacteria | 58904 |
| 142 | Ga0209147_100040 | 3300025229 | Bacteria | 307612 |
| 143 | Ga0209258_100061 | 3300025242 | Bacteria | 313501 |
| 144 | Ga0209646_1016612 | 3300025246 | Bacteria | 1090 |
| 145 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 146 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 147 | Ga0209148_1004490 | 3300025254 | Bacteria | 3428 |
| 148 | Ga0209759_1017860 | 3300025256 | Bacteria | 1733 |
| 149 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 150 | Ga0209565_1006273 | 3300025263 | Bacteria | 3358 |
| 151 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 152 | Ga0209455_1000183 | 3300025272 | Bacteria | 99952 |
| 153 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 154 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 155 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 156 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 157 | Ga0209676_1001163 | 3300025292 | Bacteria | 28546 |
| 158 | Ga0209676_1021223 | 3300025292 | Bacteria | 2186 |
| 159 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 160 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 161 | Ga0209025_1000113 | 3300025294 | Bacteria | 218943 |
| 162 | Ga0209025_1000307 | 3300025294 | Bacteria | 108704 |
| 163 | Ga0209025_1000387 | 3300025294 | Bacteria | 91323 |
| 164 | Ga0209025_1014274 | 3300025294 | Bacteria | 4905 |
| 165 | Ga0209564_1030464 | 3300025295 | Bacteria | 1671 |
| 166 | Ga0209758_1000573 | 3300025297 | Bacteria | 57583 |
| 167 | Ga0209050_1004017 | 3300025298 | Bacteria | 10357 |
| 168 | Ga0207426_1000965 | 3300025302 | Bacteria | 28363 |
| 169 | Ga0207426_1000982 | 3300025302 | Bacteria | 28021 |
| 170 | Ga0209051_1001159 | 3300025303 | Bacteria | 23972 |
| 171 | Ga0209051_1002220 | 3300025303 | Bacteria | 14326 |
| 172 | Ga0209051_1036907 | 3300025303 | Bacteria | 1799 |
| 173 | Ga0209257_1004548 | 3300025304 | Bacteria | 10621 |
| 174 | Ga0207697_10003124 | 3300025315 | Bacteria | 8277 |
| 175 | Ga0207656_10001956 | 3300025321 | Bacteria | 6852 |
| 176 | Ga0207696_1022993 | 3300025711 | Bacteria | 1972 |
| 177 | Ga0207655_1013437 | 3300025728 | Bacteria | 4701 |
| 178 | Ga0207713_1003488 | 3300025735 | Bacteria | 10687 |
| 179 | Ga0207713_1059249 | 3300025735 | Bacteria | 1470 |
| 180 | Ga0207647_10017310 | 3300025904 | Bacteria | 4900 |
| 181 | Ga0207647_10033801 | 3300025904 | Bacteria | 3270 |
| 182 | Ga0207647_10038780 | 3300025904 | Bacteria | 3010 |
| 183 | Ga0207647_10079244 | 3300025904 | Bacteria | 1972 |
| 184 | Ga0207645_10003783 | 3300025907 | Bacteria | 11364 |
| 185 | Ga0207705_10000642 | 3300025909 | Bacteria | 29173 |
| 186 | Ga0207705_10051673 | 3300025909 | Bacteria | 2958 |
| 187 | Ga0207654_10000275 | 3300025911 | Bacteria | 31294 |
| 188 | Ga0207695_10001242 | 3300025913 | Bacteria | 43591 |
| 189 | Ga0207695_10004197 | 3300025913 | Bacteria | 19798 |
| 190 | Ga0207695_10055858 | 3300025913 | Bacteria | 4112 |
| 191 | Ga0207671_10039829 | 3300025914 | Bacteria | 3480 |
| 192 | Ga0207671_10052049 | 3300025914 | Bacteria | 3034 |
| 193 | Ga0207671_10258967 | 3300025914 | Bacteria | 1369 |
| 194 | Ga0207657_10001165 | 3300025919 | Bacteria | 27919 |
| 195 | Ga0207657_10054794 | 3300025919 | Bacteria | 3446 |
| 196 | Ga0207657_10198049 | 3300025919 | Bacteria | 1617 |
| 197 | Ga0207694_10001514 | 3300025924 | Bacteria | 19795 |
| 198 | Ga0207694_10036123 | 3300025924 | Bacteria | 3791 |
| 199 | Ga0207694_10090521 | 3300025924 | Bacteria | 2414 |
| 200 | Ga0207650_10118614 | 3300025925 | Bacteria | 2057 |
| 201 | Ga0207687_10048287 | 3300025927 | Bacteria | 2954 |
| 202 | Ga0207690_10000115 | 3300025932 | Bacteria | 65817 |
| 203 | Ga0207690_10127777 | 3300025932 | Bacteria | 1856 |
| 204 | Ga0207690_10184197 | 3300025932 | Bacteria | 1574 |
| 205 | Ga0207706_10004093 | 3300025933 | Bacteria | 13778 |
| 206 | Ga0207709_10000112 | 3300025935 | Bacteria | 127357 |
| 207 | Ga0207709_10001057 | 3300025935 | Bacteria | 20345 |
| 208 | Ga0207691_10020459 | 3300025940 | Bacteria | 6255 |
| 209 | Ga0207711_10094670 | 3300025941 | Bacteria | 2633 |
| 210 | Ga0207661_10038278 | 3300025944 | Bacteria | 3758 |
| 211 | Ga0207679_10031808 | 3300025945 | Bacteria | 3697 |
| 212 | Ga0207667_10023159 | 3300025949 | Bacteria | 6840 |
| 213 | Ga0207667_10032826 | 3300025949 | Bacteria | 5588 |
| 214 | Ga0207651_10180080 | 3300025960 | Bacteria | 1676 |
| 215 | Ga0207668_10233462 | 3300025972 | Bacteria | 1484 |
| 216 | Ga0207640_10012604 | 3300025981 | Bacteria | 4821 |
| 217 | Ga0207658_10099880 | 3300025986 | Bacteria | 2271 |
| 218 | Ga0207703_10365850 | 3300026035 | Bacteria | 1331 |
| 219 | Ga0207639_10000210 | 3300026041 | Bacteria | 44226 |
| 220 | Ga0207639_10000280 | 3300026041 | Bacteria | 36724 |
| 221 | Ga0207639_10081456 | 3300026041 | Bacteria | 2564 |
| 222 | Ga0207678_10000576 | 3300026067 | Bacteria | 33612 |
| 223 | Ga0207678_10006339 | 3300026067 | Bacteria | 10500 |
| 224 | Ga0207678_10007574 | 3300026067 | Bacteria | 9596 |
| 225 | Ga0207678_10233532 | 3300026067 | Bacteria | 1575 |
| 226 | Ga0207702_10002988 | 3300026078 | Bacteria | 15741 |
| 227 | Ga0207676_10016766 | 3300026095 | Bacteria | 5304 |
| 228 | Ga0207674_10001961 | 3300026116 | Bacteria | 26062 |
| 229 | Ga0207674_10323883 | 3300026116 | Bacteria | 1491 |
| 230 | Ga0207683_10009519 | 3300026121 | Bacteria | 8282 |
| 231 | Ga0207683_10586703 | 3300026121 | Bacteria | 1031 |
| 232 | Ga0207698_10004738 | 3300026142 | Bacteria | 8321 |
| 233 | Ga0207698_10004765 | 3300026142 | Bacteria | 8300 |
| 234 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 235 | Ga0209371_1000971 | 3300027312 | Bacteria | 22220 |
| 236 | Ga0209282_1000112 | 3300027666 | Bacteria | 53120 |
| 237 | Ga0207428_10019979 | 3300027907 | Bacteria | 5705 |
| 238 | Ga0207428_10272570 | 3300027907 | Bacteria | 1258 |
| 239 | Ga0268266_10256433 | 3300028379 | Bacteria | 1619 |
| 240 | Ga0268266_10382919 | 3300028379 | Bacteria | 1327 |
| 241 | Ga0268256_1000821 | 3300030500 | Bacteria | 22220 |
| 242 | Ga0265340_10008869 | 3300031247 | Bacteria | 5419 |
| 243 | Ga0265327_10000108 | 3300031251 | Bacteria | 183209 |
| 244 | Ga0307408_100008944 | 3300031548 | Bacteria | 6615 |
| 245 | Ga0307408_100092161 | 3300031548 | Bacteria | 2290 |
| 246 | Ga0307408_100107285 | 3300031548 | Bacteria | 2138 |
| 247 | Ga0307408_100203985 | 3300031548 | Bacteria | 1602 |
| 248 | Ga0307405_10009497 | 3300031731 | Bacteria | 4991 |
| 249 | Ga0307405_10125375 | 3300031731 | Bacteria | 1765 |
| 250 | Ga0307410_10096878 | 3300031852 | Bacteria | 2106 |
| 251 | Ga0307410_10188106 | 3300031852 | Bacteria | 1568 |
| 252 | Ga0307410_10304433 | 3300031852 | Bacteria | 1259 |
| 253 | Ga0307406_10090619 | 3300031901 | Bacteria | 2058 |
| 254 | Ga0307407_10107651 | 3300031903 | Bacteria | 1744 |
| 255 | Ga0307412_10000021 | 3300031911 | Bacteria | 250629 |
| 256 | Ga0307412_10000199 | 3300031911 | Bacteria | 41000 |
| 257 | Ga0307412_10003193 | 3300031911 | Bacteria | 9106 |
| 258 | Ga0307412_10429829 | 3300031911 | Bacteria | 1082 |
| 259 | Ga0307409_100010499 | 3300031995 | Bacteria | 5764 |
| 260 | Ga0307416_100003033 | 3300032002 | Bacteria | 9815 |
| 261 | Ga0307416_100079069 | 3300032002 | Bacteria | 2770 |
| 262 | Ga0307416_100082414 | 3300032002 | Bacteria | 2725 |
| 263 | Ga0307416_100204781 | 3300032002 | Bacteria | 1876 |
| 264 | Ga0307414_10135370 | 3300032004 | Bacteria | 1920 |
| 265 | Ga0307414_10251577 | 3300032004 | Bacteria | 1469 |
| 266 | Ga0307414_10332183 | 3300032004 | Bacteria | 1298 |
| 267 | Ga0307411_10018647 | 3300032005 | Bacteria | 3987 |
| 268 | Ga0307411_10029169 | 3300032005 | Bacteria | 3365 |
| 269 | Ga0316584_0220605 | 3300036712 | Bacteria | 1393 |
| 270 | Ga0395899_0001350 | 3300037312 | Bacteria | 21128 |
| 271 | Ga0395900_0003263 | 3300037418 | Bacteria | 17573 |
| 272 | Ga0395898_0002587 | 3300037466 | Bacteria | 21139 |
| 273 | Ga0395898_0003486 | 3300037466 | Bacteria | 17573 |
| 274 | Ga0395905_0002203 | 3300037471 | Bacteria | 22010 |
| 275 | Ga0395905_0003218 | 3300037471 | Bacteria | 17573 |
| 276 | Ga0395905_0070959 | 3300037471 | Bacteria | 3265 |
| 277 | Ga0395905_0167754 | 3300037471 | Bacteria | 2063 |
| 278 | Ga0436364_1500701 | 3300037853 | Bacteria | 2848 |
| 279 | Ga0395901_0002823 | 3300038443 | Bacteria | 17545 |
| 280 | Ga0395901_0011955 | 3300038443 | Bacteria | 8802 |
| 281 | Ga0395901_0024390 | 3300038443 | Bacteria | 6207 |
| 282 | Ga0395901_0437589 | 3300038443 | Bacteria | 1339 |
| 283 | Ga0436365_0781525 | 3300039437 | Bacteria | 13622 |
| 284 | Ga0436365_1641635 | 3300039437 | Bacteria | 5698 |
| 285 | Ga0439466_0043955 | 3300041411 | Bacteria | 1482 |
| 286 | Ga0466969_0002785 | 3300044656 | Bacteria | 9338 |
| 287 | Ga0453683_0004282 | 3300044673 | Bacteria | 10176 |
| 288 | Ga0466965_0083609 | 3300044683 | Bacteria | 1616 |
| 289 | Ga0466961_0042674 | 3300044693 | Bacteria | 2907 |
| 290 | Ga0466970_0042166 | 3300044765 | Bacteria | 2427 |
| 291 | Ga0466959_0014112 | 3300045049 | Bacteria | 5797 |
| 292 | Ga0451576_0002450 | 3300045051 | Bacteria | 27662 |
| 293 | Ga0466967_0039385 | 3300045976 | Bacteria | 4063 |
| 294 | Ga0466967_0417448 | 3300045976 | Bacteria | 1307 |
| 295 | Ga0495592_0035395 | 3300046454 | Bacteria | 3762 |
| 296 | Ga0495603_0000115 | 3300046455 | Bacteria | 38890 |
| 297 | Ga0495603_0008106 | 3300046455 | Bacteria | 6346 |
| 298 | Ga0495590_0008645 | 3300046457 | Bacteria | 3879 |
| 299 | Ga0495591_019786 | 3300046458 | Bacteria | 2244 |
| 300 | Ga0495629_0000111 | 3300046459 | Bacteria | 73381 |
| 301 | Ga0495629_0000432 | 3300046459 | Bacteria | 34964 |
| 302 | Ga0495629_0002672 | 3300046459 | Bacteria | 13643 |
| 303 | Ga0495629_0006729 | 3300046459 | Bacteria | 8497 |
| 304 | Ga0495629_0007141 | 3300046459 | Bacteria | 8230 |
| 305 | Ga0495638_0123038 | 3300046460 | Bacteria | 1531 |
| 306 | Ga0495651_0068251 | 3300046462 | Bacteria | 2710 |
| 307 | Ga0495653_0002714 | 3300046463 | Bacteria | 14102 |
| 308 | Ga0495653_0008865 | 3300046463 | Bacteria | 8231 |
| 309 | Ga0495653_0018434 | 3300046463 | Bacteria | 5668 |
| 310 | Ga0495653_0098639 | 3300046463 | Bacteria | 2121 |
| 311 | Ga0495653_0140474 | 3300046463 | Bacteria | 1699 |
| 312 | Ga0495650_0000681 | 3300046471 | Bacteria | 44150 |
| 313 | Ga0495650_0001326 | 3300046471 | Bacteria | 24868 |
| 314 | Ga0495580_0006962 | 3300046472 | Bacteria | 9119 |
| 315 | Ga0495580_0014713 | 3300046472 | Bacteria | 5930 |
| 316 | Ga0495580_0015632 | 3300046472 | Bacteria | 5718 |
| 317 | Ga0495580_0057681 | 3300046472 | Bacteria | 2732 |
| 318 | Ga0495580_0105299 | 3300046472 | Bacteria | 1960 |
| 319 | Ga0495582_0009528 | 3300046473 | Bacteria | 5350 |
| 320 | Ga0495605_0014058 | 3300046474 | Bacteria | 4391 |
| 321 | Ga0495639_0016256 | 3300046475 | Bacteria | 3229 |
| 322 | Ga0495662_0003788 | 3300046476 | Bacteria | 7623 |
| 323 | Ga0495664_0000813 | 3300046477 | Bacteria | 15979 |
| 324 | Ga0495664_0057303 | 3300046477 | Bacteria | 2318 |
| 325 | Ga0495664_0122947 | 3300046477 | Bacteria | 1569 |
| 326 | Ga0495584_0026184 | 3300046491 | Bacteria | 2955 |
