F482578

General Info

Members Datasets Scaffolds Average Seq Length
828 412 1656 143

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_000127|Ga0500643_000127_56299_56790
Length 163
Sequence VFLGTYLPRLDDKSRLILPAKFRDELAGGLVITKGREHCLSVYTQETFLASAAELQARLRAAADGPDKARLRAQEREFSASASDEVPDRQGRITVPGELRRYAGIDRNVVVTGILDRLEIWDVDVYRRYQAKSEAAFAEDDDWIAPDPVDRAPAAVEEDQPDS

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
192 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
225 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
250 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
251 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
252 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
261 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
266 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
269 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
273 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 2517572101 Frankia sp. DC12 Isolate Nodule
404 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
405 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
406 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
407 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
408 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
409 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
410 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
411 8002775197 Frankia nepalensis CN7 Isolate Nodule
412 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.77
Metatranscriptomes 10.02
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 0.24
Nodule 0.24
Rhizoplane 3.26
Rhizosphere 92.51
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_000127 3300053087 Bacteria 78546
2 LJQas_1013284 3300000549 Bacteria 969
3 JGI24743J22301_10061232 3300001991 Bacteria 776
4 JGI24033J26618_1023625 3300002155 Bacteria 800
5 JGI24751J29686_10053746 3300002459 Bacteria 830
6 JGI25405J52794_10023957 3300003911 Bacteria 1244
7 Ga0058863_10003683 3300004799 Bacteria 658
8 Ga0058861_10022460 3300004800 Bacteria 650
9 Ga0058861_10057497 3300004800 Bacteria 861
10 Ga0058861_11822019 3300004800 Bacteria 705
11 Ga0058862_10024687 3300004803 Bacteria 765
12 Ga0058862_10151194 3300004803 Bacteria 868
13 Ga0058862_11010846 3300004803 Bacteria 633
14 Ga0058862_12004185 3300004803 Bacteria 608
15 Ga0070658_10001791 3300005327 Bacteria 18063
16 Ga0070658_10650125 3300005327 Bacteria 915
17 Ga0070676_10066824 3300005328 Bacteria 2148
18 Ga0070683_100234000 3300005329 Bacteria 1747
19 Ga0070683_100356721 3300005329 Bacteria 1392
20 Ga0070690_100471266 3300005330 Bacteria 934
21 Ga0070670_100231426 3300005331 Bacteria 1608
22 Ga0070677_10125079 3300005333 Bacteria 1166
23 Ga0068869_100061998 3300005334 Bacteria 2744
24 Ga0070680_100113750 3300005336 Bacteria 2254
25 Ga0070680_100339182 3300005336 Bacteria 1277
26 Ga0070680_100977900 3300005336 Bacteria 731
27 Ga0070682_100022244 3300005337 Bacteria 3753
28 Ga0068868_100047275 3300005338 Bacteria 3371
29 Ga0068868_100081564 3300005338 Bacteria 2593
30 Ga0070691_10027814 3300005341 Bacteria 2639
31 Ga0070691_10241228 3300005341 Bacteria 966
32 Ga0070661_100246882 3300005344 Bacteria 1376
33 Ga0070692_10012144 3300005345 Bacteria 3975
34 Ga0070668_100757265 3300005347 Bacteria 860
35 Ga0070675_100095022 3300005354 Bacteria 2502
36 Ga0070671_100191274 3300005355 Bacteria 1734
37 Ga0070673_100370209 3300005364 Bacteria 1276
38 Ga0070673_100506946 3300005364 Bacteria 1092
39 Ga0070688_100011303 3300005365 Bacteria 4959
40 Ga0070659_100280324 3300005366 Bacteria 1386
41 Ga0070659_100312975 3300005366 Bacteria 1311
42 Ga0070667_100461799 3300005367 Bacteria 1161
43 Ga0070709_10000132 3300005434 Bacteria 49598
44 Ga0070709_10011218 3300005434 Bacteria 4985
45 Ga0070709_10015898 3300005434 Bacteria 4286
46 Ga0070709_10024697 3300005434 Bacteria 3540
47 Ga0070709_10057263 3300005434 Bacteria 2468
48 Ga0070709_10172670 3300005434 Bacteria 1512
49 Ga0070709_10992509 3300005434 Bacteria 668
50 Ga0070714_100000290 3300005435 Bacteria 38379
51 Ga0070714_100001047 3300005435 Bacteria 19734
52 Ga0070714_100017866 3300005435 Bacteria 5751
53 Ga0070714_100034845 3300005435 Bacteria 4216
54 Ga0070714_100069282 3300005435 Bacteria 3046
55 Ga0070714_100087914 3300005435 Bacteria 2718
56 Ga0070714_100433439 3300005435 Bacteria 1247
57 Ga0070714_100437033 3300005435 Bacteria 1241
58 Ga0070714_100579005 3300005435 Bacteria 1077
59 Ga0070714_101401460 3300005435 Bacteria 682
60 Ga0070713_100000696 3300005436 Bacteria 21617
61 Ga0070713_100003571 3300005436 Bacteria 10274
62 Ga0070713_100011260 3300005436 Bacteria 6506
63 Ga0070713_100033062 3300005436 Bacteria 4140
64 Ga0070713_100058884 3300005436 Bacteria 3205
65 Ga0070713_100082795 3300005436 Bacteria 2741
66 Ga0070713_100172641 3300005436 Bacteria 1938
67 Ga0070713_100320495 3300005436 Bacteria 1431
68 Ga0070713_100614335 3300005436 Bacteria 1033
69 Ga0070713_100630983 3300005436 Bacteria 1019
70 Ga0070710_10001105 3300005437 Bacteria 12767
71 Ga0070710_10005739 3300005437 Bacteria 5911
72 Ga0070710_10009941 3300005437 Bacteria 4664
73 Ga0070710_10114743 3300005437 Bacteria 1623
74 Ga0070710_10250329 3300005437 Bacteria 1139
75 Ga0070710_10782585 3300005437 Bacteria 680
76 Ga0070701_10018729 3300005438 Bacteria 3258
77 Ga0070711_100017156 3300005439 Bacteria 4607
78 Ga0070711_100340989 3300005439 Bacteria 1202
79 Ga0070711_100452922 3300005439 Bacteria 1051
80 Ga0070705_100046994 3300005440 Bacteria 2492
81 Ga0070700_100081141 3300005441 Bacteria 2095
82 Ga0070694_101192738 3300005444 Bacteria 638
83 Ga0070708_100045744 3300005445 Bacteria 3858
84 Ga0070708_100439328 3300005445 Bacteria 1231
85 Ga0070708_101009980 3300005445 Bacteria 780
86 Ga0070663_100003030 3300005455 Bacteria 9596
87 Ga0070663_100548016 3300005455 Bacteria 966
88 Ga0070678_100778004 3300005456 Bacteria 867
89 Ga0070681_10184721 3300005458 Bacteria 2006
90 Ga0070681_10430509 3300005458 Bacteria 1231
91 Ga0070681_11772525 3300005458 Bacteria 544
92 Ga0068867_100995728 3300005459 Bacteria 760
93 Ga0070685_10020070 3300005466 Bacteria 3614
94 Ga0070706_100003733 3300005467 Bacteria 14884
95 Ga0070706_100109139 3300005467 Bacteria 2575
96 Ga0070706_100462386 3300005467 Bacteria 1180
97 Ga0070707_100382565 3300005468 Bacteria 1367
98 Ga0070707_100709054 3300005468 Bacteria 969
99 Ga0070698_100000354 3300005471 Bacteria 47476
100 Ga0070698_100021520 3300005471 Bacteria 6755
101 Ga0070679_100099789 3300005530 Bacteria 2890
102 Ga0070679_100116027 3300005530 Bacteria 2662
103 Ga0070679_100263019 3300005530 Bacteria 1680
104 Ga0070679_100320162 3300005530 Bacteria 1500
105 Ga0070679_100676505 3300005530 Bacteria 975
106 Ga0070679_101986266 3300005530 Bacteria 531
107 Ga0070684_100126029 3300005535 Bacteria 2307
108 Ga0070684_100960364 3300005535 Bacteria 802
109 Ga0070672_100679274 3300005543 Bacteria 901
110 Ga0070686_100302162 3300005544 Bacteria 1187
111 Ga0070695_100539247 3300005545 Bacteria 908
112 Ga0070695_101047610 3300005545 Bacteria 665
113 Ga0070696_101656050 3300005546 Bacteria 551
114 Ga0070693_100004054 3300005547 Bacteria 6894
115 Ga0070665_100136172 3300005548 Bacteria 2459
116 Ga0070665_100201330 3300005548 Bacteria 1992
117 Ga0070704_100185393 3300005549 Bacteria 1668
118 Ga0070704_100408796 3300005549 Bacteria 1160
119 Ga0068855_100019122 3300005563 Bacteria 8231
120 Ga0068855_100053197 3300005563 Bacteria 4765
121 Ga0068855_100484173 3300005563 Bacteria 1346
122 Ga0068855_102199985 3300005563 Bacteria 554
123 Ga0070664_100263569 3300005564 Bacteria 1551
124 Ga0068857_100738373 3300005577 Bacteria 937
125 Ga0068857_100950433 3300005577 Bacteria 826
126 Ga0068854_100102269 3300005578 Bacteria 2150
127 Ga0068856_100001364 3300005614 Bacteria 25676
128 Ga0068856_100024135 3300005614 Bacteria 5917
129 Ga0068856_100109542 3300005614 Bacteria 2758
130 Ga0068856_100482513 3300005614 Bacteria 1261
131 Ga0070702_100010326 3300005615 Bacteria 4593
132 Ga0068852_101114471 3300005616 Bacteria 809
133 Ga0068859_100062471 3300005617 Bacteria 3755
134 Ga0068864_100717789 3300005618 Bacteria 977
135 Ga0068861_102237271 3300005719 Bacteria 548
136 Ga0068851_10010718 3300005834 Bacteria 4283
137 Ga0068870_10044947 3300005840 Bacteria 2310
138 Ga0068870_10471284 3300005840 Bacteria 831
139 Ga0068863_100196808 3300005841 Bacteria 1937
140 Ga0068858_100064792 3300005842 Bacteria 3382
141 Ga0068858_100079457 3300005842 Bacteria 3048
142 Ga0068860_100081053 3300005843 Bacteria 3086
143 Ga0068860_100679330 3300005843 Bacteria 1039
144 Ga0068862_101108925 3300005844 Bacteria 787
145 Ga0081455_10000128 3300005937 Bacteria 88444
