F482578
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 412 | 1656 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_000127|Ga0500643_000127_56299_56790 |
| Length | 163 |
| Sequence | VFLGTYLPRLDDKSRLILPAKFRDELAGGLVITKGREHCLSVYTQETFLASAAELQARLRAAADGPDKARLRAQEREFSASASDEVPDRQGRITVPGELRRYAGIDRNVVVTGILDRLEIWDVDVYRRYQAKSEAAFAEDDDWIAPDPVDRAPAAVEEDQPDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 192 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 206 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 225 | 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Metagenome | Unclassified |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 250 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 251 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 252 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 261 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 266 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 271 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 272 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 273 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 274 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 275 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 276 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 404 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 405 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 406 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 407 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 408 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 409 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 410 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 411 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 412 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.77 |
| Metatranscriptomes | 10.02 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0.24 |
| Rhizoplane | 3.26 |
| Rhizosphere | 92.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500643_000127 | 3300053087 | Bacteria | 78546 |
| 2 | LJQas_1013284 | 3300000549 | Bacteria | 969 |
| 3 | JGI24743J22301_10061232 | 3300001991 | Bacteria | 776 |
| 4 | JGI24033J26618_1023625 | 3300002155 | Bacteria | 800 |
| 5 | JGI24751J29686_10053746 | 3300002459 | Bacteria | 830 |
| 6 | JGI25405J52794_10023957 | 3300003911 | Bacteria | 1244 |
| 7 | Ga0058863_10003683 | 3300004799 | Bacteria | 658 |
| 8 | Ga0058861_10022460 | 3300004800 | Bacteria | 650 |
| 9 | Ga0058861_10057497 | 3300004800 | Bacteria | 861 |
| 10 | Ga0058861_11822019 | 3300004800 | Bacteria | 705 |
| 11 | Ga0058862_10024687 | 3300004803 | Bacteria | 765 |
| 12 | Ga0058862_10151194 | 3300004803 | Bacteria | 868 |
| 13 | Ga0058862_11010846 | 3300004803 | Bacteria | 633 |
| 14 | Ga0058862_12004185 | 3300004803 | Bacteria | 608 |
| 15 | Ga0070658_10001791 | 3300005327 | Bacteria | 18063 |
| 16 | Ga0070658_10650125 | 3300005327 | Bacteria | 915 |
| 17 | Ga0070676_10066824 | 3300005328 | Bacteria | 2148 |
| 18 | Ga0070683_100234000 | 3300005329 | Bacteria | 1747 |
| 19 | Ga0070683_100356721 | 3300005329 | Bacteria | 1392 |
| 20 | Ga0070690_100471266 | 3300005330 | Bacteria | 934 |
| 21 | Ga0070670_100231426 | 3300005331 | Bacteria | 1608 |
| 22 | Ga0070677_10125079 | 3300005333 | Bacteria | 1166 |
| 23 | Ga0068869_100061998 | 3300005334 | Bacteria | 2744 |
| 24 | Ga0070680_100113750 | 3300005336 | Bacteria | 2254 |
| 25 | Ga0070680_100339182 | 3300005336 | Bacteria | 1277 |
| 26 | Ga0070680_100977900 | 3300005336 | Bacteria | 731 |
| 27 | Ga0070682_100022244 | 3300005337 | Bacteria | 3753 |
| 28 | Ga0068868_100047275 | 3300005338 | Bacteria | 3371 |
| 29 | Ga0068868_100081564 | 3300005338 | Bacteria | 2593 |
| 30 | Ga0070691_10027814 | 3300005341 | Bacteria | 2639 |
| 31 | Ga0070691_10241228 | 3300005341 | Bacteria | 966 |
| 32 | Ga0070661_100246882 | 3300005344 | Bacteria | 1376 |
| 33 | Ga0070692_10012144 | 3300005345 | Bacteria | 3975 |
| 34 | Ga0070668_100757265 | 3300005347 | Bacteria | 860 |
| 35 | Ga0070675_100095022 | 3300005354 | Bacteria | 2502 |
| 36 | Ga0070671_100191274 | 3300005355 | Bacteria | 1734 |
| 37 | Ga0070673_100370209 | 3300005364 | Bacteria | 1276 |
| 38 | Ga0070673_100506946 | 3300005364 | Bacteria | 1092 |
| 39 | Ga0070688_100011303 | 3300005365 | Bacteria | 4959 |
| 40 | Ga0070659_100280324 | 3300005366 | Bacteria | 1386 |
| 41 | Ga0070659_100312975 | 3300005366 | Bacteria | 1311 |
| 42 | Ga0070667_100461799 | 3300005367 | Bacteria | 1161 |
| 43 | Ga0070709_10000132 | 3300005434 | Bacteria | 49598 |
| 44 | Ga0070709_10011218 | 3300005434 | Bacteria | 4985 |
| 45 | Ga0070709_10015898 | 3300005434 | Bacteria | 4286 |
| 46 | Ga0070709_10024697 | 3300005434 | Bacteria | 3540 |
| 47 | Ga0070709_10057263 | 3300005434 | Bacteria | 2468 |
| 48 | Ga0070709_10172670 | 3300005434 | Bacteria | 1512 |
| 49 | Ga0070709_10992509 | 3300005434 | Bacteria | 668 |
| 50 | Ga0070714_100000290 | 3300005435 | Bacteria | 38379 |
| 51 | Ga0070714_100001047 | 3300005435 | Bacteria | 19734 |
| 52 | Ga0070714_100017866 | 3300005435 | Bacteria | 5751 |
| 53 | Ga0070714_100034845 | 3300005435 | Bacteria | 4216 |
| 54 | Ga0070714_100069282 | 3300005435 | Bacteria | 3046 |
| 55 | Ga0070714_100087914 | 3300005435 | Bacteria | 2718 |
| 56 | Ga0070714_100433439 | 3300005435 | Bacteria | 1247 |
| 57 | Ga0070714_100437033 | 3300005435 | Bacteria | 1241 |
| 58 | Ga0070714_100579005 | 3300005435 | Bacteria | 1077 |
| 59 | Ga0070714_101401460 | 3300005435 | Bacteria | 682 |
| 60 | Ga0070713_100000696 | 3300005436 | Bacteria | 21617 |
| 61 | Ga0070713_100003571 | 3300005436 | Bacteria | 10274 |
| 62 | Ga0070713_100011260 | 3300005436 | Bacteria | 6506 |
| 63 | Ga0070713_100033062 | 3300005436 | Bacteria | 4140 |
| 64 | Ga0070713_100058884 | 3300005436 | Bacteria | 3205 |
| 65 | Ga0070713_100082795 | 3300005436 | Bacteria | 2741 |
| 66 | Ga0070713_100172641 | 3300005436 | Bacteria | 1938 |
| 67 | Ga0070713_100320495 | 3300005436 | Bacteria | 1431 |
| 68 | Ga0070713_100614335 | 3300005436 | Bacteria | 1033 |
| 69 | Ga0070713_100630983 | 3300005436 | Bacteria | 1019 |
| 70 | Ga0070710_10001105 | 3300005437 | Bacteria | 12767 |
| 71 | Ga0070710_10005739 | 3300005437 | Bacteria | 5911 |
| 72 | Ga0070710_10009941 | 3300005437 | Bacteria | 4664 |
| 73 | Ga0070710_10114743 | 3300005437 | Bacteria | 1623 |
| 74 | Ga0070710_10250329 | 3300005437 | Bacteria | 1139 |
| 75 | Ga0070710_10782585 | 3300005437 | Bacteria | 680 |
| 76 | Ga0070701_10018729 | 3300005438 | Bacteria | 3258 |
| 77 | Ga0070711_100017156 | 3300005439 | Bacteria | 4607 |
| 78 | Ga0070711_100340989 | 3300005439 | Bacteria | 1202 |
| 79 | Ga0070711_100452922 | 3300005439 | Bacteria | 1051 |
| 80 | Ga0070705_100046994 | 3300005440 | Bacteria | 2492 |
| 81 | Ga0070700_100081141 | 3300005441 | Bacteria | 2095 |
| 82 | Ga0070694_101192738 | 3300005444 | Bacteria | 638 |
| 83 | Ga0070708_100045744 | 3300005445 | Bacteria | 3858 |
| 84 | Ga0070708_100439328 | 3300005445 | Bacteria | 1231 |
| 85 | Ga0070708_101009980 | 3300005445 | Bacteria | 780 |
| 86 | Ga0070663_100003030 | 3300005455 | Bacteria | 9596 |
| 87 | Ga0070663_100548016 | 3300005455 | Bacteria | 966 |
| 88 | Ga0070678_100778004 | 3300005456 | Bacteria | 867 |
| 89 | Ga0070681_10184721 | 3300005458 | Bacteria | 2006 |
| 90 | Ga0070681_10430509 | 3300005458 | Bacteria | 1231 |
| 91 | Ga0070681_11772525 | 3300005458 | Bacteria | 544 |
| 92 | Ga0068867_100995728 | 3300005459 | Bacteria | 760 |
| 93 | Ga0070685_10020070 | 3300005466 | Bacteria | 3614 |
| 94 | Ga0070706_100003733 | 3300005467 | Bacteria | 14884 |
| 95 | Ga0070706_100109139 | 3300005467 | Bacteria | 2575 |
| 96 | Ga0070706_100462386 | 3300005467 | Bacteria | 1180 |
| 97 | Ga0070707_100382565 | 3300005468 | Bacteria | 1367 |
| 98 | Ga0070707_100709054 | 3300005468 | Bacteria | 969 |
| 99 | Ga0070698_100000354 | 3300005471 | Bacteria | 47476 |
| 100 | Ga0070698_100021520 | 3300005471 | Bacteria | 6755 |
| 101 | Ga0070679_100099789 | 3300005530 | Bacteria | 2890 |
| 102 | Ga0070679_100116027 | 3300005530 | Bacteria | 2662 |
| 103 | Ga0070679_100263019 | 3300005530 | Bacteria | 1680 |
| 104 | Ga0070679_100320162 | 3300005530 | Bacteria | 1500 |
| 105 | Ga0070679_100676505 | 3300005530 | Bacteria | 975 |
| 106 | Ga0070679_101986266 | 3300005530 | Bacteria | 531 |
| 107 | Ga0070684_100126029 | 3300005535 | Bacteria | 2307 |
| 108 | Ga0070684_100960364 | 3300005535 | Bacteria | 802 |
| 109 | Ga0070672_100679274 | 3300005543 | Bacteria | 901 |
| 110 | Ga0070686_100302162 | 3300005544 | Bacteria | 1187 |
| 111 | Ga0070695_100539247 | 3300005545 | Bacteria | 908 |
| 112 | Ga0070695_101047610 | 3300005545 | Bacteria | 665 |
| 113 | Ga0070696_101656050 | 3300005546 | Bacteria | 551 |
| 114 | Ga0070693_100004054 | 3300005547 | Bacteria | 6894 |
| 115 | Ga0070665_100136172 | 3300005548 | Bacteria | 2459 |
| 116 | Ga0070665_100201330 | 3300005548 | Bacteria | 1992 |
| 117 | Ga0070704_100185393 | 3300005549 | Bacteria | 1668 |
| 118 | Ga0070704_100408796 | 3300005549 | Bacteria | 1160 |
| 119 | Ga0068855_100019122 | 3300005563 | Bacteria | 8231 |
| 120 | Ga0068855_100053197 | 3300005563 | Bacteria | 4765 |
| 121 | Ga0068855_100484173 | 3300005563 | Bacteria | 1346 |
| 122 | Ga0068855_102199985 | 3300005563 | Bacteria | 554 |
| 123 | Ga0070664_100263569 | 3300005564 | Bacteria | 1551 |
| 124 | Ga0068857_100738373 | 3300005577 | Bacteria | 937 |
| 125 | Ga0068857_100950433 | 3300005577 | Bacteria | 826 |
| 126 | Ga0068854_100102269 | 3300005578 | Bacteria | 2150 |
| 127 | Ga0068856_100001364 | 3300005614 | Bacteria | 25676 |
| 128 | Ga0068856_100024135 | 3300005614 | Bacteria | 5917 |
| 129 | Ga0068856_100109542 | 3300005614 | Bacteria | 2758 |
| 130 | Ga0068856_100482513 | 3300005614 | Bacteria | 1261 |
| 131 | Ga0070702_100010326 | 3300005615 | Bacteria | 4593 |
| 132 | Ga0068852_101114471 | 3300005616 | Bacteria | 809 |
| 133 | Ga0068859_100062471 | 3300005617 | Bacteria | 3755 |
| 134 | Ga0068864_100717789 | 3300005618 | Bacteria | 977 |
| 135 | Ga0068861_102237271 | 3300005719 | Bacteria | 548 |
| 136 | Ga0068851_10010718 | 3300005834 | Bacteria | 4283 |