| 327 | Ga0495584_0043016 | 3300046491 | Bacteria | 2280 |
| 328 | Ga0495584_0121309 | 3300046491 | Bacteria | 1324 |
| 329 | Ga0495585_0195100 | 3300046492 | Bacteria | 1034 |
| 330 | Ga0495594_0066459 | 3300046499 | Bacteria | 2000 |
| 331 | Ga0495594_0109974 | 3300046499 | Bacteria | 1554 |
| 332 | Ga0495594_0159051 | 3300046499 | Bacteria | 1284 |
| 333 | Ga0495596_0005232 | 3300046500 | Bacteria | 6164 |
| 334 | Ga0495596_0010986 | 3300046500 | Bacteria | 3922 |
| 335 | Ga0495596_0023330 | 3300046500 | Bacteria | 2511 |
| 336 | Ga0495596_0105394 | 3300046500 | Bacteria | 1095 |
| 337 | Ga0495583_0015739 | 3300046506 | Bacteria | 4098 |
| 338 | Ga0495583_0016468 | 3300046506 | Bacteria | 3971 |
| 339 | Ga0495606_0003045 | 3300046507 | Bacteria | 18275 |
| 340 | Ga0495606_0003625 | 3300046507 | Bacteria | 16226 |
| 341 | Ga0495606_0052837 | 3300046507 | Bacteria | 2639 |
| 342 | Ga0495608_0001030 | 3300046511 | Bacteria | 19558 |
| 343 | Ga0495608_0026577 | 3300046511 | Bacteria | 3944 |
| 344 | Ga0495608_0063302 | 3300046511 | Bacteria | 2428 |
| 345 | Ga0495610_0001663 | 3300046512 | Bacteria | 19543 |
| 346 | Ga0495618_0023948 | 3300046514 | Bacteria | 3780 |
| 347 | Ga0495618_0090660 | 3300046514 | Bacteria | 1954 |
| 348 | Ga0495618_0117790 | 3300046514 | Bacteria | 1701 |
| 349 | Ga0495620_0000640 | 3300046515 | Bacteria | 21757 |
| 350 | Ga0495628_0019402 | 3300046516 | Bacteria | 5622 |
| 351 | Ga0495628_0021726 | 3300046516 | Bacteria | 5274 |
| 352 | Ga0495630_0003995 | 3300046517 | Bacteria | 10320 |
| 353 | Ga0495630_0004112 | 3300046517 | Bacteria | 10187 |
| 354 | Ga0495631_0030935 | 3300046518 | Bacteria | 2426 |
| 355 | Ga0495631_0059173 | 3300046518 | Bacteria | 1665 |
| 356 | Ga0495632_0002605 | 3300046519 | Bacteria | 13596 |
| 357 | Ga0495648_0005165 | 3300046524 | Bacteria | 10924 |
| 358 | Ga0495648_0123824 | 3300046524 | Bacteria | 1385 |
| 359 | Ga0495666_0000120 | 3300046526 | Bacteria | 32561 |
| 360 | Ga0495642_0003281 | 3300046528 | Bacteria | 6397 |
| 361 | Ga0495642_0005435 | 3300046528 | Bacteria | 4894 |
| 362 | Ga0495642_0026586 | 3300046528 | Bacteria | 2299 |
| 363 | Ga0495652_0010011 | 3300046529 | Bacteria | 8593 |
| 364 | Ga0495652_0011966 | 3300046529 | Bacteria | 7845 |
| 365 | Ga0495652_0102931 | 3300046529 | Bacteria | 2312 |
| 366 | Ga0495654_0041467 | 3300046530 | Bacteria | 2289 |
| 367 | Ga0495665_0000183 | 3300046531 | Bacteria | 31950 |
| 368 | Ga0495665_0000239 | 3300046531 | Bacteria | 27614 |
| 369 | Ga0495665_0019318 | 3300046531 | Bacteria | 3664 |
| 370 | Ga0495665_0020982 | 3300046531 | Bacteria | 3510 |
| 371 | Ga0495640_0001503 | 3300046533 | Bacteria | 18377 |
| 372 | Ga0495586_0012104 | 3300046535 | Bacteria | 4580 |
| 373 | Ga0495586_0038960 | 3300046535 | Bacteria | 2554 |
| 374 | Ga0495586_0067089 | 3300046535 | Bacteria | 1956 |
| 375 | Ga0495586_0071134 | 3300046535 | Bacteria | 1900 |
| 376 | Ga0495587_0019682 | 3300046536 | Bacteria | 4174 |
| 377 | Ga0495587_0029061 | 3300046536 | Bacteria | 3358 |
| 378 | Ga0495587_0054743 | 3300046536 | Bacteria | 2351 |
| 379 | Ga0495587_0061191 | 3300046536 | Bacteria | 2206 |
| 380 | Ga0495597_0001163 | 3300046542 | Bacteria | 19763 |
| 381 | Ga0495597_0027457 | 3300046542 | Bacteria | 2610 |
| 382 | Ga0495645_0000928 | 3300046543 | Bacteria | 19942 |
| 383 | Ga0495645_0002267 | 3300046543 | Bacteria | 13087 |
| 384 | Ga0495645_0025722 | 3300046543 | Bacteria | 4273 |
| 385 | Ga0495645_0101234 | 3300046543 | Bacteria | 2048 |
| 386 | Ga0495645_0110359 | 3300046543 | Bacteria | 1947 |
| 387 | Ga0495622_0000115 | 3300046557 | Bacteria | 69111 |
| 388 | Ga0495667_0026792 | 3300046559 | Bacteria | 3884 |
| 389 | Ga0495656_0001038 | 3300046615 | Bacteria | 8987 |
| 390 | Ga0495668_0046342 | 3300046616 | Bacteria | 2415 |
| 391 | Ga0495634_0031592 | 3300046642 | Bacteria | 3645 |
| 392 | Ga0495634_0158610 | 3300046642 | Bacteria | 1427 |
| 393 | Ga0495611_0049910 | 3300046648 | Bacteria | 1884 |
| 394 | Ga0495625_0000052 | 3300046660 | Bacteria | 190656 |
| 395 | Ga0495635_0004416 | 3300046663 | Bacteria | 9739 |
| 396 | Ga0495635_0025633 | 3300046663 | Bacteria | 4108 |
| 397 | Ga0495635_0037716 | 3300046663 | Bacteria | 3345 |
| 398 | Ga0495659_0008926 | 3300046664 | Bacteria | 3194 |
| 399 | Ga0495661_0001916 | 3300046665 | Bacteria | 16560 |
| 400 | Ga0495588_0001274 | 3300046674 | Bacteria | 10806 |
| 401 | Ga0495588_0010138 | 3300046674 | Bacteria | 4371 |
| 402 | Ga0495588_0059157 | 3300046674 | Bacteria | 1982 |
| 403 | Ga0495588_0067791 | 3300046674 | Bacteria | 1852 |
| 404 | Ga0495588_0072867 | 3300046674 | Bacteria | 1787 |
| 405 | Ga0495623_0000735 | 3300046679 | Bacteria | 21966 |
| 406 | Ga0495623_0002004 | 3300046679 | Bacteria | 13669 |
| 407 | Ga0495623_0002295 | 3300046679 | Bacteria | 12744 |
| 408 | Ga0495623_0021196 | 3300046679 | Bacteria | 4198 |
| 409 | Ga0495623_0236671 | 3300046679 | Bacteria | 1033 |
| 410 | Ga0495646_0012933 | 3300046680 | Bacteria | 5305 |
| 411 | Ga0495646_0021705 | 3300046680 | Bacteria | 4055 |
| 412 | Ga0495646_0050989 | 3300046680 | Bacteria | 2506 |
| 413 | Ga0495646_0052044 | 3300046680 | Bacteria | 2475 |
| 414 | Ga0495646_0061254 | 3300046680 | Bacteria | 2241 |
| 415 | Ga0495646_0152262 | 3300046680 | Bacteria | 1285 |
| 416 | Ga0495669_0002555 | 3300046684 | Bacteria | 7431 |
| 417 | Ga0495669_0007805 | 3300046684 | Bacteria | 4491 |
| 418 | Ga0495669_0049849 | 3300046684 | Bacteria | 1876 |
| 419 | Ga0495613_0002707 | 3300046689 | Bacteria | 13299 |
| 420 | Ga0495613_0028567 | 3300046689 | Bacteria | 4148 |
| 421 | Ga0495613_0101470 | 3300046689 | Bacteria | 2078 |
| 422 | Ga0495613_0156474 | 3300046689 | Bacteria | 1623 |
| 423 | Ga0495624_0000471 | 3300046690 | Bacteria | 31497 |
| 424 | Ga0495624_0007388 | 3300046690 | Bacteria | 7715 |
| 425 | Ga0495624_0046645 | 3300046690 | Bacteria | 2755 |
| 426 | Ga0495670_0004902 | 3300046691 | Bacteria | 6574 |
| 427 | Ga0495670_0036872 | 3300046691 | Bacteria | 2437 |
| 428 | Ga0495670_0106382 | 3300046691 | Bacteria | 1449 |
| 429 | Ga0495671_0019792 | 3300046692 | Bacteria | 3554 |
| 430 | Ga0495671_0051755 | 3300046692 | Bacteria | 2042 |
| 431 | Ga0495671_0089623 | 3300046692 | Bacteria | 1506 |
| 432 | Ga0495649_0009639 | 3300046694 | Bacteria | 5725 |
| 433 | Ga0495649_0025354 | 3300046694 | Bacteria | 3302 |
| 434 | Ga0495589_0014903 | 3300046794 | Bacteria | 4000 |
| 435 | Ga0495589_0031066 | 3300046794 | Bacteria | 2689 |
| 436 | Ga0495589_0079778 | 3300046794 | Bacteria | 1592 |
| 437 | Ga0495600_0004212 | 3300046809 | Bacteria | 8585 |
| 438 | Ga0495600_0016957 | 3300046809 | Bacteria | 4630 |
| 439 | Ga0495660_0039725 | 3300046810 | Bacteria | 2612 |
| 440 | Ga0495581_0001779 | 3300047315 | Bacteria | 12038 |
| 441 | Ga0495581_0003591 | 3300047315 | Bacteria | 8921 |
| 442 | Ga0495581_0013691 | 3300047315 | Bacteria | 4702 |
| 443 | Ga0495581_0018957 | 3300047315 | Bacteria | 3993 |
| 444 | Ga0495581_0029023 | 3300047315 | Bacteria | 3208 |
| 445 | Ga0495604_0003479 | 3300047317 | Bacteria | 12558 |
| 446 | Ga0495604_0039011 | 3300047317 | Bacteria | 3734 |
| 447 | Ga0495604_0092092 | 3300047317 | Bacteria | 2246 |
| 448 | Ga0495604_0101326 | 3300047317 | Bacteria | 2115 |
| 449 | Ga0495636_0023272 | 3300047318 | Bacteria | 2507 |
| 450 | Ga0495674_0004653 | 3300047319 | Bacteria | 13191 |
| 451 | Ga0495674_0006385 | 3300047319 | Bacteria | 11304 |
| 452 | Ga0495674_0030150 | 3300047319 | Bacteria | 4934 |
| 453 | Ga0495674_0056536 | 3300047319 | Bacteria | 3435 |
| 454 | Ga0495672_0002500 | 3300047320 | Bacteria | 16819 |
| 455 | Ga0495680_0036140 | 3300047322 | Bacteria | 3970 |
| 456 | Ga0495680_0037536 | 3300047322 | Bacteria | 3879 |
| 457 | Ga0495680_0055439 | 3300047322 | Bacteria | 3074 |
| 458 | Ga0495683_0002608 | 3300047323 | Bacteria | 10820 |
| 459 | Ga0495683_0003057 | 3300047323 | Bacteria | 9829 |
| 460 | Ga0495683_0003168 | 3300047323 | Bacteria | 9611 |
| 461 | Ga0495683_0010823 | 3300047323 | Bacteria | 4811 |
| 462 | Ga0495683_0039615 | 3300047323 | Bacteria | 2381 |
| 463 | Ga0495683_0110483 | 3300047323 | Bacteria | 1313 |
| 464 | Ga0495687_000020 | 3300047443 | Bacteria | 337717 |
| 465 | Ga0495687_009870 | 3300047443 | Bacteria | 5290 |
| 466 | Ga0495687_010401 | 3300047443 | Bacteria | 5105 |
| 467 | Ga0495675_0001188 | 3300047444 | Bacteria | 15769 |
| 468 | Ga0495675_0029177 | 3300047444 | Bacteria | 3517 |
| 469 | Ga0495675_0035095 | 3300047444 | Bacteria | 3204 |
| 470 | Ga0495675_0046368 | 3300047444 | Bacteria | 2767 |
| 471 | Ga0495675_0078003 | 3300047444 | Bacteria | 2086 |
| 472 | Ga0495673_0001172 | 3300047469 | Bacteria | 22155 |
| 473 | Ga0495673_0072563 | 3300047469 | Bacteria | 1444 |
| 474 | Ga0495681_0039813 | 3300047470 | Bacteria | 2292 |
| 475 | Ga0495681_0099252 | 3300047470 | Bacteria | 1275 |
| 476 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 477 | Ga0495686_0097466 | 3300047472 | Bacteria | 1777 |
| 478 | Ga0495593_0000414 | 3300047673 | Bacteria | 23743 |
| 479 | Ga0495593_0002167 | 3300047673 | Bacteria | 11742 |
| 480 | Ga0495593_0013364 | 3300047673 | Bacteria | 4684 |
| 481 | Ga0495593_0015994 | 3300047673 | Bacteria | 4236 |
| 482 | Ga0495602_0001650 | 3300048088 | Bacteria | 22204 |
| 483 | Ga0495602_0004155 | 3300048088 | Bacteria | 15080 |
| 484 | Ga0495602_0013684 | 3300048088 | Bacteria | 8277 |
| 485 | Ga0495602_0035833 | 3300048088 | Bacteria | 4623 |
| 486 | Ga0495602_0056734 | 3300048088 | Bacteria | 3441 |
| 487 | Ga0495602_0137068 | 3300048088 | Bacteria | 1942 |
| 488 | Ga0495614_0001485 | 3300048089 | Bacteria | 10155 |
| 489 | Ga0495614_0008753 | 3300048089 | Bacteria | 4495 |
| 490 | Ga0495626_0004820 | 3300048091 | Bacteria | 8134 |
| 491 | Ga0495626_0028454 | 3300048091 | Bacteria | 2709 |
| 492 | Ga0496100_0002614 | 3300048903 | Bacteria | 9178 |
| 493 | Ga0496100_0013067 | 3300048903 | Bacteria | 4778 |
| 494 | Ga0496100_0319151 | 3300048903 | Bacteria | 1167 |
| 495 | Ga0496101_0004570 | 3300048904 | Bacteria | 8738 |
| 496 | Ga0496101_0065794 | 3300048904 | Bacteria | 2642 |
| 497 | Ga0496101_0090448 | 3300048904 | Bacteria | 2276 |
| 498 | Ga0496101_0129159 | 3300048904 | Bacteria | 1917 |
| 499 | Ga0496102_0014642 | 3300048905 | Bacteria | 6817 |
| 500 | Ga0496102_0025174 | 3300048905 | Bacteria | 5294 |
| 501 | Ga0496102_0032534 | 3300048905 | Bacteria | 4685 |
| 502 | Ga0496102_0188842 | 3300048905 | Bacteria | 1941 |
| 503 | Ga0496103_0000812 | 3300048906 | Bacteria | 22911 |
| 504 | Ga0496103_0015039 | 3300048906 | Bacteria | 4600 |
| 505 | Ga0496104_0011962 | 3300048907 | Bacteria | 7787 |
| 506 | Ga0496104_0128458 | 3300048907 | Bacteria | 2434 |
| 507 | Ga0496104_0202761 | 3300048907 | Bacteria | 1895 |
| 508 | Ga0496106_0000036 | 3300048909 | Bacteria | 124990 |
| 509 | Ga0496106_0004044 | 3300048909 | Bacteria | 10947 |
| 510 | Ga0496106_0062694 | 3300048909 | Bacteria | 2823 |
| 511 | Ga0496107_0002435 | 3300048910 | Bacteria | 12061 |
| 512 | Ga0496107_0010747 | 3300048910 | Bacteria | 6367 |
| 513 | Ga0496108_0125184 | 3300048911 | Bacteria | 2206 |
| 514 | Ga0496109_0014927 | 3300048912 | Bacteria | 6762 |