146 Ga0081455_10006978 3300005937 Bacteria 12003
147 Ga0081538_10001888 3300005981 Bacteria 21088
148 Ga0081538_10014035 3300005981 Bacteria 6298
149 Ga0081540_1001223 3300005983 Bacteria 22441
150 Ga0081540_1056794 3300005983 Bacteria 1897
151 Ga0081540_1087893 3300005983 Bacteria 1376
152 Ga0081539_10152964 3300005985 Bacteria 1108
153 Ga0070717_10016338 3300006028 Bacteria 5753
154 Ga0070717_10023113 3300006028 Bacteria 4922
155 Ga0070717_10024558 3300006028 Bacteria 4788
156 Ga0070717_10074698 3300006028 Bacteria 2834
157 Ga0070717_10253439 3300006028 Bacteria 1555
158 Ga0070717_10276875 3300006028 Bacteria 1487
159 Ga0070717_10459271 3300006028 Bacteria 1148
160 Ga0070717_10464770 3300006028 Bacteria 1141
161 Ga0070717_10524628 3300006028 Bacteria 1071
162 Ga0075432_10298202 3300006058 Bacteria 668
163 Ga0070715_10021861 3300006163 Bacteria 2486
164 Ga0070715_10032780 3300006163 Bacteria 2119
165 Ga0070715_10353800 3300006163 Bacteria 803
166 Ga0070716_100000088 3300006173 Bacteria 36109
167 Ga0070716_100001767 3300006173 Bacteria 9771
168 Ga0070716_100405165 3300006173 Bacteria 982
169 Ga0070716_100719858 3300006173 Bacteria 764
170 Ga0070712_100000796 3300006175 Bacteria 18678
171 Ga0070712_100034900 3300006175 Bacteria 3411
172 Ga0070712_100039248 3300006175 Bacteria 3240
173 Ga0070712_100130155 3300006175 Bacteria 1906
174 Ga0070712_100346477 3300006175 Bacteria 1215
175 Ga0070712_100355226 3300006175 Bacteria 1200
176 Ga0097621_100023467 3300006237 Bacteria 4803
177 Ga0097621_100355141 3300006237 Unclassified 1304
178 Ga0097621_100585479 3300006237 Bacteria 1018
179 Ga0068871_100064130 3300006358 Bacteria 3007
180 Ga0068871_100211229 3300006358 Bacteria 1678
181 Ga0068871_100601052 3300006358 Bacteria 1000
182 Ga0075428_100005771 3300006844 Bacteria 13745
183 Ga0075428_100527052 3300006844 Bacteria 1263
184 Ga0075428_100534086 3300006844 Bacteria 1254
185 Ga0075430_100024721 3300006846 Bacteria 5110
186 Ga0075430_100920719 3300006846 Bacteria 720
187 Ga0075431_100037096 3300006847 Bacteria 5022
188 Ga0075431_100064702 3300006847 Bacteria 3776
189 Ga0075433_10002154 3300006852 Bacteria 14918
190 Ga0075433_10082334 3300006852 Bacteria 2838
191 Ga0075433_10297209 3300006852 Bacteria 1430
192 Ga0075434_100002741 3300006871 Bacteria 15572
193 Ga0075429_100001979 3300006880 Bacteria 17031
194 Ga0075429_100212067 3300006880 Bacteria 1697
195 Ga0075436_100001784 3300006914 Bacteria 14746
196 Ga0075436_100030847 3300006914 Bacteria 3689
197 Ga0097620_100062470 3300006931 Bacteria 3755
198 Ga0075435_100032515 3300007076 Bacteria 4120
199 Ga0075435_101145379 3300007076 Bacteria 680
200 Ga0075435_101236816 3300007076 Bacteria 653
201 Ga0105251_10054389 3300009011 Bacteria 1901
202 Ga0105240_10003563 3300009093 Bacteria 24152
203 Ga0105240_10251875 3300009093 Bacteria 2042
204 Ga0105240_10708553 3300009093 Bacteria 1098
205 Ga0111539_10006043 3300009094 Bacteria 15633
206 Ga0111539_10253633 3300009094 Bacteria 2048
207 Ga0105245_10101474 3300009098 Bacteria 2664
208 Ga0105247_10039895 3300009101 Bacteria 2869
209 Ga0114129_10002252 3300009147 Bacteria 26655
210 Ga0114129_10008519 3300009147 Bacteria 14616
211 Ga0114129_10218138 3300009147 Bacteria 2575
212 Ga0105243_10240133 3300009148 Bacteria 1612
213 Ga0105241_10004090 3300009174 Bacteria 10780
214 Ga0105241_10061597 3300009174 Bacteria 2890
215 Ga0105241_10344095 3300009174 Bacteria 1293
216 Ga0105248_10656425 3300009177 Bacteria 1183
217 Ga0105248_11582736 3300009177 Bacteria 742
218 Ga0105237_10242007 3300009545 Bacteria 1805
219 Ga0105237_11009983 3300009545 Bacteria 839
220 Ga0105238_10108171 3300009551 Bacteria 2761
221 Ga0105238_10538083 3300009551 Bacteria 1172
222 Ga0105238_10930257 3300009551 Bacteria 888
223 Ga0105249_11004008 3300009553 Bacteria 903
224 Ga0099796_10429247 3300010159 Bacteria 584
225 Ga0105239_10215638 3300010375 Bacteria 2152
226 Ga0105239_11044741 3300010375 Bacteria 940
227 Ga0105239_11436469 3300010375 Bacteria 797
228 Ga0105246_10028661 3300011119 Bacteria 3660
229 Ga0105246_10031827 3300011119 Bacteria 3493
230 Ga0154010_158913 3300013062 Bacteria 667
231 Ga0157370_10006131 3300013104 Bacteria 13341
232 Ga0157369_10091142 3300013105 Bacteria 3254
233 Ga0157369_10109792 3300013105 Bacteria 2932
234 Ga0157369_11967129 3300013105 Bacteria 593
235 Ga0157374_10027064 3300013296 Bacteria 5167
236 Ga0157374_10128896 3300013296 Bacteria 2447
237 Ga0157374_10215911 3300013296 Bacteria 1881
238 Ga0163162_10026734 3300013306 Bacteria 5706
239 Ga0163162_10551593 3300013306 Bacteria 1281
240 Ga0157372_10028155 3300013307 Bacteria 6130
241 Ga0157372_10266181 3300013307 Bacteria 1991
242 Ga0157372_10871921 3300013307 Bacteria 1045
243 Ga0157375_10582005 3300013308 Bacteria 1280
244 Ga0163163_10501639 3300014325 Bacteria 1275
245 Ga0163163_10526492 3300014325 Bacteria 1244
246 Ga0163163_11429521 3300014325 Bacteria 753
247 Ga0182008_10093035 3300014497 Bacteria 1487
248 Ga0157377_10001915 3300014745 Bacteria 9110
249 Ga0157377_10816367 3300014745 Bacteria 689
250 Ga0157379_10020127 3300014968 Bacteria 5898
251 Ga0157376_10008666 3300014969 Bacteria 7352
252 Ga0157376_11296491 3300014969 Bacteria 758
253 Ga0184601_114265 3300019183 Bacteria 579
254 Ga0184600_116695 3300019190 Bacteria 611
255 Ga0197907_10230096 3300020069 Bacteria 807
256 Ga0197907_10862593 3300020069 Bacteria 563
257 Ga0206356_10083947 3300020070 Bacteria 3290
258 Ga0206356_10565981 3300020070 Bacteria 569
259 Ga0206356_10969686 3300020070 Bacteria 1293
260 Ga0206349_1228606 3300020075 Bacteria 998
261 Ga0206349_1321091 3300020075 Bacteria 676
262 Ga0206349_1514218 3300020075 Bacteria 1172
263 Ga0206355_1462003 3300020076 Bacteria 699
264 Ga0206355_1650148 3300020076 Bacteria 678
265 Ga0206355_1705157 3300020076 Bacteria 649
266 Ga0206351_10165417 3300020077 Bacteria 625
267 Ga0206351_10815914 3300020077 Bacteria 830
268 Ga0206352_10036563 3300020078 Bacteria 669
269 Ga0206352_10310989 3300020078 Bacteria 1107
270 Ga0206352_10834661 3300020078 Bacteria 558
271 Ga0206350_10273622 3300020080 Bacteria 688
272 Ga0206350_10584984 3300020080 Bacteria 635
273 Ga0206350_10787066 3300020080 Bacteria 562
274 Ga0206350_11162888 3300020080 Bacteria 528
275 Ga0206350_11357921 3300020080 Bacteria 881
276 Ga0206354_10140459 3300020081 Bacteria 769
277 Ga0206354_11022824 3300020081 Bacteria 560
278 Ga0206353_10120679 3300020082 Bacteria 626
279 Ga0206353_10397058 3300020082 Bacteria 515
280 Ga0154015_1056023 3300020610 Bacteria 639
281 Ga0154015_1214535 3300020610 Bacteria 656
282 Ga0154015_1223142 3300020610 Bacteria 600
283 Ga0154015_1271578 3300020610 Bacteria 669
284 Ga0213875_10002941 3300021388 Bacteria 9926
285 Ga0224712_10007480 3300022467 Bacteria 3183
286 Ga0224712_10444849 3300022467 Bacteria 622
287 Ga0224712_10563885 3300022467 Bacteria 554
288 Ga0224712_10658432 3300022467 Bacteria 514
289 Ga0256720_121953 3300023438 Bacteria 553
290 Ga0224572_1005428 3300024225 Bacteria 2272
291 Ga0207692_10000891 3300025898 Bacteria 10795
292 Ga0207692_10002245 3300025898 Bacteria 7392
293 Ga0207692_10055424 3300025898 Bacteria 2029
294 Ga0207692_10086698 3300025898 Bacteria 1687
295 Ga0207692_10177937 3300025898 Bacteria 1237
296 Ga0207692_10470833 3300025898 Bacteria 794
297 Ga0207688_10044815 3300025901 Bacteria 2465
298 Ga0207647_10101992 3300025904 Bacteria 1702
299 Ga0207685_10075549 3300025905 Bacteria 1379
300 Ga0207685_10128070 3300025905 Bacteria 1123
301 Ga0207699_10000165 3300025906 Bacteria 40682
302 Ga0207699_10001689 3300025906 Bacteria 10442
303 Ga0207699_10082244 3300025906 Bacteria 2000
304 Ga0207699_10183239 3300025906 Bacteria 1409
305 Ga0207699_10322605 3300025906 Bacteria 1084
306 Ga0207699_10549333 3300025906 Bacteria 838
307 Ga0207645_10028105 3300025907 Bacteria 3632
308 Ga0207643_10035728 3300025908 Bacteria 2787
309 Ga0207643_10447635 3300025908 Bacteria 821
310 Ga0207705_10169901 3300025909 Bacteria 1641
311 Ga0207705_10261836 3300025909 Bacteria 1320
312 Ga0207705_10993877 3300025909 Bacteria 648
313 Ga0207684_10132377 3300025910 Bacteria 2140
314 Ga0207684_10240698 3300025910 Bacteria 1561
315 Ga0207654_10014200 3300025911 Bacteria 4112
316 Ga0207654_10031882 3300025911 Bacteria 2907
317 Ga0207707_10422298 3300025912 Bacteria 1143
318 Ga0207707_11017371 3300025912 Bacteria 679
319 Ga0207695_10050307 3300025913 Bacteria 4385
320 Ga0207695_10481201 3300025913 Bacteria 1124
321 Ga0207695_10565236 3300025913 Bacteria 1019
322 Ga0207671_10295660 3300025914 Bacteria 1279
323 Ga0207693_10000836 3300025915 Bacteria 27414
324 Ga0207693_10081949 3300025915 Bacteria 2526
325 Ga0207693_10133919 3300025915 Bacteria 1948
326 Ga0207693_10135726 3300025915 Bacteria 1934