| 137 | Ga0068870_10044947 | 3300005840 | Bacteria | 2310 |
| 138 | Ga0068870_10471284 | 3300005840 | Bacteria | 831 |
| 139 | Ga0068863_100196808 | 3300005841 | Bacteria | 1937 |
| 140 | Ga0068858_100064792 | 3300005842 | Bacteria | 3382 |
| 141 | Ga0068858_100079457 | 3300005842 | Bacteria | 3048 |
| 142 | Ga0068860_100081053 | 3300005843 | Bacteria | 3086 |
| 143 | Ga0068860_100679330 | 3300005843 | Bacteria | 1039 |
| 144 | Ga0068862_101108925 | 3300005844 | Bacteria | 787 |
| 145 | Ga0081455_10000128 | 3300005937 | Bacteria | 88444 |
| 146 | Ga0081455_10006978 | 3300005937 | Bacteria | 12003 |
| 147 | Ga0081538_10001888 | 3300005981 | Bacteria | 21088 |
| 148 | Ga0081538_10014035 | 3300005981 | Bacteria | 6298 |
| 149 | Ga0081540_1001223 | 3300005983 | Bacteria | 22441 |
| 150 | Ga0081540_1056794 | 3300005983 | Bacteria | 1897 |
| 151 | Ga0081540_1087893 | 3300005983 | Bacteria | 1376 |
| 152 | Ga0081539_10152964 | 3300005985 | Bacteria | 1108 |
| 153 | Ga0070717_10016338 | 3300006028 | Bacteria | 5753 |
| 154 | Ga0070717_10023113 | 3300006028 | Bacteria | 4922 |
| 155 | Ga0070717_10024558 | 3300006028 | Bacteria | 4788 |
| 156 | Ga0070717_10074698 | 3300006028 | Bacteria | 2834 |
| 157 | Ga0070717_10253439 | 3300006028 | Bacteria | 1555 |
| 158 | Ga0070717_10276875 | 3300006028 | Bacteria | 1487 |
| 159 | Ga0070717_10459271 | 3300006028 | Bacteria | 1148 |
| 160 | Ga0070717_10464770 | 3300006028 | Bacteria | 1141 |
| 161 | Ga0070717_10524628 | 3300006028 | Bacteria | 1071 |
| 162 | Ga0075432_10298202 | 3300006058 | Bacteria | 668 |
| 163 | Ga0070715_10021861 | 3300006163 | Bacteria | 2486 |
| 164 | Ga0070715_10032780 | 3300006163 | Bacteria | 2119 |
| 165 | Ga0070715_10353800 | 3300006163 | Bacteria | 803 |
| 166 | Ga0070716_100000088 | 3300006173 | Bacteria | 36109 |
| 167 | Ga0070716_100001767 | 3300006173 | Bacteria | 9771 |
| 168 | Ga0070716_100405165 | 3300006173 | Bacteria | 982 |
| 169 | Ga0070716_100719858 | 3300006173 | Bacteria | 764 |
| 170 | Ga0070712_100000796 | 3300006175 | Bacteria | 18678 |
| 171 | Ga0070712_100034900 | 3300006175 | Bacteria | 3411 |
| 172 | Ga0070712_100039248 | 3300006175 | Bacteria | 3240 |
| 173 | Ga0070712_100130155 | 3300006175 | Bacteria | 1906 |
| 174 | Ga0070712_100346477 | 3300006175 | Bacteria | 1215 |
| 175 | Ga0070712_100355226 | 3300006175 | Bacteria | 1200 |
| 176 | Ga0097621_100023467 | 3300006237 | Bacteria | 4803 |
| 177 | Ga0097621_100355141 | 3300006237 | Unclassified | 1304 |
| 178 | Ga0097621_100585479 | 3300006237 | Bacteria | 1018 |
| 179 | Ga0068871_100064130 | 3300006358 | Bacteria | 3007 |
| 180 | Ga0068871_100211229 | 3300006358 | Bacteria | 1678 |
| 181 | Ga0068871_100601052 | 3300006358 | Bacteria | 1000 |
| 182 | Ga0075428_100005771 | 3300006844 | Bacteria | 13745 |
| 183 | Ga0075428_100527052 | 3300006844 | Bacteria | 1263 |
| 184 | Ga0075428_100534086 | 3300006844 | Bacteria | 1254 |
| 185 | Ga0075430_100024721 | 3300006846 | Bacteria | 5110 |
| 186 | Ga0075430_100920719 | 3300006846 | Bacteria | 720 |
| 187 | Ga0075431_100037096 | 3300006847 | Bacteria | 5022 |
| 188 | Ga0075431_100064702 | 3300006847 | Bacteria | 3776 |
| 189 | Ga0075433_10002154 | 3300006852 | Bacteria | 14918 |
| 190 | Ga0075433_10082334 | 3300006852 | Bacteria | 2838 |
| 191 | Ga0075433_10297209 | 3300006852 | Bacteria | 1430 |
| 192 | Ga0075434_100002741 | 3300006871 | Bacteria | 15572 |
| 193 | Ga0075429_100001979 | 3300006880 | Bacteria | 17031 |
| 194 | Ga0075429_100212067 | 3300006880 | Bacteria | 1697 |
| 195 | Ga0075436_100001784 | 3300006914 | Bacteria | 14746 |
| 196 | Ga0075436_100030847 | 3300006914 | Bacteria | 3689 |
| 197 | Ga0097620_100062470 | 3300006931 | Bacteria | 3755 |
| 198 | Ga0075435_100032515 | 3300007076 | Bacteria | 4120 |
| 199 | Ga0075435_101145379 | 3300007076 | Bacteria | 680 |
| 200 | Ga0075435_101236816 | 3300007076 | Bacteria | 653 |
| 201 | Ga0105251_10054389 | 3300009011 | Bacteria | 1901 |
| 202 | Ga0105240_10003563 | 3300009093 | Bacteria | 24152 |
| 203 | Ga0105240_10251875 | 3300009093 | Bacteria | 2042 |
| 204 | Ga0105240_10708553 | 3300009093 | Bacteria | 1098 |
| 205 | Ga0111539_10006043 | 3300009094 | Bacteria | 15633 |
| 206 | Ga0111539_10253633 | 3300009094 | Bacteria | 2048 |
| 207 | Ga0105245_10101474 | 3300009098 | Bacteria | 2664 |
| 208 | Ga0105247_10039895 | 3300009101 | Bacteria | 2869 |
| 209 | Ga0114129_10002252 | 3300009147 | Bacteria | 26655 |
| 210 | Ga0114129_10008519 | 3300009147 | Bacteria | 14616 |
| 211 | Ga0114129_10218138 | 3300009147 | Bacteria | 2575 |
| 212 | Ga0105243_10240133 | 3300009148 | Bacteria | 1612 |
| 213 | Ga0105241_10004090 | 3300009174 | Bacteria | 10780 |
| 214 | Ga0105241_10061597 | 3300009174 | Bacteria | 2890 |
| 215 | Ga0105241_10344095 | 3300009174 | Bacteria | 1293 |
| 216 | Ga0105248_10656425 | 3300009177 | Bacteria | 1183 |
| 217 | Ga0105248_11582736 | 3300009177 | Bacteria | 742 |
| 218 | Ga0105237_10242007 | 3300009545 | Bacteria | 1805 |
| 219 | Ga0105237_11009983 | 3300009545 | Bacteria | 839 |
| 220 | Ga0105238_10108171 | 3300009551 | Bacteria | 2761 |
| 221 | Ga0105238_10538083 | 3300009551 | Bacteria | 1172 |
| 222 | Ga0105238_10930257 | 3300009551 | Bacteria | 888 |
| 223 | Ga0105249_11004008 | 3300009553 | Bacteria | 903 |
| 224 | Ga0099796_10429247 | 3300010159 | Bacteria | 584 |
| 225 | Ga0105239_10215638 | 3300010375 | Bacteria | 2152 |
| 226 | Ga0105239_11044741 | 3300010375 | Bacteria | 940 |
| 227 | Ga0105239_11436469 | 3300010375 | Bacteria | 797 |
| 228 | Ga0105246_10028661 | 3300011119 | Bacteria | 3660 |
| 229 | Ga0105246_10031827 | 3300011119 | Bacteria | 3493 |
| 230 | Ga0154010_158913 | 3300013062 | Bacteria | 667 |
| 231 | Ga0157370_10006131 | 3300013104 | Bacteria | 13341 |
| 232 | Ga0157369_10091142 | 3300013105 | Bacteria | 3254 |
| 233 | Ga0157369_10109792 | 3300013105 | Bacteria | 2932 |
| 234 | Ga0157369_11967129 | 3300013105 | Bacteria | 593 |
| 235 | Ga0157374_10027064 | 3300013296 | Bacteria | 5167 |
| 236 | Ga0157374_10128896 | 3300013296 | Bacteria | 2447 |
| 237 | Ga0157374_10215911 | 3300013296 | Bacteria | 1881 |
| 238 | Ga0163162_10026734 | 3300013306 | Bacteria | 5706 |
| 239 | Ga0163162_10551593 | 3300013306 | Bacteria | 1281 |
| 240 | Ga0157372_10028155 | 3300013307 | Bacteria | 6130 |
| 241 | Ga0157372_10266181 | 3300013307 | Bacteria | 1991 |
| 242 | Ga0157372_10871921 | 3300013307 | Bacteria | 1045 |
| 243 | Ga0157375_10582005 | 3300013308 | Bacteria | 1280 |
| 244 | Ga0163163_10501639 | 3300014325 | Bacteria | 1275 |
| 245 | Ga0163163_10526492 | 3300014325 | Bacteria | 1244 |
| 246 | Ga0163163_11429521 | 3300014325 | Bacteria | 753 |
| 247 | Ga0182008_10093035 | 3300014497 | Bacteria | 1487 |
| 248 | Ga0157377_10001915 | 3300014745 | Bacteria | 9110 |
| 249 | Ga0157377_10816367 | 3300014745 | Bacteria | 689 |
| 250 | Ga0157379_10020127 | 3300014968 | Bacteria | 5898 |
| 251 | Ga0157376_10008666 | 3300014969 | Bacteria | 7352 |
| 252 | Ga0157376_11296491 | 3300014969 | Bacteria | 758 |
| 253 | Ga0184601_114265 | 3300019183 | Bacteria | 579 |
| 254 | Ga0184600_116695 | 3300019190 | Bacteria | 611 |
| 255 | Ga0197907_10230096 | 3300020069 | Bacteria | 807 |
| 256 | Ga0197907_10862593 | 3300020069 | Bacteria | 563 |
| 257 | Ga0206356_10083947 | 3300020070 | Bacteria | 3290 |
| 258 | Ga0206356_10565981 | 3300020070 | Bacteria | 569 |
| 259 | Ga0206356_10969686 | 3300020070 | Bacteria | 1293 |
| 260 | Ga0206349_1228606 | 3300020075 | Bacteria | 998 |
| 261 | Ga0206349_1321091 | 3300020075 | Bacteria | 676 |
| 262 | Ga0206349_1514218 | 3300020075 | Bacteria | 1172 |
| 263 | Ga0206355_1462003 | 3300020076 | Bacteria | 699 |
| 264 | Ga0206355_1650148 | 3300020076 | Bacteria | 678 |
| 265 | Ga0206355_1705157 | 3300020076 | Bacteria | 649 |
| 266 | Ga0206351_10165417 | 3300020077 | Bacteria | 625 |
| 267 | Ga0206351_10815914 | 3300020077 | Bacteria | 830 |
| 268 | Ga0206352_10036563 | 3300020078 | Bacteria | 669 |
| 269 | Ga0206352_10310989 | 3300020078 | Bacteria | 1107 |
| 270 | Ga0206352_10834661 | 3300020078 | Bacteria | 558 |
| 271 | Ga0206350_10273622 | 3300020080 | Bacteria | 688 |
| 272 | Ga0206350_10584984 | 3300020080 | Bacteria | 635 |
| 273 | Ga0206350_10787066 | 3300020080 | Bacteria | 562 |
| 274 | Ga0206350_11162888 | 3300020080 | Bacteria | 528 |
| 275 | Ga0206350_11357921 | 3300020080 | Bacteria | 881 |
| 276 | Ga0206354_10140459 | 3300020081 | Bacteria | 769 |
| 277 | Ga0206354_11022824 | 3300020081 | Bacteria | 560 |
| 278 | Ga0206353_10120679 | 3300020082 | Bacteria | 626 |
| 279 | Ga0206353_10397058 | 3300020082 | Bacteria | 515 |
| 280 | Ga0154015_1056023 | 3300020610 | Bacteria | 639 |
| 281 | Ga0154015_1214535 | 3300020610 | Bacteria | 656 |
| 282 | Ga0154015_1223142 | 3300020610 | Bacteria | 600 |
| 283 | Ga0154015_1271578 | 3300020610 | Bacteria | 669 |
| 284 | Ga0213875_10002941 | 3300021388 | Bacteria | 9926 |
| 285 | Ga0224712_10007480 | 3300022467 | Bacteria | 3183 |
| 286 | Ga0224712_10444849 | 3300022467 | Bacteria | 622 |
| 287 | Ga0224712_10563885 | 3300022467 | Bacteria | 554 |
| 288 | Ga0224712_10658432 | 3300022467 | Bacteria | 514 |
| 289 | Ga0256720_121953 | 3300023438 | Bacteria | 553 |
| 290 | Ga0224572_1005428 | 3300024225 | Bacteria | 2272 |
| 291 | Ga0207692_10000891 | 3300025898 | Bacteria | 10795 |
| 292 | Ga0207692_10002245 | 3300025898 | Bacteria | 7392 |
| 293 | Ga0207692_10055424 | 3300025898 | Bacteria | 2029 |
| 294 | Ga0207692_10086698 | 3300025898 | Bacteria | 1687 |
| 295 | Ga0207692_10177937 | 3300025898 | Bacteria | 1237 |
| 296 | Ga0207692_10470833 | 3300025898 | Bacteria | 794 |
| 297 | Ga0207688_10044815 | 3300025901 | Bacteria | 2465 |
| 298 | Ga0207647_10101992 | 3300025904 | Bacteria | 1702 |
| 299 | Ga0207685_10075549 | 3300025905 | Bacteria | 1379 |
| 300 | Ga0207685_10128070 | 3300025905 | Bacteria | 1123 |
| 301 | Ga0207699_10000165 | 3300025906 | Bacteria | 40682 |
| 302 | Ga0207699_10001689 | 3300025906 | Bacteria | 10442 |
| 303 | Ga0207699_10082244 | 3300025906 | Bacteria | 2000 |
| 304 | Ga0207699_10183239 | 3300025906 | Bacteria | 1409 |
| 305 | Ga0207699_10322605 | 3300025906 | Bacteria | 1084 |