| 515 | Ga0496109_0089435 | 3300048912 | Bacteria | 2846 |
| 516 | Ga0496109_0544190 | 3300048912 | Bacteria | 1095 |
| 517 | Ga0496110_0012080 | 3300048913 | Bacteria | 7094 |
| 518 | Ga0496110_0226277 | 3300048913 | Bacteria | 1701 |
| 519 | Ga0496110_0229640 | 3300048913 | Bacteria | 1687 |
| 520 | Ga0496110_0404040 | 3300048913 | Bacteria | 1245 |
| 521 | Ga0496111_0002196 | 3300048914 | Bacteria | 11698 |
| 522 | Ga0496111_0022147 | 3300048914 | Bacteria | 4445 |
| 523 | Ga0496112_0005803 | 3300048915 | Bacteria | 10741 |
| 524 | Ga0496112_0020914 | 3300048915 | Bacteria | 6212 |
| 525 | Ga0496112_0039023 | 3300048915 | Bacteria | 4638 |
| 526 | Ga0496112_0094058 | 3300048915 | Bacteria | 2968 |
| 527 | Ga0496112_0181995 | 3300048915 | Bacteria | 2065 |
| 528 | Ga0496113_0012187 | 3300048916 | Bacteria | 5770 |
| 529 | Ga0496113_0036749 | 3300048916 | Bacteria | 3590 |
| 530 | Ga0496113_0049560 | 3300048916 | Bacteria | 3127 |
| 531 | Ga0496113_0207556 | 3300048916 | Bacteria | 1559 |
| 532 | Ga0496113_0485575 | 3300048916 | Bacteria | 992 |
| 533 | Ga0496114_0004527 | 3300048917 | Bacteria | 10791 |
| 534 | Ga0496114_0008761 | 3300048917 | Bacteria | 8014 |
| 535 | Ga0496114_0057947 | 3300048917 | Bacteria | 3234 |
| 536 | Ga0496114_0075813 | 3300048917 | Bacteria | 2833 |
| 537 | Ga0496114_0079862 | 3300048917 | Bacteria | 2762 |
| 538 | Ga0496115_0201454 | 3300048918 | Bacteria | 1644 |
| 539 | Ga0496115_0279636 | 3300048918 | Bacteria | 1370 |
| 540 | Ga0496115_0392060 | 3300048918 | Bacteria | 1128 |
| 541 | Ga0496116_0003463 | 3300048919 | Bacteria | 15558 |
| 542 | Ga0496116_0005958 | 3300048919 | Bacteria | 11180 |
| 543 | Ga0496116_0032012 | 3300048919 | Bacteria | 3754 |
| 544 | Ga0496117_0002393 | 3300048920 | Bacteria | 23847 |
| 545 | Ga0496117_0004328 | 3300048920 | Bacteria | 15790 |
| 546 | Ga0496117_0007634 | 3300048920 | Bacteria | 10492 |
| 547 | Ga0496117_0012902 | 3300048920 | Bacteria | 7325 |
| 548 | Ga0496117_0016363 | 3300048920 | Bacteria | 6261 |
| 549 | Ga0496117_0170749 | 3300048920 | Bacteria | 1262 |
| 550 | Ga0496118_0003472 | 3300048921 | Bacteria | 19786 |
| 551 | Ga0496118_0016037 | 3300048921 | Bacteria | 6897 |
| 552 | Ga0496118_0019210 | 3300048921 | Bacteria | 6116 |
| 553 | Ga0496119_0004110 | 3300048922 | Bacteria | 14670 |
| 554 | Ga0496119_0048986 | 3300048922 | Bacteria | 2616 |
| 555 | Ga0496120_0002947 | 3300048923 | Bacteria | 16215 |
| 556 | Ga0496120_0026908 | 3300048923 | Bacteria | 3546 |
| 557 | Ga0496121_0000140 | 3300048924 | Bacteria | 162689 |
| 558 | Ga0496121_0002763 | 3300048924 | Bacteria | 26034 |
| 559 | Ga0496121_0003313 | 3300048924 | Bacteria | 23134 |
| 560 | Ga0496121_0018671 | 3300048924 | Bacteria | 6979 |
| 561 | Ga0496121_0084290 | 3300048924 | Bacteria | 2506 |
| 562 | Ga0496121_0086673 | 3300048924 | Bacteria | 2460 |
| 563 | Ga0496122_0000582 | 3300048925 | Bacteria | 74845 |
| 564 | Ga0496122_0026241 | 3300048925 | Bacteria | 5030 |
| 565 | Ga0496122_0096881 | 3300048925 | Bacteria | 1987 |
| 566 | Ga0496123_0000479 | 3300048926 | Bacteria | 69250 |
| 567 | Ga0496123_0007721 | 3300048926 | Bacteria | 10044 |
| 568 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 569 | Ga0496124_0000724 | 3300048927 | Bacteria | 54104 |
| 570 | Ga0496124_0014560 | 3300048927 | Bacteria | 7597 |
| 571 | Ga0496124_0024203 | 3300048927 | Bacteria | 5527 |
| 572 | Ga0496124_0127340 | 3300048927 | Bacteria | 2027 |
| 573 | Ga0496125_0000190 | 3300048928 | Bacteria | 132540 |
| 574 | Ga0496125_0010697 | 3300048928 | Bacteria | 9254 |
| 575 | Ga0496126_0000105 | 3300048929 | Bacteria | 198893 |
| 576 | Ga0496126_0000924 | 3300048929 | Bacteria | 50766 |
| 577 | Ga0496126_0010554 | 3300048929 | Bacteria | 9665 |
| 578 | Ga0496126_0153914 | 3300048929 | Bacteria | 1969 |
| 579 | Ga0496126_0303608 | 3300048929 | Bacteria | 1316 |
| 580 | Ga0496126_0362662 | 3300048929 | Bacteria | 1183 |
| 581 | Ga0495682_0019454 | 3300049460 | Bacteria | 2553 |
| 582 | Ga0501033_0011303 | 3300049570 | Bacteria | 6836 |
| 583 | Ga0501033_0201710 | 3300049570 | Bacteria | 1420 |
| 584 | Ga0501034_0000124 | 3300049571 | Bacteria | 142890 |
| 585 | Ga0501034_0000331 | 3300049571 | Bacteria | 82931 |
| 586 | Ga0501034_0016407 | 3300049571 | Bacteria | 7603 |
| 587 | Ga0501034_0047017 | 3300049571 | Bacteria | 4359 |
| 588 | Ga0501036_0067743 | 3300049572 | Bacteria | 3020 |
| 589 | Ga0501037_0042520 | 3300049573 | Bacteria | 3338 |
| 590 | Ga0501037_0164987 | 3300049573 | Bacteria | 1578 |
| 591 | Ga0501038_0188327 | 3300049574 | Bacteria | 1661 |
| 592 | Ga0501039_0064693 | 3300049575 | Bacteria | 2835 |
| 593 | Ga0501043_0054854 | 3300049579 | Bacteria | 3130 |
| 594 | Ga0501046_0056040 | 3300049580 | Bacteria | 3095 |
| 595 | Ga0501047_0014752 | 3300049581 | Bacteria | 7435 |
| 596 | Ga0501047_0365833 | 3300049581 | Bacteria | 1277 |
| 597 | Ga0501067_0070777 | 3300049583 | Bacteria | 1931 |
| 598 | Ga0501068_0035576 | 3300049584 | Bacteria | 2973 |
| 599 | Ga0501070_0118527 | 3300049586 | Bacteria | 2187 |
| 600 | Ga0501074_0383184 | 3300049590 | Bacteria | 997 |
| 601 | Ga0501079_0130516 | 3300049741 | Bacteria | 1955 |
| 602 | Ga0501080_0038273 | 3300049742 | Bacteria | 4478 |
| 603 | Ga0501080_0166414 | 3300049742 | Bacteria | 2034 |
| 604 | Ga0501035_0015361 | 3300049822 | Bacteria | 7066 |
| 605 | Ga0501035_0233384 | 3300049822 | Bacteria | 1567 |
| 606 | Ga0501044_0011583 | 3300049823 | Bacteria | 9558 |
| 607 | Ga0501044_0015770 | 3300049823 | Bacteria | 8136 |
| 608 | Ga0501044_0140341 | 3300049823 | Bacteria | 2405 |
| 609 | nmdc:mga00v17_21394_c1 | 3300050491 | Bacteria | 3718 |
| 610 | nmdc:mga0yw44_44450_c1 | 3300050492 | Bacteria | 2657 |
| 611 | nmdc:mga06z11_20818_c1 | 3300050494 | Bacteria | 3037 |
| 612 | nmdc:mga07m45_127633_c1 | 3300050496 | Bacteria | 1471 |
| 613 | nmdc:mga07m45_17966_c1 | 3300050496 | Bacteria | 2485 |
| 614 | nmdc:mga05p37_268551_c2 | 3300050507 | Bacteria | 1383 |
| 615 | nmdc:mga05p37_645595_c1 | 3300050507 | Bacteria | 1186 |
| 616 | nmdc:mga09592_112179_c1 | 3300050508 | Bacteria | 2339 |
| 617 | nmdc:mga06r32_9922_c1 | 3300050510 | Bacteria | 8594 |
| 618 | nmdc:mga08y16_151548_c1 | 3300050511 | Bacteria | 2410 |
| 619 | nmdc:mga0n895_10480_c1 | 3300050512 | Bacteria | 8194 |
| 620 | nmdc:mga0a205_13584_c1 | 3300050515 | Bacteria | 7586 |
| 621 | Ga0500610_0000014 | 3300053079 | Bacteria | 84868 |
| 622 | Ga0500643_000389 | 3300053087 | Bacteria | 33994 |
| 623 | Ga0500643_001441 | 3300053087 | Bacteria | 13716 |
| 624 | Ga0500658_0046565 | 3300053134 | Bacteria | 1757 |
| 625 | Ga0500577_0019339 | 3300053142 | Bacteria | 2207 |
| 626 | Ga0500645_007970 | 3300053730 | Bacteria | 3650 |
| 627 | Ga0501084_0043258 | 3300054114 | Bacteria | 3768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2901300506 | 2901308597 | 277 |
| 2 | 3300038443 | Ga0395901_0437589 | Ga0395901_0437589_460_1329 | 281 |
| 3 | iso_pu_bacteria | 2965102966 | 2965103184 | 286 |
| 4 | 3300009094 | Ga0111539_11118142 | Ga0111539_111181421 | 289 |
| 5 | 3300009098 | Ga0105245_10046145 | Ga0105245_100461454 | 289 |
| 6 | 3300009147 | Ga0114129_10288691 | Ga0114129_102886912 | 289 |
| 7 | 3300013104 | Ga0157370_10196210 | Ga0157370_101962102 | 289 |
| 8 | 3300046474 | Ga0495605_0014058 | Ga0495605_0014058_43_912 | 289 |
| 9 | 3300046500 | Ga0495596_0010986 | Ga0495596_0010986_46_915 | 289 |
| 10 | 3300046535 | Ga0495586_0012104 | Ga0495586_0012104_3665_4534 | 289 |
| 11 | 3300046679 | Ga0495623_0236671 | Ga0495623_0236671_139_1008 | 289 |
| 12 | 3300046691 | Ga0495670_0036872 | Ga0495670_0036872_13_882 | 289 |
| 13 | 3300047319 | Ga0495674_0030150 | Ga0495674_0030150_4029_4898 | 289 |
| 14 | 3300047443 | Ga0495687_010401 | Ga0495687_010401_1586_2455 | 289 |
| 15 | 3300047444 | Ga0495675_0046368 | Ga0495675_0046368_11_880 | 289 |
| 16 | 3300048091 | Ga0495626_0028454 | Ga0495626_0028454_105_974 | 289 |
| 17 | 3300048917 | Ga0496114_0075813 | Ga0496114_0075813_818_1687 | 289 |
| 18 | 3300048929 | Ga0496126_0362662 | Ga0496126_0362662_35_904 | 289 |
| 19 | 3300049571 | Ga0501034_0000124 | Ga0501034_0000124_28258_29127 | 289 |
| 20 | 3300050507 | nmdc:mga05p37_268551_c2 | nmdc:mga05p37_268551_c2_487_1356 | 289 |
| 21 | 3300050507 | nmdc:mga05p37_645595_c1 | nmdc:mga05p37_645595_c1_52_921 | 289 |
| 22 | 3300048916 | Ga0496113_0485575 | Ga0496113_0485575_12_908 | 298 |
| 23 | 3300044673 | Ga0453683_0004282 | Ga0453683_0004282_2556_3488 | 301 |
| 24 | 3300045051 | Ga0451576_0002450 | Ga0451576_0002450_1088_2020 | 301 |
| 25 | iso_pu_bacteria | 2508501050 | 2508728247 | 304 |
| 26 | iso_pu_bacteria | 2773857925 | 2774868904 | 304 |
| 27 | iso_pu_bacteria | 2775506901 | 2776263903 | 304 |
| 28 | iso_pu_bacteria | 2882456835 | 2882463287 | 304 |
| 29 | iso_pu_bacteria | 2995392953 | 2995393968 | 304 |
| 30 | iso_pu_bacteria | 2675903060 | 2676489213 | 305 |
| 31 | iso_pu_bacteria | 2899275550 | 2899277715 | 305 |
| 32 | iso_pu_bacteria | 8048746797 | 8048747486 | 305 |
| 33 | 3300014969 | Ga0157376_10276879 | Ga0157376_102768792 | 306 |
| 34 | 3300025927 | Ga0207687_10048287 | Ga0207687_100482872 | 306 |
| 35 | 3300031731 | Ga0307405_10125375 | Ga0307405_101253752 | 306 |
| 36 | 3300031852 | Ga0307410_10188106 | Ga0307410_101881062 | 306 |
| 37 | 3300031901 | Ga0307406_10090619 | Ga0307406_100906192 | 306 |
| 38 | 3300031903 | Ga0307407_10107651 | Ga0307407_101076511 | 306 |
| 39 | 3300031995 | Ga0307409_100010499 | Ga0307409_1000104994 | 306 |
| 40 | 3300032004 | Ga0307414_10135370 | Ga0307414_101353702 | 306 |
| 41 | 3300032005 | Ga0307411_10018647 | Ga0307411_100186473 | 306 |
| 42 | 3300036712 | Ga0316584_0220605 | Ga0316584_0220605_384_1310 | 306 |
| 43 | 3300037312 | Ga0395899_0001350 | Ga0395899_0001350_7817_8749 | 306 |
| 44 | 3300037418 | Ga0395900_0003263 | Ga0395900_0003263_7841_8773 | 306 |
| 45 | 3300037466 | Ga0395898_0003486 | Ga0395898_0003486_7841_8773 | 306 |
| 46 | 3300037471 | Ga0395905_0003218 | Ga0395905_0003218_8801_9733 | 306 |
| 47 | 3300038443 | Ga0395901_0002823 | Ga0395901_0002823_7841_8773 | 306 |
| 48 | 3300048913 | Ga0496110_0404040 | Ga0496110_0404040_74_1000 | 306 |
| 49 | 3300048917 | Ga0496114_0057947 | Ga0496114_0057947_1595_2521 | 306 |
| 50 | 3300053087 | Ga0500643_000389 | Ga0500643_000389_14981_15901 | 306 |
| 51 | iso_pu_bacteria | 2513237150 | 2513956296 | 306 |
| 52 | iso_pu_bacteria | 2537561592 | 2537899306 | 306 |
| 53 | iso_pu_bacteria | 2600255067 | 2600813599 | 306 |
| 54 | iso_pu_bacteria | 2643221569 | 2643863406 | 306 |
| 55 | iso_pu_bacteria | 2643221594 | 2643982756 | 306 |
| 56 | iso_pu_bacteria | 2643221605 | 2644040122 | 306 |
| 57 | iso_pu_bacteria | 2643221621 | 2644120819 | 306 |
| 58 | iso_pu_bacteria | 2654587600 | 2655033214 | 306 |
| 59 | iso_pu_bacteria | 2721755523 | 2722883316 | 306 |
| 60 | iso_pu_bacteria | 2738541296 | 2738818528 | 306 |
| 61 | iso_pu_bacteria | 2738541298 | 2738831315 | 306 |
| 62 | iso_pu_bacteria | 2738541306 | 2738872843 | 306 |
| 63 | iso_pu_bacteria | 2738543002 | 2739184473 | 306 |
| 64 | iso_pu_bacteria | 2738543008 | 2739219442 | 306 |