327 Ga0207693_10294799 3300025915 Bacteria 1271
328 Ga0207693_10297108 3300025915 Bacteria 1265
329 Ga0207663_10005552 3300025916 Bacteria 6366
330 Ga0207663_10021183 3300025916 Bacteria 3697
331 Ga0207663_10027678 3300025916 Bacteria 3308
332 Ga0207663_10199847 3300025916 Bacteria 1441
333 Ga0207663_10897077 3300025916 Bacteria 709
334 Ga0207660_10096989 3300025917 Bacteria 2196
335 Ga0207660_11006275 3300025917 Bacteria 680
336 Ga0207657_10009363 3300025919 Bacteria 9851
337 Ga0207657_10134398 3300025919 Bacteria 2025
338 Ga0207657_10985597 3300025919 Bacteria 647
339 Ga0207649_10530871 3300025920 Bacteria 898
340 Ga0207649_11197249 3300025920 Bacteria 600
341 Ga0207652_10065455 3300025921 Bacteria 3148
342 Ga0207652_10124386 3300025921 Bacteria 2297
343 Ga0207652_10570322 3300025921 Bacteria 1016
344 Ga0207652_11184831 3300025921 Bacteria 665
345 Ga0207646_10774239 3300025922 Bacteria 856
346 Ga0207681_11202526 3300025923 Bacteria 637
347 Ga0207694_10273727 3300025924 Bacteria 1385
348 Ga0207650_10740963 3300025925 Bacteria 831
349 Ga0207659_10109494 3300025926 Bacteria 2097
350 Ga0207687_10028797 3300025927 Bacteria 3732
351 Ga0207700_10000297 3300025928 Bacteria 29514
352 Ga0207700_10010224 3300025928 Bacteria 5906
353 Ga0207700_10017378 3300025928 Bacteria 4804
354 Ga0207700_10028955 3300025928 Bacteria 3903
355 Ga0207700_10070358 3300025928 Bacteria 2689
356 Ga0207700_10104397 3300025928 Bacteria 2267
357 Ga0207700_10180715 3300025928 Bacteria 1766
358 Ga0207664_10000224 3300025929 Bacteria 42785
359 Ga0207664_10006027 3300025929 Bacteria 8298
360 Ga0207664_10009651 3300025929 Bacteria 6783
361 Ga0207664_10014932 3300025929 Bacteria 5623
362 Ga0207664_10058173 3300025929 Bacteria 3075
363 Ga0207664_10176015 3300025929 Bacteria 1834
364 Ga0207664_10367620 3300025929 Bacteria 1275
365 Ga0207664_10452699 3300025929 Bacteria 1146
366 Ga0207664_10685709 3300025929 Bacteria 921
367 Ga0207644_10079790 3300025931 Bacteria 2415
368 Ga0207690_10492427 3300025932 Bacteria 991
369 Ga0207690_10737970 3300025932 Bacteria 811
370 Ga0207706_10154785 3300025933 Bacteria 2016
371 Ga0207665_10000698 3300025939 Bacteria 22766
372 Ga0207665_10005623 3300025939 Bacteria 8356
373 Ga0207665_10300461 3300025939 Bacteria 1200
374 Ga0207665_11397442 3300025939 Bacteria 557
375 Ga0207691_10141982 3300025940 Bacteria 2116
376 Ga0207711_10286352 3300025941 Bacteria 1518
377 Ga0207661_10002395 3300025944 Bacteria 12912
378 Ga0207661_10300974 3300025944 Bacteria 1438
379 Ga0207679_10289685 3300025945 Bacteria 1407
380 Ga0207667_10024935 3300025949 Bacteria 6556
381 Ga0207667_10068805 3300025949 Bacteria 3685
382 Ga0207667_10787001 3300025949 Bacteria 949
383 Ga0207667_11286746 3300025949 Bacteria 708
384 Ga0207667_11687128 3300025949 Bacteria 600
385 Ga0207651_10087033 3300025960 Bacteria 2273
386 Ga0207651_10979754 3300025960 Bacteria 755
387 Ga0207712_10529207 3300025961 Bacteria 1011
388 Ga0207677_10070453 3300026023 Bacteria 2464
389 Ga0207703_10032686 3300026035 Bacteria 4118
390 Ga0207703_10102847 3300026035 Bacteria 2424
391 Ga0207639_10398577 3300026041 Bacteria 1239
392 Ga0207639_10824172 3300026041 Bacteria 865
393 Ga0207678_10007707 3300026067 Bacteria 9510
394 Ga0207678_10009072 3300026067 Bacteria 8757
395 Ga0207708_10114430 3300026075 Bacteria 2097
396 Ga0207702_10012351 3300026078 Bacteria 7109
397 Ga0207702_10028083 3300026078 Bacteria 4675
398 Ga0207702_10146497 3300026078 Bacteria 2143
399 Ga0207641_11144090 3300026088 Bacteria 777
400 Ga0207648_11050840 3300026089 Bacteria 763
401 Ga0207676_10002884 3300026095 Bacteria 12252
402 Ga0207674_10030548 3300026116 Bacteria 5663
403 Ga0207674_10106859 3300026116 Bacteria 2776
404 Ga0207674_10299362 3300026116 Bacteria 1557
405 Ga0207674_10757607 3300026116 Bacteria 937
406 Ga0207675_100281140 3300026118 Bacteria 1617
407 Ga0207675_101760697 3300026118 Bacteria 639
408 Ga0207683_10007957 3300026121 Bacteria 9066
409 Ga0207683_10366722 3300026121 Bacteria 1323
410 Ga0207698_10631725 3300026142 Bacteria 1059
411 Ga0207698_10783979 3300026142 Bacteria 954
412 Ga0207698_11227764 3300026142 Bacteria 764
413 Ga0209588_1023459 3300027671 Bacteria 1944
414 Ga0207428_10005504 3300027907 Bacteria 11799
415 Ga0207428_10091244 3300027907 Bacteria 2365
416 Ga0268266_10184805 3300028379 Bacteria 1900
417 Ga0268266_10367152 3300028379 Bacteria 1355
418 Ga0268264_10101885 3300028381 Bacteria 2497
419 Ga0311003_155033 3300029282 Bacteria 640
420 Ga0265762_1020485 3300030760 Bacteria 1216
421 Ga0265767_115009 3300030836 Bacteria 554
422 Ga0265766_1003422 3300030863 Bacteria 925
423 Ga0265766_1004977 3300030863 Bacteria 829
424 Ga0265766_1007092 3300030863 Bacteria 747
425 Ga0265766_1022794 3300030863 Bacteria 525
426 Ga0265766_1026404 3300030863 Bacteria 501
427 Ga0265770_1021530 3300030878 Bacteria 1026
428 Ga0265769_108833 3300030888 Bacteria 669
429 Ga0265768_108041 3300030963 Bacteria 650
430 Ga0265771_1005649 3300031010 Bacteria 803
431 Ga0265325_10008964 3300031241 Bacteria 5875
432 Ga0265340_10021908 3300031247 Bacteria 3272
433 Ga0265339_10320460 3300031249 Bacteria 735
434 Ga0265331_10102826 3300031250 Bacteria 1314
435 Ga0265316_10228723 3300031344 Bacteria 1370
436 Ga0307408_100087740 3300031548 Bacteria 2341
437 Ga0307408_100174573 3300031548 Bacteria 1718
438 Ga0307408_100966294 3300031548 Bacteria 783
439 Ga0310116_123310 3300031591 Bacteria 501
440 Ga0310117_121382 3300031592 Bacteria 645
441 Ga0265313_10119832 3300031595 Bacteria 1149
442 Ga0310103_117113 3300031614 Bacteria 946
443 Ga0307508_10089865 3300031616 Bacteria 2657
444 Ga0265342_10131091 3300031712 Bacteria 1405
445 Ga0316576_10003781 3300031727 Bacteria 8946
446 Ga0316578_10072412 3300031728 Bacteria 2041
447 Ga0307516_10349672 3300031730 Bacteria 1144
448 Ga0307405_10055944 3300031731 Bacteria 2471
449 Ga0307405_10123988 3300031731 Bacteria 1773
450 Ga0307405_10368882 3300031731 Bacteria 1113
451 Ga0307405_10428537 3300031731 Bacteria 1043
452 Ga0307413_10295317 3300031824 Bacteria 1226
453 Ga0307413_10651913 3300031824 Bacteria 868
454 Ga0307410_10092293 3300031852 Bacteria 2152
455 Ga0307410_10321646 3300031852 Bacteria 1227
456 Ga0307410_10518297 3300031852 Bacteria 983
457 Ga0307407_10143727 3300031903 Bacteria 1542
458 Ga0307412_10005940 3300031911 Bacteria 6882
459 Ga0307412_10012266 3300031911 Bacteria 4990
460 Ga0307409_100042992 3300031995 Bacteria 3388
461 Ga0307409_100089454 3300031995 Bacteria 2517
462 Ga0307409_101047558 3300031995 Bacteria 835
463 Ga0307416_100009886 3300032002 Bacteria 6273
464 Ga0307416_100041985 3300032002 Bacteria 3567
465 Ga0307416_100194388 3300032002 Bacteria 1917
466 Ga0307416_100294183 3300032002 Bacteria 1609
467 Ga0307416_101024084 3300032002 Bacteria 929
468 Ga0307411_10346058 3300032005 Bacteria 1210
469 Ga0307411_10473658 3300032005 Bacteria 1053
470 Ga0307411_11842947 3300032005 Bacteria 562
471 Ga0316053_119824 3300032120 Bacteria 522
472 Ga0307415_100169606 3300032126 Bacteria 1700
473 Ga0316212_1020082 3300033547 Bacteria 938
474 Ga0316216_1002509 3300033548 Bacteria 1308
475 Ga0373926_0213826 3300035083 Bacteria 743
476 Ga0373926_0414878 3300035083 Bacteria 532
477 Ga0373928_0265182 3300035084 Bacteria 516
478 Ga0373934_0000337 3300035086 Bacteria 16404
479 Ga0373934_0000541 3300035086 Bacteria 13316
480 Ga0373934_0075731 3300035086 Bacteria 1349
481 Ga0373944_0108617 3300035089 Bacteria 945
482 Ga0373944_0312767 3300035089 Bacteria 591
483 Ga0373949_0085847 3300035090 Bacteria 845
484 Ga0373923_0017622 3300035111 Bacteria 2734
485 Ga0373923_0405023 3300035111 Bacteria 657
486 Ga0373936_0068383 3300035113 Bacteria 1460
487 Ga0373936_0091154 3300035113 Bacteria 1278
488 Ga0373945_0010599 3300035116 Bacteria 3037
489 Ga0373953_0009454 3300035117 Bacteria 3356
490 Ga0373954_0010264 3300035118 Bacteria 4130
491 Ga0373956_0001267 3300035119 Bacteria 10466
492 Ga0373957_0000146 3300035120 Bacteria 17727
493 Ga0373957_0002029 3300035120 Bacteria 5668
494 Ga0373943_0070264 3300035170 Bacteria 1771
495 Ga0373943_0587163 3300035170 Bacteria 655
496 Ga0373946_0042214 3300035171 Bacteria 1874
497 Ga0373946_0054620 3300035171 Bacteria 1681
498 Ga0373955_0000024 3300035172 Bacteria 60102
499 Ga0373955_0004403 3300035172 Bacteria 6234
500 Ga0373955_0035955 3300035172 Bacteria 2626
501 Ga0373955_0492441 3300035172 Bacteria 748
502 Ga0316574_0067880 3300035398 Bacteria 2248
503 Ga0373924_0003094 3300035410 Bacteria 5678
504 Ga0373924_0018354 3300035410 Bacteria 2694
505 Ga0373924_0362983 3300035410 Bacteria 646
506 Ga0373935_0014464 3300035692 Bacteria 4761
507 Ga0373935_0140621 3300035692 Bacteria 1630