| 306 | Ga0207699_10549333 | 3300025906 | Bacteria | 838 |
| 307 | Ga0207645_10028105 | 3300025907 | Bacteria | 3632 |
| 308 | Ga0207643_10035728 | 3300025908 | Bacteria | 2787 |
| 309 | Ga0207643_10447635 | 3300025908 | Bacteria | 821 |
| 310 | Ga0207705_10169901 | 3300025909 | Bacteria | 1641 |
| 311 | Ga0207705_10261836 | 3300025909 | Bacteria | 1320 |
| 312 | Ga0207705_10993877 | 3300025909 | Bacteria | 648 |
| 313 | Ga0207684_10132377 | 3300025910 | Bacteria | 2140 |
| 314 | Ga0207684_10240698 | 3300025910 | Bacteria | 1561 |
| 315 | Ga0207654_10014200 | 3300025911 | Bacteria | 4112 |
| 316 | Ga0207654_10031882 | 3300025911 | Bacteria | 2907 |
| 317 | Ga0207707_10422298 | 3300025912 | Bacteria | 1143 |
| 318 | Ga0207707_11017371 | 3300025912 | Bacteria | 679 |
| 319 | Ga0207695_10050307 | 3300025913 | Bacteria | 4385 |
| 320 | Ga0207695_10481201 | 3300025913 | Bacteria | 1124 |
| 321 | Ga0207695_10565236 | 3300025913 | Bacteria | 1019 |
| 322 | Ga0207671_10295660 | 3300025914 | Bacteria | 1279 |
| 323 | Ga0207693_10000836 | 3300025915 | Bacteria | 27414 |
| 324 | Ga0207693_10081949 | 3300025915 | Bacteria | 2526 |
| 325 | Ga0207693_10133919 | 3300025915 | Bacteria | 1948 |
| 326 | Ga0207693_10135726 | 3300025915 | Bacteria | 1934 |
| 327 | Ga0207693_10294799 | 3300025915 | Bacteria | 1271 |
| 328 | Ga0207693_10297108 | 3300025915 | Bacteria | 1265 |
| 329 | Ga0207663_10005552 | 3300025916 | Bacteria | 6366 |
| 330 | Ga0207663_10021183 | 3300025916 | Bacteria | 3697 |
| 331 | Ga0207663_10027678 | 3300025916 | Bacteria | 3308 |
| 332 | Ga0207663_10199847 | 3300025916 | Bacteria | 1441 |
| 333 | Ga0207663_10897077 | 3300025916 | Bacteria | 709 |
| 334 | Ga0207660_10096989 | 3300025917 | Bacteria | 2196 |
| 335 | Ga0207660_11006275 | 3300025917 | Bacteria | 680 |
| 336 | Ga0207657_10009363 | 3300025919 | Bacteria | 9851 |
| 337 | Ga0207657_10134398 | 3300025919 | Bacteria | 2025 |
| 338 | Ga0207657_10985597 | 3300025919 | Bacteria | 647 |
| 339 | Ga0207649_10530871 | 3300025920 | Bacteria | 898 |
| 340 | Ga0207649_11197249 | 3300025920 | Bacteria | 600 |
| 341 | Ga0207652_10065455 | 3300025921 | Bacteria | 3148 |
| 342 | Ga0207652_10124386 | 3300025921 | Bacteria | 2297 |
| 343 | Ga0207652_10570322 | 3300025921 | Bacteria | 1016 |
| 344 | Ga0207652_11184831 | 3300025921 | Bacteria | 665 |
| 345 | Ga0207646_10774239 | 3300025922 | Bacteria | 856 |
| 346 | Ga0207681_11202526 | 3300025923 | Bacteria | 637 |
| 347 | Ga0207694_10273727 | 3300025924 | Bacteria | 1385 |
| 348 | Ga0207650_10740963 | 3300025925 | Bacteria | 831 |
| 349 | Ga0207659_10109494 | 3300025926 | Bacteria | 2097 |
| 350 | Ga0207687_10028797 | 3300025927 | Bacteria | 3732 |
| 351 | Ga0207700_10000297 | 3300025928 | Bacteria | 29514 |
| 352 | Ga0207700_10010224 | 3300025928 | Bacteria | 5906 |
| 353 | Ga0207700_10017378 | 3300025928 | Bacteria | 4804 |
| 354 | Ga0207700_10028955 | 3300025928 | Bacteria | 3903 |
| 355 | Ga0207700_10070358 | 3300025928 | Bacteria | 2689 |
| 356 | Ga0207700_10104397 | 3300025928 | Bacteria | 2267 |
| 357 | Ga0207700_10180715 | 3300025928 | Bacteria | 1766 |
| 358 | Ga0207664_10000224 | 3300025929 | Bacteria | 42785 |
| 359 | Ga0207664_10006027 | 3300025929 | Bacteria | 8298 |
| 360 | Ga0207664_10009651 | 3300025929 | Bacteria | 6783 |
| 361 | Ga0207664_10014932 | 3300025929 | Bacteria | 5623 |
| 362 | Ga0207664_10058173 | 3300025929 | Bacteria | 3075 |
| 363 | Ga0207664_10176015 | 3300025929 | Bacteria | 1834 |
| 364 | Ga0207664_10367620 | 3300025929 | Bacteria | 1275 |
| 365 | Ga0207664_10452699 | 3300025929 | Bacteria | 1146 |
| 366 | Ga0207664_10685709 | 3300025929 | Bacteria | 921 |
| 367 | Ga0207644_10079790 | 3300025931 | Bacteria | 2415 |
| 368 | Ga0207690_10492427 | 3300025932 | Bacteria | 991 |
| 369 | Ga0207690_10737970 | 3300025932 | Bacteria | 811 |
| 370 | Ga0207706_10154785 | 3300025933 | Bacteria | 2016 |
| 371 | Ga0207665_10000698 | 3300025939 | Bacteria | 22766 |
| 372 | Ga0207665_10005623 | 3300025939 | Bacteria | 8356 |
| 373 | Ga0207665_10300461 | 3300025939 | Bacteria | 1200 |
| 374 | Ga0207665_11397442 | 3300025939 | Bacteria | 557 |
| 375 | Ga0207691_10141982 | 3300025940 | Bacteria | 2116 |
| 376 | Ga0207711_10286352 | 3300025941 | Bacteria | 1518 |
| 377 | Ga0207661_10002395 | 3300025944 | Bacteria | 12912 |
| 378 | Ga0207661_10300974 | 3300025944 | Bacteria | 1438 |
| 379 | Ga0207679_10289685 | 3300025945 | Bacteria | 1407 |
| 380 | Ga0207667_10024935 | 3300025949 | Bacteria | 6556 |
| 381 | Ga0207667_10068805 | 3300025949 | Bacteria | 3685 |
| 382 | Ga0207667_10787001 | 3300025949 | Bacteria | 949 |
| 383 | Ga0207667_11286746 | 3300025949 | Bacteria | 708 |
| 384 | Ga0207667_11687128 | 3300025949 | Bacteria | 600 |
| 385 | Ga0207651_10087033 | 3300025960 | Bacteria | 2273 |
| 386 | Ga0207651_10979754 | 3300025960 | Bacteria | 755 |
| 387 | Ga0207712_10529207 | 3300025961 | Bacteria | 1011 |
| 388 | Ga0207677_10070453 | 3300026023 | Bacteria | 2464 |
| 389 | Ga0207703_10032686 | 3300026035 | Bacteria | 4118 |
| 390 | Ga0207703_10102847 | 3300026035 | Bacteria | 2424 |
| 391 | Ga0207639_10398577 | 3300026041 | Bacteria | 1239 |
| 392 | Ga0207639_10824172 | 3300026041 | Bacteria | 865 |
| 393 | Ga0207678_10007707 | 3300026067 | Bacteria | 9510 |
| 394 | Ga0207678_10009072 | 3300026067 | Bacteria | 8757 |
| 395 | Ga0207708_10114430 | 3300026075 | Bacteria | 2097 |
| 396 | Ga0207702_10012351 | 3300026078 | Bacteria | 7109 |
| 397 | Ga0207702_10028083 | 3300026078 | Bacteria | 4675 |
| 398 | Ga0207702_10146497 | 3300026078 | Bacteria | 2143 |
| 399 | Ga0207641_11144090 | 3300026088 | Bacteria | 777 |
| 400 | Ga0207648_11050840 | 3300026089 | Bacteria | 763 |
| 401 | Ga0207676_10002884 | 3300026095 | Bacteria | 12252 |
| 402 | Ga0207674_10030548 | 3300026116 | Bacteria | 5663 |
| 403 | Ga0207674_10106859 | 3300026116 | Bacteria | 2776 |
| 404 | Ga0207674_10299362 | 3300026116 | Bacteria | 1557 |
| 405 | Ga0207674_10757607 | 3300026116 | Bacteria | 937 |
| 406 | Ga0207675_100281140 | 3300026118 | Bacteria | 1617 |
| 407 | Ga0207675_101760697 | 3300026118 | Bacteria | 639 |
| 408 | Ga0207683_10007957 | 3300026121 | Bacteria | 9066 |
| 409 | Ga0207683_10366722 | 3300026121 | Bacteria | 1323 |
| 410 | Ga0207698_10631725 | 3300026142 | Bacteria | 1059 |
| 411 | Ga0207698_10783979 | 3300026142 | Bacteria | 954 |
| 412 | Ga0207698_11227764 | 3300026142 | Bacteria | 764 |
| 413 | Ga0209588_1023459 | 3300027671 | Bacteria | 1944 |
| 414 | Ga0207428_10005504 | 3300027907 | Bacteria | 11799 |
| 415 | Ga0207428_10091244 | 3300027907 | Bacteria | 2365 |
| 416 | Ga0268266_10184805 | 3300028379 | Bacteria | 1900 |
| 417 | Ga0268266_10367152 | 3300028379 | Bacteria | 1355 |
| 418 | Ga0268264_10101885 | 3300028381 | Bacteria | 2497 |
| 419 | Ga0311003_155033 | 3300029282 | Bacteria | 640 |
| 420 | Ga0265762_1020485 | 3300030760 | Bacteria | 1216 |
| 421 | Ga0265767_115009 | 3300030836 | Bacteria | 554 |
| 422 | Ga0265766_1003422 | 3300030863 | Bacteria | 925 |
| 423 | Ga0265766_1004977 | 3300030863 | Bacteria | 829 |
| 424 | Ga0265766_1007092 | 3300030863 | Bacteria | 747 |
| 425 | Ga0265766_1022794 | 3300030863 | Bacteria | 525 |
| 426 | Ga0265766_1026404 | 3300030863 | Bacteria | 501 |
| 427 | Ga0265770_1021530 | 3300030878 | Bacteria | 1026 |
| 428 | Ga0265769_108833 | 3300030888 | Bacteria | 669 |
| 429 | Ga0265768_108041 | 3300030963 | Bacteria | 650 |
| 430 | Ga0265771_1005649 | 3300031010 | Bacteria | 803 |
| 431 | Ga0265325_10008964 | 3300031241 | Bacteria | 5875 |
| 432 | Ga0265340_10021908 | 3300031247 | Bacteria | 3272 |
| 433 | Ga0265339_10320460 | 3300031249 | Bacteria | 735 |
| 434 | Ga0265331_10102826 | 3300031250 | Bacteria | 1314 |
| 435 | Ga0265316_10228723 | 3300031344 | Bacteria | 1370 |
| 436 | Ga0307408_100087740 | 3300031548 | Bacteria | 2341 |
| 437 | Ga0307408_100174573 | 3300031548 | Bacteria | 1718 |
| 438 | Ga0307408_100966294 | 3300031548 | Bacteria | 783 |
| 439 | Ga0310116_123310 | 3300031591 | Bacteria | 501 |
| 440 | Ga0310117_121382 | 3300031592 | Bacteria | 645 |
| 441 | Ga0265313_10119832 | 3300031595 | Bacteria | 1149 |
| 442 | Ga0310103_117113 | 3300031614 | Bacteria | 946 |
| 443 | Ga0307508_10089865 | 3300031616 | Bacteria | 2657 |
| 444 | Ga0265342_10131091 | 3300031712 | Bacteria | 1405 |
| 445 | Ga0316576_10003781 | 3300031727 | Bacteria | 8946 |
| 446 | Ga0316578_10072412 | 3300031728 | Bacteria | 2041 |
| 447 | Ga0307516_10349672 | 3300031730 | Bacteria | 1144 |
| 448 | Ga0307405_10055944 | 3300031731 | Bacteria | 2471 |
| 449 | Ga0307405_10123988 | 3300031731 | Bacteria | 1773 |
| 450 | Ga0307405_10368882 | 3300031731 | Bacteria | 1113 |
| 451 | Ga0307405_10428537 | 3300031731 | Bacteria | 1043 |
| 452 | Ga0307413_10295317 | 3300031824 | Bacteria | 1226 |
| 453 | Ga0307413_10651913 | 3300031824 | Bacteria | 868 |
| 454 | Ga0307410_10092293 | 3300031852 | Bacteria | 2152 |
| 455 | Ga0307410_10321646 | 3300031852 | Bacteria | 1227 |
| 456 | Ga0307410_10518297 | 3300031852 | Bacteria | 983 |
| 457 | Ga0307407_10143727 | 3300031903 | Bacteria | 1542 |
| 458 | Ga0307412_10005940 | 3300031911 | Bacteria | 6882 |
| 459 | Ga0307412_10012266 | 3300031911 | Bacteria | 4990 |
| 460 | Ga0307409_100042992 | 3300031995 | Bacteria | 3388 |
| 461 | Ga0307409_100089454 | 3300031995 | Bacteria | 2517 |
| 462 | Ga0307409_101047558 | 3300031995 | Bacteria | 835 |
| 463 | Ga0307416_100009886 | 3300032002 | Bacteria | 6273 |
| 464 | Ga0307416_100041985 | 3300032002 | Bacteria | 3567 |
| 465 | Ga0307416_100194388 | 3300032002 | Bacteria | 1917 |
| 466 | Ga0307416_100294183 | 3300032002 | Bacteria | 1609 |
| 467 | Ga0307416_101024084 | 3300032002 | Bacteria | 929 |
| 468 | Ga0307411_10346058 | 3300032005 | Bacteria | 1210 |
| 469 | Ga0307411_10473658 | 3300032005 | Bacteria | 1053 |
| 470 | Ga0307411_11842947 | 3300032005 | Bacteria | 562 |
| 471 | Ga0316053_119824 | 3300032120 | Bacteria | 522 |
| 472 | Ga0307415_100169606 | 3300032126 | Bacteria | 1700 |
| 473 | Ga0316212_1020082 | 3300033547 | Bacteria | 938 |
| 474 | Ga0316216_1002509 | 3300033548 | Bacteria | 1308 |