| 65 | iso_pu_bacteria | 2791355137 | 2792838907 | 306 |
| 66 | iso_pu_bacteria | 2808606366 | 2808877287 | 306 |
| 67 | iso_pu_bacteria | 2808606384 | 2808969505 | 306 |
| 68 | iso_pu_bacteria | 2808606390 | 2809004336 | 306 |
| 69 | iso_pu_bacteria | 2808606391 | 2809012914 | 306 |
| 70 | iso_pu_bacteria | 2808606395 | 2809034865 | 306 |
| 71 | iso_pu_bacteria | 2839138175 | 2839140093 | 306 |
| 72 | iso_pu_bacteria | 2855730933 | 2855732241 | 306 |
| 73 | iso_pu_bacteria | 2855767633 | 2855768949 | 306 |
| 74 | iso_pu_bacteria | 2857537821 | 2857542033 | 306 |
| 75 | iso_pu_bacteria | 2857542790 | 2857546092 | 306 |
| 76 | iso_pu_bacteria | 2858950400 | 2858956777 | 306 |
| 77 | iso_pu_bacteria | 2863421361 | 2863422402 | 306 |
| 78 | iso_pu_bacteria | 2866552031 | 2866556477 | 306 |
| 79 | iso_pu_bacteria | 2870068957 | 2870072625 | 306 |
| 80 | iso_pu_bacteria | 2881412998 | 2881415106 | 306 |
| 81 | iso_pu_bacteria | 2881665667 | 2881672776 | 306 |
| 82 | iso_pu_bacteria | 2894023352 | 2894026142 | 306 |
| 83 | iso_pu_bacteria | 2904479285 | 2904479956 | 306 |
| 84 | iso_pu_bacteria | 2904541872 | 2904548186 | 306 |
| 85 | iso_pu_bacteria | 2904564687 | 2904564897 | 306 |
| 86 | iso_pu_bacteria | 2904571731 | 2904572407 | 306 |
| 87 | iso_pu_bacteria | 2904615490 | 2904616781 | 306 |
| 88 | iso_pu_bacteria | 2906427513 | 2906429011 | 306 |
| 89 | iso_pu_bacteria | 2928157003 | 2928157110 | 306 |
| 90 | iso_pu_bacteria | 2928163908 | 2928168936 | 306 |
| 91 | iso_pu_bacteria | 2928536128 | 2928537733 | 306 |
| 92 | iso_pu_bacteria | 2929160207 | 2929163115 | 306 |
| 93 | iso_pu_bacteria | 2935648319 | 2935656678 | 306 |
| 94 | iso_pu_bacteria | 2935656913 | 2935665488 | 306 |
| 95 | iso_pu_bacteria | 2935984226 | 2935989230 | 306 |
| 96 | iso_pu_bacteria | 2936011229 | 2936019541 | 306 |
| 97 | iso_pu_bacteria | 2936019824 | 2936028165 | 306 |
| 98 | iso_pu_bacteria | 2936028420 | 2936037038 | 306 |
| 99 | iso_pu_bacteria | 2936046547 | 2936055014 | 306 |
| 100 | iso_pu_bacteria | 2941479691 | 2941480667 | 306 |
| 101 | iso_pu_bacteria | 2945934425 | 2945937243 | 306 |
| 102 | iso_pu_bacteria | 2981990288 | 2981994955 | 306 |
| 103 | iso_pu_bacteria | 2990703756 | 2990706022 | 306 |
| 104 | iso_pu_bacteria | 641736151 | 642425758 | 306 |
| 105 | iso_pu_bacteria | 641736154 | 642417383 | 306 |
| 106 | iso_pu_bacteria | 8016583857 | 8016584198 | 306 |
| 107 | iso_pu_bacteria | 8020938398 | 8020939720 | 306 |
| 108 | iso_pu_bacteria | 8020953355 | 8020957339 | 306 |
| 109 | iso_pu_bacteria | 8056207758 | 8056212993 | 306 |
| 110 | 3300001979 | JGI24740J21852_10001964 | JGI24740J21852_100019642 | 307 |
| 111 | 3300001989 | JGI24739J22299_10001531 | JGI24739J22299_100015313 | 307 |
| 112 | 3300001990 | JGI24737J22298_10008759 | JGI24737J22298_100087593 | 307 |
| 113 | 3300001990 | JGI24737J22298_10012489 | JGI24737J22298_100124893 | 307 |
| 114 | 3300002067 | JGI24735J21928_10000021 | JGI24735J21928_1000002180 | 307 |
| 115 | 3300002067 | JGI24735J21928_10000179 | JGI24735J21928_100001795 | 307 |
| 116 | 3300002067 | JGI24735J21928_10000466 | JGI24735J21928_1000046613 | 307 |
| 117 | 3300002075 | JGI24738J21930_10003992 | JGI24738J21930_100039923 | 307 |
| 118 | 3300003187 | JGI25151J46595_10001622 | JGI25151J46595_100016224 | 307 |
| 119 | 3300003187 | JGI25151J46595_10001670 | JGI25151J46595_100016709 | 307 |
| 120 | 3300003187 | JGI25151J46595_10003677 | JGI25151J46595_100036775 | 307 |
| 121 | 3300003187 | JGI25151J46595_10003933 | JGI25151J46595_100039338 | 307 |
| 122 | 3300003215 | JGI25153J46596_10034452 | JGI25153J46596_100344522 | 307 |
| 123 | 3300003316 | rootH1_10048791 | rootH1_100487914 | 307 |
| 124 | 3300003760 | Ga0055527_1000335 | Ga0055527_100033510 | 307 |
| 125 | 3300003761 | Ga0055535_1000267 | Ga0055535_100026717 | 307 |
| 126 | 3300003762 | Ga0055542_1000175 | Ga0055542_100017544 | 307 |
| 127 | 3300003762 | Ga0055542_1001872 | Ga0055542_10018723 | 307 |
| 128 | 3300003763 | Ga0055529_1000131 | Ga0055529_100013117 | 307 |
| 129 | 3300003773 | Ga0055537_1000428 | Ga0055537_10004288 | 307 |
| 130 | 3300003773 | Ga0055537_1000433 | Ga0055537_10004338 | 307 |
| 131 | 3300003781 | Ga0055536_1003283 | Ga0055536_10032835 | 307 |
| 132 | 3300003781 | Ga0055536_1009944 | Ga0055536_10099442 | 307 |
| 133 | 3300003784 | Ga0055534_1000008 | Ga0055534_100000856 | 307 |
| 134 | 3300003790 | Ga0055528_1003161 | Ga0055528_10031612 | 307 |
| 135 | 3300003790 | Ga0055528_1003690 | Ga0055528_10036905 | 307 |
| 136 | 3300003792 | Ga0055540_1003300 | Ga0055540_10033005 | 307 |
| 137 | 3300003794 | Ga0055531_10002668 | Ga0055531_100026682 | 307 |
| 138 | 3300005288 | Ga0065714_10020982 | Ga0065714_100209821 | 307 |
| 139 | 3300005328 | Ga0070676_10016208 | Ga0070676_100162083 | 307 |
| 140 | 3300005329 | Ga0070683_100066990 | Ga0070683_1000669904 | 307 |
| 141 | 3300005331 | Ga0070670_100089227 | Ga0070670_1000892272 | 307 |
| 142 | 3300005335 | Ga0070666_10049415 | Ga0070666_100494152 | 307 |
| 143 | 3300005337 | Ga0070682_100043866 | Ga0070682_1000438662 | 307 |
| 144 | 3300005339 | Ga0070660_100000060 | Ga0070660_1000000606 | 307 |
| 145 | 3300005344 | Ga0070661_100212918 | Ga0070661_1002129182 | 307 |
| 146 | 3300005347 | Ga0070668_100102032 | Ga0070668_1001020322 | 307 |
| 147 | 3300005353 | Ga0070669_100022162 | Ga0070669_1000221623 | 307 |
| 148 | 3300005354 | Ga0070675_100016920 | Ga0070675_1000169204 | 307 |
| 149 | 3300005355 | Ga0070671_100189520 | Ga0070671_1001895202 | 307 |
| 150 | 3300005364 | Ga0070673_100111890 | Ga0070673_1001118902 | 307 |
| 151 | 3300005366 | Ga0070659_100000105 | Ga0070659_1000001056 | 307 |
| 152 | 3300005366 | Ga0070659_100130274 | Ga0070659_1001302742 | 307 |
| 153 | 3300005367 | Ga0070667_100163748 | Ga0070667_1001637482 | 307 |
| 154 | 3300005455 | Ga0070663_100004136 | Ga0070663_1000041365 | 307 |
| 155 | 3300005455 | Ga0070663_100038590 | Ga0070663_1000385902 | 307 |
| 156 | 3300005455 | Ga0070663_100087873 | Ga0070663_1000878732 | 307 |
| 157 | 3300005455 | Ga0070663_100090535 | Ga0070663_1000905352 | 307 |
| 158 | 3300005456 | Ga0070678_100029470 | Ga0070678_1000294703 | 307 |
| 159 | 3300005457 | Ga0070662_100001117 | Ga0070662_1000011178 | 307 |
| 160 | 3300005535 | Ga0070684_100299612 | Ga0070684_1002996122 | 307 |
| 161 | 3300005539 | Ga0068853_100003394 | Ga0068853_1000033948 | 307 |
| 162 | 3300005539 | Ga0068853_100053084 | Ga0068853_1000530842 | 307 |
| 163 | 3300005539 | Ga0068853_100140707 | Ga0068853_1001407072 | 307 |
| 164 | 3300005548 | Ga0070665_100072894 | Ga0070665_1000728942 | 307 |
| 165 | 3300005548 | Ga0070665_100155612 | Ga0070665_1001556122 | 307 |
| 166 | 3300005563 | Ga0068855_100005206 | Ga0068855_1000052068 | 307 |
| 167 | 3300005563 | Ga0068855_100192011 | Ga0068855_1001920112 | 307 |
| 168 | 3300005564 | Ga0070664_100047047 | Ga0070664_1000470473 | 307 |
| 169 | 3300005577 | Ga0068857_100001830 | Ga0068857_1000018308 | 307 |
| 170 | 3300005578 | Ga0068854_100014116 | Ga0068854_1000141161 | 307 |
| 171 | 3300005614 | Ga0068856_100005144 | Ga0068856_1000051448 | 307 |
| 172 | 3300005616 | Ga0068852_100004727 | Ga0068852_1000047278 | 307 |
| 173 | 3300005834 | Ga0068851_10004146 | Ga0068851_100041462 | 307 |
| 174 | 3300006028 | Ga0070717_10004861 | Ga0070717_100048618 | 307 |
| 175 | 3300006038 | Ga0075365_10010855 | Ga0075365_100108556 | 307 |
| 176 | 3300006051 | Ga0075364_10035320 | Ga0075364_100353203 | 307 |
| 177 | 3300006353 | Ga0075370_10002532 | Ga0075370_100025326 | 307 |
| 178 | 3300006353 | Ga0075370_10053986 | Ga0075370_100539862 | 307 |
| 179 | 3300006846 | Ga0075430_100240566 | Ga0075430_1002405662 | 307 |
| 180 | 3300006852 | Ga0075433_10015205 | Ga0075433_100152053 | 307 |
| 181 | 3300006871 | Ga0075434_100013935 | Ga0075434_1000139358 | 307 |
| 182 | 3300006946 | Ga0079104_1000007 | Ga0079104_1000007219 | 307 |
| 183 | 3300006948 | Ga0099826_10000084 | Ga0099826_1000008434 | 307 |
| 184 | 3300007788 | Ga0099795_10049754 | Ga0099795_100497542 | 307 |
| 185 | 3300009011 | Ga0105251_10000785 | Ga0105251_1000078510 | 307 |
| 186 | 3300009011 | Ga0105251_10001106 | Ga0105251_1000110615 | 307 |
| 187 | 3300009011 | Ga0105251_10017710 | Ga0105251_100177103 | 307 |
| 188 | 3300009036 | Ga0105244_10044711 | Ga0105244_100447113 | 307 |
| 189 | 3300009092 | Ga0105250_10008651 | Ga0105250_100086513 | 307 |
| 190 | 3300009092 | Ga0105250_10021604 | Ga0105250_100216043 | 307 |
| 191 | 3300009092 | Ga0105250_10073777 | Ga0105250_100737772 | 307 |
| 192 | 3300009093 | Ga0105240_10007552 | Ga0105240_100075527 | 307 |
| 193 | 3300009093 | Ga0105240_10047662 | Ga0105240_100476624 | 307 |
| 194 | 3300009093 | Ga0105240_10116246 | Ga0105240_101162463 | 307 |
| 195 | 3300009093 | Ga0105240_10154754 | Ga0105240_101547542 | 307 |
| 196 | 3300009094 | Ga0111539_10010305 | Ga0111539_100103055 | 307 |
| 197 | 3300009098 | Ga0105245_10594039 | Ga0105245_105940392 | 307 |
| 198 | 3300009101 | Ga0105247_10014704 | Ga0105247_100147044 | 307 |
| 199 | 3300009147 | Ga0114129_10009151 | Ga0114129_100091514 | 307 |
| 200 | 3300009148 | Ga0105243_10000538 | Ga0105243_100005388 | 307 |
| 201 | 3300009148 | Ga0105243_10001515 | Ga0105243_1000151518 | 307 |
| 202 | 3300009148 | Ga0105243_10126952 | Ga0105243_101269521 | 307 |
| 203 | 3300009174 | Ga0105241_10001889 | Ga0105241_100018897 | 307 |
| 204 | 3300009174 | Ga0105241_10046629 | Ga0105241_100466292 | 307 |
| 205 | 3300009174 | Ga0105241_10067474 | Ga0105241_100674742 | 307 |
| 206 | 3300009177 | Ga0105248_10069030 | Ga0105248_100690302 | 307 |
| 207 | 3300009545 | Ga0105237_10004677 | Ga0105237_100046777 | 307 |
| 208 | 3300009545 | Ga0105237_10011794 | Ga0105237_100117943 | 307 |
| 209 | 3300009545 | Ga0105237_10116335 | Ga0105237_101163352 | 307 |
| 210 | 3300009545 | Ga0105237_10123587 | Ga0105237_101235872 | 307 |
| 211 | 3300009545 | Ga0105237_10514138 | Ga0105237_105141381 | 307 |
| 212 | 3300009551 | Ga0105238_10003442 | Ga0105238_100034427 | 307 |
| 213 | 3300009551 | Ga0105238_10055515 | Ga0105238_100555152 | 307 |
| 214 | 3300009551 | Ga0105238_10095371 | Ga0105238_100953713 | 307 |
| 215 | 3300010375 | Ga0105239_10014965 | Ga0105239_100149652 | 307 |
| 216 | 3300010375 | Ga0105239_10037516 | Ga0105239_100375162 | 307 |
| 217 | 3300010375 | Ga0105239_10047873 | Ga0105239_100478734 | 307 |
| 218 | 3300013100 | Ga0157373_10021715 | Ga0157373_100217152 | 307 |
| 219 | 3300013102 | Ga0157371_10051329 | Ga0157371_100513292 | 307 |
| 220 | 3300013104 | Ga0157370_10001878 | Ga0157370_100018789 | 307 |
| 221 | 3300013104 | Ga0157370_10007059 | Ga0157370_100070594 | 307 |
| 222 | 3300013104 | Ga0157370_10112212 | Ga0157370_101122122 | 307 |
| 223 | 3300013105 | Ga0157369_10003126 | Ga0157369_1000312610 | 307 |
| 224 | 3300013105 | Ga0157369_10006744 | Ga0157369_100067441 | 307 |
| 225 | 3300013105 | Ga0157369_10150209 | Ga0157369_101502093 | 307 |
| 226 | 3300013105 | Ga0157369_10383251 | Ga0157369_103832512 | 307 |
| 227 | 3300013105 | Ga0157369_10424536 | Ga0157369_104245362 | 307 |
| 228 | 3300013296 | Ga0157374_10017267 | Ga0157374_100172675 | 307 |