508 Ga0373935_0779385 3300035692 Bacteria 705
509 Ga0373927_0200993 3300035695 Bacteria 1308
510 Ga0373933_0001020 3300035724 Bacteria 17008
511 Ga0373933_0057502 3300035724 Bacteria 2337
512 Ga0373933_0083274 3300035724 Bacteria 1964
513 Ga0373933_0215019 3300035724 Bacteria 1232
514 Ga0373947_0772929 3300035725 Bacteria 655
515 Ga0373937_0000333 3300036401 Bacteria 44782
516 Ga0373937_0007305 3300036401 Bacteria 9563
517 Ga0373937_1126012 3300036401 Bacteria 733
518 Ga0265778_037574 3300036457 Bacteria 640
519 Ga0310112_031912 3300036458 Bacteria 722
520 Ga0310112_049966 3300036458 Bacteria 568
521 Ga0310112_053988 3300036458 Bacteria 546
522 Ga0372808_039577 3300036459 Bacteria 676
523 Ga0372808_042148 3300036459 Bacteria 654
524 Ga0310109_016022 3300036534 Bacteria 1015
525 Ga0316584_0395693 3300036712 Bacteria 985
526 Ga0373925_0008937 3300037068 Bacteria 7300
527 Ga0373925_0013418 3300037068 Bacteria 5928
528 Ga0373925_0679740 3300037068 Bacteria 848
529 Ga0395899_0122010 3300037312 Bacteria 1866
530 Ga0395900_0212618 3300037418 Bacteria 1952
531 Ga0395898_0047501 3300037466 Bacteria 4213
532 Ga0395905_1460505 3300037471 Bacteria 588
533 Ga0436364_0557549 3300037853 Bacteria 2402
534 Ga0436364_1499747 3300037853 Bacteria 1222
535 Ga0395901_0217393 3300038443 Bacteria 1998
536 Ga0400485_17869 3300038735 Bacteria 38883
537 Ga0400486_31407 3300038742 Bacteria 45426
538 Ga0436365_1415915 3300039437 Bacteria 1032
539 Ga0436363_1260454 3300039450 Bacteria 795
540 Ga0436363_1543764 3300039450 Bacteria 830
541 Ga0439436_0026794 3300041404 Bacteria 1688
542 Ga0439438_021641 3300041405 Bacteria 1791
543 Ga0439466_0076083 3300041411 Bacteria 1063
544 Ga0439465_0031662 3300041413 Bacteria 1686
545 Ga0451789_0023683 3300041443 Bacteria 531
546 Ga0439433_0029489 3300041999 Bacteria 1252
547 Ga0439448_0004728 3300042005 Bacteria 3854
548 Ga0439449_0000737 3300042007 Bacteria 12569
549 Ga0439449_0073771 3300042007 Bacteria 1257
550 Ga0439452_045638 3300042010 Bacteria 1019
551 Ga0439455_0094789 3300042012 Bacteria 821
552 Ga0450905_021882 3300042142 Bacteria 948
553 Ga0439458_0005335 3300042157 Bacteria 2892
554 Ga0439464_0019502 3300042439 Bacteria 1852
555 Ga0466961_0112876 3300044693 Bacteria 1709
556 Ga0466963_0160124 3300044694 Bacteria 1566
557 Ga0466963_0165259 3300044694 Bacteria 1542
558 Ga0466963_0608207 3300044694 Bacteria 772
559 Ga0466963_0782802 3300044694 Bacteria 673
560 Ga0466963_0870207 3300044694 Bacteria 635
561 Ga0466964_0022535 3300044706 Bacteria 2445
562 Ga0466964_0203660 3300044706 Unclassified 951
563 Ga0466968_0207549 3300044735 Bacteria 919
564 Ga0466968_0656598 3300044735 Bacteria 533
565 Ga0466957_0448004 3300044842 Bacteria 889
566 Ga0466959_0861054 3300045049 Bacteria 605
567 Ga0466958_0002183 3300045836 Bacteria 9745
568 Ga0466958_0270867 3300045836 Bacteria 1087
569 Ga0466967_0003203 3300045976 Bacteria 10566
570 Ga0466967_0006784 3300045976 Bacteria 8158
571 Ga0466967_0372653 3300045976 Bacteria 1385
572 Ga0466967_0912671 3300045976 Bacteria 874
573 Ga0495592_0000304 3300046454 Bacteria 41482
574 Ga0495592_0004635 3300046454 Bacteria 10070
575 Ga0495592_0047028 3300046454 Bacteria 3214
576 Ga0495603_0039447 3300046455 Bacteria 2829
577 Ga0495603_0390028 3300046455 Bacteria 798
578 Ga0495629_0106780 3300046459 Bacteria 1953
579 Ga0495629_0108954 3300046459 Bacteria 1931
580 Ga0495629_0199752 3300046459 Bacteria 1382
581 Ga0495629_0413894 3300046459 Bacteria 915
582 Ga0495629_0592907 3300046459 Bacteria 742
583 Ga0495641_0040151 3300046461 Bacteria 2177
584 Ga0495651_0000252 3300046462 Bacteria 41425
585 Ga0495651_0003277 3300046462 Bacteria 12427
586 Ga0495651_0018040 3300046462 Bacteria 5463
587 Ga0495651_0462691 3300046462 Bacteria 818
588 Ga0495653_0001371 3300046463 Bacteria 18922
589 Ga0495653_0009566 3300046463 Bacteria 7928
590 Ga0495653_0015034 3300046463 Bacteria 6310
591 Ga0495653_0167270 3300046463 Bacteria 1521
592 Ga0495653_0455199 3300046463 Bacteria 804
593 Ga0495580_0793098 3300046472 Bacteria 614
594 Ga0495582_0034281 3300046473 Bacteria 2790
595 Ga0495582_0264046 3300046473 Bacteria 987
596 Ga0495639_0001540 3300046475 Bacteria 10282
597 Ga0495639_0092889 3300046475 Bacteria 1417
598 Ga0495662_0025046 3300046476 Bacteria 2881
599 Ga0495662_0030834 3300046476 Bacteria 2588
600 Ga0495662_0055526 3300046476 Bacteria 1913
601 Ga0495664_0073784 3300046477 Bacteria 2040
602 Ga0495664_0075902 3300046477 Bacteria 2011
603 Ga0495664_0203144 3300046477 Bacteria 1200
604 Ga0495664_0672903 3300046477 Bacteria 612
605 Ga0495584_0665685 3300046491 Bacteria 531
606 Ga0495594_0101650 3300046499 Bacteria 1617
607 Ga0495608_0000101 3300046511 Bacteria 61678
608 Ga0495608_0005457 3300046511 Bacteria 9093
609 Ga0495608_0073663 3300046511 Bacteria 2226
610 Ga0495610_0187835 3300046512 Bacteria 855
611 Ga0495618_0060659 3300046514 Bacteria 2398
612 Ga0495618_0102435 3300046514 Bacteria 1832
613 Ga0495618_0240813 3300046514 Bacteria 1137
614 Ga0495618_0307229 3300046514 Bacteria 984
615 Ga0495628_0004884 3300046516 Bacteria 11802
616 Ga0495628_0010389 3300046516 Bacteria 7910
617 Ga0495628_0029794 3300046516 Bacteria 4422
618 Ga0495628_0935937 3300046516 Bacteria 599
619 Ga0495630_0079039 3300046517 Bacteria 2481
620 Ga0495630_0086753 3300046517 Bacteria 2363
621 Ga0495631_0185158 3300046518 Bacteria 892
622 Ga0495643_0038445 3300046522 Bacteria 2621
623 Ga0495666_0057300 3300046526 Bacteria 1865
624 Ga0495652_0002437 3300046529 Bacteria 19162
625 Ga0495652_0035206 3300046529 Bacteria 4358
626 Ga0495652_0036673 3300046529 Bacteria 4259
627 Ga0495652_0080402 3300046529 Bacteria 2692
628 Ga0495652_0277994 3300046529 Bacteria 1227
629 Ga0495665_0012035 3300046531 Bacteria 4683
630 Ga0495665_0012799 3300046531 Bacteria 4538
631 Ga0495640_0033826 3300046533 Bacteria 3630
632 Ga0495640_0039427 3300046533 Bacteria 3314
633 Ga0495640_0040305 3300046533 Bacteria 3271
634 Ga0495640_0235447 3300046533 Bacteria 1150
635 Ga0495587_0000228 3300046536 Bacteria 41527
636 Ga0495587_0000376 3300046536 Bacteria 31800
637 Ga0495587_0015528 3300046536 Bacteria 4753
638 Ga0495587_0096035 3300046536 Bacteria 1710
639 Ga0495587_0303591 3300046536 Bacteria 892
640 Ga0495645_0012873 3300046543 Bacteria 5905
641 Ga0495645_0036433 3300046543 Bacteria 3585
642 Ga0495645_0093623 3300046543 Bacteria 2144
643 Ga0495667_0000396 3300046559 Bacteria 27834
644 Ga0495667_0015810 3300046559 Bacteria 5102
645 Ga0495667_0017978 3300046559 Bacteria 4775
646 Ga0495667_0065960 3300046559 Bacteria 2367
647 Ga0495668_0051631 3300046616 Bacteria 2276
648 Ga0495634_0041873 3300046642 Bacteria 3109
649 Ga0495634_0142855 3300046642 Bacteria 1518
650 Ga0495634_0714010 3300046642 Bacteria 576
651 Ga0495635_0068823 3300046663 Bacteria 2427
652 Ga0495635_0209789 3300046663 Bacteria 1319
653 Ga0495659_0100834 3300046664 Bacteria 1118
654 Ga0495588_0042682 3300046674 Bacteria 2319
655 Ga0495657_0000156 3300046675 Bacteria 61702
656 Ga0495657_0001735 3300046675 Bacteria 18663
657 Ga0495657_0016689 3300046675 Bacteria 5343
658 Ga0495657_0102174 3300046675 Bacteria 1825
659 Ga0495599_0000097 3300046678 Bacteria 61561
660 Ga0495599_0024650 3300046678 Bacteria 3762
661 Ga0495599_0029592 3300046678 Bacteria 3433
662 Ga0495623_0000598 3300046679 Bacteria 24081
663 Ga0495623_0009845 3300046679 Bacteria 6194
664 Ga0495623_0018638 3300046679 Bacteria 4482
665 Ga0495623_0191761 3300046679 Bacteria 1180
666 Ga0495646_0010719 3300046680 Bacteria 5824
667 Ga0495646_0019048 3300046680 Bacteria 4348
668 Ga0495646_0020586 3300046680 Bacteria 4173
669 Ga0495646_0111413 3300046680 Bacteria 1558
670 Ga0495658_0035192 3300046683 Bacteria 2753
671 Ga0495658_0429669 3300046683 Bacteria 843
672 Ga0495613_0044032 3300046689 Bacteria 3302
673 Ga0495613_0199172 3300046689 Bacteria 1412
674 Ga0495624_0108140 3300046690 Bacteria 1710
675 Ga0495670_0111065 3300046691 Bacteria 1418
676 Ga0495600_0005217 3300046809 Bacteria 7812
677 Ga0495600_0012217 3300046809 Bacteria 5364
678 Ga0495600_0030064 3300046809 Bacteria 3517
679 Ga0495600_0114560 3300046809 Bacteria 1755
680 Ga0495581_0005473 3300047315 Bacteria 7348
681 Ga0495581_0051180 3300047315 Bacteria 2385
682 Ga0495581_0169977 3300047315 Bacteria 1275
683 Ga0495581_0464677 3300047315 Bacteria 736
684 Ga0495604_0000196 3300047317 Bacteria 54755
685 Ga0495604_0040446 3300047317 Bacteria 3660
686 Ga0495604_0106368 3300047317 Bacteria 2052
687 Ga0495604_0279058 3300047317 Bacteria 1129
688 Ga0495636_0152236 3300047318 Bacteria 1038
689 Ga0495674_0033589 3300047319 Bacteria 4645
690 Ga0495674_0039058 3300047319 Bacteria 4255
691 Ga0495674_0067157 3300047319 Bacteria 3107
692 Ga0495674_0110310 3300047319 Bacteria 2333