| 475 | Ga0373926_0213826 | 3300035083 | Bacteria | 743 |
| 476 | Ga0373926_0414878 | 3300035083 | Bacteria | 532 |
| 477 | Ga0373928_0265182 | 3300035084 | Bacteria | 516 |
| 478 | Ga0373934_0000337 | 3300035086 | Bacteria | 16404 |
| 479 | Ga0373934_0000541 | 3300035086 | Bacteria | 13316 |
| 480 | Ga0373934_0075731 | 3300035086 | Bacteria | 1349 |
| 481 | Ga0373944_0108617 | 3300035089 | Bacteria | 945 |
| 482 | Ga0373944_0312767 | 3300035089 | Bacteria | 591 |
| 483 | Ga0373949_0085847 | 3300035090 | Bacteria | 845 |
| 484 | Ga0373923_0017622 | 3300035111 | Bacteria | 2734 |
| 485 | Ga0373923_0405023 | 3300035111 | Bacteria | 657 |
| 486 | Ga0373936_0068383 | 3300035113 | Bacteria | 1460 |
| 487 | Ga0373936_0091154 | 3300035113 | Bacteria | 1278 |
| 488 | Ga0373945_0010599 | 3300035116 | Bacteria | 3037 |
| 489 | Ga0373953_0009454 | 3300035117 | Bacteria | 3356 |
| 490 | Ga0373954_0010264 | 3300035118 | Bacteria | 4130 |
| 491 | Ga0373956_0001267 | 3300035119 | Bacteria | 10466 |
| 492 | Ga0373957_0000146 | 3300035120 | Bacteria | 17727 |
| 493 | Ga0373957_0002029 | 3300035120 | Bacteria | 5668 |
| 494 | Ga0373943_0070264 | 3300035170 | Bacteria | 1771 |
| 495 | Ga0373943_0587163 | 3300035170 | Bacteria | 655 |
| 496 | Ga0373946_0042214 | 3300035171 | Bacteria | 1874 |
| 497 | Ga0373946_0054620 | 3300035171 | Bacteria | 1681 |
| 498 | Ga0373955_0000024 | 3300035172 | Bacteria | 60102 |
| 499 | Ga0373955_0004403 | 3300035172 | Bacteria | 6234 |
| 500 | Ga0373955_0035955 | 3300035172 | Bacteria | 2626 |
| 501 | Ga0373955_0492441 | 3300035172 | Bacteria | 748 |
| 502 | Ga0316574_0067880 | 3300035398 | Bacteria | 2248 |
| 503 | Ga0373924_0003094 | 3300035410 | Bacteria | 5678 |
| 504 | Ga0373924_0018354 | 3300035410 | Bacteria | 2694 |
| 505 | Ga0373924_0362983 | 3300035410 | Bacteria | 646 |
| 506 | Ga0373935_0014464 | 3300035692 | Bacteria | 4761 |
| 507 | Ga0373935_0140621 | 3300035692 | Bacteria | 1630 |
| 508 | Ga0373935_0779385 | 3300035692 | Bacteria | 705 |
| 509 | Ga0373927_0200993 | 3300035695 | Bacteria | 1308 |
| 510 | Ga0373933_0001020 | 3300035724 | Bacteria | 17008 |
| 511 | Ga0373933_0057502 | 3300035724 | Bacteria | 2337 |
| 512 | Ga0373933_0083274 | 3300035724 | Bacteria | 1964 |
| 513 | Ga0373933_0215019 | 3300035724 | Bacteria | 1232 |
| 514 | Ga0373947_0772929 | 3300035725 | Bacteria | 655 |
| 515 | Ga0373937_0000333 | 3300036401 | Bacteria | 44782 |
| 516 | Ga0373937_0007305 | 3300036401 | Bacteria | 9563 |
| 517 | Ga0373937_1126012 | 3300036401 | Bacteria | 733 |
| 518 | Ga0265778_037574 | 3300036457 | Bacteria | 640 |
| 519 | Ga0310112_031912 | 3300036458 | Bacteria | 722 |
| 520 | Ga0310112_049966 | 3300036458 | Bacteria | 568 |
| 521 | Ga0310112_053988 | 3300036458 | Bacteria | 546 |
| 522 | Ga0372808_039577 | 3300036459 | Bacteria | 676 |
| 523 | Ga0372808_042148 | 3300036459 | Bacteria | 654 |
| 524 | Ga0310109_016022 | 3300036534 | Bacteria | 1015 |
| 525 | Ga0316584_0395693 | 3300036712 | Bacteria | 985 |
| 526 | Ga0373925_0008937 | 3300037068 | Bacteria | 7300 |
| 527 | Ga0373925_0013418 | 3300037068 | Bacteria | 5928 |
| 528 | Ga0373925_0679740 | 3300037068 | Bacteria | 848 |
| 529 | Ga0395899_0122010 | 3300037312 | Bacteria | 1866 |
| 530 | Ga0395900_0212618 | 3300037418 | Bacteria | 1952 |
| 531 | Ga0395898_0047501 | 3300037466 | Bacteria | 4213 |
| 532 | Ga0395905_1460505 | 3300037471 | Bacteria | 588 |
| 533 | Ga0436364_0557549 | 3300037853 | Bacteria | 2402 |
| 534 | Ga0436364_1499747 | 3300037853 | Bacteria | 1222 |
| 535 | Ga0395901_0217393 | 3300038443 | Bacteria | 1998 |
| 536 | Ga0400485_17869 | 3300038735 | Bacteria | 38883 |
| 537 | Ga0400486_31407 | 3300038742 | Bacteria | 45426 |
| 538 | Ga0436365_1415915 | 3300039437 | Bacteria | 1032 |
| 539 | Ga0436363_1260454 | 3300039450 | Bacteria | 795 |
| 540 | Ga0436363_1543764 | 3300039450 | Bacteria | 830 |
| 541 | Ga0439436_0026794 | 3300041404 | Bacteria | 1688 |
| 542 | Ga0439438_021641 | 3300041405 | Bacteria | 1791 |
| 543 | Ga0439466_0076083 | 3300041411 | Bacteria | 1063 |
| 544 | Ga0439465_0031662 | 3300041413 | Bacteria | 1686 |
| 545 | Ga0451789_0023683 | 3300041443 | Bacteria | 531 |
| 546 | Ga0439433_0029489 | 3300041999 | Bacteria | 1252 |
| 547 | Ga0439448_0004728 | 3300042005 | Bacteria | 3854 |
| 548 | Ga0439449_0000737 | 3300042007 | Bacteria | 12569 |
| 549 | Ga0439449_0073771 | 3300042007 | Bacteria | 1257 |
| 550 | Ga0439452_045638 | 3300042010 | Bacteria | 1019 |
| 551 | Ga0439455_0094789 | 3300042012 | Bacteria | 821 |
| 552 | Ga0450905_021882 | 3300042142 | Bacteria | 948 |
| 553 | Ga0439458_0005335 | 3300042157 | Bacteria | 2892 |
| 554 | Ga0439464_0019502 | 3300042439 | Bacteria | 1852 |
| 555 | Ga0466961_0112876 | 3300044693 | Bacteria | 1709 |
| 556 | Ga0466963_0160124 | 3300044694 | Bacteria | 1566 |
| 557 | Ga0466963_0165259 | 3300044694 | Bacteria | 1542 |
| 558 | Ga0466963_0608207 | 3300044694 | Bacteria | 772 |
| 559 | Ga0466963_0782802 | 3300044694 | Bacteria | 673 |
| 560 | Ga0466963_0870207 | 3300044694 | Bacteria | 635 |
| 561 | Ga0466964_0022535 | 3300044706 | Bacteria | 2445 |
| 562 | Ga0466964_0203660 | 3300044706 | Unclassified | 951 |
| 563 | Ga0466968_0207549 | 3300044735 | Bacteria | 919 |
| 564 | Ga0466968_0656598 | 3300044735 | Bacteria | 533 |
| 565 | Ga0466957_0448004 | 3300044842 | Bacteria | 889 |
| 566 | Ga0466959_0861054 | 3300045049 | Bacteria | 605 |
| 567 | Ga0466958_0002183 | 3300045836 | Bacteria | 9745 |
| 568 | Ga0466958_0270867 | 3300045836 | Bacteria | 1087 |
| 569 | Ga0466967_0003203 | 3300045976 | Bacteria | 10566 |
| 570 | Ga0466967_0006784 | 3300045976 | Bacteria | 8158 |
| 571 | Ga0466967_0372653 | 3300045976 | Bacteria | 1385 |
| 572 | Ga0466967_0912671 | 3300045976 | Bacteria | 874 |
| 573 | Ga0495592_0000304 | 3300046454 | Bacteria | 41482 |
| 574 | Ga0495592_0004635 | 3300046454 | Bacteria | 10070 |
| 575 | Ga0495592_0047028 | 3300046454 | Bacteria | 3214 |
| 576 | Ga0495603_0039447 | 3300046455 | Bacteria | 2829 |
| 577 | Ga0495603_0390028 | 3300046455 | Bacteria | 798 |
| 578 | Ga0495629_0106780 | 3300046459 | Bacteria | 1953 |
| 579 | Ga0495629_0108954 | 3300046459 | Bacteria | 1931 |
| 580 | Ga0495629_0199752 | 3300046459 | Bacteria | 1382 |
| 581 | Ga0495629_0413894 | 3300046459 | Bacteria | 915 |
| 582 | Ga0495629_0592907 | 3300046459 | Bacteria | 742 |
| 583 | Ga0495641_0040151 | 3300046461 | Bacteria | 2177 |
| 584 | Ga0495651_0000252 | 3300046462 | Bacteria | 41425 |
| 585 | Ga0495651_0003277 | 3300046462 | Bacteria | 12427 |
| 586 | Ga0495651_0018040 | 3300046462 | Bacteria | 5463 |
| 587 | Ga0495651_0462691 | 3300046462 | Bacteria | 818 |
| 588 | Ga0495653_0001371 | 3300046463 | Bacteria | 18922 |
| 589 | Ga0495653_0009566 | 3300046463 | Bacteria | 7928 |
| 590 | Ga0495653_0015034 | 3300046463 | Bacteria | 6310 |
| 591 | Ga0495653_0167270 | 3300046463 | Bacteria | 1521 |
| 592 | Ga0495653_0455199 | 3300046463 | Bacteria | 804 |
| 593 | Ga0495580_0793098 | 3300046472 | Bacteria | 614 |
| 594 | Ga0495582_0034281 | 3300046473 | Bacteria | 2790 |
| 595 | Ga0495582_0264046 | 3300046473 | Bacteria | 987 |
| 596 | Ga0495639_0001540 | 3300046475 | Bacteria | 10282 |
| 597 | Ga0495639_0092889 | 3300046475 | Bacteria | 1417 |
| 598 | Ga0495662_0025046 | 3300046476 | Bacteria | 2881 |
| 599 | Ga0495662_0030834 | 3300046476 | Bacteria | 2588 |
| 600 | Ga0495662_0055526 | 3300046476 | Bacteria | 1913 |
| 601 | Ga0495664_0073784 | 3300046477 | Bacteria | 2040 |
| 602 | Ga0495664_0075902 | 3300046477 | Bacteria | 2011 |
| 603 | Ga0495664_0203144 | 3300046477 | Bacteria | 1200 |
| 604 | Ga0495664_0672903 | 3300046477 | Bacteria | 612 |
| 605 | Ga0495584_0665685 | 3300046491 | Bacteria | 531 |
| 606 | Ga0495594_0101650 | 3300046499 | Bacteria | 1617 |
| 607 | Ga0495608_0000101 | 3300046511 | Bacteria | 61678 |
| 608 | Ga0495608_0005457 | 3300046511 | Bacteria | 9093 |
| 609 | Ga0495608_0073663 | 3300046511 | Bacteria | 2226 |
| 610 | Ga0495610_0187835 | 3300046512 | Bacteria | 855 |
| 611 | Ga0495618_0060659 | 3300046514 | Bacteria | 2398 |
| 612 | Ga0495618_0102435 | 3300046514 | Bacteria | 1832 |
| 613 | Ga0495618_0240813 | 3300046514 | Bacteria | 1137 |
| 614 | Ga0495618_0307229 | 3300046514 | Bacteria | 984 |
| 615 | Ga0495628_0004884 | 3300046516 | Bacteria | 11802 |
| 616 | Ga0495628_0010389 | 3300046516 | Bacteria | 7910 |
| 617 | Ga0495628_0029794 | 3300046516 | Bacteria | 4422 |
| 618 | Ga0495628_0935937 | 3300046516 | Bacteria | 599 |
| 619 | Ga0495630_0079039 | 3300046517 | Bacteria | 2481 |
| 620 | Ga0495630_0086753 | 3300046517 | Bacteria | 2363 |
| 621 | Ga0495631_0185158 | 3300046518 | Bacteria | 892 |
| 622 | Ga0495643_0038445 | 3300046522 | Bacteria | 2621 |
| 623 | Ga0495666_0057300 | 3300046526 | Bacteria | 1865 |
| 624 | Ga0495652_0002437 | 3300046529 | Bacteria | 19162 |
| 625 | Ga0495652_0035206 | 3300046529 | Bacteria | 4358 |
| 626 | Ga0495652_0036673 | 3300046529 | Bacteria | 4259 |
| 627 | Ga0495652_0080402 | 3300046529 | Bacteria | 2692 |
| 628 | Ga0495652_0277994 | 3300046529 | Bacteria | 1227 |
| 629 | Ga0495665_0012035 | 3300046531 | Bacteria | 4683 |
| 630 | Ga0495665_0012799 | 3300046531 | Bacteria | 4538 |
| 631 | Ga0495640_0033826 | 3300046533 | Bacteria | 3630 |
| 632 | Ga0495640_0039427 | 3300046533 | Bacteria | 3314 |
| 633 | Ga0495640_0040305 | 3300046533 | Bacteria | 3271 |
| 634 | Ga0495640_0235447 | 3300046533 | Bacteria | 1150 |
| 635 | Ga0495587_0000228 | 3300046536 | Bacteria | 41527 |
| 636 | Ga0495587_0000376 | 3300046536 | Bacteria | 31800 |
| 637 | Ga0495587_0015528 | 3300046536 | Bacteria | 4753 |
| 638 | Ga0495587_0096035 | 3300046536 | Bacteria | 1710 |
| 639 | Ga0495587_0303591 | 3300046536 | Bacteria | 892 |
| 640 | Ga0495645_0012873 | 3300046543 | Bacteria | 5905 |
| 641 | Ga0495645_0036433 | 3300046543 | Bacteria | 3585 |
| 642 | Ga0495645_0093623 | 3300046543 | Bacteria | 2144 |
| 643 | Ga0495667_0000396 | 3300046559 | Bacteria | 27834 |
| 644 | Ga0495667_0015810 | 3300046559 | Bacteria | 5102 |
| 645 | Ga0495667_0017978 | 3300046559 | Bacteria | 4775 |
| 646 | Ga0495667_0065960 | 3300046559 | Bacteria | 2367 |