| 229 | 3300013296 | Ga0157374_10031859 | Ga0157374_100318593 | 307 |
| 230 | 3300013296 | Ga0157374_10069147 | Ga0157374_100691472 | 307 |
| 231 | 3300013296 | Ga0157374_10201179 | Ga0157374_102011792 | 307 |
| 232 | 3300013297 | Ga0157378_10017744 | Ga0157378_100177443 | 307 |
| 233 | 3300013306 | Ga0163162_10008134 | Ga0163162_100081348 | 307 |
| 234 | 3300013306 | Ga0163162_10412841 | Ga0163162_104128411 | 307 |
| 235 | 3300013306 | Ga0163162_10446331 | Ga0163162_104463311 | 307 |
| 236 | 3300013307 | Ga0157372_10004099 | Ga0157372_100040997 | 307 |
| 237 | 3300013307 | Ga0157372_10139241 | Ga0157372_101392412 | 307 |
| 238 | 3300013307 | Ga0157372_10780717 | Ga0157372_107807172 | 307 |
| 239 | 3300013308 | Ga0157375_10108186 | Ga0157375_101081862 | 307 |
| 240 | 3300014497 | Ga0182008_10079704 | Ga0182008_100797041 | 307 |
| 241 | 3300015265 | Ga0182005_1008866 | Ga0182005_10088662 | 307 |
| 242 | 3300017792 | Ga0163161_10001698 | Ga0163161_100016986 | 307 |
| 243 | 3300021384 | Ga0213876_10001668 | Ga0213876_100016684 | 307 |
| 244 | 3300025228 | Ga0209672_100031 | Ga0209672_10003181 | 307 |
| 245 | 3300025228 | Ga0209672_100158 | Ga0209672_10015821 | 307 |
| 246 | 3300025229 | Ga0209147_100040 | Ga0209147_100040197 | 307 |
| 247 | 3300025242 | Ga0209258_100061 | Ga0209258_100061201 | 307 |
| 248 | 3300025246 | Ga0209646_1016612 | Ga0209646_10166121 | 307 |
| 249 | 3300025254 | Ga0209148_1000050 | Ga0209148_1000050106 | 307 |
| 250 | 3300025254 | Ga0209148_1000070 | Ga0209148_1000070218 | 307 |
| 251 | 3300025254 | Ga0209148_1004490 | Ga0209148_10044903 | 307 |
| 252 | 3300025256 | Ga0209759_1017860 | Ga0209759_10178602 | 307 |
| 253 | 3300025263 | Ga0209565_1000042 | Ga0209565_100004256 | 307 |
| 254 | 3300025263 | Ga0209565_1006273 | Ga0209565_10062732 | 307 |
| 255 | 3300025272 | Ga0209455_1000069 | Ga0209455_100006961 | 307 |
| 256 | 3300025272 | Ga0209455_1000183 | Ga0209455_10001839 | 307 |
| 257 | 3300025273 | Ga0209673_1000026 | Ga0209673_1000026198 | 307 |
| 258 | 3300025273 | Ga0209673_1000071 | Ga0209673_1000071171 | 307 |
| 259 | 3300025291 | Ga0209675_1000041 | Ga0209675_1000041170 | 307 |
| 260 | 3300025292 | Ga0209676_1000301 | Ga0209676_100030118 | 307 |
| 261 | 3300025292 | Ga0209676_1001163 | Ga0209676_10011632 | 307 |
| 262 | 3300025292 | Ga0209676_1021223 | Ga0209676_10212232 | 307 |
| 263 | 3300025294 | Ga0209025_1000026 | Ga0209025_1000026261 | 307 |
| 264 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073104 | 307 |
| 265 | 3300025294 | Ga0209025_1000113 | Ga0209025_1000113168 | 307 |
| 266 | 3300025294 | Ga0209025_1000307 | Ga0209025_100030775 | 307 |
| 267 | 3300025294 | Ga0209025_1000387 | Ga0209025_100038760 | 307 |
| 268 | 3300025294 | Ga0209025_1014274 | Ga0209025_10142742 | 307 |
| 269 | 3300025295 | Ga0209564_1030464 | Ga0209564_10304642 | 307 |
| 270 | 3300025297 | Ga0209758_1000573 | Ga0209758_100057355 | 307 |
| 271 | 3300025298 | Ga0209050_1004017 | Ga0209050_100401710 | 307 |
| 272 | 3300025302 | Ga0207426_1000965 | Ga0207426_100096513 | 307 |
| 273 | 3300025302 | Ga0207426_1000982 | Ga0207426_100098214 | 307 |
| 274 | 3300025303 | Ga0209051_1001159 | Ga0209051_100115910 | 307 |
| 275 | 3300025303 | Ga0209051_1002220 | Ga0209051_10022202 | 307 |
| 276 | 3300025303 | Ga0209051_1036907 | Ga0209051_10369072 | 307 |
| 277 | 3300025304 | Ga0209257_1004548 | Ga0209257_10045482 | 307 |
| 278 | 3300025315 | Ga0207697_10003124 | Ga0207697_100031244 | 307 |
| 279 | 3300025321 | Ga0207656_10001956 | Ga0207656_100019567 | 307 |
| 280 | 3300025711 | Ga0207696_1022993 | Ga0207696_10229932 | 307 |
| 281 | 3300025728 | Ga0207655_1013437 | Ga0207655_10134372 | 307 |
| 282 | 3300025735 | Ga0207713_1003488 | Ga0207713_10034884 | 307 |
| 283 | 3300025735 | Ga0207713_1059249 | Ga0207713_10592491 | 307 |
| 284 | 3300025904 | Ga0207647_10017310 | Ga0207647_100173104 | 307 |
| 285 | 3300025904 | Ga0207647_10033801 | Ga0207647_100338013 | 307 |
| 286 | 3300025904 | Ga0207647_10038780 | Ga0207647_100387802 | 307 |
| 287 | 3300025904 | Ga0207647_10079244 | Ga0207647_100792442 | 307 |
| 288 | 3300025907 | Ga0207645_10003783 | Ga0207645_100037832 | 307 |
| 289 | 3300025909 | Ga0207705_10000642 | Ga0207705_1000064228 | 307 |
| 290 | 3300025909 | Ga0207705_10051673 | Ga0207705_100516732 | 307 |
| 291 | 3300025911 | Ga0207654_10000275 | Ga0207654_1000027513 | 307 |
| 292 | 3300025913 | Ga0207695_10001242 | Ga0207695_1000124233 | 307 |
| 293 | 3300025913 | Ga0207695_10004197 | Ga0207695_100041979 | 307 |
| 294 | 3300025913 | Ga0207695_10055858 | Ga0207695_100558585 | 307 |
| 295 | 3300025914 | Ga0207671_10039829 | Ga0207671_100398293 | 307 |
| 296 | 3300025914 | Ga0207671_10052049 | Ga0207671_100520492 | 307 |
| 297 | 3300025914 | Ga0207671_10258967 | Ga0207671_102589672 | 307 |
| 298 | 3300025919 | Ga0207657_10001165 | Ga0207657_1000116522 | 307 |
| 299 | 3300025919 | Ga0207657_10054794 | Ga0207657_100547943 | 307 |
| 300 | 3300025919 | Ga0207657_10198049 | Ga0207657_101980492 | 307 |
| 301 | 3300025924 | Ga0207694_10001514 | Ga0207694_100015149 | 307 |
| 302 | 3300025924 | Ga0207694_10036123 | Ga0207694_100361232 | 307 |
| 303 | 3300025924 | Ga0207694_10090521 | Ga0207694_100905212 | 307 |
| 304 | 3300025925 | Ga0207650_10118614 | Ga0207650_101186142 | 307 |
| 305 | 3300025932 | Ga0207690_10000115 | Ga0207690_100001157 | 307 |
| 306 | 3300025932 | Ga0207690_10127777 | Ga0207690_101277772 | 307 |
| 307 | 3300025932 | Ga0207690_10184197 | Ga0207690_101841972 | 307 |
| 308 | 3300025933 | Ga0207706_10004093 | Ga0207706_100040937 | 307 |
| 309 | 3300025935 | Ga0207709_10000112 | Ga0207709_1000011266 | 307 |
| 310 | 3300025935 | Ga0207709_10001057 | Ga0207709_100010576 | 307 |
| 311 | 3300025940 | Ga0207691_10020459 | Ga0207691_100204594 | 307 |
| 312 | 3300025941 | Ga0207711_10094670 | Ga0207711_100946703 | 307 |
| 313 | 3300025944 | Ga0207661_10038278 | Ga0207661_100382784 | 307 |
| 314 | 3300025945 | Ga0207679_10031808 | Ga0207679_100318083 | 307 |
| 315 | 3300025949 | Ga0207667_10023159 | Ga0207667_100231597 | 307 |
| 316 | 3300025949 | Ga0207667_10032826 | Ga0207667_100328264 | 307 |
| 317 | 3300025960 | Ga0207651_10180080 | Ga0207651_101800802 | 307 |
| 318 | 3300025972 | Ga0207668_10233462 | Ga0207668_102334622 | 307 |
| 319 | 3300025981 | Ga0207640_10012604 | Ga0207640_100126045 | 307 |
| 320 | 3300025986 | Ga0207658_10099880 | Ga0207658_100998802 | 307 |
| 321 | 3300026035 | Ga0207703_10365850 | Ga0207703_103658502 | 307 |
| 322 | 3300026041 | Ga0207639_10000210 | Ga0207639_1000021029 | 307 |
| 323 | 3300026041 | Ga0207639_10000280 | Ga0207639_1000028031 | 307 |
| 324 | 3300026041 | Ga0207639_10081456 | Ga0207639_100814562 | 307 |
| 325 | 3300026067 | Ga0207678_10000576 | Ga0207678_100005763 | 307 |
| 326 | 3300026067 | Ga0207678_10006339 | Ga0207678_100063396 | 307 |
| 327 | 3300026067 | Ga0207678_10007574 | Ga0207678_100075748 | 307 |
| 328 | 3300026067 | Ga0207678_10233532 | Ga0207678_102335322 | 307 |
| 329 | 3300026078 | Ga0207702_10002988 | Ga0207702_100029889 | 307 |
| 330 | 3300026095 | Ga0207676_10016766 | Ga0207676_100167664 | 307 |
| 331 | 3300026116 | Ga0207674_10001961 | Ga0207674_1000196115 | 307 |
| 332 | 3300026116 | Ga0207674_10323883 | Ga0207674_103238831 | 307 |
| 333 | 3300026121 | Ga0207683_10009519 | Ga0207683_100095194 | 307 |
| 334 | 3300026121 | Ga0207683_10586703 | Ga0207683_105867031 | 307 |
| 335 | 3300026142 | Ga0207698_10004738 | Ga0207698_100047383 | 307 |
| 336 | 3300026142 | Ga0207698_10004765 | Ga0207698_100047658 | 307 |
| 337 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020279 | 307 |
| 338 | 3300027312 | Ga0209371_1000971 | Ga0209371_100097110 | 307 |
| 339 | 3300027666 | Ga0209282_1000112 | Ga0209282_100011234 | 307 |
| 340 | 3300027907 | Ga0207428_10019979 | Ga0207428_100199793 | 307 |
| 341 | 3300027907 | Ga0207428_10272570 | Ga0207428_102725701 | 307 |
| 342 | 3300028379 | Ga0268266_10256433 | Ga0268266_102564331 | 307 |
| 343 | 3300028379 | Ga0268266_10382919 | Ga0268266_103829192 | 307 |
| 344 | 3300030500 | Ga0268256_1000821 | Ga0268256_100082112 | 307 |
| 345 | 3300031247 | Ga0265340_10008869 | Ga0265340_100088691 | 307 |
| 346 | 3300031251 | Ga0265327_10000108 | Ga0265327_10000108141 | 307 |
| 347 | 3300031548 | Ga0307408_100008944 | Ga0307408_1000089442 | 307 |
| 348 | 3300031548 | Ga0307408_100092161 | Ga0307408_1000921612 | 307 |
| 349 | 3300031548 | Ga0307408_100107285 | Ga0307408_1001072852 | 307 |
| 350 | 3300031548 | Ga0307408_100203985 | Ga0307408_1002039852 | 307 |
| 351 | 3300031731 | Ga0307405_10009497 | Ga0307405_100094975 | 307 |
| 352 | 3300031852 | Ga0307410_10096878 | Ga0307410_100968782 | 307 |
| 353 | 3300031852 | Ga0307410_10304433 | Ga0307410_103044331 | 307 |
| 354 | 3300031911 | Ga0307412_10000021 | Ga0307412_1000002166 | 307 |
| 355 | 3300031911 | Ga0307412_10000199 | Ga0307412_1000019927 | 307 |
| 356 | 3300031911 | Ga0307412_10003193 | Ga0307412_100031938 | 307 |
| 357 | 3300031911 | Ga0307412_10429829 | Ga0307412_104298292 | 307 |
| 358 | 3300032002 | Ga0307416_100003033 | Ga0307416_1000030332 | 307 |
| 359 | 3300032002 | Ga0307416_100079069 | Ga0307416_1000790693 | 307 |
| 360 | 3300032002 | Ga0307416_100082414 | Ga0307416_1000824142 | 307 |
| 361 | 3300032002 | Ga0307416_100204781 | Ga0307416_1002047811 | 307 |
| 362 | 3300032004 | Ga0307414_10251577 | Ga0307414_102515771 | 307 |
| 363 | 3300032004 | Ga0307414_10332183 | Ga0307414_103321831 | 307 |
| 364 | 3300032005 | Ga0307411_10029169 | Ga0307411_100291692 | 307 |
| 365 | 3300037466 | Ga0395898_0002587 | Ga0395898_0002587_1171_2103 | 307 |
| 366 | 3300037471 | Ga0395905_0002203 | Ga0395905_0002203_8640_9584 | 307 |
| 367 | 3300037471 | Ga0395905_0070959 | Ga0395905_0070959_602_1534 | 307 |
| 368 | 3300037471 | Ga0395905_0167754 | Ga0395905_0167754_1118_2047 | 307 |
| 369 | 3300037853 | Ga0436364_1500701 | Ga0436364_1500701_1113_2045 | 307 |
| 370 | 3300038443 | Ga0395901_0011955 | Ga0395901_0011955_4788_5762 | 307 |
| 371 | 3300038443 | Ga0395901_0024390 | Ga0395901_0024390_4001_4933 | 307 |
| 372 | 3300039437 | Ga0436365_0781525 | Ga0436365_0781525_4534_5466 | 307 |
| 373 | 3300039437 | Ga0436365_1641635 | Ga0436365_1641635_3547_4479 | 307 |
| 374 | 3300041411 | Ga0439466_0043955 | Ga0439466_0043955_19_951 | 307 |
| 375 | 3300044656 | Ga0466969_0002785 | Ga0466969_0002785_4033_4974 | 307 |
| 376 | 3300044683 | Ga0466965_0083609 | Ga0466965_0083609_461_1393 | 307 |
| 377 | 3300044693 | Ga0466961_0042674 | Ga0466961_0042674_356_1288 | 307 |
| 378 | 3300044765 | Ga0466970_0042166 | Ga0466970_0042166_1373_2305 | 307 |
| 379 | 3300045049 | Ga0466959_0014112 | Ga0466959_0014112_2730_3671 | 307 |
| 380 | 3300045976 | Ga0466967_0039385 | Ga0466967_0039385_466_1398 | 307 |
| 381 | 3300045976 | Ga0466967_0417448 | Ga0466967_0417448_259_1221 | 307 |
| 382 | 3300046454 | Ga0495592_0035395 | Ga0495592_0035395_177_1109 | 307 |
| 383 | 3300046455 | Ga0495603_0000115 | Ga0495603_0000115_5836_6768 | 307 |
| 384 | 3300046455 | Ga0495603_0008106 | Ga0495603_0008106_5310_6242 | 307 |
| 385 | 3300046457 | Ga0495590_0008645 | Ga0495590_0008645_2283_3215 | 307 |