693 Ga0495674_0428851 3300047319 Bacteria 1064
694 Ga0495674_1101999 3300047319 Bacteria 604
695 Ga0495676_0116995 3300047321 Bacteria 1945
696 Ga0495676_0145164 3300047321 Bacteria 1696
697 Ga0495680_0000226 3300047322 Bacteria 61646
698 Ga0495680_0003937 3300047322 Bacteria 14360
699 Ga0495680_0017763 3300047322 Bacteria 6056
700 Ga0495680_0028043 3300047322 Bacteria 4620
701 Ga0495675_0000536 3300047444 Bacteria 24593
702 Ga0495675_0012300 3300047444 Bacteria 5387
703 Ga0495675_0030117 3300047444 Bacteria 3463
704 Ga0495675_0044376 3300047444 Bacteria 2832
705 Ga0495677_0119242 3300047445 Bacteria 1005
706 Ga0495677_0313551 3300047445 Bacteria 617
707 Ga0495684_0011554 3300047471 Bacteria 6820
708 Ga0495684_0505305 3300047471 Bacteria 830
709 Ga0495593_0017425 3300047673 Bacteria 4043
710 Ga0495593_0021237 3300047673 Bacteria 3628
711 Ga0495593_0067040 3300047673 Bacteria 1869
712 Ga0495602_0000172 3300048088 Bacteria 60316
713 Ga0495602_0007430 3300048088 Bacteria 11467
714 Ga0495602_0037737 3300048088 Bacteria 4478
715 Ga0495602_0490524 3300048088 Bacteria 860
716 Ga0495614_0038690 3300048089 Bacteria 2047
717 Ga0496100_0096525 3300048903 Bacteria 2028
718 Ga0496100_0281888 3300048903 Bacteria 1239
719 Ga0496101_0158094 3300048904 Bacteria 1737
720 Ga0496102_0116236 3300048905 Bacteria 2496
721 Ga0496102_0265711 3300048905 Bacteria 1618
722 Ga0496103_0544145 3300048906 Bacteria 741
723 Ga0496104_0000813 3300048907 Bacteria 26826
724 Ga0496104_0028893 3300048907 Bacteria 5141
725 Ga0496104_0959758 3300048907 Bacteria 759
726 Ga0496105_0037143 3300048908 Bacteria 4012
727 Ga0496105_0164025 3300048908 Bacteria 1823
728 Ga0496106_0123135 3300048909 Bacteria 2028
729 Ga0496107_0143639 3300048910 Bacteria 1764
730 Ga0496108_0003404 3300048911 Bacteria 12772
731 Ga0496108_0044574 3300048911 Bacteria 3701
732 Ga0496109_0112040 3300048912 Bacteria 2537
733 Ga0496109_1154008 3300048912 Bacteria 711
734 Ga0496110_0043935 3300048913 Bacteria 3901
735 Ga0496111_0318266 3300048914 Bacteria 1152
736 Ga0496112_0004025 3300048915 Bacteria 12328
737 Ga0496112_1151352 3300048915 Bacteria 693
738 Ga0496113_0286929 3300048916 Bacteria 1316
739 Ga0496115_0019404 3300048918 Bacteria 5231
740 Ga0496115_0024030 3300048918 Bacteria 4735
741 Ga0496115_0295379 3300048918 Bacteria 1328
742 Ga0496115_0347869 3300048918 Bacteria 1209
743 Ga0496126_0022803 3300048929 Bacteria 6080
744 Ga0496126_0090601 3300048929 Bacteria 2690
745 Ga0496126_0625705 3300048929 Bacteria 845
746 Ga0501318_087358 3300049534 Bacteria 512
747 Ga0501031_0306167 3300049568 Bacteria 1030
748 Ga0501032_0518569 3300049569 Bacteria 761
749 Ga0501032_0521959 3300049569 Bacteria 758
750 Ga0501034_0202283 3300049571 Bacteria 1944
751 Ga0501036_0000170 3300049572 Bacteria 42985
752 Ga0501037_0028717 3300049573 Bacteria 4109
753 Ga0501037_0162491 3300049573 Bacteria 1592
754 Ga0501038_0001501 3300049574 Bacteria 21457
755 Ga0501039_0698605 3300049575 Bacteria 793
756 Ga0501041_1026168 3300049577 Bacteria 531
757 Ga0501042_0001254 3300049578 Bacteria 14777
758 Ga0501043_0000648 3300049579 Bacteria 30700
759 Ga0501047_0011636 3300049581 Bacteria 8321
760 Ga0501047_0372770 3300049581 Bacteria 1262
761 Ga0501048_0035496 3300049582 Bacteria 3589
762 Ga0501069_0034330 3300049585 Bacteria 2794
763 Ga0501069_0547894 3300049585 Bacteria 692
764 Ga0501070_0003798 3300049586 Bacteria 13051
765 Ga0501070_0019825 3300049586 Bacteria 5639
766 Ga0501073_0008157 3300049589 Bacteria 7769
767 Ga0501073_0012663 3300049589 Bacteria 6151
768 Ga0501074_0000484 3300049590 Bacteria 24222
769 Ga0501074_0002243 3300049590 Bacteria 13424
770 Ga0501079_0000159 3300049741 Bacteria 37178
771 Ga0501080_0004998 3300049742 Bacteria 11808
772 Ga0501080_0187462 3300049742 Bacteria 1902
773 Ga0501080_0276282 3300049742 Bacteria 1528
774 Ga0501080_0705820 3300049742 Bacteria 889
775 Ga0501044_0397856 3300049823 Bacteria 1290
776 nmdc:mga05p37_2542_c1 3300050507 Bacteria 21207
777 nmdc:mga05p37_527_c1 3300050507 Bacteria 42352
778 nmdc:mga05p37_534113_c1 3300050507 Bacteria 1339
779 nmdc:mga09592_125911_c1 3300050508 Bacteria 2202
780 nmdc:mga09592_237_c1 3300050508 Bacteria 40055
781 nmdc:mga0qj67_10713_c1 3300050509 Bacteria 6854
782 nmdc:mga06r32_4457_c1 3300050510 Bacteria 12539
783 nmdc:mga06r32_876643_c1 3300050510 Bacteria 855
784 nmdc:mga08y16_1161107_c1 3300050511 Bacteria 745
785 nmdc:mga08y16_256845_c1 3300050511 Bacteria 1805
786 nmdc:mga08y16_4679_c1 3300050511 Bacteria 14262
787 nmdc:mga0n895_4012_c1 3300050512 Bacteria 11977
788 nmdc:mga0rr50_1090521_c1 3300050513 Bacteria 679
789 nmdc:mga0rr50_28718_c1 3300050513 Bacteria 3914
790 nmdc:mga0rr50_71544_c1 3300050513 Bacteria 2647
791 nmdc:mga08x19_96989_c1 3300050514 Bacteria 1952
792 nmdc:mga0a205_147493_c1 3300050515 Bacteria 2253
793 nmdc:mga0a205_199607_c1 3300050515 Bacteria 1891
794 Ga0495612_0018161 3300053078 Bacteria 2815
795 Ga0495612_0180505 3300053078 Bacteria 927
796 Ga0495595_0019153 3300053084 Bacteria 2967
797 Ga0495595_0049484 3300053084 Bacteria 1944
798 Ga0495619_0021876 3300053085 Bacteria 4086
799 Ga0495619_0121711 3300053085 Bacteria 1789
800 Ga0500568_0028236 3300053139 Bacteria 2340
801 Ga0501084_0257261 3300054114 Bacteria 1474
802 Ga0590075_014495 3300059424 Bacteria 1927
803 Ga0590075_017288 3300059424 Bacteria 1777
804 Ga0587084_156970 3300059477 Bacteria 504
805 Ga0587066_145129 3300059490 Bacteria 583
806 Ga0587073_0179092 3300059492 Bacteria 621
807 Ga0587073_0187562 3300059492 Bacteria 611
808 Ga0587082_186084 3300059504 Bacteria 512
809 Ga0587088_086925 3300059508 Bacteria 678
810 Ga0587092_163885 3300059512 Bacteria 504
811 Ga0587113_055303 3300059625 Bacteria 503
812 Ga0587067_152730 3300059640 Bacteria 581
813 Ga0587069_143524 3300059642 Bacteria 525
814 Ga0587078_080468 3300059646 Bacteria 522
815 Ga0587107_037464 3300059652 Bacteria 768
816 Ga0587114_059059 3300059655 Bacteria 668
817 Ga0587111_0262498 3300060346 Bacteria 515
818 Ga0466962_0071137 3300061719 Bacteria 1662
819 2517763896 2517572101 Bacteria 6884336
820 2691513560 2690315906 Bacteria 4517044
821 2729906109 2728369276 Bacteria 5610032
822 2891403072 2891395885 Bacteria 9251614
823 2891554609 2891554331 Bacteria 8812224
824 2984580625 2984576629 Bacteria 4248407
825 2990258317 2990256926 Bacteria 4252839
826 3001891117 3001889506 Bacteria 2975194
827 8002777146 8002775197 Bacteria 10728764
828 8056066417 8056060235 Bacteria 7259403
829 Ga0500643_000127
830 LJQas_1013284
831 JGI24743J22301_10061232
832 JGI24033J26618_1023625
833 JGI24751J29686_10053746
834 JGI25405J52794_10023957
835 Ga0058863_10003683
836 Ga0058861_10022460
837 Ga0058861_10057497
838 Ga0058861_11822019
839 Ga0058862_10024687
840 Ga0058862_10151194
841 Ga0058862_11010846
842 Ga0058862_12004185
843 Ga0070658_10001791
844 Ga0070658_10650125
845 Ga0070676_10066824
846 Ga0070683_100234000
847 Ga0070683_100356721
848 Ga0070690_100471266
849 Ga0070670_100231426
850 Ga0070677_10125079
851 Ga0068869_100061998
852 Ga0070680_100113750
853 Ga0070680_100339182
854 Ga0070680_100977900
855 Ga0070682_100022244
856 Ga0068868_100047275
857 Ga0068868_100081564
858 Ga0070691_10027814
859 Ga0070691_10241228
860 Ga0070661_100246882
861 Ga0070692_10012144
862 Ga0070668_100757265
863 Ga0070675_100095022
864 Ga0070671_100191274
865 Ga0070673_100370209
866 Ga0070673_100506946
867 Ga0070688_100011303
868 Ga0070659_100280324
869 Ga0070659_100312975
870 Ga0070667_100461799
871 Ga0070709_10000132
872 Ga0070709_10011218
873 Ga0070709_10015898
874 Ga0070709_10024697
875 Ga0070709_10057263
876 Ga0070709_10172670
877 Ga0070709_10992509
878 Ga0070714_100000290
879 Ga0070714_100001047
880 Ga0070714_100017866
881 Ga0070714_100034845
882 Ga0070714_100069282
883 Ga0070714_100087914
884 Ga0070714_100433439
885 Ga0070714_100437033
886 Ga0070714_100579005
887 Ga0070714_101401460
888 Ga0070713_100000696
889 Ga0070713_100003571
890 Ga0070713_100011260
891 Ga0070713_100033062
892 Ga0070713_100058884
893 Ga0070713_100082795
894 Ga0070713_100172641
895 Ga0070713_100320495
896 Ga0070713_100614335
897 Ga0070713_100630983
898 Ga0070710_10001105
899 Ga0070710_10005739
900 Ga0070710_10009941
901 Ga0070710_10114743
902 Ga0070710_10250329
903 Ga0070710_10782585
904 Ga0070701_10018729
905 Ga0070711_100017156
906 Ga0070711_100340989
907 Ga0070711_100452922
908 Ga0070705_100046994
909 Ga0070700_100081141
910 Ga0070694_101192738
911 Ga0070708_100045744
912 Ga0070708_100439328
913 Ga0070708_101009980
914 Ga0070663_100003030
915 Ga0070663_100548016
916 Ga0070678_100778004
917 Ga0070681_10184721
918 Ga0070681_10430509
919 Ga0070681_11772525
920 Ga0068867_100995728