| 647 | Ga0495668_0051631 | 3300046616 | Bacteria | 2276 |
| 648 | Ga0495634_0041873 | 3300046642 | Bacteria | 3109 |
| 649 | Ga0495634_0142855 | 3300046642 | Bacteria | 1518 |
| 650 | Ga0495634_0714010 | 3300046642 | Bacteria | 576 |
| 651 | Ga0495635_0068823 | 3300046663 | Bacteria | 2427 |
| 652 | Ga0495635_0209789 | 3300046663 | Bacteria | 1319 |
| 653 | Ga0495659_0100834 | 3300046664 | Bacteria | 1118 |
| 654 | Ga0495588_0042682 | 3300046674 | Bacteria | 2319 |
| 655 | Ga0495657_0000156 | 3300046675 | Bacteria | 61702 |
| 656 | Ga0495657_0001735 | 3300046675 | Bacteria | 18663 |
| 657 | Ga0495657_0016689 | 3300046675 | Bacteria | 5343 |
| 658 | Ga0495657_0102174 | 3300046675 | Bacteria | 1825 |
| 659 | Ga0495599_0000097 | 3300046678 | Bacteria | 61561 |
| 660 | Ga0495599_0024650 | 3300046678 | Bacteria | 3762 |
| 661 | Ga0495599_0029592 | 3300046678 | Bacteria | 3433 |
| 662 | Ga0495623_0000598 | 3300046679 | Bacteria | 24081 |
| 663 | Ga0495623_0009845 | 3300046679 | Bacteria | 6194 |
| 664 | Ga0495623_0018638 | 3300046679 | Bacteria | 4482 |
| 665 | Ga0495623_0191761 | 3300046679 | Bacteria | 1180 |
| 666 | Ga0495646_0010719 | 3300046680 | Bacteria | 5824 |
| 667 | Ga0495646_0019048 | 3300046680 | Bacteria | 4348 |
| 668 | Ga0495646_0020586 | 3300046680 | Bacteria | 4173 |
| 669 | Ga0495646_0111413 | 3300046680 | Bacteria | 1558 |
| 670 | Ga0495658_0035192 | 3300046683 | Bacteria | 2753 |
| 671 | Ga0495658_0429669 | 3300046683 | Bacteria | 843 |
| 672 | Ga0495613_0044032 | 3300046689 | Bacteria | 3302 |
| 673 | Ga0495613_0199172 | 3300046689 | Bacteria | 1412 |
| 674 | Ga0495624_0108140 | 3300046690 | Bacteria | 1710 |
| 675 | Ga0495670_0111065 | 3300046691 | Bacteria | 1418 |
| 676 | Ga0495600_0005217 | 3300046809 | Bacteria | 7812 |
| 677 | Ga0495600_0012217 | 3300046809 | Bacteria | 5364 |
| 678 | Ga0495600_0030064 | 3300046809 | Bacteria | 3517 |
| 679 | Ga0495600_0114560 | 3300046809 | Bacteria | 1755 |
| 680 | Ga0495581_0005473 | 3300047315 | Bacteria | 7348 |
| 681 | Ga0495581_0051180 | 3300047315 | Bacteria | 2385 |
| 682 | Ga0495581_0169977 | 3300047315 | Bacteria | 1275 |
| 683 | Ga0495581_0464677 | 3300047315 | Bacteria | 736 |
| 684 | Ga0495604_0000196 | 3300047317 | Bacteria | 54755 |
| 685 | Ga0495604_0040446 | 3300047317 | Bacteria | 3660 |
| 686 | Ga0495604_0106368 | 3300047317 | Bacteria | 2052 |
| 687 | Ga0495604_0279058 | 3300047317 | Bacteria | 1129 |
| 688 | Ga0495636_0152236 | 3300047318 | Bacteria | 1038 |
| 689 | Ga0495674_0033589 | 3300047319 | Bacteria | 4645 |
| 690 | Ga0495674_0039058 | 3300047319 | Bacteria | 4255 |
| 691 | Ga0495674_0067157 | 3300047319 | Bacteria | 3107 |
| 692 | Ga0495674_0110310 | 3300047319 | Bacteria | 2333 |
| 693 | Ga0495674_0428851 | 3300047319 | Bacteria | 1064 |
| 694 | Ga0495674_1101999 | 3300047319 | Bacteria | 604 |
| 695 | Ga0495676_0116995 | 3300047321 | Bacteria | 1945 |
| 696 | Ga0495676_0145164 | 3300047321 | Bacteria | 1696 |
| 697 | Ga0495680_0000226 | 3300047322 | Bacteria | 61646 |
| 698 | Ga0495680_0003937 | 3300047322 | Bacteria | 14360 |
| 699 | Ga0495680_0017763 | 3300047322 | Bacteria | 6056 |
| 700 | Ga0495680_0028043 | 3300047322 | Bacteria | 4620 |
| 701 | Ga0495675_0000536 | 3300047444 | Bacteria | 24593 |
| 702 | Ga0495675_0012300 | 3300047444 | Bacteria | 5387 |
| 703 | Ga0495675_0030117 | 3300047444 | Bacteria | 3463 |
| 704 | Ga0495675_0044376 | 3300047444 | Bacteria | 2832 |
| 705 | Ga0495677_0119242 | 3300047445 | Bacteria | 1005 |
| 706 | Ga0495677_0313551 | 3300047445 | Bacteria | 617 |
| 707 | Ga0495684_0011554 | 3300047471 | Bacteria | 6820 |
| 708 | Ga0495684_0505305 | 3300047471 | Bacteria | 830 |
| 709 | Ga0495593_0017425 | 3300047673 | Bacteria | 4043 |
| 710 | Ga0495593_0021237 | 3300047673 | Bacteria | 3628 |
| 711 | Ga0495593_0067040 | 3300047673 | Bacteria | 1869 |
| 712 | Ga0495602_0000172 | 3300048088 | Bacteria | 60316 |
| 713 | Ga0495602_0007430 | 3300048088 | Bacteria | 11467 |
| 714 | Ga0495602_0037737 | 3300048088 | Bacteria | 4478 |
| 715 | Ga0495602_0490524 | 3300048088 | Bacteria | 860 |
| 716 | Ga0495614_0038690 | 3300048089 | Bacteria | 2047 |
| 717 | Ga0496100_0096525 | 3300048903 | Bacteria | 2028 |
| 718 | Ga0496100_0281888 | 3300048903 | Bacteria | 1239 |
| 719 | Ga0496101_0158094 | 3300048904 | Bacteria | 1737 |
| 720 | Ga0496102_0116236 | 3300048905 | Bacteria | 2496 |
| 721 | Ga0496102_0265711 | 3300048905 | Bacteria | 1618 |
| 722 | Ga0496103_0544145 | 3300048906 | Bacteria | 741 |
| 723 | Ga0496104_0000813 | 3300048907 | Bacteria | 26826 |
| 724 | Ga0496104_0028893 | 3300048907 | Bacteria | 5141 |
| 725 | Ga0496104_0959758 | 3300048907 | Bacteria | 759 |
| 726 | Ga0496105_0037143 | 3300048908 | Bacteria | 4012 |
| 727 | Ga0496105_0164025 | 3300048908 | Bacteria | 1823 |
| 728 | Ga0496106_0123135 | 3300048909 | Bacteria | 2028 |
| 729 | Ga0496107_0143639 | 3300048910 | Bacteria | 1764 |
| 730 | Ga0496108_0003404 | 3300048911 | Bacteria | 12772 |
| 731 | Ga0496108_0044574 | 3300048911 | Bacteria | 3701 |
| 732 | Ga0496109_0112040 | 3300048912 | Bacteria | 2537 |
| 733 | Ga0496109_1154008 | 3300048912 | Bacteria | 711 |
| 734 | Ga0496110_0043935 | 3300048913 | Bacteria | 3901 |
| 735 | Ga0496111_0318266 | 3300048914 | Bacteria | 1152 |
| 736 | Ga0496112_0004025 | 3300048915 | Bacteria | 12328 |
| 737 | Ga0496112_1151352 | 3300048915 | Bacteria | 693 |
| 738 | Ga0496113_0286929 | 3300048916 | Bacteria | 1316 |
| 739 | Ga0496115_0019404 | 3300048918 | Bacteria | 5231 |
| 740 | Ga0496115_0024030 | 3300048918 | Bacteria | 4735 |
| 741 | Ga0496115_0295379 | 3300048918 | Bacteria | 1328 |
| 742 | Ga0496115_0347869 | 3300048918 | Bacteria | 1209 |
| 743 | Ga0496126_0022803 | 3300048929 | Bacteria | 6080 |
| 744 | Ga0496126_0090601 | 3300048929 | Bacteria | 2690 |
| 745 | Ga0496126_0625705 | 3300048929 | Bacteria | 845 |
| 746 | Ga0501318_087358 | 3300049534 | Bacteria | 512 |
| 747 | Ga0501031_0306167 | 3300049568 | Bacteria | 1030 |
| 748 | Ga0501032_0518569 | 3300049569 | Bacteria | 761 |
| 749 | Ga0501032_0521959 | 3300049569 | Bacteria | 758 |
| 750 | Ga0501034_0202283 | 3300049571 | Bacteria | 1944 |
| 751 | Ga0501036_0000170 | 3300049572 | Bacteria | 42985 |
| 752 | Ga0501037_0028717 | 3300049573 | Bacteria | 4109 |
| 753 | Ga0501037_0162491 | 3300049573 | Bacteria | 1592 |
| 754 | Ga0501038_0001501 | 3300049574 | Bacteria | 21457 |
| 755 | Ga0501039_0698605 | 3300049575 | Bacteria | 793 |
| 756 | Ga0501041_1026168 | 3300049577 | Bacteria | 531 |
| 757 | Ga0501042_0001254 | 3300049578 | Bacteria | 14777 |
| 758 | Ga0501043_0000648 | 3300049579 | Bacteria | 30700 |
| 759 | Ga0501047_0011636 | 3300049581 | Bacteria | 8321 |
| 760 | Ga0501047_0372770 | 3300049581 | Bacteria | 1262 |
| 761 | Ga0501048_0035496 | 3300049582 | Bacteria | 3589 |
| 762 | Ga0501069_0034330 | 3300049585 | Bacteria | 2794 |
| 763 | Ga0501069_0547894 | 3300049585 | Bacteria | 692 |
| 764 | Ga0501070_0003798 | 3300049586 | Bacteria | 13051 |
| 765 | Ga0501070_0019825 | 3300049586 | Bacteria | 5639 |
| 766 | Ga0501073_0008157 | 3300049589 | Bacteria | 7769 |
| 767 | Ga0501073_0012663 | 3300049589 | Bacteria | 6151 |
| 768 | Ga0501074_0000484 | 3300049590 | Bacteria | 24222 |
| 769 | Ga0501074_0002243 | 3300049590 | Bacteria | 13424 |
| 770 | Ga0501079_0000159 | 3300049741 | Bacteria | 37178 |
| 771 | Ga0501080_0004998 | 3300049742 | Bacteria | 11808 |
| 772 | Ga0501080_0187462 | 3300049742 | Bacteria | 1902 |
| 773 | Ga0501080_0276282 | 3300049742 | Bacteria | 1528 |
| 774 | Ga0501080_0705820 | 3300049742 | Bacteria | 889 |
| 775 | Ga0501044_0397856 | 3300049823 | Bacteria | 1290 |
| 776 | nmdc:mga05p37_2542_c1 | 3300050507 | Bacteria | 21207 |
| 777 | nmdc:mga05p37_527_c1 | 3300050507 | Bacteria | 42352 |
| 778 | nmdc:mga05p37_534113_c1 | 3300050507 | Bacteria | 1339 |
| 779 | nmdc:mga09592_125911_c1 | 3300050508 | Bacteria | 2202 |
| 780 | nmdc:mga09592_237_c1 | 3300050508 | Bacteria | 40055 |
| 781 | nmdc:mga0qj67_10713_c1 | 3300050509 | Bacteria | 6854 |
| 782 | nmdc:mga06r32_4457_c1 | 3300050510 | Bacteria | 12539 |
| 783 | nmdc:mga06r32_876643_c1 | 3300050510 | Bacteria | 855 |
| 784 | nmdc:mga08y16_1161107_c1 | 3300050511 | Bacteria | 745 |
| 785 | nmdc:mga08y16_256845_c1 | 3300050511 | Bacteria | 1805 |
| 786 | nmdc:mga08y16_4679_c1 | 3300050511 | Bacteria | 14262 |
| 787 | nmdc:mga0n895_4012_c1 | 3300050512 | Bacteria | 11977 |
| 788 | nmdc:mga0rr50_1090521_c1 | 3300050513 | Bacteria | 679 |
| 789 | nmdc:mga0rr50_28718_c1 | 3300050513 | Bacteria | 3914 |
| 790 | nmdc:mga0rr50_71544_c1 | 3300050513 | Bacteria | 2647 |
| 791 | nmdc:mga08x19_96989_c1 | 3300050514 | Bacteria | 1952 |
| 792 | nmdc:mga0a205_147493_c1 | 3300050515 | Bacteria | 2253 |
| 793 | nmdc:mga0a205_199607_c1 | 3300050515 | Bacteria | 1891 |
| 794 | Ga0495612_0018161 | 3300053078 | Bacteria | 2815 |
| 795 | Ga0495612_0180505 | 3300053078 | Bacteria | 927 |
| 796 | Ga0495595_0019153 | 3300053084 | Bacteria | 2967 |
| 797 | Ga0495595_0049484 | 3300053084 | Bacteria | 1944 |
| 798 | Ga0495619_0021876 | 3300053085 | Bacteria | 4086 |
| 799 | Ga0495619_0121711 | 3300053085 | Bacteria | 1789 |
| 800 | Ga0500568_0028236 | 3300053139 | Bacteria | 2340 |
| 801 | Ga0501084_0257261 | 3300054114 | Bacteria | 1474 |
| 802 | Ga0590075_014495 | 3300059424 | Bacteria | 1927 |
| 803 | Ga0590075_017288 | 3300059424 | Bacteria | 1777 |
| 804 | Ga0587084_156970 | 3300059477 | Bacteria | 504 |
| 805 | Ga0587066_145129 | 3300059490 | Bacteria | 583 |
| 806 | Ga0587073_0179092 | 3300059492 | Bacteria | 621 |
| 807 | Ga0587073_0187562 | 3300059492 | Bacteria | 611 |
| 808 | Ga0587082_186084 | 3300059504 | Bacteria | 512 |
| 809 | Ga0587088_086925 | 3300059508 | Bacteria | 678 |
| 810 | Ga0587092_163885 | 3300059512 | Bacteria | 504 |
| 811 | Ga0587113_055303 | 3300059625 | Bacteria | 503 |
| 812 | Ga0587067_152730 | 3300059640 | Bacteria | 581 |
| 813 | Ga0587069_143524 | 3300059642 | Bacteria | 525 |
| 814 | Ga0587078_080468 | 3300059646 | Bacteria | 522 |
| 815 | Ga0587107_037464 | 3300059652 | Bacteria | 768 |
| 816 | Ga0587114_059059 | 3300059655 | Bacteria | 668 |