| 386 | 3300046458 | Ga0495591_019786 | Ga0495591_019786_1249_2181 | 307 |
| 387 | 3300046459 | Ga0495629_0000111 | Ga0495629_0000111_69857_70789 | 307 |
| 388 | 3300046459 | Ga0495629_0000432 | Ga0495629_0000432_2039_2971 | 307 |
| 389 | 3300046459 | Ga0495629_0002672 | Ga0495629_0002672_4168_5100 | 307 |
| 390 | 3300046459 | Ga0495629_0006729 | Ga0495629_0006729_7019_7951 | 307 |
| 391 | 3300046459 | Ga0495629_0007141 | Ga0495629_0007141_5203_6135 | 307 |
| 392 | 3300046460 | Ga0495638_0123038 | Ga0495638_0123038_140_1069 | 307 |
| 393 | 3300046462 | Ga0495651_0068251 | Ga0495651_0068251_823_1755 | 307 |
| 394 | 3300046463 | Ga0495653_0002714 | Ga0495653_0002714_499_1431 | 307 |
| 395 | 3300046463 | Ga0495653_0008865 | Ga0495653_0008865_5642_6574 | 307 |
| 396 | 3300046463 | Ga0495653_0018434 | Ga0495653_0018434_2060_2992 | 307 |
| 397 | 3300046463 | Ga0495653_0098639 | Ga0495653_0098639_594_1526 | 307 |
| 398 | 3300046463 | Ga0495653_0140474 | Ga0495653_0140474_208_1140 | 307 |
| 399 | 3300046471 | Ga0495650_0000681 | Ga0495650_0000681_29400_30332 | 307 |
| 400 | 3300046471 | Ga0495650_0001326 | Ga0495650_0001326_9581_10513 | 307 |
| 401 | 3300046472 | Ga0495580_0006962 | Ga0495580_0006962_6057_6989 | 307 |
| 402 | 3300046472 | Ga0495580_0014713 | Ga0495580_0014713_4376_5308 | 307 |
| 403 | 3300046472 | Ga0495580_0015632 | Ga0495580_0015632_1059_1991 | 307 |
| 404 | 3300046472 | Ga0495580_0057681 | Ga0495580_0057681_1465_2397 | 307 |
| 405 | 3300046472 | Ga0495580_0105299 | Ga0495580_0105299_197_1129 | 307 |
| 406 | 3300046473 | Ga0495582_0009528 | Ga0495582_0009528_1129_2061 | 307 |
| 407 | 3300046475 | Ga0495639_0016256 | Ga0495639_0016256_1617_2549 | 307 |
| 408 | 3300046476 | Ga0495662_0003788 | Ga0495662_0003788_5500_6432 | 307 |
| 409 | 3300046477 | Ga0495664_0000813 | Ga0495664_0000813_3864_4796 | 307 |
| 410 | 3300046477 | Ga0495664_0057303 | Ga0495664_0057303_1251_2183 | 307 |
| 411 | 3300046477 | Ga0495664_0122947 | Ga0495664_0122947_240_1172 | 307 |
| 412 | 3300046491 | Ga0495584_0026184 | Ga0495584_0026184_591_1523 | 307 |
| 413 | 3300046491 | Ga0495584_0043016 | Ga0495584_0043016_748_1680 | 307 |
| 414 | 3300046491 | Ga0495584_0121309 | Ga0495584_0121309_101_1033 | 307 |
| 415 | 3300046492 | Ga0495585_0195100 | Ga0495585_0195100_11_943 | 307 |
| 416 | 3300046499 | Ga0495594_0066459 | Ga0495594_0066459_419_1351 | 307 |
| 417 | 3300046499 | Ga0495594_0109974 | Ga0495594_0109974_328_1260 | 307 |
| 418 | 3300046499 | Ga0495594_0159051 | Ga0495594_0159051_237_1169 | 307 |
| 419 | 3300046500 | Ga0495596_0005232 | Ga0495596_0005232_1465_2397 | 307 |
| 420 | 3300046500 | Ga0495596_0023330 | Ga0495596_0023330_927_1859 | 307 |
| 421 | 3300046500 | Ga0495596_0105394 | Ga0495596_0105394_61_993 | 307 |
| 422 | 3300046506 | Ga0495583_0015739 | Ga0495583_0015739_626_1558 | 307 |
| 423 | 3300046506 | Ga0495583_0016468 | Ga0495583_0016468_1125_2057 | 307 |
| 424 | 3300046507 | Ga0495606_0003045 | Ga0495606_0003045_15403_16335 | 307 |
| 425 | 3300046507 | Ga0495606_0003625 | Ga0495606_0003625_11039_11971 | 307 |
| 426 | 3300046507 | Ga0495606_0052837 | Ga0495606_0052837_136_1068 | 307 |
| 427 | 3300046511 | Ga0495608_0001030 | Ga0495608_0001030_7703_8635 | 307 |
| 428 | 3300046511 | Ga0495608_0026577 | Ga0495608_0026577_851_1783 | 307 |
| 429 | 3300046511 | Ga0495608_0063302 | Ga0495608_0063302_1103_2035 | 307 |
| 430 | 3300046512 | Ga0495610_0001663 | Ga0495610_0001663_18283_19215 | 307 |
| 431 | 3300046514 | Ga0495618_0023948 | Ga0495618_0023948_2519_3451 | 307 |
| 432 | 3300046514 | Ga0495618_0090660 | Ga0495618_0090660_335_1267 | 307 |
| 433 | 3300046514 | Ga0495618_0117790 | Ga0495618_0117790_334_1266 | 307 |
| 434 | 3300046515 | Ga0495620_0000640 | Ga0495620_0000640_3255_4184 | 307 |
| 435 | 3300046516 | Ga0495628_0019402 | Ga0495628_0019402_244_1176 | 307 |
| 436 | 3300046516 | Ga0495628_0021726 | Ga0495628_0021726_2752_3684 | 307 |
| 437 | 3300046517 | Ga0495630_0003995 | Ga0495630_0003995_6647_7579 | 307 |
| 438 | 3300046517 | Ga0495630_0004112 | Ga0495630_0004112_7765_8697 | 307 |
| 439 | 3300046518 | Ga0495631_0030935 | Ga0495631_0030935_1454_2386 | 307 |
| 440 | 3300046518 | Ga0495631_0059173 | Ga0495631_0059173_556_1488 | 307 |
| 441 | 3300046519 | Ga0495632_0002605 | Ga0495632_0002605_9402_10331 | 307 |
| 442 | 3300046524 | Ga0495648_0005165 | Ga0495648_0005165_9657_10589 | 307 |
| 443 | 3300046524 | Ga0495648_0123824 | Ga0495648_0123824_171_1103 | 307 |
| 444 | 3300046526 | Ga0495666_0000120 | Ga0495666_0000120_2431_3363 | 307 |
| 445 | 3300046528 | Ga0495642_0003281 | Ga0495642_0003281_4833_5765 | 307 |
| 446 | 3300046528 | Ga0495642_0005435 | Ga0495642_0005435_661_1593 | 307 |
| 447 | 3300046528 | Ga0495642_0026586 | Ga0495642_0026586_754_1686 | 307 |
| 448 | 3300046529 | Ga0495652_0010011 | Ga0495652_0010011_1482_2414 | 307 |
| 449 | 3300046529 | Ga0495652_0011966 | Ga0495652_0011966_2816_3748 | 307 |
| 450 | 3300046529 | Ga0495652_0102931 | Ga0495652_0102931_1368_2300 | 307 |
| 451 | 3300046530 | Ga0495654_0041467 | Ga0495654_0041467_711_1643 | 307 |
| 452 | 3300046531 | Ga0495665_0000183 | Ga0495665_0000183_13940_14872 | 307 |
| 453 | 3300046531 | Ga0495665_0000239 | Ga0495665_0000239_5943_6875 | 307 |
| 454 | 3300046531 | Ga0495665_0019318 | Ga0495665_0019318_1228_2160 | 307 |
| 455 | 3300046531 | Ga0495665_0020982 | Ga0495665_0020982_2508_3440 | 307 |
| 456 | 3300046533 | Ga0495640_0001503 | Ga0495640_0001503_11333_12265 | 307 |
| 457 | 3300046535 | Ga0495586_0038960 | Ga0495586_0038960_743_1675 | 307 |
| 458 | 3300046535 | Ga0495586_0067089 | Ga0495586_0067089_920_1852 | 307 |
| 459 | 3300046535 | Ga0495586_0071134 | Ga0495586_0071134_194_1126 | 307 |
| 460 | 3300046536 | Ga0495587_0019682 | Ga0495587_0019682_930_1862 | 307 |
| 461 | 3300046536 | Ga0495587_0029061 | Ga0495587_0029061_478_1410 | 307 |
| 462 | 3300046536 | Ga0495587_0054743 | Ga0495587_0054743_1115_2047 | 307 |
| 463 | 3300046536 | Ga0495587_0061191 | Ga0495587_0061191_541_1473 | 307 |
| 464 | 3300046542 | Ga0495597_0001163 | Ga0495597_0001163_8039_8971 | 307 |
| 465 | 3300046542 | Ga0495597_0027457 | Ga0495597_0027457_78_1010 | 307 |
| 466 | 3300046543 | Ga0495645_0000928 | Ga0495645_0000928_5168_6100 | 307 |
| 467 | 3300046543 | Ga0495645_0002267 | Ga0495645_0002267_7988_8920 | 307 |
| 468 | 3300046543 | Ga0495645_0025722 | Ga0495645_0025722_654_1586 | 307 |
| 469 | 3300046543 | Ga0495645_0101234 | Ga0495645_0101234_930_1862 | 307 |
| 470 | 3300046543 | Ga0495645_0110359 | Ga0495645_0110359_1004_1936 | 307 |
| 471 | 3300046557 | Ga0495622_0000115 | Ga0495622_0000115_57589_58521 | 307 |
| 472 | 3300046559 | Ga0495667_0026792 | Ga0495667_0026792_1784_2716 | 307 |
| 473 | 3300046615 | Ga0495656_0001038 | Ga0495656_0001038_2607_3539 | 307 |
| 474 | 3300046616 | Ga0495668_0046342 | Ga0495668_0046342_1319_2251 | 307 |
| 475 | 3300046642 | Ga0495634_0031592 | Ga0495634_0031592_1611_2543 | 307 |
| 476 | 3300046642 | Ga0495634_0158610 | Ga0495634_0158610_336_1268 | 307 |
| 477 | 3300046648 | Ga0495611_0049910 | Ga0495611_0049910_320_1249 | 307 |
| 478 | 3300046660 | Ga0495625_0000052 | Ga0495625_0000052_151622_152554 | 307 |
| 479 | 3300046663 | Ga0495635_0004416 | Ga0495635_0004416_2006_2938 | 307 |
| 480 | 3300046663 | Ga0495635_0025633 | Ga0495635_0025633_2465_3397 | 307 |
| 481 | 3300046663 | Ga0495635_0037716 | Ga0495635_0037716_1768_2700 | 307 |
| 482 | 3300046664 | Ga0495659_0008926 | Ga0495659_0008926_762_1694 | 307 |
| 483 | 3300046665 | Ga0495661_0001916 | Ga0495661_0001916_3449_4381 | 307 |
| 484 | 3300046674 | Ga0495588_0001274 | Ga0495588_0001274_5642_6574 | 307 |
| 485 | 3300046674 | Ga0495588_0010138 | Ga0495588_0010138_193_1125 | 307 |
| 486 | 3300046674 | Ga0495588_0059157 | Ga0495588_0059157_86_1018 | 307 |
| 487 | 3300046674 | Ga0495588_0067791 | Ga0495588_0067791_119_1051 | 307 |
| 488 | 3300046674 | Ga0495588_0072867 | Ga0495588_0072867_777_1709 | 307 |
| 489 | 3300046679 | Ga0495623_0000735 | Ga0495623_0000735_12608_13540 | 307 |
| 490 | 3300046679 | Ga0495623_0002004 | Ga0495623_0002004_6418_7350 | 307 |
| 491 | 3300046679 | Ga0495623_0002295 | Ga0495623_0002295_8035_8967 | 307 |
| 492 | 3300046679 | Ga0495623_0021196 | Ga0495623_0021196_2825_3757 | 307 |
| 493 | 3300046680 | Ga0495646_0012933 | Ga0495646_0012933_688_1620 | 307 |
| 494 | 3300046680 | Ga0495646_0021705 | Ga0495646_0021705_2468_3400 | 307 |
| 495 | 3300046680 | Ga0495646_0050989 | Ga0495646_0050989_1390_2322 | 307 |
| 496 | 3300046680 | Ga0495646_0052044 | Ga0495646_0052044_498_1430 | 307 |
| 497 | 3300046680 | Ga0495646_0061254 | Ga0495646_0061254_771_1703 | 307 |
| 498 | 3300046680 | Ga0495646_0152262 | Ga0495646_0152262_135_1067 | 307 |
| 499 | 3300046684 | Ga0495669_0002555 | Ga0495669_0002555_2263_3195 | 307 |
| 500 | 3300046684 | Ga0495669_0007805 | Ga0495669_0007805_914_1846 | 307 |
| 501 | 3300046684 | Ga0495669_0049849 | Ga0495669_0049849_928_1860 | 307 |
| 502 | 3300046689 | Ga0495613_0002707 | Ga0495613_0002707_5566_6498 | 307 |
| 503 | 3300046689 | Ga0495613_0028567 | Ga0495613_0028567_903_1835 | 307 |
| 504 | 3300046689 | Ga0495613_0101470 | Ga0495613_0101470_673_1605 | 307 |
| 505 | 3300046689 | Ga0495613_0156474 | Ga0495613_0156474_559_1491 | 307 |
| 506 | 3300046690 | Ga0495624_0000471 | Ga0495624_0000471_17105_18037 | 307 |
| 507 | 3300046690 | Ga0495624_0007388 | Ga0495624_0007388_5760_6692 | 307 |
| 508 | 3300046690 | Ga0495624_0046645 | Ga0495624_0046645_170_1102 | 307 |
| 509 | 3300046691 | Ga0495670_0004902 | Ga0495670_0004902_52_984 | 307 |
| 510 | 3300046691 | Ga0495670_0106382 | Ga0495670_0106382_247_1179 | 307 |
| 511 | 3300046692 | Ga0495671_0019792 | Ga0495671_0019792_159_1091 | 307 |
| 512 | 3300046692 | Ga0495671_0051755 | Ga0495671_0051755_67_999 | 307 |
| 513 | 3300046692 | Ga0495671_0089623 | Ga0495671_0089623_296_1228 | 307 |
| 514 | 3300046694 | Ga0495649_0009639 | Ga0495649_0009639_1683_2615 | 307 |
| 515 | 3300046694 | Ga0495649_0025354 | Ga0495649_0025354_2000_2932 | 307 |
| 516 | 3300046794 | Ga0495589_0014903 | Ga0495589_0014903_1304_2236 | 307 |
| 517 | 3300046794 | Ga0495589_0031066 | Ga0495589_0031066_1650_2582 | 307 |
| 518 | 3300046794 | Ga0495589_0079778 | Ga0495589_0079778_74_1006 | 307 |
| 519 | 3300046809 | Ga0495600_0004212 | Ga0495600_0004212_1136_2068 | 307 |
| 520 | 3300046809 | Ga0495600_0016957 | Ga0495600_0016957_611_1543 | 307 |
| 521 | 3300046810 | Ga0495660_0039725 | Ga0495660_0039725_804_1736 | 307 |
| 522 | 3300047315 | Ga0495581_0001779 | Ga0495581_0001779_7603_8535 | 307 |
| 523 | 3300047315 | Ga0495581_0003591 | Ga0495581_0003591_5812_6744 | 307 |
| 524 | 3300047315 | Ga0495581_0013691 | Ga0495581_0013691_3100_4032 | 307 |
| 525 | 3300047315 | Ga0495581_0018957 | Ga0495581_0018957_1551_2483 | 307 |
| 526 | 3300047315 | Ga0495581_0029023 | Ga0495581_0029023_1610_2542 | 307 |
| 527 | 3300047317 | Ga0495604_0003479 | Ga0495604_0003479_7905_8837 | 307 |
| 528 | 3300047317 | Ga0495604_0039011 | Ga0495604_0039011_547_1479 | 307 |
| 529 | 3300047317 | Ga0495604_0092092 | Ga0495604_0092092_228_1160 | 307 |
| 530 | 3300047317 | Ga0495604_0101326 | Ga0495604_0101326_160_1092 | 307 |