921 Ga0070685_10020070
922 Ga0070706_100003733
923 Ga0070706_100109139
924 Ga0070706_100462386
925 Ga0070707_100382565
926 Ga0070707_100709054
927 Ga0070698_100000354
928 Ga0070698_100021520
929 Ga0070679_100099789
930 Ga0070679_100116027
931 Ga0070679_100263019
932 Ga0070679_100320162
933 Ga0070679_100676505
934 Ga0070679_101986266
935 Ga0070684_100126029
936 Ga0070684_100960364
937 Ga0070672_100679274
938 Ga0070686_100302162
939 Ga0070695_100539247
940 Ga0070695_101047610
941 Ga0070696_101656050
942 Ga0070693_100004054
943 Ga0070665_100136172
944 Ga0070665_100201330
945 Ga0070704_100185393
946 Ga0070704_100408796
947 Ga0068855_100019122
948 Ga0068855_100053197
949 Ga0068855_100484173
950 Ga0068855_102199985
951 Ga0070664_100263569
952 Ga0068857_100738373
953 Ga0068857_100950433
954 Ga0068854_100102269
955 Ga0068856_100001364
956 Ga0068856_100024135
957 Ga0068856_100109542
958 Ga0068856_100482513
959 Ga0070702_100010326
960 Ga0068852_101114471
961 Ga0068859_100062471
962 Ga0068864_100717789
963 Ga0068861_102237271
964 Ga0068851_10010718
965 Ga0068870_10044947
966 Ga0068870_10471284
967 Ga0068863_100196808
968 Ga0068858_100064792
969 Ga0068858_100079457
970 Ga0068860_100081053
971 Ga0068860_100679330
972 Ga0068862_101108925
973 Ga0081455_10000128
974 Ga0081455_10006978
975 Ga0081538_10001888
976 Ga0081538_10014035
977 Ga0081540_1001223
978 Ga0081540_1056794
979 Ga0081540_1087893
980 Ga0081539_10152964
981 Ga0070717_10016338
982 Ga0070717_10023113
983 Ga0070717_10024558
984 Ga0070717_10074698
985 Ga0070717_10253439
986 Ga0070717_10276875
987 Ga0070717_10459271
988 Ga0070717_10464770
989 Ga0070717_10524628
990 Ga0075432_10298202
991 Ga0070715_10021861
992 Ga0070715_10032780
993 Ga0070715_10353800
994 Ga0070716_100000088
995 Ga0070716_100001767
996 Ga0070716_100405165
997 Ga0070716_100719858
998 Ga0070712_100000796
999 Ga0070712_100034900
1000 Ga0070712_100039248
1001 Ga0070712_100130155
1002 Ga0070712_100346477
1003 Ga0070712_100355226
1004 Ga0097621_100023467
1005 Ga0097621_100355141
1006 Ga0097621_100585479
1007 Ga0068871_100064130
1008 Ga0068871_100211229
1009 Ga0068871_100601052
1010 Ga0075428_100005771
1011 Ga0075428_100527052
1012 Ga0075428_100534086
1013 Ga0075430_100024721
1014 Ga0075430_100920719
1015 Ga0075431_100037096
1016 Ga0075431_100064702
1017 Ga0075433_10002154
1018 Ga0075433_10082334
1019 Ga0075433_10297209
1020 Ga0075434_100002741
1021 Ga0075429_100001979
1022 Ga0075429_100212067
1023 Ga0075436_100001784
1024 Ga0075436_100030847
1025 Ga0097620_100062470
1026 Ga0075435_100032515
1027 Ga0075435_101145379
1028 Ga0075435_101236816
1029 Ga0105251_10054389
1030 Ga0105240_10003563
1031 Ga0105240_10251875
1032 Ga0105240_10708553
1033 Ga0111539_10006043
1034 Ga0111539_10253633
1035 Ga0105245_10101474
1036 Ga0105247_10039895
1037 Ga0114129_10002252
1038 Ga0114129_10008519
1039 Ga0114129_10218138
1040 Ga0105243_10240133
1041 Ga0105241_10004090
1042 Ga0105241_10061597
1043 Ga0105241_10344095
1044 Ga0105248_10656425
1045 Ga0105248_11582736
1046 Ga0105237_10242007
1047 Ga0105237_11009983
1048 Ga0105238_10108171
1049 Ga0105238_10538083
1050 Ga0105238_10930257
1051 Ga0105249_11004008
1052 Ga0099796_10429247
1053 Ga0105239_10215638
1054 Ga0105239_11044741
1055 Ga0105239_11436469
1056 Ga0105246_10028661
1057 Ga0105246_10031827
1058 Ga0154010_158913
1059 Ga0157370_10006131
1060 Ga0157369_10091142
1061 Ga0157369_10109792
1062 Ga0157369_11967129
1063 Ga0157374_10027064
1064 Ga0157374_10128896
1065 Ga0157374_10215911
1066 Ga0163162_10026734
1067 Ga0163162_10551593
1068 Ga0157372_10028155
1069 Ga0157372_10266181
1070 Ga0157372_10871921
1071 Ga0157375_10582005
1072 Ga0163163_10501639
1073 Ga0163163_10526492
1074 Ga0163163_11429521
1075 Ga0182008_10093035
1076 Ga0157377_10001915
1077 Ga0157377_10816367
1078 Ga0157379_10020127
1079 Ga0157376_10008666
1080 Ga0157376_11296491
1081 Ga0184601_114265
1082 Ga0184600_116695
1083 Ga0197907_10230096
1084 Ga0197907_10862593
1085 Ga0206356_10083947
1086 Ga0206356_10565981
1087 Ga0206356_10969686
1088 Ga0206349_1228606
1089 Ga0206349_1321091
1090 Ga0206349_1514218
1091 Ga0206355_1462003
1092 Ga0206355_1650148
1093 Ga0206355_1705157
1094 Ga0206351_10165417
1095 Ga0206351_10815914
1096 Ga0206352_10036563
1097 Ga0206352_10310989
1098 Ga0206352_10834661
1099 Ga0206350_10273622
1100 Ga0206350_10584984
1101 Ga0206350_10787066
1102 Ga0206350_11162888
1103 Ga0206350_11357921
1104 Ga0206354_10140459
1105 Ga0206354_11022824
1106 Ga0206353_10120679
1107 Ga0206353_10397058
1108 Ga0154015_1056023
1109 Ga0154015_1214535
1110 Ga0154015_1223142
1111 Ga0154015_1271578
1112 Ga0213875_10002941
1113 Ga0224712_10007480
1114 Ga0224712_10444849
1115 Ga0224712_10563885
1116 Ga0224712_10658432
1117 Ga0256720_121953
1118 Ga0224572_1005428
1119 Ga0207692_10000891
1120 Ga0207692_10002245
1121 Ga0207692_10055424
1122 Ga0207692_10086698
1123 Ga0207692_10177937
1124 Ga0207692_10470833
1125 Ga0207688_10044815
1126 Ga0207647_10101992
1127 Ga0207685_10075549
1128 Ga0207685_10128070
1129 Ga0207699_10000165
1130 Ga0207699_10001689
1131 Ga0207699_10082244
1132 Ga0207699_10183239
1133 Ga0207699_10322605
1134 Ga0207699_10549333
1135 Ga0207645_10028105
1136 Ga0207643_10035728
1137 Ga0207643_10447635
1138 Ga0207705_10169901
1139 Ga0207705_10261836
1140 Ga0207705_10993877
1141 Ga0207684_10132377
1142 Ga0207684_10240698
1143 Ga0207654_10014200
1144 Ga0207654_10031882
1145 Ga0207707_10422298
1146 Ga0207707_11017371
1147 Ga0207695_10050307
1148 Ga0207695_10481201
1149 Ga0207695_10565236
1150 Ga0207671_10295660
1151 Ga0207693_10000836
1152 Ga0207693_10081949
1153 Ga0207693_10133919
1154 Ga0207693_10135726
1155 Ga0207693_10294799
1156 Ga0207693_10297108
1157 Ga0207663_10005552
1158 Ga0207663_10021183
1159 Ga0207663_10027678
1160 Ga0207663_10199847
1161 Ga0207663_10897077
1162 Ga0207660_10096989
1163 Ga0207660_11006275
1164 Ga0207657_10009363
1165 Ga0207657_10134398
1166 Ga0207657_10985597
1167 Ga0207649_10530871
1168 Ga0207649_11197249
1169 Ga0207652_10065455
1170 Ga0207652_10124386
1171 Ga0207652_10570322
1172 Ga0207652_11184831
1173 Ga0207646_10774239
1174 Ga0207681_11202526
1175 Ga0207694_10273727
1176 Ga0207650_10740963
1177 Ga0207659_10109494
1178 Ga0207687_10028797
1179 Ga0207700_10000297
1180 Ga0207700_10010224
1181 Ga0207700_10017378
1182 Ga0207700_10028955
1183 Ga0207700_10070358
1184 Ga0207700_10104397
1185 Ga0207700_10180715
1186 Ga0207664_10000224
1187 Ga0207664_10006027
1188 Ga0207664_10009651
1189 Ga0207664_10014932
1190 Ga0207664_10058173
1191 Ga0207664_10176015
1192 Ga0207664_10367620
1193 Ga0207664_10452699
1194 Ga0207664_10685709
1195 Ga0207644_10079790
1196 Ga0207690_10492427
1197 Ga0207690_10737970
1198 Ga0207706_10154785
1199 Ga0207665_10000698
1200 Ga0207665_10005623
1201 Ga0207665_10300461
1202 Ga0207665_11397442
1203 Ga0207691_10141982
1204 Ga0207711_10286352
1205 Ga0207661_10002395
1206 Ga0207661_10300974
1207 Ga0207679_10289685
1208 Ga0207667_10024935
1209 Ga0207667_10068805
1210 Ga0207667_10787001
1211 Ga0207667_11286746
1212 Ga0207667_11687128
1213 Ga0207651_10087033
1214 Ga0207651_10979754
1215 Ga0207712_10529207
1216 Ga0207677_10070453
1217 Ga0207703_10032686
1218 Ga0207703_10102847
1219 Ga0207639_10398577
1220 Ga0207639_10824172
1221 Ga0207678_10007707
1222 Ga0207678_10009072
1223 Ga0207708_10114430
1224 Ga0207702_10012351
1225 Ga0207702_10028083
1226 Ga0207702_10146497
1227 Ga0207641_11144090
1228 Ga0207648_11050840
1229 Ga0207676_10002884
1230 Ga0207674_10030548
1231 Ga0207674_10106859
1232 Ga0207674_10299362
1233 Ga0207674_10757607
1234 Ga0207675_100281140
1235 Ga0207675_101760697
1236 Ga0207683_10007957
1237 Ga0207683_10366722
1238 Ga0207698_10631725
1239 Ga0207698_10783979
1240 Ga0207698_11227764
1241 Ga0209588_1023459
1242 Ga0207428_10005504
1243 Ga0207428_10091244
1244 Ga0268266_10184805
1245 Ga0268266_10367152
1246 Ga0268264_10101885
1247 Ga0311003_155033
1248 Ga0265762_1020485
1249 Ga0265767_115009
1250 Ga0265766_1003422
1251 Ga0265766_1004977
1252 Ga0265766_1007092
1253 Ga0265766_1022794
1254 Ga0265766_1026404
1255 Ga0265770_1021530
1256 Ga0265769_108833
1257 Ga0265768_108041
1258 Ga0265771_1005649
1259 Ga0265325_10008964
1260 Ga0265340_10021908
1261 Ga0265339_10320460
1262 Ga0265331_10102826
1263 Ga0265316_10228723
1264 Ga0307408_100087740
1265 Ga0307408_100174573
1266 Ga0307408_100966294
1267 Ga0310116_123310
1268 Ga0310117_121382
1269 Ga0265313_10119832
1270 Ga0310103_117113
1271 Ga0307508_10089865
1272 Ga0265342_10131091
1273 Ga0316576_10003781
1274 Ga0316578_10072412
1275 Ga0307516_10349672
1276 Ga0307405_10055944
1277 Ga0307405_10123988
1278 Ga0307405_10368882
1279 Ga0307405_10428537
1280 Ga0307413_10295317
1281 Ga0307413_10651913
1282 Ga0307410_10092293
1283 Ga0307410_10321646
1284 Ga0307410_10518297
1285 Ga0307407_10143727
1286 Ga0307412_10005940
1287 Ga0307412_10012266
1288 Ga0307409_100042992
1289 Ga0307409_100089454
1290 Ga0307409_101047558
1291 Ga0307416_100009886
1292 Ga0307416_100041985
1293 Ga0307416_100194388
1294 Ga0307416_100294183
1295 Ga0307416_101024084
1296 Ga0307411_10346058
1297 Ga0307411_10473658
1298 Ga0307411_11842947
1299 Ga0316053_119824
1300 Ga0307415_100169606
1301 Ga0316212_1020082
1302 Ga0316216_1002509
1303 Ga0373926_0213826
1304 Ga0373926_0414878
1305 Ga0373928_0265182
1306 Ga0373934_0000337
1307 Ga0373934_0000541
1308 Ga0373934_0075731
1309 Ga0373944_0108617
1310 Ga0373944_0312767
1311 Ga0373949_0085847
1312 Ga0373923_0017622
1313 Ga0373923_0405023
1314 Ga0373936_0068383
1315 Ga0373936_0091154
1316 Ga0373945_0010599
1317 Ga0373953_0009454
1318 Ga0373954_0010264
1319 Ga0373956_0001267
1320 Ga0373957_0000146
1321 Ga0373957_0002029
1322 Ga0373943_0070264
1323 Ga0373943_0587163
1324 Ga0373946_0042214
1325 Ga0373946_0054620
1326 Ga0373955_0000024
1327 Ga0373955_0004403
1328 Ga0373955_0035955
1329 Ga0373955_0492441
1330 Ga0316574_0067880
1331 Ga0373924_0003094
1332 Ga0373924_0018354
1333 Ga0373924_0362983
1334 Ga0373935_0014464
1335 Ga0373935_0140621
1336 Ga0373935_0779385
1337 Ga0373927_0200993
1338 Ga0373933_0001020
1339 Ga0373933_0057502
1340 Ga0373933_0083274
1341 Ga0373933_0215019
1342 Ga0373947_0772929
1343 Ga0373937_0000333
1344 Ga0373937_0007305
1345 Ga0373937_1126012
1346 Ga0265778_037574
1347 Ga0310112_031912
1348 Ga0310112_049966
1349 Ga0310112_053988
1350 Ga0372808_039577
1351 Ga0372808_042148
1352 Ga0310109_016022
1353 Ga0316584_0395693
1354 Ga0373925_0008937
1355 Ga0373925_0013418
1356 Ga0373925_0679740
1357 Ga0395899_0122010
1358 Ga0395900_0212618
1359 Ga0395898_0047501
1360 Ga0395905_1460505
1361 Ga0436364_0557549
1362 Ga0436364_1499747
1363 Ga0395901_0217393
1364 Ga0400485_17869
1365 Ga0400486_31407
1366 Ga0436365_1415915
1367 Ga0436363_1260454
1368 Ga0436363_1543764
1369 Ga0439436_0026794
1370 Ga0439438_021641
1371 Ga0439466_0076083
1372 Ga0439465_0031662
1373 Ga0451789_0023683
1374 Ga0439433_0029489
1375 Ga0439448_0004728
1376 Ga0439449_0000737
1377 Ga0439449_0073771
1378 Ga0439452_045638
1379 Ga0439455_0094789
1380 Ga0450905_021882
1381 Ga0439458_0005335
1382 Ga0439464_0019502
1383 Ga0466961_0112876
1384 Ga0466963_0160124
1385 Ga0466963_0165259
1386 Ga0466963_0608207
1387 Ga0466963_0782802
1388 Ga0466963_0870207
1389 Ga0466964_0022535
1390 Ga0466964_0203660
1391 Ga0466968_0207549
1392 Ga0466968_0656598
1393 Ga0466957_0448004
1394 Ga0466959_0861054
1395 Ga0466958_0002183
1396 Ga0466958_0270867
1397 Ga0466967_0003203
1398 Ga0466967_0006784
1399 Ga0466967_0372653
1400 Ga0466967_0912671
1401 Ga0495592_0000304
1402 Ga0495592_0004635
1403 Ga0495592_0047028
1404 Ga0495603_0039447
1405 Ga0495603_0390028
1406 Ga0495629_0106780
1407 Ga0495629_0108954
1408 Ga0495629_0199752
1409 Ga0495629_0413894
1410 Ga0495629_0592907
1411 Ga0495641_0040151
1412 Ga0495651_0000252
1413 Ga0495651_0003277
1414 Ga0495651_0018040
1415 Ga0495651_0462691
1416 Ga0495653_0001371
1417 Ga0495653_0009566
1418 Ga0495653_0015034
1419 Ga0495653_0167270
1420 Ga0495653_0455199
1421 Ga0495580_0793098
1422 Ga0495582_0034281
1423 Ga0495582_0264046
1424 Ga0495639_0001540
1425 Ga0495639_0092889
1426 Ga0495662_0025046
1427 Ga0495662_0030834
1428 Ga0495662_0055526
1429 Ga0495664_0073784
1430 Ga0495664_0075902
1431 Ga0495664_0203144
1432 Ga0495664_0672903
1433 Ga0495584_0665685
1434 Ga0495594_0101650
1435 Ga0495608_0000101
1436 Ga0495608_0005457
1437 Ga0495608_0073663
1438 Ga0495610_0187835
1439 Ga0495618_0060659
1440 Ga0495618_0102435
1441 Ga0495618_0240813
1442 Ga0495618_0307229
1443 Ga0495628_0004884
1444 Ga0495628_0010389
1445 Ga0495628_0029794
1446 Ga0495628_0935937
1447 Ga0495630_0079039
1448 Ga0495630_0086753
1449 Ga0495631_0185158
1450 Ga0495643_0038445
1451 Ga0495666_0057300
1452 Ga0495652_0002437
1453 Ga0495652_0035206
1454 Ga0495652_0036673
1455 Ga0495652_0080402
1456 Ga0495652_0277994
1457 Ga0495665_0012035
1458 Ga0495665_0012799
1459 Ga0495640_0033826
1460 Ga0495640_0039427
1461 Ga0495640_0040305
1462 Ga0495640_0235447
1463 Ga0495587_0000228
1464 Ga0495587_0000376
1465 Ga0495587_0015528
1466 Ga0495587_0096035
1467 Ga0495587_0303591
1468 Ga0495645_0012873
1469 Ga0495645_0036433
1470 Ga0495645_0093623
1471 Ga0495667_0000396
1472 Ga0495667_0015810
1473 Ga0495667_0017978
1474 Ga0495667_0065960
1475 Ga0495668_0051631
1476 Ga0495634_0041873
1477 Ga0495634_0142855
1478 Ga0495634_0714010
1479 Ga0495635_0068823
1480 Ga0495635_0209789
1481 Ga0495659_0100834
1482 Ga0495588_0042682
1483 Ga0495657_0000156
1484 Ga0495657_0001735
1485 Ga0495657_0016689
1486 Ga0495657_0102174
1487 Ga0495599_0000097
1488 Ga0495599_0024650
1489 Ga0495599_0029592
1490 Ga0495623_0000598
1491 Ga0495623_0009845
1492 Ga0495623_0018638
1493 Ga0495623_0191761
1494 Ga0495646_0010719
1495 Ga0495646_0019048
1496 Ga0495646_0020586
1497 Ga0495646_0111413
1498 Ga0495658_0035192
1499 Ga0495658_0429669
1500 Ga0495613_0044032
1501 Ga0495613_0199172
1502 Ga0495624_0108140
1503 Ga0495670_0111065
1504 Ga0495600_0005217
1505 Ga0495600_0012217
1506 Ga0495600_0030064
1507 Ga0495600_0114560
1508 Ga0495581_0005473
1509 Ga0495581_0051180
1510 Ga0495581_0169977
1511 Ga0495581_0464677
1512 Ga0495604_0000196
1513 Ga0495604_0040446
1514 Ga0495604_0106368
1515 Ga0495604_0279058
1516 Ga0495636_0152236
1517 Ga0495674_0033589
1518 Ga0495674_0039058
1519 Ga0495674_0067157
1520 Ga0495674_0110310
1521 Ga0495674_0428851
1522 Ga0495674_1101999
1523 Ga0495676_0116995
1524 Ga0495676_0145164
1525 Ga0495680_0000226
1526 Ga0495680_0003937
1527 Ga0495680_0017763
1528 Ga0495680_0028043
1529 Ga0495675_0000536
1530 Ga0495675_0012300
1531 Ga0495675_0030117
1532 Ga0495675_0044376
1533 Ga0495677_0119242
1534 Ga0495677_0313551
1535 Ga0495684_0011554
1536 Ga0495684_0505305
1537 Ga0495593_0017425
1538 Ga0495593_0021237
1539 Ga0495593_0067040
1540 Ga0495602_0000172
1541 Ga0495602_0007430
1542 Ga0495602_0037737
1543 Ga0495602_0490524
1544 Ga0495614_0038690
1545 Ga0496100_0096525
1546 Ga0496100_0281888
1547 Ga0496101_0158094
1548 Ga0496102_0116236
1549 Ga0496102_0265711
1550 Ga0496103_0544145
1551 Ga0496104_0000813
1552 Ga0496104_0028893
1553 Ga0496104_0959758
1554 Ga0496105_0037143
1555 Ga0496105_0164025
1556 Ga0496106_0123135
1557 Ga0496107_0143639
1558 Ga0496108_0003404
1559 Ga0496108_0044574
1560 Ga0496109_0112040
1561 Ga0496109_1154008
1562 Ga0496110_0043935
1563 Ga0496111_0318266
1564 Ga0496112_0004025
1565 Ga0496112_1151352
1566 Ga0496113_0286929
1567 Ga0496115_0019404
1568 Ga0496115_0024030
1569 Ga0496115_0295379
1570 Ga0496115_0347869
1571 Ga0496126_0022803
1572 Ga0496126_0090601
1573 Ga0496126_0625705
1574 Ga0501318_087358
1575 Ga0501031_0306167
1576 Ga0501032_0518569
1577 Ga0501032_0521959
1578 Ga0501034_0202283
1579 Ga0501036_0000170
1580 Ga0501037_0028717
1581 Ga0501037_0162491
1582 Ga0501038_0001501
1583 Ga0501039_0698605
1584 Ga0501041_1026168
1585 Ga0501042_0001254
1586 Ga0501043_0000648
1587 Ga0501047_0011636
1588 Ga0501047_0372770
1589 Ga0501048_0035496
1590 Ga0501069_0034330
1591 Ga0501069_0547894
1592 Ga0501070_0003798
1593 Ga0501070_0019825
1594 Ga0501073_0008157
1595 Ga0501073_0012663
1596 Ga0501074_0000484
1597 Ga0501074_0002243
1598 Ga0501079_0000159
1599 Ga0501080_0004998
1600 Ga0501080_0187462
1601 Ga0501080_0276282
1602 Ga0501080_0705820
1603 Ga0501044_0397856
1604 nmdc:mga05p37_2542_c1
1605 nmdc:mga05p37_527_c1
1606 nmdc:mga05p37_534113_c1
1607 nmdc:mga09592_125911_c1
1608 nmdc:mga09592_237_c1
1609 nmdc:mga0qj67_10713_c1
1610 nmdc:mga06r32_4457_c1
1611 nmdc:mga06r32_876643_c1
1612 nmdc:mga08y16_1161107_c1
1613 nmdc:mga08y16_256845_c1
1614 nmdc:mga08y16_4679_c1
1615 nmdc:mga0n895_4012_c1
1616 nmdc:mga0rr50_1090521_c1
1617 nmdc:mga0rr50_28718_c1
1618 nmdc:mga0rr50_71544_c1
1619 nmdc:mga08x19_96989_c1
1620 nmdc:mga0a205_147493_c1
1621 nmdc:mga0a205_199607_c1
1622 Ga0495612_0018161
1623 Ga0495612_0180505
1624 Ga0495595_0019153
1625 Ga0495595_0049484
1626 Ga0495619_0021876
1627 Ga0495619_0121711
1628 Ga0500568_0028236
1629 Ga0501084_0257261
1630 Ga0590075_014495
1631 Ga0590075_017288
1632 Ga0587084_156970
1633 Ga0587066_145129
1634 Ga0587073_0179092
1635 Ga0587073_0187562
1636 Ga0587082_186084
1637 Ga0587088_086925
1638 Ga0587092_163885
1639 Ga0587113_055303
1640 Ga0587067_152730
1641 Ga0587069_143524
1642 Ga0587078_080468
1643 Ga0587107_037464
1644 Ga0587114_059059
1645 Ga0587111_0262498
1646 Ga0466962_0071137
1647 2517763896
1648 2691513560
1649 2729906109
1650 2891403072
1651 2891554609
1652 2984580625
1653 2990258317
1654 3001891117
1655 8002777146
1656 8056066417

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

78

144

0.91

PF02381

MraZ

MraZ protein, putative antitoxin-like

1

70

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.928 2 136
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8774 2 136
6nzd-assembly1.cif.gz_D cryo-em structure of the lysosomal folliculin complex (flcn-fnip2-raga-ragc-ragulator) 0.7993 102 114
7cus-assembly1.cif.gz_A crystal structure of the sensor domain of vbrk from vibrio parahaemolyticus 0.6328 103 126
7f2g-assembly1.cif.gz_A crystal structure of the sensor domain of vbrk from vibrio rotiferianus (crystal type 1) 0.6276 103 126
ID Description Score Start End Superfamily
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9634 1 136 3.40.1550.20
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9566 1 133 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9215 2 136 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9174 1 136 3.40.1550.20
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9165 1 133 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A1C4PYH1-F1-model_v4 Transcriptional regulator MraZ 0.9834 1 131 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A1S1DF99-F1-model_v4 Transcriptional regulator MraZ 0.9827 1 132 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A0K2RXW4-F1-model_v4 Transcriptional regulator MraZ 0.9779 11 132 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:0051301
GO:2000143
AF-A0A2M7RCH2-F1-model_v4 Transcriptional regulator MraZ 0.9752 1 137 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:0051301
GO:2000143
AF-A0A1F4YDA3-F1-model_v4 Transcriptional regulator MraZ 0.9708 1 138 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:0051301
GO:2000143

Map