| 817 | Ga0587111_0262498 | 3300060346 | Bacteria | 515 |
| 818 | Ga0466962_0071137 | 3300061719 | Bacteria | 1662 |
| 819 | 2517763896 | 2517572101 | Bacteria | 6884336 |
| 820 | 2691513560 | 2690315906 | Bacteria | 4517044 |
| 821 | 2729906109 | 2728369276 | Bacteria | 5610032 |
| 822 | 2891403072 | 2891395885 | Bacteria | 9251614 |
| 823 | 2891554609 | 2891554331 | Bacteria | 8812224 |
| 824 | 2984580625 | 2984576629 | Bacteria | 4248407 |
| 825 | 2990258317 | 2990256926 | Bacteria | 4252839 |
| 826 | 3001891117 | 3001889506 | Bacteria | 2975194 |
| 827 | 8002777146 | 8002775197 | Bacteria | 10728764 |
| 828 | 8056066417 | 8056060235 | Bacteria | 7259403 |
| 829 | Ga0500643_000127 | |||
| 830 | LJQas_1013284 | |||
| 831 | JGI24743J22301_10061232 | |||
| 832 | JGI24033J26618_1023625 | |||
| 833 | JGI24751J29686_10053746 | |||
| 834 | JGI25405J52794_10023957 | |||
| 835 | Ga0058863_10003683 | |||
| 836 | Ga0058861_10022460 | |||
| 837 | Ga0058861_10057497 | |||
| 838 | Ga0058861_11822019 | |||
| 839 | Ga0058862_10024687 | |||
| 840 | Ga0058862_10151194 | |||
| 841 | Ga0058862_11010846 | |||
| 842 | Ga0058862_12004185 | |||
| 843 | Ga0070658_10001791 | |||
| 844 | Ga0070658_10650125 | |||
| 845 | Ga0070676_10066824 | |||
| 846 | Ga0070683_100234000 | |||
| 847 | Ga0070683_100356721 | |||
| 848 | Ga0070690_100471266 | |||
| 849 | Ga0070670_100231426 | |||
| 850 | Ga0070677_10125079 | |||
| 851 | Ga0068869_100061998 | |||
| 852 | Ga0070680_100113750 | |||
| 853 | Ga0070680_100339182 | |||
| 854 | Ga0070680_100977900 | |||
| 855 | Ga0070682_100022244 | |||
| 856 | Ga0068868_100047275 | |||
| 857 | Ga0068868_100081564 | |||
| 858 | Ga0070691_10027814 | |||
| 859 | Ga0070691_10241228 | |||
| 860 | Ga0070661_100246882 | |||
| 861 | Ga0070692_10012144 | |||
| 862 | Ga0070668_100757265 | |||
| 863 | Ga0070675_100095022 | |||
| 864 | Ga0070671_100191274 | |||
| 865 | Ga0070673_100370209 | |||
| 866 | Ga0070673_100506946 | |||
| 867 | Ga0070688_100011303 | |||
| 868 | Ga0070659_100280324 | |||
| 869 | Ga0070659_100312975 | |||
| 870 | Ga0070667_100461799 | |||
| 871 | Ga0070709_10000132 | |||
| 872 | Ga0070709_10011218 | |||
| 873 | Ga0070709_10015898 | |||
| 874 | Ga0070709_10024697 | |||
| 875 | Ga0070709_10057263 | |||
| 876 | Ga0070709_10172670 | |||
| 877 | Ga0070709_10992509 | |||
| 878 | Ga0070714_100000290 | |||
| 879 | Ga0070714_100001047 | |||
| 880 | Ga0070714_100017866 | |||
| 881 | Ga0070714_100034845 | |||
| 882 | Ga0070714_100069282 | |||
| 883 | Ga0070714_100087914 | |||
| 884 | Ga0070714_100433439 | |||
| 885 | Ga0070714_100437033 | |||
| 886 | Ga0070714_100579005 | |||
| 887 | Ga0070714_101401460 | |||
| 888 | Ga0070713_100000696 | |||
| 889 | Ga0070713_100003571 | |||
| 890 | Ga0070713_100011260 | |||
| 891 | Ga0070713_100033062 | |||
| 892 | Ga0070713_100058884 | |||
| 893 | Ga0070713_100082795 | |||
| 894 | Ga0070713_100172641 | |||
| 895 | Ga0070713_100320495 | |||
| 896 | Ga0070713_100614335 | |||
| 897 | Ga0070713_100630983 | |||
| 898 | Ga0070710_10001105 | |||
| 899 | Ga0070710_10005739 | |||
| 900 | Ga0070710_10009941 | |||
| 901 | Ga0070710_10114743 | |||
| 902 | Ga0070710_10250329 | |||
| 903 | Ga0070710_10782585 | |||
| 904 | Ga0070701_10018729 | |||
| 905 | Ga0070711_100017156 | |||
| 906 | Ga0070711_100340989 | |||
| 907 | Ga0070711_100452922 | |||
| 908 | Ga0070705_100046994 | |||
| 909 | Ga0070700_100081141 | |||
| 910 | Ga0070694_101192738 | |||
| 911 | Ga0070708_100045744 | |||
| 912 | Ga0070708_100439328 | |||
| 913 | Ga0070708_101009980 | |||
| 914 | Ga0070663_100003030 | |||
| 915 | Ga0070663_100548016 | |||
| 916 | Ga0070678_100778004 | |||
| 917 | Ga0070681_10184721 | |||
| 918 | Ga0070681_10430509 | |||
| 919 | Ga0070681_11772525 | |||
| 920 | Ga0068867_100995728 | |||
| 921 | Ga0070685_10020070 | |||
| 922 | Ga0070706_100003733 | |||
| 923 | Ga0070706_100109139 | |||
| 924 | Ga0070706_100462386 | |||
| 925 | Ga0070707_100382565 | |||
| 926 | Ga0070707_100709054 | |||
| 927 | Ga0070698_100000354 | |||
| 928 | Ga0070698_100021520 | |||
| 929 | Ga0070679_100099789 | |||
| 930 | Ga0070679_100116027 | |||
| 931 | Ga0070679_100263019 | |||
| 932 | Ga0070679_100320162 | |||
| 933 | Ga0070679_100676505 | |||
| 934 | Ga0070679_101986266 | |||
| 935 | Ga0070684_100126029 | |||
| 936 | Ga0070684_100960364 | |||
| 937 | Ga0070672_100679274 | |||
| 938 | Ga0070686_100302162 | |||
| 939 | Ga0070695_100539247 | |||
| 940 | Ga0070695_101047610 | |||
| 941 | Ga0070696_101656050 | |||
| 942 | Ga0070693_100004054 | |||
| 943 | Ga0070665_100136172 | |||
| 944 | Ga0070665_100201330 | |||
| 945 | Ga0070704_100185393 | |||
| 946 | Ga0070704_100408796 | |||
| 947 | Ga0068855_100019122 | |||
| 948 | Ga0068855_100053197 | |||
| 949 | Ga0068855_100484173 | |||
| 950 | Ga0068855_102199985 | |||
| 951 | Ga0070664_100263569 | |||
| 952 | Ga0068857_100738373 | |||
| 953 | Ga0068857_100950433 | |||
| 954 | Ga0068854_100102269 | |||
| 955 | Ga0068856_100001364 | |||
| 956 | Ga0068856_100024135 | |||
| 957 | Ga0068856_100109542 | |||
| 958 | Ga0068856_100482513 | |||
| 959 | Ga0070702_100010326 | |||
| 960 | Ga0068852_101114471 | |||
| 961 | Ga0068859_100062471 | |||
| 962 | Ga0068864_100717789 | |||
| 963 | Ga0068861_102237271 | |||
| 964 | Ga0068851_10010718 | |||
| 965 | Ga0068870_10044947 | |||
| 966 | Ga0068870_10471284 | |||
| 967 | Ga0068863_100196808 | |||
| 968 | Ga0068858_100064792 | |||
| 969 | Ga0068858_100079457 | |||
| 970 | Ga0068860_100081053 | |||
| 971 | Ga0068860_100679330 | |||
| 972 | Ga0068862_101108925 | |||
| 973 | Ga0081455_10000128 | |||
| 974 | Ga0081455_10006978 | |||
| 975 | Ga0081538_10001888 | |||
| 976 | Ga0081538_10014035 | |||
| 977 | Ga0081540_1001223 | |||
| 978 | Ga0081540_1056794 | |||
| 979 | Ga0081540_1087893 | |||
| 980 | Ga0081539_10152964 | |||
| 981 | Ga0070717_10016338 | |||
| 982 | Ga0070717_10023113 | |||
| 983 | Ga0070717_10024558 | |||
| 984 | Ga0070717_10074698 | |||
| 985 | Ga0070717_10253439 | |||
| 986 | Ga0070717_10276875 | |||
| 987 | Ga0070717_10459271 | |||
| 988 | Ga0070717_10464770 | |||
| 989 | Ga0070717_10524628 | |||
| 990 | Ga0075432_10298202 | |||
| 991 | Ga0070715_10021861 | |||
| 992 | Ga0070715_10032780 | |||
| 993 | Ga0070715_10353800 | |||
| 994 | Ga0070716_100000088 | |||
| 995 | Ga0070716_100001767 | |||
| 996 | Ga0070716_100405165 | |||
| 997 | Ga0070716_100719858 | |||
| 998 | Ga0070712_100000796 | |||
| 999 | Ga0070712_100034900 | |||
| 1000 | Ga0070712_100039248 | |||
| 1001 | Ga0070712_100130155 | |||
| 1002 | Ga0070712_100346477 | |||
| 1003 | Ga0070712_100355226 | |||
| 1004 | Ga0097621_100023467 | |||
| 1005 | Ga0097621_100355141 | |||
| 1006 | Ga0097621_100585479 | |||
| 1007 | Ga0068871_100064130 | |||
| 1008 | Ga0068871_100211229 | |||
| 1009 | Ga0068871_100601052 | |||
| 1010 | Ga0075428_100005771 | |||
| 1011 | Ga0075428_100527052 | |||
| 1012 | Ga0075428_100534086 | |||
| 1013 | Ga0075430_100024721 | |||
| 1014 | Ga0075430_100920719 | |||
| 1015 | Ga0075431_100037096 | |||
| 1016 | Ga0075431_100064702 | |||
| 1017 | Ga0075433_10002154 | |||
| 1018 | Ga0075433_10082334 | |||
| 1019 | Ga0075433_10297209 | |||
| 1020 | Ga0075434_100002741 | |||
| 1021 | Ga0075429_100001979 | |||
| 1022 | Ga0075429_100212067 | |||
| 1023 | Ga0075436_100001784 | |||
| 1024 | Ga0075436_100030847 | |||
| 1025 | Ga0097620_100062470 | |||
| 1026 | Ga0075435_100032515 | |||
| 1027 | Ga0075435_101145379 | |||
| 1028 | Ga0075435_101236816 | |||
| 1029 | Ga0105251_10054389 | |||
| 1030 | Ga0105240_10003563 | |||
| 1031 | Ga0105240_10251875 | |||
| 1032 | Ga0105240_10708553 | |||
| 1033 | Ga0111539_10006043 | |||
| 1034 | Ga0111539_10253633 | |||
| 1035 | Ga0105245_10101474 | |||
| 1036 | Ga0105247_10039895 | |||
| 1037 | Ga0114129_10002252 | |||
| 1038 | Ga0114129_10008519 | |||
| 1039 | Ga0114129_10218138 | |||
| 1040 | Ga0105243_10240133 | |||
| 1041 | Ga0105241_10004090 | |||
| 1042 | Ga0105241_10061597 | |||
| 1043 | Ga0105241_10344095 | |||
| 1044 | Ga0105248_10656425 | |||
| 1045 | Ga0105248_11582736 | |||
| 1046 | Ga0105237_10242007 | |||
| 1047 | Ga0105237_11009983 | |||
| 1048 | Ga0105238_10108171 | |||
| 1049 | Ga0105238_10538083 | |||
| 1050 | Ga0105238_10930257 | |||
| 1051 | Ga0105249_11004008 | |||
| 1052 | Ga0099796_10429247 | |||
| 1053 | Ga0105239_10215638 | |||
| 1054 | Ga0105239_11044741 | |||
| 1055 | Ga0105239_11436469 | |||
| 1056 | Ga0105246_10028661 | |||
| 1057 | Ga0105246_10031827 | |||
| 1058 | Ga0154010_158913 | |||
| 1059 | Ga0157370_10006131 | |||
| 1060 | Ga0157369_10091142 | |||
| 1061 | Ga0157369_10109792 | |||
| 1062 | Ga0157369_11967129 | |||
| 1063 | Ga0157374_10027064 | |||
| 1064 | Ga0157374_10128896 | |||
| 1065 | Ga0157374_10215911 | |||
| 1066 | Ga0163162_10026734 | |||
| 1067 | Ga0163162_10551593 | |||
| 1068 | Ga0157372_10028155 | |||
| 1069 | Ga0157372_10266181 | |||
| 1070 | Ga0157372_10871921 | |||
| 1071 | Ga0157375_10582005 | |||
| 1072 | Ga0163163_10501639 | |||
| 1073 | Ga0163163_10526492 | |||
| 1074 | Ga0163163_11429521 | |||
| 1075 | Ga0182008_10093035 | |||
| 1076 | Ga0157377_10001915 | |||
| 1077 | Ga0157377_10816367 | |||
| 1078 | Ga0157379_10020127 | |||
| 1079 | Ga0157376_10008666 | |||
| 1080 | Ga0157376_11296491 | |||
| 1081 | Ga0184601_114265 | |||
| 1082 | Ga0184600_116695 | |||
| 1083 | Ga0197907_10230096 | |||
| 1084 | Ga0197907_10862593 | |||
| 1085 | Ga0206356_10083947 | |||
| 1086 | Ga0206356_10565981 | |||
| 1087 | Ga0206356_10969686 | |||
| 1088 | Ga0206349_1228606 | |||
| 1089 | Ga0206349_1321091 | |||
| 1090 | Ga0206349_1514218 | |||
| 1091 | Ga0206355_1462003 | |||
| 1092 | Ga0206355_1650148 | |||
| 1093 | Ga0206355_1705157 | |||
| 1094 | Ga0206351_10165417 | |||
| 1095 | Ga0206351_10815914 | |||
| 1096 | Ga0206352_10036563 | |||
| 1097 | Ga0206352_10310989 | |||
| 1098 | Ga0206352_10834661 | |||
| 1099 | Ga0206350_10273622 | |||
| 1100 | Ga0206350_10584984 | |||
| 1101 | Ga0206350_10787066 | |||
| 1102 | Ga0206350_11162888 | |||
| 1103 | Ga0206350_11357921 | |||
| 1104 | Ga0206354_10140459 | |||
| 1105 | Ga0206354_11022824 | |||
| 1106 | Ga0206353_10120679 | |||
| 1107 | Ga0206353_10397058 | |||
| 1108 | Ga0154015_1056023 | |||
| 1109 | Ga0154015_1214535 | |||
| 1110 | Ga0154015_1223142 | |||
| 1111 | Ga0154015_1271578 | |||
| 1112 | Ga0213875_10002941 | |||
| 1113 | Ga0224712_10007480 | |||
| 1114 | Ga0224712_10444849 | |||
| 1115 | Ga0224712_10563885 | |||
| 1116 | Ga0224712_10658432 | |||
| 1117 | Ga0256720_121953 | |||
| 1118 | Ga0224572_1005428 | |||
| 1119 | Ga0207692_10000891 | |||
| 1120 | Ga0207692_10002245 | |||
| 1121 | Ga0207692_10055424 | |||
| 1122 | Ga0207692_10086698 | |||
| 1123 | Ga0207692_10177937 | |||
| 1124 | Ga0207692_10470833 | |||
| 1125 | Ga0207688_10044815 | |||
| 1126 | Ga0207647_10101992 | |||
| 1127 | Ga0207685_10075549 | |||
| 1128 | Ga0207685_10128070 | |||
| 1129 | Ga0207699_10000165 | |||
| 1130 | Ga0207699_10001689 | |||
| 1131 | Ga0207699_10082244 | |||
| 1132 | Ga0207699_10183239 | |||
| 1133 | Ga0207699_10322605 | |||
| 1134 | Ga0207699_10549333 | |||
| 1135 | Ga0207645_10028105 | |||
| 1136 | Ga0207643_10035728 | |||
| 1137 | Ga0207643_10447635 | |||
| 1138 | Ga0207705_10169901 | |||
| 1139 | Ga0207705_10261836 | |||
| 1140 | Ga0207705_10993877 | |||
| 1141 | Ga0207684_10132377 | |||
| 1142 | Ga0207684_10240698 | |||
| 1143 | Ga0207654_10014200 | |||
| 1144 | Ga0207654_10031882 | |||
| 1145 | Ga0207707_10422298 | |||
| 1146 | Ga0207707_11017371 | |||
| 1147 | Ga0207695_10050307 | |||
| 1148 | Ga0207695_10481201 | |||
| 1149 | Ga0207695_10565236 | |||
| 1150 | Ga0207671_10295660 | |||
| 1151 | Ga0207693_10000836 | |||
| 1152 | Ga0207693_10081949 | |||
| 1153 | Ga0207693_10133919 | |||
| 1154 | Ga0207693_10135726 | |||
| 1155 | Ga0207693_10294799 | |||
| 1156 | Ga0207693_10297108 | |||
| 1157 | Ga0207663_10005552 | |||
| 1158 | Ga0207663_10021183 | |||
| 1159 | Ga0207663_10027678 | |||
| 1160 | Ga0207663_10199847 | |||
| 1161 | Ga0207663_10897077 | |||
| 1162 | Ga0207660_10096989 | |||
| 1163 | Ga0207660_11006275 | |||
| 1164 | Ga0207657_10009363 | |||
| 1165 | Ga0207657_10134398 | |||
| 1166 | Ga0207657_10985597 | |||
| 1167 | Ga0207649_10530871 | |||
| 1168 | Ga0207649_11197249 | |||
| 1169 | Ga0207652_10065455 | |||
| 1170 | Ga0207652_10124386 | |||
| 1171 | Ga0207652_10570322 | |||
| 1172 | Ga0207652_11184831 | |||
| 1173 | Ga0207646_10774239 | |||
| 1174 | Ga0207681_11202526 | |||
| 1175 | Ga0207694_10273727 | |||
| 1176 | Ga0207650_10740963 | |||
| 1177 | Ga0207659_10109494 | |||
| 1178 | Ga0207687_10028797 | |||
| 1179 | Ga0207700_10000297 | |||
| 1180 | Ga0207700_10010224 | |||
| 1181 | Ga0207700_10017378 | |||
| 1182 | Ga0207700_10028955 | |||
| 1183 | Ga0207700_10070358 | |||
| 1184 | Ga0207700_10104397 | |||
| 1185 | Ga0207700_10180715 | |||
| 1186 | Ga0207664_10000224 | |||
| 1187 | Ga0207664_10006027 | |||
| 1188 | Ga0207664_10009651 | |||
| 1189 | Ga0207664_10014932 | |||
| 1190 | Ga0207664_10058173 | |||
| 1191 | Ga0207664_10176015 | |||
| 1192 | Ga0207664_10367620 | |||
| 1193 | Ga0207664_10452699 | |||
| 1194 | Ga0207664_10685709 | |||
| 1195 | Ga0207644_10079790 | |||
| 1196 | Ga0207690_10492427 | |||
| 1197 | Ga0207690_10737970 | |||
| 1198 | Ga0207706_10154785 | |||
| 1199 | Ga0207665_10000698 | |||
| 1200 | Ga0207665_10005623 | |||
| 1201 | Ga0207665_10300461 | |||
| 1202 | Ga0207665_11397442 | |||
| 1203 | Ga0207691_10141982 | |||
| 1204 | Ga0207711_10286352 | |||
| 1205 | Ga0207661_10002395 | |||
| 1206 | Ga0207661_10300974 | |||
| 1207 | Ga0207679_10289685 | |||
| 1208 | Ga0207667_10024935 | |||
| 1209 | Ga0207667_10068805 | |||
| 1210 | Ga0207667_10787001 | |||
| 1211 | Ga0207667_11286746 | |||
| 1212 | Ga0207667_11687128 | |||
| 1213 | Ga0207651_10087033 | |||
| 1214 | Ga0207651_10979754 | |||
| 1215 | Ga0207712_10529207 | |||
| 1216 | Ga0207677_10070453 | |||
| 1217 | Ga0207703_10032686 | |||
| 1218 | Ga0207703_10102847 | |||
| 1219 | Ga0207639_10398577 | |||
| 1220 | Ga0207639_10824172 | |||
| 1221 | Ga0207678_10007707 | |||
| 1222 | Ga0207678_10009072 | |||
| 1223 | Ga0207708_10114430 | |||
| 1224 | Ga0207702_10012351 | |||
| 1225 | Ga0207702_10028083 | |||
| 1226 | Ga0207702_10146497 | |||
| 1227 | Ga0207641_11144090 | |||
| 1228 | Ga0207648_11050840 | |||
| 1229 | Ga0207676_10002884 | |||
| 1230 | Ga0207674_10030548 | |||
| 1231 | Ga0207674_10106859 | |||
| 1232 | Ga0207674_10299362 | |||
| 1233 | Ga0207674_10757607 | |||
| 1234 | Ga0207675_100281140 | |||
| 1235 | Ga0207675_101760697 | |||
| 1236 | Ga0207683_10007957 | |||
| 1237 | Ga0207683_10366722 | |||
| 1238 | Ga0207698_10631725 | |||
| 1239 | Ga0207698_10783979 | |||
| 1240 | Ga0207698_11227764 | |||
| 1241 | Ga0209588_1023459 | |||
| 1242 | Ga0207428_10005504 | |||
| 1243 | Ga0207428_10091244 | |||
| 1244 | Ga0268266_10184805 | |||
| 1245 | Ga0268266_10367152 | |||
| 1246 | Ga0268264_10101885 | |||
| 1247 | Ga0311003_155033 | |||
| 1248 | Ga0265762_1020485 | |||
| 1249 | Ga0265767_115009 | |||
| 1250 | Ga0265766_1003422 | |||
| 1251 | Ga0265766_1004977 | |||
| 1252 | Ga0265766_1007092 | |||
| 1253 | Ga0265766_1022794 | |||
| 1254 | Ga0265766_1026404 | |||
| 1255 | Ga0265770_1021530 | |||
| 1256 | Ga0265769_108833 | |||
| 1257 | Ga0265768_108041 | |||
| 1258 | Ga0265771_1005649 | |||
| 1259 | Ga0265325_10008964 | |||
| 1260 | Ga0265340_10021908 | |||
| 1261 | Ga0265339_10320460 | |||
| 1262 | Ga0265331_10102826 | |||
| 1263 | Ga0265316_10228723 | |||
| 1264 | Ga0307408_100087740 | |||
| 1265 | Ga0307408_100174573 | |||
| 1266 | Ga0307408_100966294 | |||
| 1267 | Ga0310116_123310 | |||
| 1268 | Ga0310117_121382 | |||
| 1269 | Ga0265313_10119832 | |||
| 1270 | Ga0310103_117113 | |||
| 1271 | Ga0307508_10089865 | |||
| 1272 | Ga0265342_10131091 | |||
| 1273 | Ga0316576_10003781 | |||
| 1274 | Ga0316578_10072412 | |||
| 1275 | Ga0307516_10349672 | |||
| 1276 | Ga0307405_10055944 | |||
| 1277 | Ga0307405_10123988 | |||
| 1278 | Ga0307405_10368882 | |||
| 1279 | Ga0307405_10428537 | |||
| 1280 | Ga0307413_10295317 | |||
| 1281 | Ga0307413_10651913 | |||
| 1282 | Ga0307410_10092293 | |||
| 1283 | Ga0307410_10321646 | |||
| 1284 | Ga0307410_10518297 | |||
| 1285 | Ga0307407_10143727 | |||
| 1286 | Ga0307412_10005940 | |||
| 1287 | Ga0307412_10012266 | |||
| 1288 | Ga0307409_100042992 | |||
| 1289 | Ga0307409_100089454 | |||
| 1290 | Ga0307409_101047558 | |||
| 1291 | Ga0307416_100009886 | |||
| 1292 | Ga0307416_100041985 | |||
| 1293 | Ga0307416_100194388 | |||
| 1294 | Ga0307416_100294183 | |||
| 1295 | Ga0307416_101024084 | |||
| 1296 | Ga0307411_10346058 | |||
| 1297 | Ga0307411_10473658 | |||
| 1298 | Ga0307411_11842947 | |||
| 1299 | Ga0316053_119824 | |||
| 1300 | Ga0307415_100169606 | |||
| 1301 | Ga0316212_1020082 | |||
| 1302 | Ga0316216_1002509 | |||
| 1303 | Ga0373926_0213826 | |||
| 1304 | Ga0373926_0414878 | |||
| 1305 | Ga0373928_0265182 | |||
| 1306 | Ga0373934_0000337 | |||
| 1307 | Ga0373934_0000541 | |||
| 1308 | Ga0373934_0075731 | |||
| 1309 | Ga0373944_0108617 | |||
| 1310 | Ga0373944_0312767 | |||
| 1311 | Ga0373949_0085847 | |||
| 1312 | Ga0373923_0017622 | |||
| 1313 | Ga0373923_0405023 | |||
| 1314 | Ga0373936_0068383 | |||
| 1315 | Ga0373936_0091154 | |||
| 1316 | Ga0373945_0010599 | |||
| 1317 | Ga0373953_0009454 | |||
| 1318 | Ga0373954_0010264 | |||
| 1319 | Ga0373956_0001267 | |||
| 1320 | Ga0373957_0000146 | |||
| 1321 | Ga0373957_0002029 | |||
| 1322 | Ga0373943_0070264 | |||
| 1323 | Ga0373943_0587163 | |||
| 1324 | Ga0373946_0042214 | |||
| 1325 | Ga0373946_0054620 | |||
| 1326 | Ga0373955_0000024 | |||
| 1327 | Ga0373955_0004403 | |||
| 1328 | Ga0373955_0035955 | |||
| 1329 | Ga0373955_0492441 | |||
| 1330 | Ga0316574_0067880 | |||
| 1331 | Ga0373924_0003094 | |||
| 1332 | Ga0373924_0018354 | |||
| 1333 | Ga0373924_0362983 | |||
| 1334 | Ga0373935_0014464 | |||
| 1335 | Ga0373935_0140621 | |||
| 1336 | Ga0373935_0779385 | |||
| 1337 | Ga0373927_0200993 | |||
| 1338 | Ga0373933_0001020 | |||
| 1339 | Ga0373933_0057502 | |||
| 1340 | Ga0373933_0083274 | |||
| 1341 | Ga0373933_0215019 | |||
| 1342 | Ga0373947_0772929 | |||
| 1343 | Ga0373937_0000333 | |||
| 1344 | Ga0373937_0007305 | |||
| 1345 | Ga0373937_1126012 | |||
| 1346 | Ga0265778_037574 | |||
| 1347 | Ga0310112_031912 | |||
| 1348 | Ga0310112_049966 | |||
| 1349 | Ga0310112_053988 | |||
| 1350 | Ga0372808_039577 | |||
| 1351 | Ga0372808_042148 | |||
| 1352 | Ga0310109_016022 | |||
| 1353 | Ga0316584_0395693 | |||
| 1354 | Ga0373925_0008937 | |||
| 1355 | Ga0373925_0013418 | |||
| 1356 | Ga0373925_0679740 | |||
| 1357 | Ga0395899_0122010 | |||
| 1358 | Ga0395900_0212618 | |||
| 1359 | Ga0395898_0047501 | |||
| 1360 | Ga0395905_1460505 | |||
| 1361 | Ga0436364_0557549 | |||
| 1362 | Ga0436364_1499747 | |||
| 1363 | Ga0395901_0217393 | |||
| 1364 | Ga0400485_17869 | |||
| 1365 | Ga0400486_31407 | |||
| 1366 | Ga0436365_1415915 | |||
| 1367 | Ga0436363_1260454 | |||
| 1368 | Ga0436363_1543764 | |||
| 1369 | Ga0439436_0026794 | |||
| 1370 | Ga0439438_021641 | |||
| 1371 | Ga0439466_0076083 | |||
| 1372 | Ga0439465_0031662 | |||
| 1373 | Ga0451789_0023683 | |||
| 1374 | Ga0439433_0029489 | |||
| 1375 | Ga0439448_0004728 | |||
| 1376 | Ga0439449_0000737 | |||
| 1377 | Ga0439449_0073771 | |||
| 1378 | Ga0439452_045638 | |||
| 1379 | Ga0439455_0094789 | |||
| 1380 | Ga0450905_021882 | |||
| 1381 | Ga0439458_0005335 | |||
| 1382 | Ga0439464_0019502 | |||
| 1383 | Ga0466961_0112876 | |||
| 1384 | Ga0466963_0160124 | |||
| 1385 | Ga0466963_0165259 | |||
| 1386 | Ga0466963_0608207 | |||
| 1387 | Ga0466963_0782802 | |||
| 1388 | Ga0466963_0870207 | |||
| 1389 | Ga0466964_0022535 | |||
| 1390 | Ga0466964_0203660 | |||
| 1391 | Ga0466968_0207549 | |||
| 1392 | Ga0466968_0656598 | |||
| 1393 | Ga0466957_0448004 | |||
| 1394 | Ga0466959_0861054 | |||
| 1395 | Ga0466958_0002183 | |||
| 1396 | Ga0466958_0270867 | |||
| 1397 | Ga0466967_0003203 | |||
| 1398 | Ga0466967_0006784 | |||
| 1399 | Ga0466967_0372653 | |||
| 1400 | Ga0466967_0912671 | |||
| 1401 | Ga0495592_0000304 | |||
| 1402 | Ga0495592_0004635 | |||
| 1403 | Ga0495592_0047028 | |||
| 1404 | Ga0495603_0039447 | |||
| 1405 | Ga0495603_0390028 | |||
| 1406 | Ga0495629_0106780 | |||
| 1407 | Ga0495629_0108954 | |||
| 1408 | Ga0495629_0199752 | |||
| 1409 | Ga0495629_0413894 | |||
| 1410 | Ga0495629_0592907 | |||
| 1411 | Ga0495641_0040151 | |||
| 1412 | Ga0495651_0000252 | |||
| 1413 | Ga0495651_0003277 | |||
| 1414 | Ga0495651_0018040 | |||
| 1415 | Ga0495651_0462691 | |||
| 1416 | Ga0495653_0001371 | |||
| 1417 | Ga0495653_0009566 | |||
| 1418 | Ga0495653_0015034 | |||
| 1419 | Ga0495653_0167270 | |||
| 1420 | Ga0495653_0455199 | |||
| 1421 | Ga0495580_0793098 | |||
| 1422 | Ga0495582_0034281 | |||
| 1423 | Ga0495582_0264046 | |||
| 1424 | Ga0495639_0001540 | |||
| 1425 | Ga0495639_0092889 | |||
| 1426 | Ga0495662_0025046 | |||
| 1427 | Ga0495662_0030834 | |||
| 1428 | Ga0495662_0055526 | |||
| 1429 | Ga0495664_0073784 | |||
| 1430 | Ga0495664_0075902 | |||
| 1431 | Ga0495664_0203144 | |||
| 1432 | Ga0495664_0672903 | |||
| 1433 | Ga0495584_0665685 | |||
| 1434 | Ga0495594_0101650 | |||
| 1435 | Ga0495608_0000101 | |||
| 1436 | Ga0495608_0005457 | |||
| 1437 | Ga0495608_0073663 | |||
| 1438 | Ga0495610_0187835 | |||
| 1439 | Ga0495618_0060659 | |||
| 1440 | Ga0495618_0102435 | |||
| 1441 | Ga0495618_0240813 | |||
| 1442 | Ga0495618_0307229 | |||
| 1443 | Ga0495628_0004884 | |||
| 1444 | Ga0495628_0010389 | |||
| 1445 | Ga0495628_0029794 | |||
| 1446 | Ga0495628_0935937 | |||
| 1447 | Ga0495630_0079039 | |||
| 1448 | Ga0495630_0086753 | |||
| 1449 | Ga0495631_0185158 | |||
| 1450 | Ga0495643_0038445 | |||
| 1451 | Ga0495666_0057300 | |||
| 1452 | Ga0495652_0002437 | |||
| 1453 | Ga0495652_0035206 | |||
| 1454 | Ga0495652_0036673 | |||
| 1455 | Ga0495652_0080402 | |||
| 1456 | Ga0495652_0277994 | |||
| 1457 | Ga0495665_0012035 | |||
| 1458 | Ga0495665_0012799 | |||
| 1459 | Ga0495640_0033826 | |||
| 1460 | Ga0495640_0039427 | |||
| 1461 | Ga0495640_0040305 | |||
| 1462 | Ga0495640_0235447 | |||
| 1463 | Ga0495587_0000228 | |||
| 1464 | Ga0495587_0000376 | |||
| 1465 | Ga0495587_0015528 | |||
| 1466 | Ga0495587_0096035 | |||
| 1467 | Ga0495587_0303591 | |||
| 1468 | Ga0495645_0012873 | |||
| 1469 | Ga0495645_0036433 | |||
| 1470 | Ga0495645_0093623 | |||
| 1471 | Ga0495667_0000396 | |||
| 1472 | Ga0495667_0015810 | |||
| 1473 | Ga0495667_0017978 | |||
| 1474 | Ga0495667_0065960 | |||
| 1475 | Ga0495668_0051631 | |||
| 1476 | Ga0495634_0041873 | |||
| 1477 | Ga0495634_0142855 | |||
| 1478 | Ga0495634_0714010 | |||
| 1479 | Ga0495635_0068823 | |||
| 1480 | Ga0495635_0209789 | |||
| 1481 | Ga0495659_0100834 | |||
| 1482 | Ga0495588_0042682 | |||
| 1483 | Ga0495657_0000156 | |||
| 1484 | Ga0495657_0001735 | |||
| 1485 | Ga0495657_0016689 | |||
| 1486 | Ga0495657_0102174 | |||
| 1487 | Ga0495599_0000097 | |||
| 1488 | Ga0495599_0024650 | |||
| 1489 | Ga0495599_0029592 | |||
| 1490 | Ga0495623_0000598 | |||
| 1491 | Ga0495623_0009845 | |||
| 1492 | Ga0495623_0018638 | |||
| 1493 | Ga0495623_0191761 | |||
| 1494 | Ga0495646_0010719 | |||
| 1495 | Ga0495646_0019048 | |||
| 1496 | Ga0495646_0020586 | |||
| 1497 | Ga0495646_0111413 | |||
| 1498 | Ga0495658_0035192 | |||
| 1499 | Ga0495658_0429669 | |||
| 1500 | Ga0495613_0044032 | |||
| 1501 | Ga0495613_0199172 | |||
| 1502 | Ga0495624_0108140 | |||
| 1503 | Ga0495670_0111065 | |||
| 1504 | Ga0495600_0005217 | |||
| 1505 | Ga0495600_0012217 | |||
| 1506 | Ga0495600_0030064 | |||
| 1507 | Ga0495600_0114560 | |||
| 1508 | Ga0495581_0005473 | |||
| 1509 | Ga0495581_0051180 | |||
| 1510 | Ga0495581_0169977 | |||
| 1511 | Ga0495581_0464677 | |||
| 1512 | Ga0495604_0000196 | |||
| 1513 | Ga0495604_0040446 | |||
| 1514 | Ga0495604_0106368 | |||
| 1515 | Ga0495604_0279058 | |||
| 1516 | Ga0495636_0152236 | |||
| 1517 | Ga0495674_0033589 | |||
| 1518 | Ga0495674_0039058 | |||
| 1519 | Ga0495674_0067157 | |||
| 1520 | Ga0495674_0110310 | |||
| 1521 | Ga0495674_0428851 | |||
| 1522 | Ga0495674_1101999 | |||
| 1523 | Ga0495676_0116995 | |||
| 1524 | Ga0495676_0145164 | |||
| 1525 | Ga0495680_0000226 | |||
| 1526 | Ga0495680_0003937 | |||
| 1527 | Ga0495680_0017763 | |||
| 1528 | Ga0495680_0028043 | |||
| 1529 | Ga0495675_0000536 | |||
| 1530 | Ga0495675_0012300 | |||
| 1531 | Ga0495675_0030117 | |||
| 1532 | Ga0495675_0044376 | |||
| 1533 | Ga0495677_0119242 | |||
| 1534 | Ga0495677_0313551 | |||
| 1535 | Ga0495684_0011554 | |||
| 1536 | Ga0495684_0505305 | |||
| 1537 | Ga0495593_0017425 | |||
| 1538 | Ga0495593_0021237 | |||
| 1539 | Ga0495593_0067040 | |||
| 1540 | Ga0495602_0000172 | |||
| 1541 | Ga0495602_0007430 | |||
| 1542 | Ga0495602_0037737 | |||
| 1543 | Ga0495602_0490524 | |||
| 1544 | Ga0495614_0038690 | |||
| 1545 | Ga0496100_0096525 | |||
| 1546 | Ga0496100_0281888 | |||
| 1547 | Ga0496101_0158094 | |||
| 1548 | Ga0496102_0116236 | |||
| 1549 | Ga0496102_0265711 | |||
| 1550 | Ga0496103_0544145 | |||
| 1551 | Ga0496104_0000813 | |||
| 1552 | Ga0496104_0028893 | |||
| 1553 | Ga0496104_0959758 | |||
| 1554 | Ga0496105_0037143 | |||
| 1555 | Ga0496105_0164025 | |||
| 1556 | Ga0496106_0123135 | |||
| 1557 | Ga0496107_0143639 | |||
| 1558 | Ga0496108_0003404 | |||
| 1559 | Ga0496108_0044574 | |||
| 1560 | Ga0496109_0112040 | |||
| 1561 | Ga0496109_1154008 | |||
| 1562 | Ga0496110_0043935 | |||
| 1563 | Ga0496111_0318266 | |||
| 1564 | Ga0496112_0004025 | |||
| 1565 | Ga0496112_1151352 | |||
| 1566 | Ga0496113_0286929 | |||
| 1567 | Ga0496115_0019404 | |||
| 1568 | Ga0496115_0024030 | |||
| 1569 | Ga0496115_0295379 | |||
| 1570 | Ga0496115_0347869 | |||
| 1571 | Ga0496126_0022803 | |||
| 1572 | Ga0496126_0090601 | |||
| 1573 | Ga0496126_0625705 | |||
| 1574 | Ga0501318_087358 | |||
| 1575 | Ga0501031_0306167 | |||
| 1576 | Ga0501032_0518569 | |||
| 1577 | Ga0501032_0521959 | |||
| 1578 | Ga0501034_0202283 | |||
| 1579 | Ga0501036_0000170 | |||
| 1580 | Ga0501037_0028717 | |||
| 1581 | Ga0501037_0162491 | |||
| 1582 | Ga0501038_0001501 | |||
| 1583 | Ga0501039_0698605 | |||
| 1584 | Ga0501041_1026168 | |||
| 1585 | Ga0501042_0001254 | |||
| 1586 | Ga0501043_0000648 | |||
| 1587 | Ga0501047_0011636 | |||
| 1588 | Ga0501047_0372770 | |||
| 1589 | Ga0501048_0035496 | |||
| 1590 | Ga0501069_0034330 | |||
| 1591 | Ga0501069_0547894 | |||
| 1592 | Ga0501070_0003798 | |||
| 1593 | Ga0501070_0019825 | |||
| 1594 | Ga0501073_0008157 | |||
| 1595 | Ga0501073_0012663 | |||
| 1596 | Ga0501074_0000484 | |||
| 1597 | Ga0501074_0002243 | |||
| 1598 | Ga0501079_0000159 | |||
| 1599 | Ga0501080_0004998 | |||
| 1600 | Ga0501080_0187462 | |||
| 1601 | Ga0501080_0276282 | |||
| 1602 | Ga0501080_0705820 | |||
| 1603 | Ga0501044_0397856 | |||
| 1604 | nmdc:mga05p37_2542_c1 | |||
| 1605 | nmdc:mga05p37_527_c1 | |||
| 1606 | nmdc:mga05p37_534113_c1 | |||
| 1607 | nmdc:mga09592_125911_c1 | |||
| 1608 | nmdc:mga09592_237_c1 | |||
| 1609 | nmdc:mga0qj67_10713_c1 | |||
| 1610 | nmdc:mga06r32_4457_c1 | |||
| 1611 | nmdc:mga06r32_876643_c1 | |||
| 1612 | nmdc:mga08y16_1161107_c1 | |||
| 1613 | nmdc:mga08y16_256845_c1 | |||
| 1614 | nmdc:mga08y16_4679_c1 | |||
| 1615 | nmdc:mga0n895_4012_c1 | |||
| 1616 | nmdc:mga0rr50_1090521_c1 | |||
| 1617 | nmdc:mga0rr50_28718_c1 | |||
| 1618 | nmdc:mga0rr50_71544_c1 | |||
| 1619 | nmdc:mga08x19_96989_c1 | |||
| 1620 | nmdc:mga0a205_147493_c1 | |||
| 1621 | nmdc:mga0a205_199607_c1 | |||
| 1622 | Ga0495612_0018161 | |||
| 1623 | Ga0495612_0180505 | |||
| 1624 | Ga0495595_0019153 | |||
| 1625 | Ga0495595_0049484 | |||
| 1626 | Ga0495619_0021876 | |||
| 1627 | Ga0495619_0121711 | |||
| 1628 | Ga0500568_0028236 | |||
| 1629 | Ga0501084_0257261 | |||
| 1630 | Ga0590075_014495 | |||
| 1631 | Ga0590075_017288 | |||
| 1632 | Ga0587084_156970 | |||
| 1633 | Ga0587066_145129 | |||
| 1634 | Ga0587073_0179092 | |||
| 1635 | Ga0587073_0187562 | |||
| 1636 | Ga0587082_186084 | |||
| 1637 | Ga0587088_086925 | |||
| 1638 | Ga0587092_163885 | |||
| 1639 | Ga0587113_055303 | |||
| 1640 | Ga0587067_152730 | |||
| 1641 | Ga0587069_143524 | |||
| 1642 | Ga0587078_080468 | |||
| 1643 | Ga0587107_037464 | |||
| 1644 | Ga0587114_059059 | |||
| 1645 | Ga0587111_0262498 | |||
| 1646 | Ga0466962_0071137 | |||
| 1647 | 2517763896 | |||
| 1648 | 2691513560 | |||
| 1649 | 2729906109 | |||
| 1650 | 2891403072 | |||
| 1651 | 2891554609 | |||
| 1652 | 2984580625 | |||
| 1653 | 2990258317 | |||
| 1654 | 3001891117 | |||
| 1655 | 8002777146 | |||
| 1656 | 8056066417 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n0g-assembly1.cif.gz_A | crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif | 0.928 | 2 | 136 |
| 1n0g-assembly1.cif.gz_A | crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif | 0.8774 | 2 | 136 |
| 6nzd-assembly1.cif.gz_D | cryo-em structure of the lysosomal folliculin complex (flcn-fnip2-raga-ragc-ragulator) | 0.7993 | 102 | 114 |
| 7cus-assembly1.cif.gz_A | crystal structure of the sensor domain of vbrk from vibrio parahaemolyticus | 0.6328 | 103 | 126 |
| 7f2g-assembly1.cif.gz_A | crystal structure of the sensor domain of vbrk from vibrio rotiferianus (crystal type 1) | 0.6276 | 103 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ97_1_142_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9634 | 1 | 136 | 3.40.1550.20 |
| af_P9WJN9_1_138_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9566 | 1 | 133 | 3.40.1550.20 |
| 1n0eB00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9215 | 2 | 136 | 3.40.1550.20 |
| af_Q2FZ97_1_142_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9174 | 1 | 136 | 3.40.1550.20 |
| af_P9WJN9_1_138_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9165 | 1 | 133 | 3.40.1550.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C4PYH1-F1-model_v4 | Transcriptional regulator MraZ | 0.9834 | 1 | 131 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |
| AF-A0A1S1DF99-F1-model_v4 | Transcriptional regulator MraZ | 0.9827 | 1 | 132 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |
| AF-A0A0K2RXW4-F1-model_v4 | Transcriptional regulator MraZ | 0.9779 | 11 | 132 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:0051301 GO:2000143 |
| AF-A0A2M7RCH2-F1-model_v4 | Transcriptional regulator MraZ | 0.9752 | 1 | 137 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:0051301 GO:2000143 |
| AF-A0A1F4YDA3-F1-model_v4 | Transcriptional regulator MraZ | 0.9708 | 1 | 138 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:0051301 GO:2000143 |