| 531 | 3300047318 | Ga0495636_0023272 | Ga0495636_0023272_512_1444 | 307 |
| 532 | 3300047319 | Ga0495674_0004653 | Ga0495674_0004653_3002_3934 | 307 |
| 533 | 3300047319 | Ga0495674_0006385 | Ga0495674_0006385_5610_6542 | 307 |
| 534 | 3300047319 | Ga0495674_0056536 | Ga0495674_0056536_1062_1994 | 307 |
| 535 | 3300047320 | Ga0495672_0002500 | Ga0495672_0002500_5086_6018 | 307 |
| 536 | 3300047322 | Ga0495680_0036140 | Ga0495680_0036140_1799_2731 | 307 |
| 537 | 3300047322 | Ga0495680_0037536 | Ga0495680_0037536_2361_3293 | 307 |
| 538 | 3300047322 | Ga0495680_0055439 | Ga0495680_0055439_165_1097 | 307 |
| 539 | 3300047323 | Ga0495683_0002608 | Ga0495683_0002608_7482_8414 | 307 |
| 540 | 3300047323 | Ga0495683_0003057 | Ga0495683_0003057_6387_7319 | 307 |
| 541 | 3300047323 | Ga0495683_0003168 | Ga0495683_0003168_4481_5413 | 307 |
| 542 | 3300047323 | Ga0495683_0010823 | Ga0495683_0010823_2744_3676 | 307 |
| 543 | 3300047323 | Ga0495683_0039615 | Ga0495683_0039615_827_1759 | 307 |
| 544 | 3300047323 | Ga0495683_0110483 | Ga0495683_0110483_258_1190 | 307 |
| 545 | 3300047443 | Ga0495687_000020 | Ga0495687_000020_213140_214072 | 307 |
| 546 | 3300047443 | Ga0495687_009870 | Ga0495687_009870_1647_2579 | 307 |
| 547 | 3300047444 | Ga0495675_0001188 | Ga0495675_0001188_12345_13277 | 307 |
| 548 | 3300047444 | Ga0495675_0029177 | Ga0495675_0029177_307_1239 | 307 |
| 549 | 3300047444 | Ga0495675_0035095 | Ga0495675_0035095_575_1507 | 307 |
| 550 | 3300047444 | Ga0495675_0078003 | Ga0495675_0078003_294_1226 | 307 |
| 551 | 3300047469 | Ga0495673_0001172 | Ga0495673_0001172_19033_19965 | 307 |
| 552 | 3300047469 | Ga0495673_0072563 | Ga0495673_0072563_131_1063 | 307 |
| 553 | 3300047470 | Ga0495681_0039813 | Ga0495681_0039813_1008_1940 | 307 |
| 554 | 3300047470 | Ga0495681_0099252 | Ga0495681_0099252_124_1056 | 307 |
| 555 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_1040725_1041657 | 307 |
| 556 | 3300047472 | Ga0495686_0097466 | Ga0495686_0097466_728_1660 | 307 |
| 557 | 3300047673 | Ga0495593_0000414 | Ga0495593_0000414_6574_7506 | 307 |
| 558 | 3300047673 | Ga0495593_0002167 | Ga0495593_0002167_5019_5951 | 307 |
| 559 | 3300047673 | Ga0495593_0013364 | Ga0495593_0013364_1008_1940 | 307 |
| 560 | 3300047673 | Ga0495593_0015994 | Ga0495593_0015994_666_1598 | 307 |
| 561 | 3300048088 | Ga0495602_0001650 | Ga0495602_0001650_3652_4584 | 307 |
| 562 | 3300048088 | Ga0495602_0004155 | Ga0495602_0004155_7014_7946 | 307 |
| 563 | 3300048088 | Ga0495602_0013684 | Ga0495602_0013684_1465_2397 | 307 |
| 564 | 3300048088 | Ga0495602_0035833 | Ga0495602_0035833_1545_2477 | 307 |
| 565 | 3300048088 | Ga0495602_0056734 | Ga0495602_0056734_1064_1996 | 307 |
| 566 | 3300048088 | Ga0495602_0137068 | Ga0495602_0137068_323_1255 | 307 |
| 567 | 3300048089 | Ga0495614_0001485 | Ga0495614_0001485_8041_8973 | 307 |
| 568 | 3300048089 | Ga0495614_0008753 | Ga0495614_0008753_2663_3595 | 307 |
| 569 | 3300048091 | Ga0495626_0004820 | Ga0495626_0004820_4280_5212 | 307 |
| 570 | 3300048903 | Ga0496100_0002614 | Ga0496100_0002614_1634_2566 | 307 |
| 571 | 3300048903 | Ga0496100_0013067 | Ga0496100_0013067_439_1371 | 307 |
| 572 | 3300048903 | Ga0496100_0319151 | Ga0496100_0319151_79_1011 | 307 |
| 573 | 3300048904 | Ga0496101_0004570 | Ga0496101_0004570_1532_2464 | 307 |
| 574 | 3300048904 | Ga0496101_0065794 | Ga0496101_0065794_709_1641 | 307 |
| 575 | 3300048904 | Ga0496101_0090448 | Ga0496101_0090448_721_1653 | 307 |
| 576 | 3300048904 | Ga0496101_0129159 | Ga0496101_0129159_514_1446 | 307 |
| 577 | 3300048905 | Ga0496102_0014642 | Ga0496102_0014642_2998_3930 | 307 |
| 578 | 3300048905 | Ga0496102_0025174 | Ga0496102_0025174_2729_3661 | 307 |
| 579 | 3300048905 | Ga0496102_0032534 | Ga0496102_0032534_2875_3807 | 307 |
| 580 | 3300048905 | Ga0496102_0188842 | Ga0496102_0188842_923_1855 | 307 |
| 581 | 3300048906 | Ga0496103_0000812 | Ga0496103_0000812_10621_11553 | 307 |
| 582 | 3300048906 | Ga0496103_0015039 | Ga0496103_0015039_3015_3947 | 307 |
| 583 | 3300048907 | Ga0496104_0011962 | Ga0496104_0011962_1977_2909 | 307 |
| 584 | 3300048907 | Ga0496104_0128458 | Ga0496104_0128458_17_949 | 307 |
| 585 | 3300048907 | Ga0496104_0202761 | Ga0496104_0202761_125_1057 | 307 |
| 586 | 3300048909 | Ga0496106_0000036 | Ga0496106_0000036_104892_105824 | 307 |
| 587 | 3300048909 | Ga0496106_0004044 | Ga0496106_0004044_6462_7394 | 307 |
| 588 | 3300048909 | Ga0496106_0062694 | Ga0496106_0062694_1764_2696 | 307 |
| 589 | 3300048910 | Ga0496107_0002435 | Ga0496107_0002435_3436_4368 | 307 |
| 590 | 3300048910 | Ga0496107_0010747 | Ga0496107_0010747_3194_4126 | 307 |
| 591 | 3300048911 | Ga0496108_0125184 | Ga0496108_0125184_1118_2080 | 307 |
| 592 | 3300048912 | Ga0496109_0014927 | Ga0496109_0014927_2265_3197 | 307 |
| 593 | 3300048912 | Ga0496109_0089435 | Ga0496109_0089435_987_1919 | 307 |
| 594 | 3300048912 | Ga0496109_0544190 | Ga0496109_0544190_74_1006 | 307 |
| 595 | 3300048913 | Ga0496110_0012080 | Ga0496110_0012080_2755_3687 | 307 |
| 596 | 3300048913 | Ga0496110_0226277 | Ga0496110_0226277_339_1271 | 307 |
| 597 | 3300048913 | Ga0496110_0229640 | Ga0496110_0229640_645_1577 | 307 |
| 598 | 3300048914 | Ga0496111_0002196 | Ga0496111_0002196_6373_7305 | 307 |
| 599 | 3300048914 | Ga0496111_0022147 | Ga0496111_0022147_3498_4430 | 307 |
| 600 | 3300048915 | Ga0496112_0005803 | Ga0496112_0005803_6280_7242 | 307 |
| 601 | 3300048915 | Ga0496112_0020914 | Ga0496112_0020914_3526_4458 | 307 |
| 602 | 3300048915 | Ga0496112_0039023 | Ga0496112_0039023_3442_4374 | 307 |
| 603 | 3300048915 | Ga0496112_0094058 | Ga0496112_0094058_943_1905 | 307 |
| 604 | 3300048915 | Ga0496112_0181995 | Ga0496112_0181995_656_1588 | 307 |
| 605 | 3300048916 | Ga0496113_0012187 | Ga0496113_0012187_4165_5097 | 307 |
| 606 | 3300048916 | Ga0496113_0036749 | Ga0496113_0036749_2106_3038 | 307 |
| 607 | 3300048916 | Ga0496113_0049560 | Ga0496113_0049560_657_1589 | 307 |
| 608 | 3300048916 | Ga0496113_0207556 | Ga0496113_0207556_289_1221 | 307 |
| 609 | 3300048917 | Ga0496114_0004527 | Ga0496114_0004527_1436_2368 | 307 |
| 610 | 3300048917 | Ga0496114_0008761 | Ga0496114_0008761_6980_7912 | 307 |
| 611 | 3300048917 | Ga0496114_0079862 | Ga0496114_0079862_683_1615 | 307 |
| 612 | 3300048918 | Ga0496115_0201454 | Ga0496115_0201454_673_1605 | 307 |
| 613 | 3300048918 | Ga0496115_0279636 | Ga0496115_0279636_260_1192 | 307 |
| 614 | 3300048918 | Ga0496115_0392060 | Ga0496115_0392060_20_952 | 307 |
| 615 | 3300048919 | Ga0496116_0003463 | Ga0496116_0003463_9268_10203 | 307 |
| 616 | 3300048919 | Ga0496116_0005958 | Ga0496116_0005958_2252_3184 | 307 |
| 617 | 3300048919 | Ga0496116_0032012 | Ga0496116_0032012_1594_2526 | 307 |
| 618 | 3300048920 | Ga0496117_0002393 | Ga0496117_0002393_12957_13889 | 307 |
| 619 | 3300048920 | Ga0496117_0004328 | Ga0496117_0004328_11759_12691 | 307 |
| 620 | 3300048920 | Ga0496117_0007634 | Ga0496117_0007634_505_1437 | 307 |
| 621 | 3300048920 | Ga0496117_0012902 | Ga0496117_0012902_3770_4702 | 307 |
| 622 | 3300048920 | Ga0496117_0016363 | Ga0496117_0016363_81_1013 | 307 |
| 623 | 3300048920 | Ga0496117_0170749 | Ga0496117_0170749_289_1221 | 307 |
| 624 | 3300048921 | Ga0496118_0003472 | Ga0496118_0003472_12896_13828 | 307 |
| 625 | 3300048921 | Ga0496118_0016037 | Ga0496118_0016037_3921_4853 | 307 |
| 626 | 3300048921 | Ga0496118_0019210 | Ga0496118_0019210_4198_5133 | 307 |
| 627 | 3300048922 | Ga0496119_0004110 | Ga0496119_0004110_9102_10037 | 307 |
| 628 | 3300048922 | Ga0496119_0048986 | Ga0496119_0048986_225_1157 | 307 |
| 629 | 3300048923 | Ga0496120_0002947 | Ga0496120_0002947_89_1024 | 307 |
| 630 | 3300048923 | Ga0496120_0026908 | Ga0496120_0026908_739_1701 | 307 |
| 631 | 3300048924 | Ga0496121_0000140 | Ga0496121_0000140_26712_27647 | 307 |
| 632 | 3300048924 | Ga0496121_0002763 | Ga0496121_0002763_12696_13628 | 307 |
| 633 | 3300048924 | Ga0496121_0003313 | Ga0496121_0003313_12002_12934 | 307 |
| 634 | 3300048924 | Ga0496121_0018671 | Ga0496121_0018671_4307_5239 | 307 |
| 635 | 3300048924 | Ga0496121_0084290 | Ga0496121_0084290_1316_2278 | 307 |
| 636 | 3300048924 | Ga0496121_0086673 | Ga0496121_0086673_873_1820 | 307 |
| 637 | 3300048925 | Ga0496122_0000582 | Ga0496122_0000582_46999_47934 | 307 |
| 638 | 3300048925 | Ga0496122_0026241 | Ga0496122_0026241_3262_4194 | 307 |
| 639 | 3300048925 | Ga0496122_0096881 | Ga0496122_0096881_136_1071 | 307 |
| 640 | 3300048926 | Ga0496123_0000479 | Ga0496123_0000479_26411_27346 | 307 |
| 641 | 3300048926 | Ga0496123_0007721 | Ga0496123_0007721_2860_3792 | 307 |
| 642 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_565550_566485 | 307 |
| 643 | 3300048927 | Ga0496124_0000724 | Ga0496124_0000724_35715_36656 | 307 |
| 644 | 3300048927 | Ga0496124_0014560 | Ga0496124_0014560_2504_3439 | 307 |
| 645 | 3300048927 | Ga0496124_0024203 | Ga0496124_0024203_433_1365 | 307 |
| 646 | 3300048927 | Ga0496124_0127340 | Ga0496124_0127340_130_1062 | 307 |
| 647 | 3300048928 | Ga0496125_0000190 | Ga0496125_0000190_110281_111216 | 307 |
| 648 | 3300048928 | Ga0496125_0010697 | Ga0496125_0010697_1924_2856 | 307 |
| 649 | 3300048929 | Ga0496126_0000105 | Ga0496126_0000105_49377_50309 | 307 |
| 650 | 3300048929 | Ga0496126_0000924 | Ga0496126_0000924_17786_18799 | 307 |
| 651 | 3300048929 | Ga0496126_0010554 | Ga0496126_0010554_8276_9211 | 307 |
| 652 | 3300048929 | Ga0496126_0153914 | Ga0496126_0153914_357_1289 | 307 |
| 653 | 3300048929 | Ga0496126_0303608 | Ga0496126_0303608_340_1302 | 307 |
| 654 | 3300049460 | Ga0495682_0019454 | Ga0495682_0019454_85_1008 | 307 |
| 655 | 3300049570 | Ga0501033_0011303 | Ga0501033_0011303_176_1111 | 307 |
| 656 | 3300049570 | Ga0501033_0201710 | Ga0501033_0201710_265_1200 | 307 |
| 657 | 3300049571 | Ga0501034_0000331 | Ga0501034_0000331_35569_36501 | 307 |
| 658 | 3300049571 | Ga0501034_0016407 | Ga0501034_0016407_244_1179 | 307 |
| 659 | 3300049571 | Ga0501034_0047017 | Ga0501034_0047017_3148_4080 | 307 |
| 660 | 3300049572 | Ga0501036_0067743 | Ga0501036_0067743_1877_2812 | 307 |
| 661 | 3300049573 | Ga0501037_0042520 | Ga0501037_0042520_707_1642 | 307 |
| 662 | 3300049573 | Ga0501037_0164987 | Ga0501037_0164987_577_1512 | 307 |
| 663 | 3300049574 | Ga0501038_0188327 | Ga0501038_0188327_209_1144 | 307 |
| 664 | 3300049575 | Ga0501039_0064693 | Ga0501039_0064693_1690_2625 | 307 |
| 665 | 3300049579 | Ga0501043_0054854 | Ga0501043_0054854_716_1651 | 307 |
| 666 | 3300049580 | Ga0501046_0056040 | Ga0501046_0056040_559_1494 | 307 |
| 667 | 3300049581 | Ga0501047_0014752 | Ga0501047_0014752_474_1409 | 307 |
| 668 | 3300049581 | Ga0501047_0365833 | Ga0501047_0365833_134_1069 | 307 |
| 669 | 3300049583 | Ga0501067_0070777 | Ga0501067_0070777_576_1511 | 307 |
| 670 | 3300049584 | Ga0501068_0035576 | Ga0501068_0035576_598_1533 | 307 |
| 671 | 3300049586 | Ga0501070_0118527 | Ga0501070_0118527_347_1282 | 307 |
| 672 | 3300049590 | Ga0501074_0383184 | Ga0501074_0383184_33_968 | 307 |
| 673 | 3300049741 | Ga0501079_0130516 | Ga0501079_0130516_247_1182 | 307 |
| 674 | 3300049742 | Ga0501080_0038273 | Ga0501080_0038273_2209_3144 | 307 |
| 675 | 3300049742 | Ga0501080_0166414 | Ga0501080_0166414_207_1139 | 307 |
| 676 | 3300049822 | Ga0501035_0015361 | Ga0501035_0015361_3577_4506 | 307 |
| 677 | 3300049822 | Ga0501035_0233384 | Ga0501035_0233384_304_1239 | 307 |
| 678 | 3300049823 | Ga0501044_0011583 | Ga0501044_0011583_3925_4854 | 307 |
| 679 | 3300049823 | Ga0501044_0015770 | Ga0501044_0015770_7119_8054 | 307 |
| 680 | 3300049823 | Ga0501044_0140341 | Ga0501044_0140341_1438_2373 | 307 |
| 681 | 3300050491 | nmdc:mga00v17_21394_c1 | nmdc:mga00v17_21394_c1_1505_2467 | 307 |
| 682 | 3300050492 | nmdc:mga0yw44_44450_c1 | nmdc:mga0yw44_44450_c1_339_1301 | 307 |
| 683 | 3300050494 | nmdc:mga06z11_20818_c1 | nmdc:mga06z11_20818_c1_952_1914 | 307 |
| 684 | 3300050496 | nmdc:mga07m45_127633_c1 | nmdc:mga07m45_127633_c1_72_1004 | 307 |
| 685 | 3300050496 | nmdc:mga07m45_17966_c1 | nmdc:mga07m45_17966_c1_972_1934 | 307 |
| 686 | 3300050508 | nmdc:mga09592_112179_c1 | nmdc:mga09592_112179_c1_89_1024 | 307 |
| 687 | 3300050510 | nmdc:mga06r32_9922_c1 | nmdc:mga06r32_9922_c1_2952_3884 | 307 |
| 688 | 3300050511 | nmdc:mga08y16_151548_c1 | nmdc:mga08y16_151548_c1_1090_2022 | 307 |
| 689 | 3300050512 | nmdc:mga0n895_10480_c1 | nmdc:mga0n895_10480_c1_2406_3338 | 307 |
| 690 | 3300050515 | nmdc:mga0a205_13584_c1 | nmdc:mga0a205_13584_c1_5736_6668 | 307 |
| 691 | 3300053079 | Ga0500610_0000014 | Ga0500610_0000014_60658_61608 | 307 |
| 692 | 3300053087 | Ga0500643_001441 | Ga0500643_001441_8103_9035 | 307 |
| 693 | 3300053134 | Ga0500658_0046565 | Ga0500658_0046565_570_1499 | 307 |
| 694 | 3300053142 | Ga0500577_0019339 | Ga0500577_0019339_421_1350 | 307 |
| 695 | 3300053730 | Ga0500645_007970 | Ga0500645_007970_1692_2618 | 307 |
| 696 | 3300054114 | Ga0501084_0043258 | Ga0501084_0043258_1774_2709 | 307 |
| 697 | iso_pu_bacteria | 2503198000 | 2503202056 | 307 |
| 698 | iso_pu_bacteria | 2508501127 | 2509141270 | 307 |
| 699 | iso_pu_bacteria | 2509276018 | 2509369200 | 307 |
| 700 | iso_pu_bacteria | 2510065059 | 2510316908 | 307 |
| 701 | iso_pu_bacteria | 2512875016 | 2512931047 | 307 |
| 702 | iso_pu_bacteria | 2512875024 | 2512958775 | 307 |
| 703 | iso_pu_bacteria | 2513237164 | 2514037670 | 307 |
| 704 | iso_pu_bacteria | 2588253730 | 2588516802 | 307 |
| 705 | iso_pu_bacteria | 2597489875 | 2597815492 | 307 |
| 706 | iso_pu_bacteria | 2643221595 | 2643986375 | 307 |
| 707 | iso_pu_bacteria | 2643221627 | 2644152607 | 307 |
| 708 | iso_pu_bacteria | 2687453392 | 2688600702 | 307 |
| 709 | iso_pu_bacteria | 2756170246 | 2756672702 | 307 |
| 710 | iso_pu_bacteria | 2841734538 | 2841735436 | 307 |
| 711 | iso_pu_bacteria | 2844002411 | 2844005158 | 307 |
| 712 | iso_pu_bacteria | 2844009547 | 2844016052 | 307 |
| 713 | iso_pu_bacteria | 2856320880 | 2856323192 | 307 |
| 714 | iso_pu_bacteria | 2856328259 | 2856330167 | 307 |
| 715 | iso_pu_bacteria | 2856334872 | 2856339572 | 307 |
| 716 | iso_pu_bacteria | 2856342000 | 2856347597 | 307 |
| 717 | iso_pu_bacteria | 2857367948 | 2857374627 | 307 |
| 718 | iso_pu_bacteria | 2869162929 | 2869166482 | 307 |
| 719 | iso_pu_bacteria | 2869169390 | 2869174217 | 307 |
| 720 | iso_pu_bacteria | 2869234852 | 2869234923 | 307 |
| 721 | iso_pu_bacteria | 2869242130 | 2869242460 | 307 |
| 722 | iso_pu_bacteria | 2869249662 | 2869255254 | 307 |
| 723 | iso_pu_bacteria | 2869256925 | 2869259150 | 307 |
| 724 | iso_pu_bacteria | 2869264136 | 2869265074 | 307 |
| 725 | iso_pu_bacteria | 2869271264 | 2869274886 | 307 |
| 726 | iso_pu_bacteria | 2869278585 | 2869282742 | 307 |
| 727 | iso_pu_bacteria | 2871435913 | 2871437335 | 307 |
| 728 | iso_pu_bacteria | 2871451962 | 2871455790 | 307 |
| 729 | iso_pu_bacteria | 2871459585 | 2871461826 | 307 |
| 730 | iso_pu_bacteria | 2871466892 | 2871473441 | 307 |
| 731 | iso_pu_bacteria | 2871474448 | 2871479685 | 307 |
| 732 | iso_pu_bacteria | 2871481445 | 2871485096 | 307 |
| 733 | iso_pu_bacteria | 2874109183 | 2874115625 | 307 |
| 734 | iso_pu_bacteria | 2874116593 | 2874117257 | 307 |
| 735 | iso_pu_bacteria | 2874131515 | 2874135397 | 307 |
| 736 | iso_pu_bacteria | 2874139085 | 2874142400 | 307 |
| 737 | iso_pu_bacteria | 2874162495 | 2874167927 | 307 |
| 738 | iso_pu_bacteria | 2876363079 | 2876365700 | 307 |
| 739 | iso_pu_bacteria | 2876386047 | 2876388654 | 307 |
| 740 | iso_pu_bacteria | 2876399893 | 2876401808 | 307 |
| 741 | iso_pu_bacteria | 2876406927 | 2876409808 | 307 |
| 742 | iso_pu_bacteria | 2876420981 | 2876423670 | 307 |
| 743 | iso_pu_bacteria | 2878738818 | 2878744415 | 307 |
| 744 | iso_pu_bacteria | 2878774303 | 2878775521 | 307 |
| 745 | iso_pu_bacteria | 2888337043 | 2888338413 | 307 |
| 746 | iso_pu_bacteria | 2888343758 | 2888349403 | 307 |
| 747 | iso_pu_bacteria | 2903448605 | 2903455488 | 307 |
| 748 | iso_pu_bacteria | 2903521522 | 2903523629 | 307 |
| 749 | iso_pu_bacteria | 2903528002 | 2903534263 | 307 |
| 750 | iso_pu_bacteria | 2906363423 | 2906370088 | 307 |
| 751 | iso_pu_bacteria | 2906370794 | 2906371407 | 307 |
| 752 | iso_pu_bacteria | 2906378014 | 2906386033 | 307 |
| 753 | iso_pu_bacteria | 2906386501 | 2906390261 | 307 |
| 754 | iso_pu_bacteria | 2906393657 | 2906394916 | 307 |
| 755 | iso_pu_bacteria | 2906408224 | 2906409837 | 307 |
| 756 | iso_pu_bacteria | 2922151315 | 2922153130 | 307 |
| 757 | iso_pu_bacteria | 2922172374 | 2922176258 | 307 |
| 758 | iso_pu_bacteria | 2922178524 | 2922183070 | 307 |
| 759 | iso_pu_bacteria | 2924710171 | 2924710469 | 307 |
| 760 | iso_pu_bacteria | 2924733363 | 2924737530 | 307 |
| 761 | iso_pu_bacteria | 2924741084 | 2924745091 | 307 |
| 762 | iso_pu_bacteria | 2924748358 | 2924752472 | 307 |
| 763 | iso_pu_bacteria | 2924754689 | 2924762502 | 307 |
| 764 | iso_pu_bacteria | 2924776078 | 2924782445 | 307 |
| 765 | iso_pu_bacteria | 2937836603 | 2937842253 | 307 |
| 766 | iso_pu_bacteria | 2937861824 | 2937866979 | 307 |
| 767 | iso_pu_bacteria | 2937868953 | 2937873544 | 307 |
| 768 | iso_pu_bacteria | 2937877337 | 2937881086 | 307 |
| 769 | iso_pu_bacteria | 2937972304 | 2937977180 | 307 |
| 770 | iso_pu_bacteria | 2937980651 | 2937986511 | 307 |
| 771 | iso_pu_bacteria | 2958034702 | 2958039525 | 307 |
| 772 | iso_pu_bacteria | 2958041894 | 2958052846 | 307 |
| 773 | iso_pu_bacteria | 2958071322 | 2958075568 | 307 |
| 774 | iso_pu_bacteria | 2958084443 | 2958088357 | 307 |
| 775 | iso_pu_bacteria | 2958092219 | 2958093958 | 307 |
| 776 | iso_pu_bacteria | 2958122699 | 2958128415 | 307 |
| 777 | iso_pu_bacteria | 2958158011 | 2958160865 | 307 |
| 778 | iso_pu_bacteria | 2961136820 | 2961141463 | 307 |
| 779 | iso_pu_bacteria | 2961183825 | 2961186198 | 307 |
| 780 | iso_pu_bacteria | 2963644680 | 2963648175 | 307 |
| 781 | iso_pu_bacteria | 2965025482 | 2965027407 | 307 |
| 782 | iso_pu_bacteria | 2965032056 | 2965035066 | 307 |
| 783 | iso_pu_bacteria | 2965040258 | 2965044059 | 307 |
| 784 | iso_pu_bacteria | 2965047637 | 2965048479 | 307 |
| 785 | iso_pu_bacteria | 2965089291 | 2965089913 | 307 |
| 786 | iso_pu_bacteria | 2965110997 | 2965113097 | 307 |
| 787 | iso_pu_bacteria | 2968016561 | 2968020852 | 307 |
| 788 | iso_pu_bacteria | 2968083720 | 2968090998 | 307 |
| 789 | iso_pu_bacteria | 2968138860 | 2968138882 | 307 |
| 790 | iso_pu_bacteria | 2970469710 | 2970474149 | 307 |
| 791 | iso_pu_bacteria | 2970489779 | 2970491807 | 307 |
| 792 | iso_pu_bacteria | 2970510686 | 2970511014 | 307 |
| 793 | iso_pu_bacteria | 2970524798 | 2970531012 | 307 |
| 794 | iso_pu_bacteria | 2970532167 | 2970534646 | 307 |
| 795 | iso_pu_bacteria | 2970540015 | 2970543277 | 307 |
| 796 | iso_pu_bacteria | 2970547951 | 2970549662 | 307 |
| 797 | iso_pu_bacteria | 2970593180 | 2970597351 | 307 |
| 798 | iso_pu_bacteria | 2977851361 | 2977855592 | 307 |
| 799 | iso_pu_bacteria | 2977872689 | 2977879930 | 307 |
| 800 | iso_pu_bacteria | 2977915119 | 2977919161 | 307 |
| 801 | iso_pu_bacteria | 2977922695 | 2977929301 | 307 |
| 802 | iso_pu_bacteria | 2977935797 | 2977937375 | 307 |
| 803 | iso_pu_bacteria | 2977950692 | 2977951209 | 307 |
| 804 | iso_pu_bacteria | 2977986579 | 2977992782 | 307 |
| 805 | iso_pu_bacteria | 2979764755 | 2979767294 | 307 |
| 806 | iso_pu_bacteria | 2979772303 | 2979774161 | 307 |
| 807 | iso_pu_bacteria | 2987645492 | 2987650623 | 307 |
| 808 | iso_pu_bacteria | 2987673487 | 2987676148 | 307 |
| 809 | iso_pu_bacteria | 2996348954 | 2996352530 | 307 |
| 810 | iso_pu_bacteria | 2996386984 | 2996391183 | 307 |
| 811 | iso_pu_bacteria | 3004167301 | 3004171589 | 307 |
| 812 | iso_pu_bacteria | 3004195979 | 3004196951 | 307 |
| 813 | iso_pu_bacteria | 3004211236 | 3004211843 | 307 |
| 814 | iso_pu_bacteria | 3004218560 | 3004219090 | 307 |
| 815 | iso_pu_bacteria | 3004232784 | 3004234454 | 307 |
| 816 | iso_pu_bacteria | 3004248173 | 3004251203 | 307 |
| 817 | iso_pu_bacteria | 3004268573 | 3004270201 | 307 |
| 818 | iso_pu_bacteria | 3004275668 | 3004279212 | 307 |
| 819 | iso_pu_bacteria | 3004289098 | 3004293305 | 307 |
| 820 | iso_pu_bacteria | 3004334049 | 3004341216 | 307 |
| 821 | iso_pu_bacteria | 637000159 | 637074152 | 307 |
| 822 | iso_pu_bacteria | 649633066 | 649875154 | 307 |
| 823 | iso_pu_bacteria | 8004300914 | 8004307038 | 307 |
| 824 | iso_pu_bacteria | 8004312739 | 8004315691 | 307 |
| 825 | iso_pu_bacteria | 8004361976 | 8004366193 | 307 |
| 826 | iso_pu_bacteria | 8004633249 | 8004635270 | 307 |
| 827 | iso_pu_bacteria | 8004640170 | 8004640300 | 307 |
| 828 | iso_pu_bacteria | 8004727605 | 8004728263 | 307 |
| 829 | iso_pu_bacteria | 8055617313 | 8055623817 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e49-assembly1.cif.gz_D | crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution | 0.9939 | 3 | 307 |
| 3e02-assembly1.cif.gz_A | crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution | 0.9917 | 3 | 307 |
| 3lot-assembly1.cif.gz_C | crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution | 0.9876 | 3 | 307 |
| 3e02-assembly1.cif.gz_A | crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution | 0.9821 | 3 | 307 |
| 3lot-assembly1.cif.gz_C | crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution | 0.9781 | 3 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9914 | 3 | 307 | 3.20.20.70 |
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9815 | 3 | 307 | 3.20.20.70 |
| af_P71976_1_271_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9754 | 3 | 301 | 3.20.20.70 |
| af_P71976_1_271_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9648 | 3 | 301 | 3.20.20.70 |
| 2y7dC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.956 | 3 | 298 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530BE36-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9994 | 78 | 252 |
GO:0043720
GO:0046872 |
| AF-A0A357CK18-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9979 | 15 | 91 |
GO:0043720
GO:0046872 |
| AF-A0A528TNE6-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9976 | 42 | 188 |
GO:0043720
GO:0046872 |
| AF-A0A434H308-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9974 | 4 | 307 |
GO:0043720
GO:0046872 |
| AF-A0A527I4L6-F1-model_v4 | deleted | 0.9974 | 45 | 226 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar