F482528

General Info

Members Datasets Scaffolds Average Seq Length
827 411 827 50

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0238331|Ga0495606_0238331_417_599
Length 60
Sequence MGNLALWRPCMSGNRNVLFLIIGALIVGIGVLGYNLYQTKKEPEGLQINVGPSGLKVQNK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
214 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
244 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
245 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
248 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
380 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
381 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
382 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
383 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
384 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
385 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
386 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
387 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
390 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
391 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
392 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
396 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
397 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
398 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
399 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
400 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
401 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
402 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
403 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
404 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
405 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
406 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
407 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
410 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
411 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.52
Nodule 0.12
Rhizoplane 4.59
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10081189 3300001979 Bacteria 849
2 JGI24739J22299_10000711 3300001989 Bacteria 12063
3 JGI24737J22298_10000671 3300001990 Bacteria 12097
4 JGI24735J21928_10011428 3300002067 Bacteria 2814
5 JGI24750J21931_1086753 3300002070 Bacteria 526
6 JGI24742J22300_10007644 3300002244 Bacteria 1785
7 JGI25153J46596_10039621 3300003215 Bacteria 1471
8 JGI25153J46596_10105380 3300003215 Bacteria 656
9 rootH2_10243292 3300003320 Bacteria 1302
10 JGI25404J52841_10043842 3300003659 Bacteria 944
11 JGI25404J52841_10050250 3300003659 Bacteria 876
12 Ga0055539_1019512 3300003752 Bacteria 812
13 Ga0055526_1021911 3300003771 Bacteria 2199
14 Ga0070658_10033314 3300005327 Bacteria 4144
15 Ga0070658_10055755 3300005327 Bacteria 3211
16 Ga0070658_10147211 3300005327 Bacteria 1970
17 Ga0070658_10186997 3300005327 Bacteria 1745
18 Ga0070658_10930751 3300005327 Bacteria 756
19 Ga0070658_11931186 3300005327 Bacteria 510
20 Ga0070676_10226832 3300005328 Bacteria 1236
21 Ga0070683_100127791 3300005329 Bacteria 2404
22 Ga0068869_100192169 3300005334 Bacteria 1606
23 Ga0070666_10861941 3300005335 Bacteria 669
24 Ga0070680_100019388 3300005336 Bacteria 5389
25 Ga0070680_100182285 3300005336 Bacteria 1769
26 Ga0070680_101020236 3300005336 Bacteria 715
27 Ga0068868_100270054 3300005338 Bacteria 1437
28 Ga0070660_100017380 3300005339 Bacteria 5242
29 Ga0070660_100536723 3300005339 Bacteria 975
30 Ga0070660_100958988 3300005339 Bacteria 722
31 Ga0070687_101335039 3300005343 Bacteria 534
32 Ga0070661_100477578 3300005344 Bacteria 995
33 Ga0070661_100583923 3300005344 Bacteria 902
34 Ga0070661_101601202 3300005344 Bacteria 551
35 Ga0070692_10665210 3300005345 Bacteria 697
36 Ga0070668_100059516 3300005347 Bacteria 2956
37 Ga0070668_100272754 3300005347 Bacteria 1410
38 Ga0070668_100514643 3300005347 Bacteria 1038
39 Ga0070669_100598439 3300005353 Bacteria 923
40 Ga0070669_101343276 3300005353 Bacteria 619
41 Ga0070671_100554398 3300005355 Bacteria 991
42 Ga0070674_100116307 3300005356 Bacteria 1973
43 Ga0070674_100153161 3300005356 Bacteria 1741
44 Ga0070673_101368516 3300005364 Bacteria 666
45 Ga0070688_100075427 3300005365 Bacteria 2168
46 Ga0070659_100182108 3300005366 Bacteria 1725
47 Ga0070667_100035592 3300005367 Bacteria 4172
48 Ga0070667_100656102 3300005367 Bacteria 969
49 Ga0070667_101841181 3300005367 Bacteria 570
50 Ga0070709_10013858 3300005434 Bacteria 4545
51 Ga0070714_100056261 3300005435 Bacteria 3364
52 Ga0070714_100172047 3300005435 Bacteria 1966
53 Ga0070714_100181179 3300005435 Bacteria 1917
54 Ga0070714_101028318 3300005435 Bacteria 802
55 Ga0070713_100003948 3300005436 Bacteria 9858
56 Ga0070713_100039476 3300005436 Bacteria 3832
57 Ga0070713_100144116 3300005436 Bacteria 2113
58 Ga0070713_100961658 3300005436 Bacteria 823
59 Ga0070713_101636543 3300005436 Bacteria 625
60 Ga0070710_10262506 3300005437 Bacteria 1114
61 Ga0070710_10964758 3300005437 Bacteria 619
62 Ga0070701_10072143 3300005438 Bacteria 1848
63 Ga0070711_100094825 3300005439 Bacteria 2158
64 Ga0070705_101883062 3300005440 Bacteria 509
65 Ga0070700_100038740 3300005441 Bacteria 2907
66 Ga0070708_100916202 3300005445 Bacteria 823
67 Ga0070663_100158555 3300005455 Bacteria 1740
68 Ga0070663_100158845 3300005455 Bacteria 1739
69 Ga0070678_100241507 3300005456 Bacteria 1510
70 Ga0070678_101544770 3300005456 Bacteria 622
71 Ga0070662_100215552 3300005457 Bacteria 1529
72 Ga0070662_100474818 3300005457 Bacteria 1040
73 Ga0070681_10221437 3300005458 Bacteria 1807
74 Ga0070681_10340182 3300005458 Bacteria 1410
75 Ga0068867_100032263 3300005459 Bacteria 3786
76 Ga0068867_101102885 3300005459 Bacteria 725
77 Ga0068867_101551831 3300005459 Bacteria 618
78 Ga0070706_100820102 3300005467 Bacteria 861
79 Ga0070707_100545466 3300005468 Bacteria 1122
80 Ga0070679_100214947 3300005530 Bacteria 1885
81 Ga0070679_100348953 3300005530 Bacteria 1428
82 Ga0070679_100417674 3300005530 Bacteria 1287
83 Ga0070679_101421379 3300005530 Bacteria 640
84 Ga0070684_100004374 3300005535 Bacteria 10739
85 Ga0070697_100049851 3300005536 Bacteria 3398
86 Ga0070697_100557988 3300005536 Bacteria 1005
87 Ga0068853_100015197 3300005539 Bacteria 6328
88 Ga0068853_100020983 3300005539 Bacteria 5437
89 Ga0068853_100087112 3300005539 Bacteria 2739
90 Ga0068853_100246247 3300005539 Bacteria 1639
91 Ga0068853_100617193 3300005539 Bacteria 1030
92 Ga0070672_100110347 3300005543 Bacteria 2241
93 Ga0070672_100214550 3300005543 Bacteria 1613
94 Ga0070686_100100328 3300005544 Bacteria 1954
95 Ga0070695_100615170 3300005545 Bacteria 854
96 Ga0070696_101233525 3300005546 Bacteria 633
97 Ga0070665_100196951 3300005548 Bacteria 2016
98 Ga0070665_102670157 3300005548 Bacteria 500
99 Ga0070704_100800681 3300005549 Bacteria 842
100 Ga0068855_100010315 3300005563 Bacteria 11267
101 Ga0068855_100031543 3300005563 Bacteria 6329
102 Ga0068855_100070306 3300005563 Bacteria 4073
103 Ga0068855_100275945 3300005563 Bacteria 1868
104 Ga0068855_100759385 3300005563 Bacteria 1033
105 Ga0068855_101702135 3300005563 Bacteria 643
106 Ga0070664_101426098 3300005564 Bacteria 655
107 Ga0068857_100003351 3300005577 Bacteria 13343
108 Ga0068857_100114201 3300005577 Bacteria 2429
109 Ga0068857_100129080 3300005577 Bacteria 2279
110 Ga0068854_100004647 3300005578 Bacteria 8666
111 Ga0068854_100010537 3300005578 Bacteria 5997
112 Ga0068854_100975830 3300005578 Bacteria 749
113 Ga0068854_101985224 3300005578 Bacteria 536
114 Ga0068856_100009171 3300005614 Bacteria 9620
115 Ga0068856_100330866 3300005614 Bacteria 1541
116 Ga0068856_100610703 3300005614 Bacteria 1111
117 Ga0068856_101083935 3300005614 Bacteria 819
118 Ga0070702_100120700 3300005615 Bacteria 1640
119 Ga0070702_101439731 3300005615 Bacteria 565
120 Ga0068852_100077939 3300005616 Bacteria 2931
121 Ga0068852_100084688 3300005616 Bacteria 2822
122 Ga0068852_100159336 3300005616 Bacteria 2106
123 Ga0068852_100355585 3300005616 Bacteria 1431
124 Ga0068852_100406165 3300005616 Bacteria 1341
125 Ga0068866_10128540 3300005718 Bacteria 1437
126 Ga0068861_100016364 3300005719 Bacteria 5247
127 Ga0068861_100193846 3300005719 Bacteria 1701
128 Ga0068851_10026729 3300005834 Bacteria 2839
129 Ga0068851_10042900 3300005834 Bacteria 2278
130 Ga0068863_100153114 3300005841 Bacteria 2207
131 Ga0068858_100221497 3300005842 Bacteria 1792
132 Ga0068858_100629407 3300005842 Bacteria 1042
133 Ga0068860_100779965 3300005843 Bacteria 968
134 Ga0068860_102627596 3300005843 Bacteria 522
135 Ga0068862_100194967 3300005844 Bacteria 1824
136 Ga0068862_100252914 3300005844 Bacteria 1606
137 Ga0068862_100766773 3300005844 Bacteria 940
138 Ga0081455_10002419 3300005937 Bacteria 22263
139 Ga0081455_10003658 3300005937 Bacteria 17616
140 Ga0081455_10125266 3300005937 Bacteria 2018
141 Ga0081540_1002804 3300005983 Bacteria 14119
142 Ga0081540_1004519 3300005983 Bacteria 10561
143 Ga0081540_1048457 3300005983 Bacteria 2128
144 Ga0081540_1074125 3300005983 Bacteria 1561
145 Ga0081540_1206006 3300005983 Bacteria 711
146 Ga0081540_1237291 3300005983 Bacteria 641
147 Ga0081539_10060955 3300005985 Bacteria 2069
148 Ga0070717_10011433 3300006028 Bacteria 6742
149 Ga0070717_10348221 3300006028 Bacteria 1324
150 Ga0070717_10648051 3300006028 Bacteria 959
151 Ga0070717_10676922 3300006028 Bacteria 937
152 Ga0075365_10639125 3300006038 Bacteria 752
153 Ga0075365_11259125 3300006038 Bacteria 520
154 Ga0070715_10075193 3300006163 Bacteria 1519
155 Ga0070715_10886706 3300006163 Bacteria 548
156 Ga0070716_100007220 3300006173 Bacteria 5464
157 Ga0070716_100067550 3300006173 Bacteria 2088
158 Ga0070712_100032824 3300006175 Bacteria 3508
159 Ga0070712_100627082 3300006175 Bacteria 912
160 Ga0070712_101656083 3300006175 Bacteria 560
161 Ga0075362_10078151 3300006177 Bacteria 1522
162 Ga0075367_10504098 3300006178 Bacteria 768
163 Ga0075369_10364066 3300006186 Bacteria 679
164 Ga0075366_10758140 3300006195 Bacteria 603
165 Ga0097621_100306101 3300006237 Bacteria 1405
166 Ga0097621_100491236 3300006237 Bacteria 1111
167 Ga0068871_100215269 3300006358 Bacteria 1663
168 Ga0068871_102307727 3300006358 Bacteria 513
169 Ga0075428_101694586 3300006844 Bacteria 660
170 Ga0075433_11873910 3300006852 Bacteria 515
171 Ga0075434_100998236 3300006871 Bacteria 851
172 Ga0075434_102536305 3300006871 Bacteria 514
173 Ga0068865_100097401 3300006881 Bacteria 2147
174 Ga0099794_10059552 3300007265 Bacteria 1853
175 Ga0099794_10653890 3300007265 Bacteria 558
176 Ga0099795_10024518 3300007788 Bacteria 2013
177 Ga0099795_10264014 3300007788 Bacteria 746
178 Ga0099795_10525200 3300007788 Bacteria 555
179 Ga0105240_10028738 3300009093 Bacteria 7254
180 Ga0105240_10047953 3300009093 Bacteria 5402
181 Ga0105240_10189207 3300009093 Bacteria 2421
182 Ga0105240_10461369 3300009093 Bacteria 1419
183 Ga0105240_11355183 3300009093 Bacteria 749
184 Ga0105240_11611118 3300009093 Bacteria 679
185 Ga0111539_10093931 3300009094 Bacteria 3523
186 Ga0111539_13504050 3300009094 Bacteria 504
187 Ga0105245_10093236 3300009098 Bacteria 2774
188 Ga0105245_11177621 3300009098 Bacteria 814
189 Ga0105245_11268877 3300009098 Bacteria 785
190 Ga0105247_10240343 3300009101 Bacteria 1234
191 Ga0105243_10093348 3300009148 Bacteria 2483
192 Ga0105243_10967365 3300009148 Bacteria 851
193 Ga0105243_11963456 3300009148 Bacteria 619
194 Ga0105243_12355502 3300009148 Unclassified 570
195 Ga0105241_10047352 3300009174 Bacteria 3269
196 Ga0105241_10877138 3300009174 Bacteria 832
197 Ga0105242_10051882 3300009176 Bacteria 3344
198 Ga0105242_10831111 3300009176 Bacteria 917
199 Ga0105242_11913351 3300009176 Bacteria 634
200 Ga0105248_10611999 3300009177 Bacteria 1229
201 Ga0105248_12523632 3300009177 Bacteria 586
202 Ga0105248_13419677 3300009177 Bacteria 504
203 Ga0105237_10005643 3300009545 Bacteria 14090
204 Ga0105237_10014877 3300009545 Bacteria 8114
205 Ga0105237_10029473 3300009545 Bacteria 5579
206 Ga0105237_10248145 3300009545 Bacteria 1782
207 Ga0105237_11174676 3300009545 Bacteria 774
208 Ga0105237_11683781 3300009545 Bacteria 641
209 Ga0105237_12711798 3300009545 Bacteria 506
210 Ga0105238_10001837 3300009551 Bacteria 21282
211 Ga0105238_10014865 3300009551 Bacteria 7875
212 Ga0105238_10018123 3300009551 Bacteria 7159
213 Ga0105238_10407771 3300009551 Bacteria 1353
214 Ga0105249_10044480 3300009553 Bacteria 4037
215 Ga0105249_12493091 3300009553 Bacteria 590
216 Ga0105249_13485995 3300009553 Bacteria 506
217 Ga0099796_10032904 3300010159 Bacteria 1703
218 Ga0099796_10085197 3300010159 Bacteria 1166
219 Ga0105239_10023538 3300010375 Bacteria 6784
220 Ga0105239_10063511 3300010375 Bacteria 4054
221 Ga0105239_10085653 3300010375 Bacteria 3473
222 Ga0105239_10125840 3300010375 Bacteria 2848
223 Ga0105239_11872700 3300010375 Bacteria 695
224 Ga0105239_12128009 3300010375 Bacteria 652
225 Ga0105239_12247290 3300010375 Bacteria 634
226 Ga0105239_13226338 3300010375 Bacteria 531
227 Ga0105246_10280991 3300011119 Bacteria 1335
228 Ga0105246_10341466 3300011119 Bacteria 1224
229 Ga0105246_10446928 3300011119 Bacteria 1085
230 Ga0105246_11299457 3300011119 Bacteria 674
231 Ga0105246_12433840 3300011119 Bacteria 514
232 Ga0157319_1005298 3300012497 Bacteria 883
233 Ga0157370_10027385 3300013104 Bacteria 5620
234 Ga0157370_10257438 3300013104 Bacteria 1613
235 Ga0157369_10026982 3300013105 Bacteria 6370
236 Ga0157369_10723343 3300013105 Bacteria 1025
237 Ga0157374_11835973 3300013296 Bacteria 632
238 Ga0157378_10030150 3300013297 Bacteria 4792
239 Ga0157378_11054735 3300013297 Bacteria 849
240 Ga0163162_10119163 3300013306 Bacteria 2742
241 Ga0157375_10379311 3300013308 Bacteria 1580
242 Ga0157375_11704681 3300013308 Bacteria 746
243 Ga0157375_12892231 3300013308 Bacteria 574
244 Ga0157375_13109143 3300013308 Bacteria 554
245 Ga0163163_11603738 3300014325 Bacteria 712
246 Ga0163163_11760596 3300014325 Bacteria 680
247 Ga0163163_12689759 3300014325 Bacteria 555
248 Ga0157380_10412787 3300014326 Bacteria 1285
249 Ga0157380_10686294 3300014326 Bacteria 1027
250 Ga0157380_12525868 3300014326 Bacteria 580
251 Ga0182008_10713716 3300014497 Bacteria 574
252 Ga0157379_10291308 3300014968 Bacteria 1487
253 Ga0157379_11314991 3300014968 Bacteria 698
254 Ga0157376_10081108 3300014969 Bacteria 2785
255 Ga0157376_11355528 3300014969 Bacteria 742
256 Ga0163161_10442897 3300017792 Bacteria 1049
257 Ga0213876_10041155 3300021384 Bacteria 2442
258 Ga0209677_100235 3300025253 Bacteria 38918
259 Ga0209564_1009747 3300025295 Bacteria 4521
260 Ga0209758_1001576 3300025297 Bacteria 26090
261 Ga0209758_1007649 3300025297 Bacteria 7285
262 Ga0209758_1121224 3300025297 Bacteria 705
263 Ga0207656_10063389 3300025321 Bacteria 1627
264 Ga0207656_10151391 3300025321 Bacteria 1099
265 Ga0207692_10073593 3300025898 Bacteria 1808
266 Ga0207692_10230096 3300025898 Bacteria 1103
267 Ga0207642_10008842 3300025899 Bacteria 3477
268 Ga0207710_10152399 3300025900 Bacteria 1122
269 Ga0207710_10594277 3300025900 Bacteria 578
270 Ga0207688_10124104 3300025901 Bacteria 1509
271 Ga0207680_10984507 3300025903 Bacteria 604
272 Ga0207647_10002624 3300025904 Bacteria 13593
273 Ga0207685_10282414 3300025905 Bacteria 815
274 Ga0207699_10402923 3300025906 Bacteria 974
275 Ga0207699_11067732 3300025906 Bacteria 598
276 Ga0207699_11254661 3300025906 Bacteria 549
277 Ga0207645_10247030 3300025907 Bacteria 1180
278 Ga0207705_10113159 3300025909 Bacteria 2007
279 Ga0207705_10260891 3300025909 Bacteria 1323
280 Ga0207705_11479457 3300025909 Bacteria 515
281 Ga0207684_10937158 3300025910 Bacteria 727
282 Ga0207654_10003876 3300025911 Bacteria 7539
283 Ga0207654_10940540 3300025911 Bacteria 627
284 Ga0207707_10059270 3300025912 Bacteria 3331
285 Ga0207707_10092716 3300025912 Bacteria 2639
286 Ga0207695_10004042 3300025913 Bacteria 20184
287 Ga0207695_10012960 3300025913 Bacteria 9965
288 Ga0207695_10335570 3300025913 Bacteria 1400
289 Ga0207671_10015510 3300025914 Bacteria 5960
290 Ga0207671_10031399 3300025914 Bacteria 3958
291 Ga0207671_10103241 3300025914 Bacteria 2162
292 Ga0207671_10405141 3300025914 Bacteria 1085
293 Ga0207671_10414576 3300025914 Bacteria 1071
294 Ga0207671_10473748 3300025914 Bacteria 998
295 Ga0207693_10011177 3300025915 Bacteria 7268
296 Ga0207693_10033297 3300025915 Bacteria 4067
297 Ga0207693_10093209 3300025915 Bacteria 2361
298 Ga0207663_10080161 3300025916 Bacteria 2134
299 Ga0207663_10795145 3300025916 Bacteria 753
300 Ga0207663_11079689 3300025916 Bacteria 645
301 Ga0207660_10017864 3300025917 Bacteria 4720
302 Ga0207660_10133415 3300025917 Bacteria 1892
303 Ga0207660_10289639 3300025917 Bacteria 1302
304 Ga0207660_10756931 3300025917 Bacteria 793
305 Ga0207660_10874562 3300025917 Bacteria 733
306 Ga0207657_10004981 3300025919 Bacteria 13971
307 Ga0207657_10599984 3300025919 Bacteria 859
308 Ga0207657_10915518 3300025919 Bacteria 675
309 Ga0207657_10918921 3300025919 Bacteria 674
310 Ga0207649_10189962 3300025920 Bacteria 1444
311 Ga0207652_10015155 3300025921 Bacteria 6255
312 Ga0207652_10444209 3300025921 Bacteria 1169
313 Ga0207652_11090715 3300025921 Bacteria 699
314 Ga0207681_10317196 3300025923 Bacteria 1238
315 Ga0207694_10000082 3300025924 Bacteria 109787
316 Ga0207694_10042681 3300025924 Bacteria 3499
317 Ga0207694_10048492 3300025924 Bacteria 3286
318 Ga0207650_11173134 3300025925 Bacteria 654
319 Ga0207687_11118216 3300025927 Bacteria 677
320 Ga0207687_11319200 3300025927 Bacteria 620
321 Ga0207687_11319635 3300025927 Bacteria 620
322 Ga0207700_10055551 3300025928 Bacteria 2977
323 Ga0207700_10275884 3300025928 Bacteria 1444
324 Ga0207700_10322022 3300025928 Bacteria 1340
325 Ga0207700_11003127 3300025928 Bacteria 747
326 Ga0207700_11086488 3300025928 Bacteria 715
327 Ga0207664_10037970 3300025929 Bacteria 3731
328 Ga0207664_10058930 3300025929 Bacteria 3056
329 Ga0207664_10883372 3300025929 Bacteria 803
330 Ga0207644_10063190 3300025931 Bacteria 2688
331 Ga0207644_10619743 3300025931 Bacteria 899
332 Ga0207644_11631659 3300025931 Bacteria 541
333 Ga0207690_10026152 3300025932 Bacteria 3673
334 Ga0207690_10230047 3300025932 Bacteria 1423
335 Ga0207706_10051098 3300025933 Bacteria 3651
336 Ga0207706_10884245 3300025933 Bacteria 755
337 Ga0207706_10889116 3300025933 Bacteria 753
338 Ga0207686_10283393 3300025934 Bacteria 1224
339 Ga0207709_10008505 3300025935 Bacteria 5678
340 Ga0207709_10067048 3300025935 Bacteria 2263
341 Ga0207670_11276726 3300025936 Bacteria 622
342 Ga0207669_10125578 3300025937 Bacteria 1752
343 Ga0207669_10176802 3300025937 Bacteria 1525
344 Ga0207669_11027750 3300025937 Bacteria 693
345 Ga0207704_10051070 3300025938 Bacteria 2498
346 Ga0207704_10851129 3300025938 Bacteria 764
347 Ga0207665_10246166 3300025939 Bacteria 1319
348 Ga0207665_10259030 3300025939 Bacteria 1288
349 Ga0207691_10034519 3300025940 Bacteria 4702
350 Ga0207691_11181823 3300025940 Bacteria 635
351 Ga0207711_11200023 3300025941 Bacteria 700
352 Ga0207689_10275231 3300025942 Bacteria 1394
353 Ga0207689_11173315 3300025942 Bacteria 647
354 Ga0207661_10167569 3300025944 Bacteria 1910
355 Ga0207679_10653027 3300025945 Bacteria 951
356 Ga0207667_10013948 3300025949 Bacteria 9181
357 Ga0207667_10078267 3300025949 Bacteria 3427
358 Ga0207667_10207544 3300025949 Bacteria 2008
359 Ga0207667_10490751 3300025949 Bacteria 1246
360 Ga0207667_10767889 3300025949 Bacteria 962
361 Ga0207667_10921839 3300025949 Bacteria 864
362 Ga0207651_11154374 3300025960 Bacteria 695
363 Ga0207712_10129613 3300025961 Bacteria 1920
364 Ga0207668_10038360 3300025972 Bacteria 3214
365 Ga0207668_10417169 3300025972 Bacteria 1138
366 Ga0207668_10450331 3300025972 Bacteria 1098
367 Ga0207640_10907455 3300025981 Bacteria 770
368 Ga0207658_10571410 3300025986 Bacteria 1013
369 Ga0207658_11795392 3300025986 Bacteria 559
370 Ga0207658_11796391 3300025986 Bacteria 559
371 Ga0207658_11981575 3300025986 Bacteria 530
372 Ga0207703_10446060 3300026035 Bacteria 1208
373 Ga0207703_10958593 3300026035 Bacteria 820
374 Ga0207639_10016076 3300026041 Bacteria 5287
375 Ga0207639_10022946 3300026041 Bacteria 4500
376 Ga0207639_10200670 3300026041 Bacteria 1710
377 Ga0207639_10294007 3300026041 Bacteria 1433
378 Ga0207639_10626828 3300026041 Bacteria 993
379 Ga0207678_10058598 3300026067 Bacteria 3313
380 Ga0207678_10160182 3300026067 Bacteria 1922
381 Ga0207678_10185583 3300026067 Bacteria 1776
382 Ga0207678_10250454 3300026067 Bacteria 1517
383 Ga0207678_11797514 3300026067 Bacteria 537
384 Ga0207708_10054831 3300026075 Bacteria 3039
385 Ga0207702_10000002 3300026078 Bacteria 491507
386 Ga0207702_10003315 3300026078 Bacteria 14804
387 Ga0207702_11087798 3300026078 Bacteria 793
388 Ga0207702_12200052 3300026078 Bacteria 540
389 Ga0207648_10037161 3300026089 Bacteria 4288
390 Ga0207648_11467912 3300026089 Bacteria 641
391 Ga0207676_10147521 3300026095 Bacteria 2022
392 Ga0207674_10001889 3300026116 Bacteria 26658
393 Ga0207674_10004659 3300026116 Bacteria 16461
394 Ga0207674_10005787 3300026116 Bacteria 14663
395 Ga0207674_11151868 3300026116 Bacteria 745
396 Ga0207675_100063476 3300026118 Bacteria 3451
397 Ga0207675_100393127 3300026118 Bacteria 1365
398 Ga0207675_101747017 3300026118 Bacteria 642
399 Ga0207683_10377778 3300026121 Bacteria 1302
400 Ga0207698_10160918 3300026142 Bacteria 1963
401 Ga0207698_10211937 3300026142 Bacteria 1744
402 Ga0207698_10215367 3300026142 Bacteria 1731
403 Ga0207698_11666658 3300026142 Bacteria 653
404 Ga0209179_1004345 3300027512 Bacteria 2132
405 Ga0209588_1063920 3300027671 Bacteria 1189
406 Ga0209813_10096797 3300027866 Bacteria 999
407 Ga0268266_10004442 3300028379 Bacteria 13419
408 Ga0268266_10816346 3300028379 Bacteria 901
409 Ga0268265_11407848 3300028380 Bacteria 699
410 Ga0268265_12288545 3300028380 Bacteria 547
411 Ga0268264_11338603 3300028381 Bacteria 726
412 Ga0268264_12318401 3300028381 Bacteria 544
413 Ga0307517_10390735 3300028786 Bacteria 740
414 Ga0265338_10769484 3300028800 Bacteria 661
415 Ga0307511_10049805 3300030521 Bacteria 3383
416 Ga0265330_10035542 3300031235 Bacteria 2223
417 Ga0265330_10119307 3300031235 Bacteria 1124
418 Ga0265332_10006188 3300031238 Bacteria 5455
419 Ga0265332_10113260 3300031238 Bacteria 1141
420 Ga0265328_10255064 3300031239 Bacteria 672
421 Ga0265325_10022232 3300031241 Bacteria 3477
422 Ga0265340_10002614 3300031247 Bacteria 10238
423 Ga0265339_10100248 3300031249 Bacteria 1508
424 Ga0265331_10035274 3300031250 Bacteria 2462
425 Ga0265316_10140574 3300031344 Bacteria 1814
426 Ga0265316_10155117 3300031344 Bacteria 1714
427 Ga0307509_10038177 3300031507 Bacteria 5241
428 Ga0307509_10218560 3300031507 Bacteria 1721
429 Ga0307509_10347977 3300031507 Bacteria 1206
430 Ga0307509_10671558 3300031507 Bacteria 704
431 Ga0307508_10000009 3300031616 Bacteria 256966
432 Ga0307508_10164958 3300031616 Bacteria 1818
433 Ga0265314_10047125 3300031711 Bacteria 3036
434 Ga0265314_10226595 3300031711 Bacteria 1087
435 Ga0265342_10263205 3300031712 Bacteria 917
436 Ga0307516_10109129 3300031730 Bacteria 2573
437 Ga0307516_10147601 3300031730 Bacteria 2116
438 Ga0307413_10055169 3300031824 Bacteria 2416
439 Ga0307413_11159284 3300031824 Bacteria 670
440 Ga0307410_10598894 3300031852 Bacteria 919
441 Ga0307407_10505054 3300031903 Bacteria 887
442 Ga0307412_10806642 3300031911 Bacteria 815
443 Ga0307409_101901686 3300031995 Bacteria 624
444 Ga0307414_10364317 3300032004 Bacteria 1245
445 Ga0307411_12288974 3300032005 Bacteria 507
446 Ga0307415_100627553 3300032126 Bacteria 960
447 Ga0307507_10035312 3300033179 Bacteria 5138
448 Ga0307510_10142653 3300033180 Bacteria 2035
449 Ga0307510_10494591 3300033180 Bacteria 665
450 Ga0315911_1000001 3300033442 Bacteria 1088602
451 Ga0316215_1016541 3300033544 Bacteria 742
452 Ga0316215_1030587 3300033544 Bacteria 558
453 Ga0316215_1034504 3300033544 Bacteria 528
454 Ga0373926_0024531 3300035083 Bacteria 2101
455 Ga0373934_0001166 3300035086 Bacteria 9586
456 Ga0373934_0434512 3300035086 Bacteria 550
457 Ga0373944_0103137 3300035089 Bacteria 966
458 Ga0373923_0008553 3300035111 Bacteria 3657
459 Ga0373923_0548369 3300035111 Bacteria 566
460 Ga0373932_0167563 3300035112 Bacteria 763
461 Ga0373936_0043565 3300035113 Bacteria 1804
462 Ga0373936_0095072 3300035113 Bacteria 1253
463 Ga0373936_0136528 3300035113 Bacteria 1057
464 Ga0373939_0334682 3300035114 Bacteria 612
465 Ga0373953_0003332 3300035117 Bacteria 4982
466 Ga0373953_0331693 3300035117 Bacteria 666
467 Ga0373953_0429982 3300035117 Bacteria 582
468 Ga0373954_0007921 3300035118 Bacteria 4653
469 Ga0373954_0319627 3300035118 Bacteria 766
470 Ga0373956_0001159 3300035119 Bacteria 10897
471 Ga0373957_0009755 3300035120 Bacteria 3149
472 Ga0373943_0013016 3300035170 Bacteria 3753
473 Ga0373946_0063490 3300035171 Bacteria 1577
474 Ga0373955_0003515 3300035172 Bacteria 6895
475 Ga0373955_0406131 3300035172 Bacteria 828
476 Ga0373924_0013420 3300035410 Bacteria 3079
477 Ga0373924_0045234 3300035410 Bacteria 1811
478 Ga0373935_0000701 3300035692 Bacteria 17791
479 Ga0373935_0191650 3300035692 Bacteria 1408
480 Ga0373935_0499099 3300035692 Bacteria 883
481 Ga0373935_0684413 3300035692 Bacteria 754
482 Ga0373935_0754217 3300035692 Bacteria 717
483 Ga0373935_1441226 3300035692 Bacteria 515
484 Ga0373927_0001744 3300035695 Bacteria 16246
485 Ga0373927_0007540 3300035695 Bacteria 7359
486 Ga0373927_0013004 3300035695 Bacteria 5535
487 Ga0373927_0551897 3300035695 Bacteria 761
488 Ga0373933_0008789 3300035724 Bacteria 5508
489 Ga0373933_0030554 3300035724 Bacteria 3120
490 Ga0373933_1165185 3300035724 Bacteria 508
491 Ga0373947_0005322 3300035725 Bacteria 7521
492 Ga0373947_0161160 3300035725 Bacteria 1451
493 Ga0373947_0330820 3300035725 Bacteria 1020
494 Ga0373937_0067053 3300036401 Bacteria 3306
495 Ga0373937_0246381 3300036401 Bacteria 1684
496 Ga0373937_1823718 3300036401 Bacteria 555
497 Ga0310110_015967 3300036535 Bacteria 1070
498 Ga0373925_0004587 3300037068 Bacteria 10437
499 Ga0373925_0206849 3300037068 Bacteria 1562
500 Ga0373925_0277464 3300037068 Bacteria 1349
501 Ga0395900_0583962 3300037418 Bacteria 1059
502 Ga0395898_0121218 3300037466 Bacteria 2506
503 Ga0395905_0043982 3300037471 Bacteria 4191
504 Ga0436364_0609221 3300037853 Bacteria 1332
505 Ga0436365_1678992 3300039437 Bacteria 2667
506 Ga0439465_0425671 3300041413 Bacteria 507
507 Ga0451791_0310822 3300041451 Bacteria 844
508 Ga0451791_1004722 3300041451 Bacteria 557
509 Ga0451797_0286223 3300041453 Bacteria 616
510 Ga0451802_1199996 3300041460 Bacteria 688
511 Ga0451802_1963004 3300041460 Bacteria 707
512 Ga0451807_0794862 3300041486 Bacteria 638
513 Ga0451833_0692571 3300041491 Bacteria 838
514 Ga0451843_1671675 3300041509 Bacteria 1284
515 Ga0495592_0008975 3300046454 Bacteria 7511
516 Ga0495592_0856949 3300046454 Bacteria 536
517 Ga0495603_0000624 3300046455 Bacteria 19835
518 Ga0495603_0164144 3300046455 Bacteria 1288
519 Ga0495629_0001961 3300046459 Bacteria 16039
520 Ga0495629_0004200 3300046459 Bacteria 10815
521 Ga0495629_0699485 3300046459 Bacteria 673
522 Ga0495641_0010879 3300046461 Bacteria 5230
523 Ga0495651_0039274 3300046462 Bacteria 3686
524 Ga0495651_0099650 3300046462 Bacteria 2166
525 Ga0495653_0000923 3300046463 Bacteria 22739
526 Ga0495580_0008876 3300046472 Bacteria 7954
527 Ga0495582_0000739 3300046473 Bacteria 18050
528 Ga0495605_0031514 3300046474 Bacteria 2708
529 Ga0495639_0000335 3300046475 Bacteria 22677
530 Ga0495662_0008807 3300046476 Bacteria 4962
531 Ga0495662_0232035 3300046476 Bacteria 910
532 Ga0495662_0410665 3300046476 Bacteria 665
533 Ga0495664_0054559 3300046477 Bacteria 2376
534 Ga0495664_0301238 3300046477 Bacteria 968
535 Ga0495664_0889492 3300046477 Bacteria 521
536 Ga0495664_0947145 3300046477 Bacteria 502
537 Ga0495584_0610427 3300046491 Bacteria 556
538 Ga0495584_0716314 3300046491 Bacteria 510
539 Ga0495594_0004402 3300046499 Bacteria 7249
540 Ga0495594_0166097 3300046499 Bacteria 1255
541 Ga0495596_0180855 3300046500 Bacteria 820
542 Ga0495607_0231301 3300046501 Bacteria 899
543 Ga0495606_0238331 3300046507 Bacteria 1016
544 Ga0495608_0003276 3300046511 Bacteria 11569
545 Ga0495618_0172687 3300046514 Bacteria 1375
546 Ga0495628_0043887 3300046516 Bacteria 3559
547 Ga0495628_0073081 3300046516 Bacteria 2672
548 Ga0495630_0010570 3300046517 Bacteria 6669
549 Ga0495631_0245681 3300046518 Bacteria 763
550 Ga0495643_0252352 3300046522 Bacteria 823
551 Ga0495644_0099049 3300046523 Bacteria 1102
552 Ga0495648_0006521 3300046524 Bacteria 9507
553 Ga0495648_0030230 3300046524 Bacteria 3584
554 Ga0495666_0264561 3300046526 Bacteria 782
555 Ga0495666_0525020 3300046526 Bacteria 528
556 Ga0495652_0002339 3300046529 Bacteria 19668
557 Ga0495652_0109021 3300046529 Bacteria 2230
558 Ga0495652_0345840 3300046529 Bacteria 1067
559 Ga0495665_0005791 3300046531 Bacteria 6669
560 Ga0495640_0000826 3300046533 Bacteria 23573
561 Ga0495640_0375237 3300046533 Bacteria 875
562 Ga0495586_0220580 3300046535 Bacteria 1078
563 Ga0495587_0032759 3300046536 Bacteria 3139
564 Ga0495598_0258399 3300046537 Bacteria 647
565 Ga0495645_0194641 3300046543 Bacteria 1379
566 Ga0495645_0595835 3300046543 Bacteria 680
567 Ga0495622_0028887 3300046557 Bacteria 2591
568 Ga0495622_0133936 3300046557 Bacteria 1127
569 Ga0495667_0009056 3300046559 Bacteria 6764
570 Ga0495656_0170013 3300046615 Bacteria 1065
571 Ga0495634_0001338 3300046642 Bacteria 22465
572 Ga0495634_0007240 3300046642 Bacteria 8363
573 Ga0495611_0443550 3300046648 Bacteria 592
574 Ga0495625_0615905 3300046660 Bacteria 650
575 Ga0495635_0000187 3300046663 Bacteria 39002
576 Ga0495635_0006608 3300046663 Bacteria 8094
577 Ga0495659_0101276 3300046664 Bacteria 1116
578 Ga0495588_0014639 3300046674 Bacteria 3759
579 Ga0495588_0418607 3300046674 Bacteria 703
580 Ga0495657_0024857 3300046675 Bacteria 4258
581 Ga0495657_0057670 3300046675 Bacteria 2581
582 Ga0495657_0111670 3300046675 Bacteria 1731
583 Ga0495657_0123835 3300046675 Bacteria 1626
584 Ga0495599_0002320 3300046678 Bacteria 11052
585 Ga0495623_0007791 3300046679 Bacteria 6962
586 Ga0495623_0640593 3300046679 Bacteria 549
587 Ga0495646_0021219 3300046680 Bacteria 4106
588 Ga0495647_0002967 3300046681 Bacteria 5389
589 Ga0495658_0000047 3300046683 Bacteria 59626
590 Ga0495669_0030372 3300046684 Bacteria 2372
591 Ga0495613_0001031 3300046689 Bacteria 21255
592 Ga0495613_0014828 3300046689 Bacteria 5784
593 Ga0495613_0535560 3300046689 Bacteria 785
594 Ga0495624_0002051 3300046690 Bacteria 15345
595 Ga0495649_0367371 3300046694 Bacteria 725
596 Ga0495589_0348573 3300046794 Bacteria 682
597 Ga0495600_0013920 3300046809 Bacteria 5068
598 Ga0495600_0086049 3300046809 Bacteria 2051
599 Ga0495600_0170817 3300046809 Bacteria 1403
600 Ga0495581_0000563 3300047315 Bacteria 19241
601 Ga0495604_0010697 3300047317 Bacteria 7282
602 Ga0495674_0001402 3300047319 Bacteria 23571
603 Ga0495674_0046806 3300047319 Bacteria 3839
604 Ga0495674_0994502 3300047319 Bacteria 643
605 Ga0495674_1427849 3300047319 Bacteria 515
606 Ga0495672_0018107 3300047320 Bacteria 4688
607 Ga0495672_0543610 3300047320 Bacteria 510
608 Ga0495676_0245695 3300047321 Bacteria 1223
609 Ga0495680_0030674 3300047322 Bacteria 4386
610 Ga0495680_0080724 3300047322 Bacteria 2457
611 Ga0495680_0593325 3300047322 Bacteria 742
612 Ga0495680_0717500 3300047322 Unclassified 659
613 Ga0495680_0953237 3300047322 Bacteria 551
614 Ga0495683_0319158 3300047323 Bacteria 663
615 Ga0495675_0005669 3300047444 Bacteria 7628
616 Ga0495675_0493852 3300047444 Bacteria 704
617 Ga0495684_0001482 3300047471 Bacteria 18783
618 Ga0495684_0008519 3300047471 Bacteria 7942
619 Ga0495686_0095836 3300047472 Bacteria 1797
620 Ga0495686_0168919 3300047472 Bacteria 1273
621 Ga0495593_0000723 3300047673 Bacteria 19146
622 Ga0495593_0006359 3300047673 Bacteria 6928
623 Ga0495602_0043621 3300048088 Bacteria 4075
624 Ga0495614_0270017 3300048089 Bacteria 781
625 Ga0496100_0796674 3300048903 Bacteria 740
626 Ga0496102_0032393 3300048905 Bacteria 4695
627 Ga0496102_0292270 3300048905 Bacteria 1536
628 Ga0496102_0598873 3300048905 Bacteria 1025
629 Ga0496102_1001474 3300048905 Bacteria 756
630 Ga0496102_1138956 3300048905 Bacteria 700
631 Ga0496104_0010232 3300048907 Bacteria 8375
632 Ga0496104_0385388 3300048907 Bacteria 1314
633 Ga0496104_0483799 3300048907 Bacteria 1149
634 Ga0496105_1196982 3300048908 Bacteria 559
635 Ga0496106_0000540 3300048909 Bacteria 26830
636 Ga0496106_0348444 3300048909 Bacteria 1190
637 Ga0496106_0514071 3300048909 Bacteria 962
638 Ga0496106_0841907 3300048909 Bacteria 726
639 Ga0496106_0894556 3300048909 Bacteria 701
640 Ga0496107_0456423 3300048910 Bacteria 949
641 Ga0496108_0245050 3300048911 Bacteria 1559
642 Ga0496108_0354000 3300048911 Bacteria 1281
643 Ga0496109_0551964 3300048912 Bacteria 1087
644 Ga0496110_0013566 3300048913 Bacteria 6743
645 Ga0496111_0071275 3300048914 Bacteria 2529
646 Ga0496112_0000021 3300048915 Bacteria 156561
647 Ga0496112_0484197 3300048915 Bacteria 1173
648 Ga0496112_0584444 3300048915 Bacteria 1049
649 Ga0496113_0163739 3300048916 Bacteria 1759
650 Ga0496113_0246939 3300048916 Bacteria 1424
651 Ga0496114_0234191 3300048917 Bacteria 1614
652 Ga0496114_0916999 3300048917 Bacteria 758
653 Ga0496115_0234694 3300048918 Bacteria 1512
654 Ga0496115_0276440 3300048918 Bacteria 1379
655 Ga0496115_0370766 3300048918 Bacteria 1165
656 Ga0496115_0526797 3300048918 Bacteria 947
657 Ga0496116_0369747 3300048919 Bacteria 648
658 Ga0496116_0483301 3300048919 Bacteria 520
659 Ga0496117_0037191 3300048920 Bacteria 3630
660 Ga0496118_0006481 3300048921 Bacteria 12851
661 Ga0496118_0022090 3300048921 Bacteria 5576
662 Ga0496118_0052105 3300048921 Bacteria 3125
663 Ga0496118_0453900 3300048921 Bacteria 650
664 Ga0496119_0139502 3300048922 Bacteria 1311
665 Ga0496119_0157482 3300048922 Bacteria 1211
666 Ga0496119_0218062 3300048922 Bacteria 978
667 Ga0496119_0226198 3300048922 Bacteria 955
668 Ga0496121_0000456 3300048924 Bacteria 80536
669 Ga0496121_0002176 3300048924 Bacteria 30692
670 Ga0496121_0005356 3300048924 Bacteria 16491
671 Ga0496121_0027220 3300048924 Bacteria 5356
672 Ga0496121_0062407 3300048924 Bacteria 3052
673 Ga0496121_0106637 3300048924 Bacteria 2148
674 Ga0496121_0206017 3300048924 Bacteria 1397
675 Ga0496121_0226379 3300048924 Bacteria 1313
676 Ga0496121_0276535 3300048924 Bacteria 1151
677 Ga0496121_0668145 3300048924 Bacteria 630
678 Ga0496122_0038748 3300048925 Bacteria 3811
679 Ga0496122_0331913 3300048925 Bacteria 803
680 Ga0496122_0343466 3300048925 Bacteria 783
681 Ga0496122_0605092 3300048925 Bacteria 512
682 Ga0496123_0101339 3300048926 Bacteria 1674
683 Ga0496123_0300052 3300048926 Bacteria 767
684 Ga0496124_0001010 3300048927 Bacteria 44569
685 Ga0496124_0141277 3300048927 Bacteria 1900
686 Ga0496124_0299355 3300048927 Bacteria 1163
687 Ga0496125_0000272 3300048928 Bacteria 105490
688 Ga0496125_0006804 3300048928 Bacteria 12277
689 Ga0496125_0026319 3300048928 Bacteria 5305
690 Ga0496125_0440152 3300048928 Bacteria 750
691 Ga0496125_0522979 3300048928 Bacteria 663
692 Ga0496126_0002820 3300048929 Bacteria 22789
693 Ga0496126_0010869 3300048929 Bacteria 9486
694 Ga0496126_0017190 3300048929 Bacteria 7213
695 Ga0496126_0022319 3300048929 Bacteria 6161
696 Ga0496126_0037772 3300048929 Bacteria 4502
697 Ga0496126_0051196 3300048929 Bacteria 3760
698 Ga0496126_0085595 3300048929 Bacteria 2779
699 Ga0496126_0130347 3300048929 Bacteria 2173
700 Ga0496126_0132118 3300048929 Bacteria 2156
701 Ga0496126_0162002 3300048929 Bacteria 1911
702 Ga0496126_0322251 3300048929 Bacteria 1270
703 Ga0496126_0529996 3300048929 Bacteria 937
704 Ga0496126_0763561 3300048929 Bacteria 745
705 Ga0496126_0855724 3300048929 Bacteria 693
706 Ga0496126_0876333 3300048929 Bacteria 683
707 Ga0501031_0225489 3300049568 Bacteria 1220
708 Ga0501031_0764065 3300049568 Bacteria 620
709 Ga0501032_0029893 3300049569 Bacteria 3737
710 Ga0501033_0013873 3300049570 Bacteria 6131
711 Ga0501033_0701666 3300049570 Bacteria 688
712 Ga0501034_0184180 3300049571 Bacteria 2052
713 Ga0501034_0447118 3300049571 Bacteria 1210
714 Ga0501036_0066886 3300049572 Bacteria 3041
715 Ga0501036_0506913 3300049572 Bacteria 1004
716 Ga0501037_0008746 3300049573 Bacteria 7421
717 Ga0501037_0318506 3300049573 Bacteria 1077
718 Ga0501037_0334073 3300049573 Bacteria 1047
719 Ga0501038_0140923 3300049574 Bacteria 1972
720 Ga0501038_1007107 3300049574 Unclassified 611
721 Ga0501039_0101591 3300049575 Bacteria 2244
722 Ga0501042_0291495 3300049578 Bacteria 1179
723 Ga0501043_0070101 3300049579 Bacteria 2753
724 Ga0501043_1205816 3300049579 Bacteria 531
725 Ga0501046_0099277 3300049580 Bacteria 2235
726 Ga0501046_0304009 3300049580 Bacteria 1164
727 Ga0501047_0055504 3300049581 Bacteria 3830
728 Ga0501048_0081995 3300049582 Bacteria 2275
729 Ga0501067_0061344 3300049583 Bacteria 2082
730 Ga0501067_0476014 3300049583 Bacteria 698
731 Ga0501067_0739114 3300049583 Bacteria 554
732 Ga0501068_0125629 3300049584 Bacteria 1602
733 Ga0501069_0167758 3300049585 Bacteria 1266
734 Ga0501070_0076502 3300049586 Bacteria 2771
735 Ga0501071_0108660 3300049587 Bacteria 2049
736 Ga0501072_0689879 3300049588 Bacteria 803
737 Ga0501072_0812623 3300049588 Bacteria 732
738 Ga0501072_0840148 3300049588 Bacteria 718
739 Ga0501073_0342449 3300049589 Bacteria 1032
740 Ga0501074_0114738 3300049590 Bacteria 1927
741 Ga0501079_0499874 3300049741 Bacteria 956
742 Ga0501080_0084317 3300049742 Bacteria 2952
743 Ga0501035_0079019 3300049822 Bacteria 2906
744 Ga0501035_0091301 3300049822 Bacteria 2680
745 Ga0501035_0316247 3300049822 Bacteria 1313
746 Ga0501044_0110279 3300049823 Bacteria 2760
747 Ga0501044_0211670 3300049823 Bacteria 1892
748 Ga0501044_1584184 3300049823 Bacteria 520
749 Ga0501045_0333804 3300049824 Bacteria 1128
750 nmdc:mga03683_440359_c1 3300050489 Bacteria 626
751 nmdc:mga03n38_107010_c1 3300050490 Bacteria 1357
752 nmdc:mga00v17_295619_c1 3300050491 Bacteria 1052
753 nmdc:mga00v17_473662_c1 3300050491 Bacteria 812
754 nmdc:mga0yw44_1188402_c1 3300050492 Bacteria 515
755 nmdc:mga0k408_894330_c1 3300050493 Bacteria 515
756 nmdc:mga06z11_15312_c1 3300050494 Bacteria 3420
757 nmdc:mga07m45_548575_c1 3300050496 Bacteria 668
758 nmdc:mga07m45_98117_c1 3300050496 Bacteria 1682
759 nmdc:mga08y16_671424_c1 3300050511 Bacteria 1038
760 nmdc:mga0n895_405781_c1 3300050512 Bacteria 1378
761 nmdc:mga0n895_606732_c1 3300050512 Bacteria 1096
762 Ga0500635_0020115 3300053080 Bacteria 2040
763 Ga0500635_0097419 3300053080 Bacteria 1078
764 Ga0495655_0339768 3300053083 Bacteria 523
765 Ga0495595_0005251 3300053084 Bacteria 5231
766 Ga0495619_0002231 3300053085 Bacteria 12815
767 Ga0495619_0035165 3300053085 Bacteria 3259
768 Ga0500647_0069387 3300053091 Bacteria 1695
769 Ga0500647_0189726 3300053091 Bacteria 938
770 Ga0500651_0257544 3300053093 Bacteria 1012
771 Ga0500651_0313457 3300053093 Bacteria 897
772 Ga0500566_0000938 3300053094 Bacteria 16701
773 Ga0500566_0001308 3300053094 Bacteria 14522
774 Ga0500566_0134949 3300053094 Bacteria 1316
775 Ga0500640_003151 3300053095 Bacteria 5670
776 Ga0500650_0166768 3300053098 Bacteria 1014
777 Ga0500554_043366 3300053102 Bacteria 1389
778 Ga0500554_051279 3300053102 Bacteria 1299
779 Ga0500558_199236 3300053106 Bacteria 699
780 Ga0500572_000217 3300053111 Bacteria 20413
781 Ga0500592_037622 3300053116 Bacteria 782
782 Ga0500595_000324 3300053119 Bacteria 31413
783 Ga0500595_002617 3300053119 Bacteria 8763
784 Ga0500595_006868 3300053119 Bacteria 4785
785 Ga0500595_025854 3300053119 Bacteria 2029
786 Ga0500595_042239 3300053119 Bacteria 1460
787 Ga0500597_397152 3300053120 Bacteria 525
788 Ga0500608_051766 3300053122 Bacteria 1972
789 Ga0500614_005804 3300053123 Bacteria 2593
790 Ga0500652_065775 3300053131 Bacteria 1497
791 Ga0500559_0001486 3300053136 Bacteria 13223
792 Ga0500559_0018761 3300053136 Bacteria 2921
793 Ga0500559_0287895 3300053136 Bacteria 772
794 Ga0500559_0315713 3300053136 Bacteria 733
795 Ga0500568_0056098 3300053139 Bacteria 1536
796 Ga0500573_0015719 3300053140 Bacteria 4293
797 Ga0500590_195182 3300053148 Bacteria 863
798 Ga0500603_000507 3300053150 Bacteria 9880
799 Ga0500603_011705 3300053150 Bacteria 2003
800 Ga0500603_058945 3300053150 Bacteria 1069
801 Ga0500603_179537 3300053150 Bacteria 665
802 Ga0500619_312113 3300053154 Bacteria 505
803 Ga0500627_0118630 3300053158 Bacteria 1192
804 Ga0500630_000537 3300053159 Bacteria 17060
805 Ga0500638_000078 3300053162 Bacteria 17252
806 Ga0500638_002399 3300053162 Bacteria 6506
807 Ga0500638_061923 3300053162 Bacteria 1797
808 Ga0500639_000001 3300053163 Bacteria 244795
809 Ga0500639_115377 3300053163 Bacteria 1299
810 Ga0500636_0008443 3300053177 Bacteria 5973
811 Ga0500636_0019204 3300053177 Bacteria 4044
812 Ga0500636_0066084 3300053177 Bacteria 2103
813 Ga0500636_0162190 3300053177 Bacteria 1217
814 Ga0500636_0186634 3300053177 Bacteria 1108
815 Ga0500637_0000088 3300053178 Bacteria 33146
816 Ga0500637_0030575 3300053178 Bacteria 2997
817 Ga0500637_0117642 3300053178 Bacteria 1542
818 Ga0500637_0289334 3300053178 Bacteria 898
819 Ga0500570_143918 3300053724 Bacteria 868
820 Ga0500576_095614 3300053725 Bacteria 1224
821 Ga0500657_129993 3300053728 Bacteria 979
822 Ga0500645_083395 3300053730 Bacteria 911
823 Ga0500596_000054 3300053735 Bacteria 15502
824 Ga0500596_033617 3300053735 Bacteria 801
825 Ga0500601_005425 3300053737 Bacteria 1395
826 Ga0500661_000867 3300055283 Bacteria 5651
827 Ga0500661_017471 3300055283 Bacteria 1282

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_11067732 Ga0207699_110677322 48
2 3300048910 Ga0496107_0456423 Ga0496107_0456423_704_850 48
3 3300048924 Ga0496121_0002176 Ga0496121_0002176_30347_30493 48
4 3300048929 Ga0496126_0051196 Ga0496126_0051196_3534_3680 48
5 3300049568 Ga0501031_0225489 Ga0501031_0225489_962_1108 48
6 3300049569 Ga0501032_0029893 Ga0501032_0029893_2736_2882 48
7 3300049570 Ga0501033_0013873 Ga0501033_0013873_4272_4418 48
8 3300049570 Ga0501033_0701666 Ga0501033_0701666_16_162 48
9 3300049571 Ga0501034_0184180 Ga0501034_0184180_1896_2042 48
10 3300049571 Ga0501034_0447118 Ga0501034_0447118_541_687 48
11 3300049572 Ga0501036_0066886 Ga0501036_0066886_395_541 48
12 3300049573 Ga0501037_0008746 Ga0501037_0008746_5415_5561 48
13 3300049573 Ga0501037_0334073 Ga0501037_0334073_658_804 48
14 3300049574 Ga0501038_0140923 Ga0501038_0140923_622_768 48
15 3300049574 Ga0501038_1007107 Ga0501038_1007107_184_330 48
16 3300049575 Ga0501039_0101591 Ga0501039_0101591_414_560 48
17 3300049578 Ga0501042_0291495 Ga0501042_0291495_320_466 48
18 3300049579 Ga0501043_0070101 Ga0501043_0070101_1034_1180 48
19 3300049580 Ga0501046_0099277 Ga0501046_0099277_1833_1979 48
20 3300049580 Ga0501046_0304009 Ga0501046_0304009_32_178 48
21 3300049581 Ga0501047_0055504 Ga0501047_0055504_1285_1431 48
22 3300049582 Ga0501048_0081995 Ga0501048_0081995_80_226 48
23 3300049583 Ga0501067_0476014 Ga0501067_0476014_196_342 48
24 3300049584 Ga0501068_0125629 Ga0501068_0125629_967_1113 48
25 3300049585 Ga0501069_0167758 Ga0501069_0167758_326_472 48
26 3300049586 Ga0501070_0076502 Ga0501070_0076502_2033_2179 48
27 3300049587 Ga0501071_0108660 Ga0501071_0108660_1788_1934 48
28 3300049588 Ga0501072_0689879 Ga0501072_0689879_204_350 48
29 3300049589 Ga0501073_0342449 Ga0501073_0342449_90_236 48
30 3300049590 Ga0501074_0114738 Ga0501074_0114738_938_1084 48
31 3300049741 Ga0501079_0499874 Ga0501079_0499874_44_190 48
32 3300049742 Ga0501080_0084317 Ga0501080_0084317_1102_1248 48
33 3300049822 Ga0501035_0079019 Ga0501035_0079019_861_1007 48
34 3300049822 Ga0501035_0091301 Ga0501035_0091301_1134_1280 48
35 3300049823 Ga0501044_0110279 Ga0501044_0110279_2250_2396 48
36 3300049823 Ga0501044_0211670 Ga0501044_0211670_1714_1860 48
37 3300049824 Ga0501045_0333804 Ga0501045_0333804_329_475 48
38 3300005327 Ga0070658_10930751 Ga0070658_109307511 49
39 3300005355 Ga0070671_100554398 Ga0070671_1005543982 49
40 3300005367 Ga0070667_100035592 Ga0070667_1000355924 49
41 3300005435 Ga0070714_100056261 Ga0070714_1000562613 49
42 3300005436 Ga0070713_100144116 Ga0070713_1001441164 49
43 3300005844 Ga0068862_100194967 Ga0068862_1001949672 49
44 3300009101 Ga0105247_10240343 Ga0105247_102403432 49
45 3300025916 Ga0207663_10795145 Ga0207663_107951452 49
46 3300025928 Ga0207700_10322022 Ga0207700_103220222 49
47 3300025929 Ga0207664_10037970 Ga0207664_100379703 49
48 3300025931 Ga0207644_10619743 Ga0207644_106197432 49
49 3300025986 Ga0207658_10571410 Ga0207658_105714102 49
50 3300033442 Ga0315911_1000001 Ga0315911_100000187 49
51 3300047320 Ga0495672_0018107 Ga0495672_0018107_437_586 49
52 3300048924 Ga0496121_0276535 Ga0496121_0276535_401_550 49
53 3300048924 Ga0496121_0668145 Ga0496121_0668145_367_516 49
54 3300001979 JGI24740J21852_10081189 JGI24740J21852_100811892 50
55 3300001989 JGI24739J22299_10000711 JGI24739J22299_1000071116 50
56 3300001990 JGI24737J22298_10000671 JGI24737J22298_1000067114 50
57 3300002067 JGI24735J21928_10011428 JGI24735J21928_100114285 50
58 3300002070 JGI24750J21931_1086753 JGI24750J21931_10867531 50
59 3300002244 JGI24742J22300_10007644 JGI24742J22300_100076441 50
60 3300003215 JGI25153J46596_10039621 JGI25153J46596_100396212 50
61 3300003215 JGI25153J46596_10105380 JGI25153J46596_101053802 50
62 3300003320 rootH2_10243292 rootH2_102432922 50
63 3300003659 JGI25404J52841_10043842 JGI25404J52841_100438423 50
64 3300003659 JGI25404J52841_10050250 JGI25404J52841_100502503 50
65 3300003752 Ga0055539_1019512 Ga0055539_10195122 50
66 3300003771 Ga0055526_1021911 Ga0055526_10219115 50
67 3300005327 Ga0070658_10033314 Ga0070658_100333145 50
68 3300005327 Ga0070658_10055755 Ga0070658_100557554 50
69 3300005327 Ga0070658_10147211 Ga0070658_101472113 50
70 3300005327 Ga0070658_10186997 Ga0070658_101869973 50
71 3300005327 Ga0070658_11931186 Ga0070658_119311861 50
72 3300005328 Ga0070676_10226832 Ga0070676_102268323 50
73 3300005329 Ga0070683_100127791 Ga0070683_1001277912 50
74 3300005334 Ga0068869_100192169 Ga0068869_1001921692 50
75 3300005335 Ga0070666_10861941 Ga0070666_108619411 50
76 3300005336 Ga0070680_100019388 Ga0070680_1000193883 50
77 3300005336 Ga0070680_100182285 Ga0070680_1001822853 50
78 3300005336 Ga0070680_101020236 Ga0070680_1010202362 50
79 3300005338 Ga0068868_100270054 Ga0068868_1002700542 50
80 3300005339 Ga0070660_100017380 Ga0070660_1000173806 50
81 3300005339 Ga0070660_100536723 Ga0070660_1005367232 50
82 3300005339 Ga0070660_100958988 Ga0070660_1009589882 50
83 3300005343 Ga0070687_101335039 Ga0070687_1013350392 50
84 3300005344 Ga0070661_100477578 Ga0070661_1004775782 50
85 3300005344 Ga0070661_100583923 Ga0070661_1005839232 50
86 3300005344 Ga0070661_101601202 Ga0070661_1016012022 50
87 3300005345 Ga0070692_10665210 Ga0070692_106652102 50
88 3300005347 Ga0070668_100059516 Ga0070668_1000595162 50
89 3300005347 Ga0070668_100272754 Ga0070668_1002727543 50
90 3300005347 Ga0070668_100514643 Ga0070668_1005146432 50
91 3300005353 Ga0070669_100598439 Ga0070669_1005984393 50
92 3300005353 Ga0070669_101343276 Ga0070669_1013432762 50
93 3300005356 Ga0070674_100116307 Ga0070674_1001163073 50
94 3300005356 Ga0070674_100153161 Ga0070674_1001531613 50
95 3300005364 Ga0070673_101368516 Ga0070673_1013685162 50
96 3300005365 Ga0070688_100075427 Ga0070688_1000754273 50
97 3300005366 Ga0070659_100182108 Ga0070659_1001821082 50
98 3300005367 Ga0070667_100656102 Ga0070667_1006561023 50
99 3300005367 Ga0070667_101841181 Ga0070667_1018411812 50
100 3300005434 Ga0070709_10013858 Ga0070709_100138588 50
101 3300005435 Ga0070714_100172047 Ga0070714_1001720472 50
102 3300005435 Ga0070714_100181179 Ga0070714_1001811792 50
103 3300005435 Ga0070714_101028318 Ga0070714_1010283182 50
104 3300005436 Ga0070713_100003948 Ga0070713_10000394814 50
105 3300005436 Ga0070713_100039476 Ga0070713_1000394762 50
106 3300005436 Ga0070713_100961658 Ga0070713_1009616581 50
107 3300005436 Ga0070713_101636543 Ga0070713_1016365432 50
108 3300005437 Ga0070710_10262506 Ga0070710_102625062 50
109 3300005437 Ga0070710_10964758 Ga0070710_109647582 50
110 3300005438 Ga0070701_10072143 Ga0070701_100721433 50
111 3300005439 Ga0070711_100094825 Ga0070711_1000948252 50
112 3300005440 Ga0070705_101883062 Ga0070705_1018830622 50
113 3300005441 Ga0070700_100038740 Ga0070700_1000387403 50
114 3300005445 Ga0070708_100916202 Ga0070708_1009162021 50
115 3300005455 Ga0070663_100158555 Ga0070663_1001585552 50
116 3300005455 Ga0070663_100158845 Ga0070663_1001588453 50
117 3300005456 Ga0070678_100241507 Ga0070678_1002415071 50
118 3300005456 Ga0070678_101544770 Ga0070678_1015447702 50
119 3300005457 Ga0070662_100215552 Ga0070662_1002155523 50
120 3300005457 Ga0070662_100474818 Ga0070662_1004748182 50
121 3300005458 Ga0070681_10221437 Ga0070681_102214372 50
122 3300005458 Ga0070681_10340182 Ga0070681_103401823 50
123 3300005459 Ga0068867_100032263 Ga0068867_1000322633 50
124 3300005459 Ga0068867_101102885 Ga0068867_1011028851 50
125 3300005459 Ga0068867_101551831 Ga0068867_1015518312 50
126 3300005467 Ga0070706_100820102 Ga0070706_1008201022 50
127 3300005468 Ga0070707_100545466 Ga0070707_1005454662 50
128 3300005530 Ga0070679_100214947 Ga0070679_1002149473 50
129 3300005530 Ga0070679_100348953 Ga0070679_1003489532 50
130 3300005530 Ga0070679_100417674 Ga0070679_1004176743 50
131 3300005530 Ga0070679_101421379 Ga0070679_1014213792 50
132 3300005535 Ga0070684_100004374 Ga0070684_1000043745 50
133 3300005536 Ga0070697_100049851 Ga0070697_1000498514 50
134 3300005536 Ga0070697_100557988 Ga0070697_1005579882 50
135 3300005539 Ga0068853_100015197 Ga0068853_1000151977 50
136 3300005539 Ga0068853_100020983 Ga0068853_1000209836 50
137 3300005539 Ga0068853_100087112 Ga0068853_1000871122 50
138 3300005539 Ga0068853_100246247 Ga0068853_1002462473 50
139 3300005539 Ga0068853_100617193 Ga0068853_1006171932 50
140 3300005543 Ga0070672_100110347 Ga0070672_1001103472 50
141 3300005543 Ga0070672_100214550 Ga0070672_1002145502 50
142 3300005544 Ga0070686_100100328 Ga0070686_1001003283 50
143 3300005545 Ga0070695_100615170 Ga0070695_1006151702 50
144 3300005546 Ga0070696_101233525 Ga0070696_1012335252 50
145 3300005548 Ga0070665_100196951 Ga0070665_1001969512 50
146 3300005548 Ga0070665_102670157 Ga0070665_1026701572 50
147 3300005549 Ga0070704_100800681 Ga0070704_1008006812 50
148 3300005563 Ga0068855_100010315 Ga0068855_10001031511 50
149 3300005563 Ga0068855_100031543 Ga0068855_1000315434 50
150 3300005563 Ga0068855_100070306 Ga0068855_1000703066 50
151 3300005563 Ga0068855_100275945 Ga0068855_1002759452 50
152 3300005563 Ga0068855_100759385 Ga0068855_1007593852 50
153 3300005563 Ga0068855_101702135 Ga0068855_1017021352 50
154 3300005564 Ga0070664_101426098 Ga0070664_1014260983 50
155 3300005577 Ga0068857_100003351 Ga0068857_1000033519 50
156 3300005577 Ga0068857_100114201 Ga0068857_1001142015 50
157 3300005577 Ga0068857_100129080 Ga0068857_1001290802 50
158 3300005578 Ga0068854_100004647 Ga0068854_1000046471 50
159 3300005578 Ga0068854_100010537 Ga0068854_1000105373 50
160 3300005578 Ga0068854_100975830 Ga0068854_1009758302 50
161 3300005578 Ga0068854_101985224 Ga0068854_1019852242 50
162 3300005614 Ga0068856_100009171 Ga0068856_10000917112 50
163 3300005614 Ga0068856_100330866 Ga0068856_1003308663 50
164 3300005614 Ga0068856_100610703 Ga0068856_1006107032 50
165 3300005614 Ga0068856_101083935 Ga0068856_1010839352 50
166 3300005615 Ga0070702_100120700 Ga0070702_1001207003 50
167 3300005615 Ga0070702_101439731 Ga0070702_1014397312 50
168 3300005616 Ga0068852_100077939 Ga0068852_1000779392 50
169 3300005616 Ga0068852_100084688 Ga0068852_1000846882 50
170 3300005616 Ga0068852_100159336 Ga0068852_1001593362 50
171 3300005616 Ga0068852_100355585 Ga0068852_1003555852 50
172 3300005616 Ga0068852_100406165 Ga0068852_1004061653 50
173 3300005718 Ga0068866_10128540 Ga0068866_101285402 50
174 3300005719 Ga0068861_100016364 Ga0068861_1000163644 50
175 3300005719 Ga0068861_100193846 Ga0068861_1001938463 50
176 3300005834 Ga0068851_10026729 Ga0068851_100267294 50
177 3300005834 Ga0068851_10042900 Ga0068851_100429002 50
178 3300005841 Ga0068863_100153114 Ga0068863_1001531142 50
179 3300005842 Ga0068858_100221497 Ga0068858_1002214975 50
180 3300005842 Ga0068858_100629407 Ga0068858_1006294072 50
181 3300005843 Ga0068860_100779965 Ga0068860_1007799652 50
182 3300005843 Ga0068860_102627596 Ga0068860_1026275961 50
183 3300005844 Ga0068862_100252914 Ga0068862_1002529143 50
184 3300005844 Ga0068862_100766773 Ga0068862_1007667733 50
185 3300005937 Ga0081455_10002419 Ga0081455_100024195 50
186 3300005937 Ga0081455_10003658 Ga0081455_100036582 50
187 3300005937 Ga0081455_10125266 Ga0081455_101252663 50
188 3300005983 Ga0081540_1002804 Ga0081540_100280410 50
189 3300005983 Ga0081540_1004519 Ga0081540_10045193 50
190 3300005983 Ga0081540_1048457 Ga0081540_10484573 50
191 3300005983 Ga0081540_1074125 Ga0081540_10741253 50
192 3300005983 Ga0081540_1206006 Ga0081540_12060062 50
193 3300005983 Ga0081540_1237291 Ga0081540_12372912 50
194 3300005985 Ga0081539_10060955 Ga0081539_100609552 50
195 3300006028 Ga0070717_10011433 Ga0070717_100114332 50
196 3300006028 Ga0070717_10348221 Ga0070717_103482214 50
197 3300006028 Ga0070717_10648051 Ga0070717_106480513 50
198 3300006028 Ga0070717_10676922 Ga0070717_106769222 50
199 3300006038 Ga0075365_10639125 Ga0075365_106391253 50
200 3300006038 Ga0075365_11259125 Ga0075365_112591252 50
201 3300006163 Ga0070715_10075193 Ga0070715_100751932 50
202 3300006163 Ga0070715_10886706 Ga0070715_108867061 50
203 3300006173 Ga0070716_100007220 Ga0070716_1000072207 50
204 3300006173 Ga0070716_100067550 Ga0070716_1000675502 50
205 3300006175 Ga0070712_100032824 Ga0070712_1000328244 50
206 3300006175 Ga0070712_100627082 Ga0070712_1006270822 50
207 3300006175 Ga0070712_101656083 Ga0070712_1016560832 50
208 3300006177 Ga0075362_10078151 Ga0075362_100781512 50
209 3300006178 Ga0075367_10504098 Ga0075367_105040982 50
210 3300006186 Ga0075369_10364066 Ga0075369_103640662 50
211 3300006195 Ga0075366_10758140 Ga0075366_107581402 50
212 3300006237 Ga0097621_100306101 Ga0097621_1003061013 50
213 3300006237 Ga0097621_100491236 Ga0097621_1004912361 50
214 3300006358 Ga0068871_100215269 Ga0068871_1002152692 50
215 3300006358 Ga0068871_102307727 Ga0068871_1023077272 50
216 3300006844 Ga0075428_101694586 Ga0075428_1016945862 50
217 3300006852 Ga0075433_11873910 Ga0075433_118739101 50
218 3300006871 Ga0075434_100998236 Ga0075434_1009982362 50
219 3300006871 Ga0075434_102536305 Ga0075434_1025363052 50
220 3300006881 Ga0068865_100097401 Ga0068865_1000974012 50
221 3300007265 Ga0099794_10059552 Ga0099794_100595523 50
222 3300007265 Ga0099794_10653890 Ga0099794_106538901 50
223 3300007788 Ga0099795_10024518 Ga0099795_100245182 50
224 3300007788 Ga0099795_10264014 Ga0099795_102640142 50
225 3300007788 Ga0099795_10525200 Ga0099795_105252002 50
226 3300009093 Ga0105240_10028738 Ga0105240_100287382 50
227 3300009093 Ga0105240_10047953 Ga0105240_100479532 50
228 3300009093 Ga0105240_10189207 Ga0105240_101892071 50
229 3300009093 Ga0105240_10461369 Ga0105240_104613692 50
230 3300009093 Ga0105240_11355183 Ga0105240_113551833 50
231 3300009093 Ga0105240_11611118 Ga0105240_116111182 50
232 3300009094 Ga0111539_10093931 Ga0111539_100939312 50
233 3300009094 Ga0111539_13504050 Ga0111539_135040502 50
234 3300009098 Ga0105245_10093236 Ga0105245_100932362 50
235 3300009098 Ga0105245_11177621 Ga0105245_111776211 50
236 3300009098 Ga0105245_11268877 Ga0105245_112688772 50
237 3300009148 Ga0105243_10093348 Ga0105243_100933483 50
238 3300009148 Ga0105243_10967365 Ga0105243_109673653 50
239 3300009148 Ga0105243_11963456 Ga0105243_119634562 50
240 3300009148 Ga0105243_12355502 Ga0105243_123555021 50
241 3300009174 Ga0105241_10047352 Ga0105241_100473526 50
242 3300009174 Ga0105241_10877138 Ga0105241_108771381 50
243 3300009176 Ga0105242_10051882 Ga0105242_100518823 50
244 3300009176 Ga0105242_10831111 Ga0105242_108311113 50
245 3300009176 Ga0105242_11913351 Ga0105242_119133512 50
246 3300009177 Ga0105248_10611999 Ga0105248_106119991 50
247 3300009177 Ga0105248_12523632 Ga0105248_125236322 50
248 3300009177 Ga0105248_13419677 Ga0105248_134196772 50
249 3300009545 Ga0105237_10005643 Ga0105237_100056432 50
250 3300009545 Ga0105237_10014877 Ga0105237_100148774 50
251 3300009545 Ga0105237_10029473 Ga0105237_100294733 50
252 3300009545 Ga0105237_10248145 Ga0105237_102481452 50
253 3300009545 Ga0105237_11174676 Ga0105237_111746762 50
254 3300009545 Ga0105237_11683781 Ga0105237_116837812 50
255 3300009545 Ga0105237_12711798 Ga0105237_127117982 50
256 3300009551 Ga0105238_10001837 Ga0105238_1000183715 50
257 3300009551 Ga0105238_10014865 Ga0105238_100148656 50
258 3300009551 Ga0105238_10018123 Ga0105238_1001812311 50
259 3300009551 Ga0105238_10407771 Ga0105238_104077712 50
260 3300009553 Ga0105249_10044480 Ga0105249_100444804 50
261 3300009553 Ga0105249_12493091 Ga0105249_124930912 50
262 3300009553 Ga0105249_13485995 Ga0105249_134859952 50
263 3300010159 Ga0099796_10032904 Ga0099796_100329042 50
264 3300010159 Ga0099796_10085197 Ga0099796_100851973 50
265 3300010375 Ga0105239_10023538 Ga0105239_100235384 50
266 3300010375 Ga0105239_10063511 Ga0105239_100635116 50
267 3300010375 Ga0105239_10085653 Ga0105239_100856533 50
268 3300010375 Ga0105239_10125840 Ga0105239_101258403 50
269 3300010375 Ga0105239_11872700 Ga0105239_118727002 50
270 3300010375 Ga0105239_12128009 Ga0105239_121280091 50
271 3300010375 Ga0105239_12247290 Ga0105239_122472901 50
272 3300010375 Ga0105239_13226338 Ga0105239_132263382 50
273 3300011119 Ga0105246_10280991 Ga0105246_102809912 50
274 3300011119 Ga0105246_10341466 Ga0105246_103414662 50
275 3300011119 Ga0105246_10446928 Ga0105246_104469282 50
276 3300011119 Ga0105246_11299457 Ga0105246_112994572 50
277 3300011119 Ga0105246_12433840 Ga0105246_124338402 50
278 3300012497 Ga0157319_1005298 Ga0157319_10052983 50
279 3300013104 Ga0157370_10027385 Ga0157370_100273856 50
280 3300013104 Ga0157370_10257438 Ga0157370_102574382 50
281 3300013105 Ga0157369_10026982 Ga0157369_100269824 50
282 3300013105 Ga0157369_10723343 Ga0157369_107233433 50
283 3300013296 Ga0157374_11835973 Ga0157374_118359732 50
284 3300013297 Ga0157378_10030150 Ga0157378_100301507 50
285 3300013297 Ga0157378_11054735 Ga0157378_110547353 50
286 3300013306 Ga0163162_10119163 Ga0163162_101191634 50
287 3300013308 Ga0157375_10379311 Ga0157375_103793113 50
288 3300013308 Ga0157375_11704681 Ga0157375_117046812 50
289 3300013308 Ga0157375_12892231 Ga0157375_128922311 50
290 3300013308 Ga0157375_13109143 Ga0157375_131091431 50
291 3300014325 Ga0163163_11603738 Ga0163163_116037382 50
292 3300014325 Ga0163163_11760596 Ga0163163_117605962 50
293 3300014325 Ga0163163_12689759 Ga0163163_126897592 50
294 3300014326 Ga0157380_10412787 Ga0157380_104127873 50
295 3300014326 Ga0157380_10686294 Ga0157380_106862942 50
296 3300014326 Ga0157380_12525868 Ga0157380_125258681 50
297 3300014497 Ga0182008_10713716 Ga0182008_107137162 50
298 3300014968 Ga0157379_10291308 Ga0157379_102913082 50
299 3300014968 Ga0157379_11314991 Ga0157379_113149912 50
300 3300014969 Ga0157376_10081108 Ga0157376_100811082 50
301 3300014969 Ga0157376_11355528 Ga0157376_113555281 50
302 3300017792 Ga0163161_10442897 Ga0163161_104428972 50
303 3300021384 Ga0213876_10041155 Ga0213876_100411552 50
304 3300025253 Ga0209677_100235 Ga0209677_10023544 50
305 3300025295 Ga0209564_1009747 Ga0209564_10097472 50
306 3300025297 Ga0209758_1001576 Ga0209758_100157613 50
307 3300025297 Ga0209758_1007649 Ga0209758_10076493 50
308 3300025297 Ga0209758_1121224 Ga0209758_11212241 50
309 3300025321 Ga0207656_10063389 Ga0207656_100633894 50
310 3300025321 Ga0207656_10151391 Ga0207656_101513912 50
311 3300025898 Ga0207692_10073593 Ga0207692_100735932 50
312 3300025898 Ga0207692_10230096 Ga0207692_102300962 50
313 3300025899 Ga0207642_10008842 Ga0207642_100088424 50
314 3300025900 Ga0207710_10152399 Ga0207710_101523994 50
315 3300025900 Ga0207710_10594277 Ga0207710_105942771 50
316 3300025901 Ga0207688_10124104 Ga0207688_101241042 50
317 3300025903 Ga0207680_10984507 Ga0207680_109845072 50
318 3300025904 Ga0207647_10002624 Ga0207647_1000262412 50
319 3300025905 Ga0207685_10282414 Ga0207685_102824142 50
320 3300025906 Ga0207699_10402923 Ga0207699_104029231 50
321 3300025906 Ga0207699_11254661 Ga0207699_112546611 50
322 3300025907 Ga0207645_10247030 Ga0207645_102470303 50
323 3300025909 Ga0207705_10113159 Ga0207705_101131591 50
324 3300025909 Ga0207705_10260891 Ga0207705_102608912 50
325 3300025909 Ga0207705_11479457 Ga0207705_114794572 50
326 3300025910 Ga0207684_10937158 Ga0207684_109371581 50
327 3300025911 Ga0207654_10003876 Ga0207654_1000387610 50
328 3300025911 Ga0207654_10940540 Ga0207654_109405401 50
329 3300025912 Ga0207707_10059270 Ga0207707_100592705 50
330 3300025912 Ga0207707_10092716 Ga0207707_100927163 50
331 3300025913 Ga0207695_10004042 Ga0207695_1000404215 50
332 3300025913 Ga0207695_10012960 Ga0207695_100129601 50
333 3300025913 Ga0207695_10335570 Ga0207695_103355702 50
334 3300025914 Ga0207671_10015510 Ga0207671_100155108 50
335 3300025914 Ga0207671_10031399 Ga0207671_100313994 50
336 3300025914 Ga0207671_10103241 Ga0207671_101032412 50
337 3300025914 Ga0207671_10405141 Ga0207671_104051411 50
338 3300025914 Ga0207671_10414576 Ga0207671_104145763 50
339 3300025914 Ga0207671_10473748 Ga0207671_104737482 50
340 3300025915 Ga0207693_10011177 Ga0207693_100111774 50
341 3300025915 Ga0207693_10033297 Ga0207693_100332978 50
342 3300025915 Ga0207693_10093209 Ga0207693_100932094 50
343 3300025916 Ga0207663_10080161 Ga0207663_100801616 50
344 3300025916 Ga0207663_11079689 Ga0207663_110796891 50
345 3300025917 Ga0207660_10017864 Ga0207660_100178647 50
346 3300025917 Ga0207660_10133415 Ga0207660_101334153 50
347 3300025917 Ga0207660_10289639 Ga0207660_102896393 50
348 3300025917 Ga0207660_10756931 Ga0207660_107569312 50
349 3300025917 Ga0207660_10874562 Ga0207660_108745622 50
350 3300025919 Ga0207657_10004981 Ga0207657_1000498114 50
351 3300025919 Ga0207657_10599984 Ga0207657_105999842 50
352 3300025919 Ga0207657_10915518 Ga0207657_109155183 50
353 3300025919 Ga0207657_10918921 Ga0207657_109189211 50
354 3300025920 Ga0207649_10189962 Ga0207649_101899622 50
355 3300025921 Ga0207652_10015155 Ga0207652_100151556 50
356 3300025921 Ga0207652_10444209 Ga0207652_104442092 50
357 3300025921 Ga0207652_11090715 Ga0207652_110907152 50
358 3300025923 Ga0207681_10317196 Ga0207681_103171962 50
359 3300025924 Ga0207694_10000082 Ga0207694_1000008279 50
360 3300025924 Ga0207694_10042681 Ga0207694_100426813 50
361 3300025924 Ga0207694_10048492 Ga0207694_100484924 50
362 3300025925 Ga0207650_11173134 Ga0207650_111731341 50
363 3300025927 Ga0207687_11118216 Ga0207687_111182162 50
364 3300025927 Ga0207687_11319200 Ga0207687_113192002 50
365 3300025927 Ga0207687_11319635 Ga0207687_113196352 50
366 3300025928 Ga0207700_10055551 Ga0207700_100555511 50
367 3300025928 Ga0207700_10275884 Ga0207700_102758843 50
368 3300025928 Ga0207700_11003127 Ga0207700_110031272 50
369 3300025928 Ga0207700_11086488 Ga0207700_110864883 50
370 3300025929 Ga0207664_10058930 Ga0207664_100589302 50
371 3300025929 Ga0207664_10883372 Ga0207664_108833722 50
372 3300025931 Ga0207644_10063190 Ga0207644_100631907 50
373 3300025931 Ga0207644_11631659 Ga0207644_116316592 50
374 3300025932 Ga0207690_10026152 Ga0207690_100261522 50
375 3300025932 Ga0207690_10230047 Ga0207690_102300473 50
376 3300025933 Ga0207706_10051098 Ga0207706_100510984 50
377 3300025933 Ga0207706_10884245 Ga0207706_108842452 50
378 3300025933 Ga0207706_10889116 Ga0207706_108891161 50
379 3300025934 Ga0207686_10283393 Ga0207686_102833933 50
380 3300025935 Ga0207709_10008505 Ga0207709_100085053 50
381 3300025935 Ga0207709_10067048 Ga0207709_100670484 50
382 3300025936 Ga0207670_11276726 Ga0207670_112767262 50
383 3300025937 Ga0207669_10125578 Ga0207669_101255782 50
384 3300025937 Ga0207669_10176802 Ga0207669_101768022 50
385 3300025937 Ga0207669_11027750 Ga0207669_110277502 50
386 3300025938 Ga0207704_10051070 Ga0207704_100510703 50
387 3300025938 Ga0207704_10851129 Ga0207704_108511291 50
388 3300025939 Ga0207665_10246166 Ga0207665_102461662 50
389 3300025939 Ga0207665_10259030 Ga0207665_102590302 50
390 3300025940 Ga0207691_10034519 Ga0207691_100345192 50
391 3300025940 Ga0207691_11181823 Ga0207691_111818232 50
392 3300025941 Ga0207711_11200023 Ga0207711_112000232 50
393 3300025942 Ga0207689_10275231 Ga0207689_102752312 50
394 3300025942 Ga0207689_11173315 Ga0207689_111733152 50
395 3300025944 Ga0207661_10167569 Ga0207661_101675694 50
396 3300025945 Ga0207679_10653027 Ga0207679_106530272 50
397 3300025949 Ga0207667_10013948 Ga0207667_100139485 50
398 3300025949 Ga0207667_10078267 Ga0207667_100782672 50
399 3300025949 Ga0207667_10207544 Ga0207667_102075443 50
400 3300025949 Ga0207667_10490751 Ga0207667_104907512 50
401 3300025949 Ga0207667_10767889 Ga0207667_107678892 50
402 3300025949 Ga0207667_10921839 Ga0207667_109218391 50
403 3300025960 Ga0207651_11154374 Ga0207651_111543741 50
404 3300025961 Ga0207712_10129613 Ga0207712_101296133 50
405 3300025972 Ga0207668_10038360 Ga0207668_100383603 50
406 3300025972 Ga0207668_10417169 Ga0207668_104171692 50
407 3300025972 Ga0207668_10450331 Ga0207668_104503313 50
408 3300025981 Ga0207640_10907455 Ga0207640_109074552 50
409 3300025986 Ga0207658_11795392 Ga0207658_117953921 50
410 3300025986 Ga0207658_11796391 Ga0207658_117963911 50
411 3300025986 Ga0207658_11981575 Ga0207658_119815752 50
412 3300026035 Ga0207703_10446060 Ga0207703_104460602 50
413 3300026035 Ga0207703_10958593 Ga0207703_109585932 50
414 3300026041 Ga0207639_10016076 Ga0207639_100160766 50
415 3300026041 Ga0207639_10022946 Ga0207639_100229464 50
416 3300026041 Ga0207639_10200670 Ga0207639_102006704 50
417 3300026041 Ga0207639_10294007 Ga0207639_102940072 50
418 3300026041 Ga0207639_10626828 Ga0207639_106268283 50
419 3300026067 Ga0207678_10058598 Ga0207678_100585983 50
420 3300026067 Ga0207678_10160182 Ga0207678_101601822 50
421 3300026067 Ga0207678_10185583 Ga0207678_101855832 50
422 3300026067 Ga0207678_10250454 Ga0207678_102504544 50
423 3300026067 Ga0207678_11797514 Ga0207678_117975142 50
424 3300026075 Ga0207708_10054831 Ga0207708_100548312 50
425 3300026078 Ga0207702_10000002 Ga0207702_10000002342 50
426 3300026078 Ga0207702_10003315 Ga0207702_1000331510 50
427 3300026078 Ga0207702_11087798 Ga0207702_110877982 50
428 3300026078 Ga0207702_12200052 Ga0207702_122000521 50
429 3300026089 Ga0207648_10037161 Ga0207648_100371616 50
430 3300026089 Ga0207648_11467912 Ga0207648_114679121 50
431 3300026095 Ga0207676_10147521 Ga0207676_101475215 50
432 3300026116 Ga0207674_10001889 Ga0207674_1000188911 50
433 3300026116 Ga0207674_10004659 Ga0207674_100046595 50
434 3300026116 Ga0207674_10005787 Ga0207674_1000578711 50
435 3300026116 Ga0207674_11151868 Ga0207674_111518682 50
436 3300026118 Ga0207675_100063476 Ga0207675_1000634765 50
437 3300026118 Ga0207675_100393127 Ga0207675_1003931272 50
438 3300026118 Ga0207675_101747017 Ga0207675_1017470172 50
439 3300026121 Ga0207683_10377778 Ga0207683_103777783 50
440 3300026142 Ga0207698_10160918 Ga0207698_101609183 50
441 3300026142 Ga0207698_10211937 Ga0207698_102119373 50
442 3300026142 Ga0207698_10215367 Ga0207698_102153673 50
443 3300026142 Ga0207698_11666658 Ga0207698_116666582 50
444 3300027512 Ga0209179_1004345 Ga0209179_10043452 50
445 3300027671 Ga0209588_1063920 Ga0209588_10639203 50
446 3300027866 Ga0209813_10096797 Ga0209813_100967972 50
447 3300028379 Ga0268266_10004442 Ga0268266_100044423 50
448 3300028379 Ga0268266_10816346 Ga0268266_108163463 50
449 3300028380 Ga0268265_11407848 Ga0268265_114078481 50
450 3300028380 Ga0268265_12288545 Ga0268265_122885452 50
451 3300028381 Ga0268264_11338603 Ga0268264_113386032 50
452 3300028381 Ga0268264_12318401 Ga0268264_123184011 50
453 3300028786 Ga0307517_10390735 Ga0307517_103907353 50
454 3300028800 Ga0265338_10769484 Ga0265338_107694842 50
455 3300030521 Ga0307511_10049805 Ga0307511_100498054 50
456 3300031235 Ga0265330_10035542 Ga0265330_100355422 50
457 3300031235 Ga0265330_10119307 Ga0265330_101193072 50
458 3300031238 Ga0265332_10006188 Ga0265332_100061882 50
459 3300031238 Ga0265332_10113260 Ga0265332_101132602 50
460 3300031239 Ga0265328_10255064 Ga0265328_102550642 50
461 3300031241 Ga0265325_10022232 Ga0265325_100222324 50
462 3300031247 Ga0265340_10002614 Ga0265340_1000261414 50
463 3300031249 Ga0265339_10100248 Ga0265339_101002482 50
464 3300031250 Ga0265331_10035274 Ga0265331_100352742 50
465 3300031344 Ga0265316_10140574 Ga0265316_101405742 50
466 3300031344 Ga0265316_10155117 Ga0265316_101551172 50
467 3300031507 Ga0307509_10038177 Ga0307509_100381772 50
468 3300031507 Ga0307509_10218560 Ga0307509_102185602 50
469 3300031507 Ga0307509_10347977 Ga0307509_103479772 50
470 3300031507 Ga0307509_10671558 Ga0307509_106715582 50
471 3300031616 Ga0307508_10000009 Ga0307508_10000009173 50
472 3300031616 Ga0307508_10164958 Ga0307508_101649582 50
473 3300031711 Ga0265314_10047125 Ga0265314_100471253 50
474 3300031711 Ga0265314_10226595 Ga0265314_102265952 50
475 3300031712 Ga0265342_10263205 Ga0265342_102632052 50
476 3300031730 Ga0307516_10109129 Ga0307516_101091292 50
477 3300031730 Ga0307516_10147601 Ga0307516_101476015 50
478 3300031824 Ga0307413_10055169 Ga0307413_100551692 50
479 3300031824 Ga0307413_11159284 Ga0307413_111592843 50
480 3300031852 Ga0307410_10598894 Ga0307410_105988942 50
481 3300031903 Ga0307407_10505054 Ga0307407_105050542 50
482 3300031911 Ga0307412_10806642 Ga0307412_108066422 50
483 3300031995 Ga0307409_101901686 Ga0307409_1019016862 50
484 3300032004 Ga0307414_10364317 Ga0307414_103643171 50
485 3300032005 Ga0307411_12288974 Ga0307411_122889742 50
486 3300032126 Ga0307415_100627553 Ga0307415_1006275532 50
487 3300033179 Ga0307507_10035312 Ga0307507_100353122 50
488 3300033180 Ga0307510_10142653 Ga0307510_101426535 50
489 3300033180 Ga0307510_10494591 Ga0307510_104945912 50
490 3300033544 Ga0316215_1016541 Ga0316215_10165413 50
491 3300033544 Ga0316215_1030587 Ga0316215_10305872 50
492 3300033544 Ga0316215_1034504 Ga0316215_10345042 50
493 3300035083 Ga0373926_0024531 Ga0373926_0024531_1590_1742 50
494 3300035086 Ga0373934_0001166 Ga0373934_0001166_1126_1290 50
495 3300035086 Ga0373934_0434512 Ga0373934_0434512_222_386 50
496 3300035089 Ga0373944_0103137 Ga0373944_0103137_346_498 50
497 3300035111 Ga0373923_0008553 Ga0373923_0008553_1450_1614 50
498 3300035111 Ga0373923_0548369 Ga0373923_0548369_194_346 50
499 3300035112 Ga0373932_0167563 Ga0373932_0167563_490_642 50
500 3300035113 Ga0373936_0043565 Ga0373936_0043565_1228_1380 50
501 3300035113 Ga0373936_0095072 Ga0373936_0095072_583_735 50
502 3300035113 Ga0373936_0136528 Ga0373936_0136528_431_595 50
503 3300035114 Ga0373939_0334682 Ga0373939_0334682_428_595 50
504 3300035117 Ga0373953_0003332 Ga0373953_0003332_2321_2485 50
505 3300035117 Ga0373953_0331693 Ga0373953_0331693_299_451 50
506 3300035117 Ga0373953_0429982 Ga0373953_0429982_181_333 50
507 3300035118 Ga0373954_0007921 Ga0373954_0007921_1540_1704 50
508 3300035118 Ga0373954_0319627 Ga0373954_0319627_153_305 50
509 3300035119 Ga0373956_0001159 Ga0373956_0001159_9305_9469 50
510 3300035120 Ga0373957_0009755 Ga0373957_0009755_2522_2686 50
511 3300035170 Ga0373943_0013016 Ga0373943_0013016_2040_2192 50
512 3300035171 Ga0373946_0063490 Ga0373946_0063490_143_295 50
513 3300035172 Ga0373955_0003515 Ga0373955_0003515_2321_2485 50
514 3300035172 Ga0373955_0406131 Ga0373955_0406131_218_370 50
515 3300035410 Ga0373924_0013420 Ga0373924_0013420_2025_2189 50
516 3300035410 Ga0373924_0045234 Ga0373924_0045234_50_202 50
517 3300035692 Ga0373935_0000701 Ga0373935_0000701_1724_1876 50
518 3300035692 Ga0373935_0191650 Ga0373935_0191650_597_749 50
519 3300035692 Ga0373935_0499099 Ga0373935_0499099_108_272 50
520 3300035692 Ga0373935_0684413 Ga0373935_0684413_448_612 50
521 3300035692 Ga0373935_0754217 Ga0373935_0754217_315_467 50
522 3300035692 Ga0373935_1441226 Ga0373935_1441226_347_499 50
523 3300035695 Ga0373927_0001744 Ga0373927_0001744_6976_7128 50
524 3300035695 Ga0373927_0007540 Ga0373927_0007540_4192_4344 50
525 3300035695 Ga0373927_0013004 Ga0373927_0013004_5014_5178 50
526 3300035695 Ga0373927_0551897 Ga0373927_0551897_411_575 50
527 3300035724 Ga0373933_0008789 Ga0373933_0008789_3402_3566 50
528 3300035724 Ga0373933_0030554 Ga0373933_0030554_1706_1858 50
529 3300035724 Ga0373933_1165185 Ga0373933_1165185_233_385 50
530 3300035725 Ga0373947_0005322 Ga0373947_0005322_6386_6538 50
531 3300035725 Ga0373947_0161160 Ga0373947_0161160_750_902 50
532 3300035725 Ga0373947_0330820 Ga0373947_0330820_423_575 50
533 3300036401 Ga0373937_0067053 Ga0373937_0067053_2322_2486 50
534 3300036401 Ga0373937_0246381 Ga0373937_0246381_1490_1642 50
535 3300036401 Ga0373937_1823718 Ga0373937_1823718_33_185 50
536 3300036535 Ga0310110_015967 Ga0310110_015967_890_1054 50
537 3300037068 Ga0373925_0004587 Ga0373925_0004587_1360_1512 50
538 3300037068 Ga0373925_0206849 Ga0373925_0206849_645_797 50
539 3300037068 Ga0373925_0277464 Ga0373925_0277464_254_406 50
540 3300037418 Ga0395900_0583962 Ga0395900_0583962_446_598 50
541 3300037466 Ga0395898_0121218 Ga0395898_0121218_961_1113 50
542 3300037471 Ga0395905_0043982 Ga0395905_0043982_1751_1903 50
543 3300037853 Ga0436364_0609221 Ga0436364_0609221_59_211 50
544 3300039437 Ga0436365_1678992 Ga0436365_1678992_1189_1341 50
545 3300041413 Ga0439465_0425671 Ga0439465_0425671_322_474 50
546 3300041451 Ga0451791_0310822 Ga0451791_0310822_328_480 50
547 3300041451 Ga0451791_1004722 Ga0451791_1004722_81_233 50
548 3300041453 Ga0451797_0286223 Ga0451797_0286223_407_559 50
549 3300041460 Ga0451802_1199996 Ga0451802_1199996_305_457 50
550 3300041460 Ga0451802_1963004 Ga0451802_1963004_89_241 50
551 3300041486 Ga0451807_0794862 Ga0451807_0794862_170_322 50
552 3300041491 Ga0451833_0692571 Ga0451833_0692571_103_255 50
553 3300041509 Ga0451843_1671675 Ga0451843_1671675_1069_1221 50
554 3300046454 Ga0495592_0008975 Ga0495592_0008975_4722_4886 50
555 3300046454 Ga0495592_0856949 Ga0495592_0856949_96_248 50
556 3300046455 Ga0495603_0000624 Ga0495603_0000624_4972_5124 50
557 3300046455 Ga0495603_0164144 Ga0495603_0164144_133_285 50
558 3300046459 Ga0495629_0001961 Ga0495629_0001961_7089_7241 50
559 3300046459 Ga0495629_0004200 Ga0495629_0004200_6107_6271 50
560 3300046459 Ga0495629_0699485 Ga0495629_0699485_56_208 50
561 3300046461 Ga0495641_0010879 Ga0495641_0010879_556_708 50
562 3300046462 Ga0495651_0039274 Ga0495651_0039274_1255_1407 50
563 3300046462 Ga0495651_0099650 Ga0495651_0099650_1182_1346 50
564 3300046463 Ga0495653_0000923 Ga0495653_0000923_16533_16697 50
565 3300046472 Ga0495580_0008876 Ga0495580_0008876_7567_7719 50
566 3300046473 Ga0495582_0000739 Ga0495582_0000739_13257_13409 50
567 3300046474 Ga0495605_0031514 Ga0495605_0031514_1206_1358 50
568 3300046475 Ga0495639_0000335 Ga0495639_0000335_16028_16180 50
569 3300046476 Ga0495662_0008807 Ga0495662_0008807_2137_2289 50
570 3300046476 Ga0495662_0232035 Ga0495662_0232035_18_182 50
571 3300046476 Ga0495662_0410665 Ga0495662_0410665_404_556 50
572 3300046477 Ga0495664_0054559 Ga0495664_0054559_89_241 50
573 3300046477 Ga0495664_0301238 Ga0495664_0301238_565_729 50
574 3300046477 Ga0495664_0889492 Ga0495664_0889492_266_418 50
575 3300046477 Ga0495664_0947145 Ga0495664_0947145_322_474 50
576 3300046491 Ga0495584_0610427 Ga0495584_0610427_14_166 50
577 3300046491 Ga0495584_0716314 Ga0495584_0716314_294_446 50
578 3300046499 Ga0495594_0004402 Ga0495594_0004402_2336_2488 50
579 3300046499 Ga0495594_0166097 Ga0495594_0166097_105_257 50
580 3300046500 Ga0495596_0180855 Ga0495596_0180855_643_795 50
581 3300046501 Ga0495607_0231301 Ga0495607_0231301_120_272 50
582 3300046507 Ga0495606_0238331 Ga0495606_0238331_417_599 50
583 3300046511 Ga0495608_0003276 Ga0495608_0003276_5731_5895 50
584 3300046514 Ga0495618_0172687 Ga0495618_0172687_429_581 50
585 3300046516 Ga0495628_0043887 Ga0495628_0043887_2932_3096 50
586 3300046516 Ga0495628_0073081 Ga0495628_0073081_1223_1375 50
587 3300046517 Ga0495630_0010570 Ga0495630_0010570_6501_6653 50
588 3300046518 Ga0495631_0245681 Ga0495631_0245681_334_486 50
589 3300046522 Ga0495643_0252352 Ga0495643_0252352_28_180 50
590 3300046523 Ga0495644_0099049 Ga0495644_0099049_385_537 50
591 3300046524 Ga0495648_0006521 Ga0495648_0006521_6849_7001 50
592 3300046524 Ga0495648_0030230 Ga0495648_0030230_1696_1848 50
593 3300046526 Ga0495666_0264561 Ga0495666_0264561_533_697 50
594 3300046526 Ga0495666_0525020 Ga0495666_0525020_298_450 50
595 3300046529 Ga0495652_0002339 Ga0495652_0002339_13830_13994 50
596 3300046529 Ga0495652_0109021 Ga0495652_0109021_1531_1683 50
597 3300046529 Ga0495652_0345840 Ga0495652_0345840_20_172 50
598 3300046531 Ga0495665_0005791 Ga0495665_0005791_1888_2040 50
599 3300046533 Ga0495640_0000826 Ga0495640_0000826_20725_20877 50
600 3300046533 Ga0495640_0375237 Ga0495640_0375237_26_178 50
601 3300046535 Ga0495586_0220580 Ga0495586_0220580_832_996 50
602 3300046536 Ga0495587_0032759 Ga0495587_0032759_821_985 50
603 3300046537 Ga0495598_0258399 Ga0495598_0258399_304_456 50
604 3300046543 Ga0495645_0194641 Ga0495645_0194641_927_1091 50
605 3300046543 Ga0495645_0595835 Ga0495645_0595835_12_164 50
606 3300046557 Ga0495622_0028887 Ga0495622_0028887_1674_1826 50
607 3300046557 Ga0495622_0133936 Ga0495622_0133936_531_683 50
608 3300046559 Ga0495667_0009056 Ga0495667_0009056_1054_1218 50
609 3300046615 Ga0495656_0170013 Ga0495656_0170013_651_803 50
610 3300046642 Ga0495634_0001338 Ga0495634_0001338_17_169 50
611 3300046642 Ga0495634_0007240 Ga0495634_0007240_2710_2874 50
612 3300046648 Ga0495611_0443550 Ga0495611_0443550_74_226 50
613 3300046660 Ga0495625_0615905 Ga0495625_0615905_138_290 50
614 3300046663 Ga0495635_0000187 Ga0495635_0000187_31882_32034 50
615 3300046663 Ga0495635_0006608 Ga0495635_0006608_4418_4582 50
616 3300046664 Ga0495659_0101276 Ga0495659_0101276_183_335 50
617 3300046674 Ga0495588_0014639 Ga0495588_0014639_429_581 50
618 3300046674 Ga0495588_0418607 Ga0495588_0418607_496_660 50
619 3300046675 Ga0495657_0024857 Ga0495657_0024857_693_857 50
620 3300046675 Ga0495657_0057670 Ga0495657_0057670_2404_2556 50
621 3300046675 Ga0495657_0111670 Ga0495657_0111670_355_507 50
622 3300046675 Ga0495657_0123835 Ga0495657_0123835_437_589 50
623 3300046678 Ga0495599_0002320 Ga0495599_0002320_1958_2122 50
624 3300046679 Ga0495623_0007791 Ga0495623_0007791_4772_4936 50
625 3300046679 Ga0495623_0640593 Ga0495623_0640593_58_210 50
626 3300046680 Ga0495646_0021219 Ga0495646_0021219_3385_3537 50
627 3300046681 Ga0495647_0002967 Ga0495647_0002967_2811_2963 50
628 3300046683 Ga0495658_0000047 Ga0495658_0000047_40992_41144 50
629 3300046684 Ga0495669_0030372 Ga0495669_0030372_350_502 50
630 3300046689 Ga0495613_0001031 Ga0495613_0001031_19123_19275 50
631 3300046689 Ga0495613_0014828 Ga0495613_0014828_5236_5400 50
632 3300046689 Ga0495613_0535560 Ga0495613_0535560_599_763 50
633 3300046690 Ga0495624_0002051 Ga0495624_0002051_2781_2933 50
634 3300046694 Ga0495649_0367371 Ga0495649_0367371_258_410 50
635 3300046794 Ga0495589_0348573 Ga0495589_0348573_486_638 50
636 3300046809 Ga0495600_0013920 Ga0495600_0013920_3851_4015 50
637 3300046809 Ga0495600_0086049 Ga0495600_0086049_1525_1677 50
638 3300046809 Ga0495600_0170817 Ga0495600_0170817_345_497 50
639 3300047315 Ga0495581_0000563 Ga0495581_0000563_16683_16835 50
640 3300047317 Ga0495604_0010697 Ga0495604_0010697_821_985 50
641 3300047319 Ga0495674_0001402 Ga0495674_0001402_17019_17171 50
642 3300047319 Ga0495674_0046806 Ga0495674_0046806_380_544 50
643 3300047319 Ga0495674_0994502 Ga0495674_0994502_67_219 50
644 3300047319 Ga0495674_1427849 Ga0495674_1427849_92_244 50
645 3300047320 Ga0495672_0543610 Ga0495672_0543610_156_308 50
646 3300047321 Ga0495676_0245695 Ga0495676_0245695_771_923 50
647 3300047322 Ga0495680_0030674 Ga0495680_0030674_3530_3694 50
648 3300047322 Ga0495680_0080724 Ga0495680_0080724_25_177 50
649 3300047322 Ga0495680_0593325 Ga0495680_0593325_157_309 50
650 3300047322 Ga0495680_0717500 Ga0495680_0717500_35_187 50
651 3300047322 Ga0495680_0953237 Ga0495680_0953237_174_338 50
652 3300047323 Ga0495683_0319158 Ga0495683_0319158_38_190 50
653 3300047444 Ga0495675_0005669 Ga0495675_0005669_2183_2347 50
654 3300047444 Ga0495675_0493852 Ga0495675_0493852_65_229 50
655 3300047471 Ga0495684_0001482 Ga0495684_0001482_13423_13587 50
656 3300047471 Ga0495684_0008519 Ga0495684_0008519_7725_7877 50
657 3300047472 Ga0495686_0095836 Ga0495686_0095836_253_405 50
658 3300047472 Ga0495686_0168919 Ga0495686_0168919_84_236 50
659 3300047673 Ga0495593_0000723 Ga0495593_0000723_6633_6785 50
660 3300047673 Ga0495593_0006359 Ga0495593_0006359_5216_5380 50
661 3300048088 Ga0495602_0043621 Ga0495602_0043621_821_985 50
662 3300048089 Ga0495614_0270017 Ga0495614_0270017_228_380 50
663 3300048903 Ga0496100_0796674 Ga0496100_0796674_521_673 50
664 3300048905 Ga0496102_0032393 Ga0496102_0032393_1676_1828 50
665 3300048905 Ga0496102_0292270 Ga0496102_0292270_1347_1499 50
666 3300048905 Ga0496102_0598873 Ga0496102_0598873_637_789 50
667 3300048905 Ga0496102_1001474 Ga0496102_1001474_335_487 50
668 3300048905 Ga0496102_1138956 Ga0496102_1138956_31_183 50
669 3300048907 Ga0496104_0010232 Ga0496104_0010232_6496_6660 50
670 3300048907 Ga0496104_0385388 Ga0496104_0385388_195_347 50
671 3300048907 Ga0496104_0483799 Ga0496104_0483799_617_769 50
672 3300048908 Ga0496105_1196982 Ga0496105_1196982_117_269 50
673 3300048909 Ga0496106_0000540 Ga0496106_0000540_18984_19136 50
674 3300048909 Ga0496106_0348444 Ga0496106_0348444_768_920 50
675 3300048909 Ga0496106_0514071 Ga0496106_0514071_508_660 50
676 3300048909 Ga0496106_0841907 Ga0496106_0841907_486_638 50
677 3300048909 Ga0496106_0894556 Ga0496106_0894556_433_585 50
678 3300048911 Ga0496108_0245050 Ga0496108_0245050_1355_1507 50
679 3300048911 Ga0496108_0354000 Ga0496108_0354000_257_421 50
680 3300048912 Ga0496109_0551964 Ga0496109_0551964_330_482 50
681 3300048913 Ga0496110_0013566 Ga0496110_0013566_5917_6081 50
682 3300048914 Ga0496111_0071275 Ga0496111_0071275_16_180 50
683 3300048915 Ga0496112_0000021 Ga0496112_0000021_116588_116740 50
684 3300048915 Ga0496112_0484197 Ga0496112_0484197_962_1126 50
685 3300048915 Ga0496112_0584444 Ga0496112_0584444_532_684 50
686 3300048916 Ga0496113_0163739 Ga0496113_0163739_963_1115 50
687 3300048916 Ga0496113_0246939 Ga0496113_0246939_146_310 50
688 3300048917 Ga0496114_0234191 Ga0496114_0234191_291_443 50
689 3300048917 Ga0496114_0916999 Ga0496114_0916999_126_278 50
690 3300048918 Ga0496115_0234694 Ga0496115_0234694_597_761 50
691 3300048918 Ga0496115_0276440 Ga0496115_0276440_959_1123 50
692 3300048918 Ga0496115_0370766 Ga0496115_0370766_394_546 50
693 3300048918 Ga0496115_0526797 Ga0496115_0526797_700_852 50
694 3300048919 Ga0496116_0369747 Ga0496116_0369747_306_458 50
695 3300048919 Ga0496116_0483301 Ga0496116_0483301_101_253 50
696 3300048920 Ga0496117_0037191 Ga0496117_0037191_2834_2986 50
697 3300048921 Ga0496118_0006481 Ga0496118_0006481_4607_4759 50
698 3300048921 Ga0496118_0022090 Ga0496118_0022090_2327_2479 50
699 3300048921 Ga0496118_0052105 Ga0496118_0052105_684_836 50
700 3300048921 Ga0496118_0453900 Ga0496118_0453900_365_517 50
701 3300048922 Ga0496119_0139502 Ga0496119_0139502_555_707 50
702 3300048922 Ga0496119_0157482 Ga0496119_0157482_1035_1187 50
703 3300048922 Ga0496119_0218062 Ga0496119_0218062_384_536 50
704 3300048922 Ga0496119_0226198 Ga0496119_0226198_345_497 50
705 3300048924 Ga0496121_0000456 Ga0496121_0000456_34622_34774 50
706 3300048924 Ga0496121_0005356 Ga0496121_0005356_7372_7524 50
707 3300048924 Ga0496121_0027220 Ga0496121_0027220_559_738 50
708 3300048924 Ga0496121_0062407 Ga0496121_0062407_1200_1352 50
709 3300048924 Ga0496121_0106637 Ga0496121_0106637_1765_1917 50
710 3300048924 Ga0496121_0206017 Ga0496121_0206017_1191_1343 50
711 3300048924 Ga0496121_0226379 Ga0496121_0226379_948_1100 50
712 3300048925 Ga0496122_0038748 Ga0496122_0038748_1739_1891 50
713 3300048925 Ga0496122_0331913 Ga0496122_0331913_155_307 50
714 3300048925 Ga0496122_0343466 Ga0496122_0343466_505_657 50
715 3300048925 Ga0496122_0605092 Ga0496122_0605092_216_368 50
716 3300048926 Ga0496123_0101339 Ga0496123_0101339_47_199 50
717 3300048926 Ga0496123_0300052 Ga0496123_0300052_298_450 50
718 3300048927 Ga0496124_0001010 Ga0496124_0001010_1360_1512 50
719 3300048927 Ga0496124_0141277 Ga0496124_0141277_1474_1626 50
720 3300048927 Ga0496124_0299355 Ga0496124_0299355_180_332 50
721 3300048928 Ga0496125_0000272 Ga0496125_0000272_95054_95206 50
722 3300048928 Ga0496125_0006804 Ga0496125_0006804_1830_1982 50
723 3300048928 Ga0496125_0026319 Ga0496125_0026319_3964_4116 50
724 3300048928 Ga0496125_0440152 Ga0496125_0440152_49_201 50
725 3300048928 Ga0496125_0522979 Ga0496125_0522979_412_564 50
726 3300048929 Ga0496126_0002820 Ga0496126_0002820_21467_21619 50
727 3300048929 Ga0496126_0010869 Ga0496126_0010869_5041_5193 50
728 3300048929 Ga0496126_0017190 Ga0496126_0017190_697_849 50
729 3300048929 Ga0496126_0022319 Ga0496126_0022319_1520_1672 50
730 3300048929 Ga0496126_0037772 Ga0496126_0037772_3103_3255 50
731 3300048929 Ga0496126_0085595 Ga0496126_0085595_1079_1231 50
732 3300048929 Ga0496126_0130347 Ga0496126_0130347_1377_1529 50
733 3300048929 Ga0496126_0132118 Ga0496126_0132118_1104_1256 50
734 3300048929 Ga0496126_0162002 Ga0496126_0162002_1195_1347 50
735 3300048929 Ga0496126_0322251 Ga0496126_0322251_130_282 50
736 3300048929 Ga0496126_0529996 Ga0496126_0529996_582_734 50
737 3300048929 Ga0496126_0763561 Ga0496126_0763561_411_563 50
738 3300048929 Ga0496126_0855724 Ga0496126_0855724_94_246 50
739 3300048929 Ga0496126_0876333 Ga0496126_0876333_314_466 50
740 3300049568 Ga0501031_0764065 Ga0501031_0764065_416_583 50
741 3300049572 Ga0501036_0506913 Ga0501036_0506913_168_320 50
742 3300049573 Ga0501037_0318506 Ga0501037_0318506_333_485 50
743 3300049579 Ga0501043_1205816 Ga0501043_1205816_171_323 50
744 3300049583 Ga0501067_0061344 Ga0501067_0061344_994_1161 50
745 3300049583 Ga0501067_0739114 Ga0501067_0739114_79_231 50
746 3300049588 Ga0501072_0812623 Ga0501072_0812623_240_392 50
747 3300049588 Ga0501072_0840148 Ga0501072_0840148_352_519 50
748 3300049822 Ga0501035_0316247 Ga0501035_0316247_111_263 50
749 3300049823 Ga0501044_1584184 Ga0501044_1584184_149_301 50
750 3300050489 nmdc:mga03683_440359_c1 nmdc:mga03683_440359_c1_340_492 50
751 3300050490 nmdc:mga03n38_107010_c1 nmdc:mga03n38_107010_c1_1117_1269 50
752 3300050491 nmdc:mga00v17_295619_c1 nmdc:mga00v17_295619_c1_480_632 50
753 3300050491 nmdc:mga00v17_473662_c1 nmdc:mga00v17_473662_c1_645_797 50
754 3300050492 nmdc:mga0yw44_1188402_c1 nmdc:mga0yw44_1188402_c1_130_282 50
755 3300050493 nmdc:mga0k408_894330_c1 nmdc:mga0k408_894330_c1_256_408 50
756 3300050494 nmdc:mga06z11_15312_c1 nmdc:mga06z11_15312_c1_1790_1942 50
757 3300050496 nmdc:mga07m45_548575_c1 nmdc:mga07m45_548575_c1_402_569 50
758 3300050496 nmdc:mga07m45_98117_c1 nmdc:mga07m45_98117_c1_98_250 50
759 3300050511 nmdc:mga08y16_671424_c1 nmdc:mga08y16_671424_c1_170_322 50
760 3300050512 nmdc:mga0n895_405781_c1 nmdc:mga0n895_405781_c1_1055_1207 50
761 3300050512 nmdc:mga0n895_606732_c1 nmdc:mga0n895_606732_c1_223_375 50
762 3300053080 Ga0500635_0020115 Ga0500635_0020115_1700_1852 50
763 3300053080 Ga0500635_0097419 Ga0500635_0097419_688_840 50
764 3300053083 Ga0495655_0339768 Ga0495655_0339768_48_200 50
765 3300053084 Ga0495595_0005251 Ga0495595_0005251_1336_1500 50
766 3300053085 Ga0495619_0002231 Ga0495619_0002231_9391_9555 50
767 3300053085 Ga0495619_0035165 Ga0495619_0035165_1521_1673 50
768 3300053091 Ga0500647_0069387 Ga0500647_0069387_1314_1466 50
769 3300053091 Ga0500647_0189726 Ga0500647_0189726_160_312 50
770 3300053093 Ga0500651_0257544 Ga0500651_0257544_77_229 50
771 3300053093 Ga0500651_0313457 Ga0500651_0313457_451_603 50
772 3300053094 Ga0500566_0000938 Ga0500566_0000938_7167_7319 50
773 3300053094 Ga0500566_0001308 Ga0500566_0001308_10101_10253 50
774 3300053094 Ga0500566_0134949 Ga0500566_0134949_552_704 50
775 3300053095 Ga0500640_003151 Ga0500640_003151_4430_4582 50
776 3300053098 Ga0500650_0166768 Ga0500650_0166768_646_798 50
777 3300053102 Ga0500554_043366 Ga0500554_043366_521_673 50
778 3300053102 Ga0500554_051279 Ga0500554_051279_139_291 50
779 3300053106 Ga0500558_199236 Ga0500558_199236_392_544 50
780 3300053111 Ga0500572_000217 Ga0500572_000217_9457_9609 50
781 3300053116 Ga0500592_037622 Ga0500592_037622_456_608 50
782 3300053119 Ga0500595_000324 Ga0500595_000324_25881_26033 50
783 3300053119 Ga0500595_002617 Ga0500595_002617_4992_5144 50
784 3300053119 Ga0500595_006868 Ga0500595_006868_2711_2863 50
785 3300053119 Ga0500595_025854 Ga0500595_025854_1837_1989 50
786 3300053119 Ga0500595_042239 Ga0500595_042239_646_798 50
787 3300053120 Ga0500597_397152 Ga0500597_397152_199_351 50
788 3300053122 Ga0500608_051766 Ga0500608_051766_1763_1915 50
789 3300053123 Ga0500614_005804 Ga0500614_005804_2108_2260 50
790 3300053131 Ga0500652_065775 Ga0500652_065775_801_953 50
791 3300053136 Ga0500559_0001486 Ga0500559_0001486_5140_5292 50
792 3300053136 Ga0500559_0018761 Ga0500559_0018761_2048_2200 50
793 3300053136 Ga0500559_0287895 Ga0500559_0287895_97_249 50
794 3300053136 Ga0500559_0315713 Ga0500559_0315713_454_606 50
795 3300053139 Ga0500568_0056098 Ga0500568_0056098_767_919 50
796 3300053140 Ga0500573_0015719 Ga0500573_0015719_935_1087 50
797 3300053148 Ga0500590_195182 Ga0500590_195182_221_373 50
798 3300053150 Ga0500603_000507 Ga0500603_000507_8870_9022 50
799 3300053150 Ga0500603_011705 Ga0500603_011705_380_532 50
800 3300053150 Ga0500603_058945 Ga0500603_058945_684_836 50
801 3300053150 Ga0500603_179537 Ga0500603_179537_123_275 50
802 3300053154 Ga0500619_312113 Ga0500619_312113_68_220 50
803 3300053158 Ga0500627_0118630 Ga0500627_0118630_679_831 50
804 3300053159 Ga0500630_000537 Ga0500630_000537_1964_2116 50
805 3300053162 Ga0500638_000078 Ga0500638_000078_3444_3596 50
806 3300053162 Ga0500638_002399 Ga0500638_002399_543_695 50
807 3300053162 Ga0500638_061923 Ga0500638_061923_376_528 50
808 3300053163 Ga0500639_000001 Ga0500639_000001_10604_10756 50
809 3300053163 Ga0500639_115377 Ga0500639_115377_457_609 50
810 3300053177 Ga0500636_0008443 Ga0500636_0008443_5105_5257 50
811 3300053177 Ga0500636_0019204 Ga0500636_0019204_3497_3649 50
812 3300053177 Ga0500636_0066084 Ga0500636_0066084_358_510 50
813 3300053177 Ga0500636_0162190 Ga0500636_0162190_869_1021 50
814 3300053177 Ga0500636_0186634 Ga0500636_0186634_210_362 50
815 3300053178 Ga0500637_0000088 Ga0500637_0000088_24780_24932 50
816 3300053178 Ga0500637_0030575 Ga0500637_0030575_1761_1913 50
817 3300053178 Ga0500637_0117642 Ga0500637_0117642_585_737 50
818 3300053178 Ga0500637_0289334 Ga0500637_0289334_115_267 50
819 3300053724 Ga0500570_143918 Ga0500570_143918_603_755 50
820 3300053725 Ga0500576_095614 Ga0500576_095614_329_481 50
821 3300053728 Ga0500657_129993 Ga0500657_129993_768_920 50
822 3300053730 Ga0500645_083395 Ga0500645_083395_738_890 50
823 3300053735 Ga0500596_000054 Ga0500596_000054_8830_8982 50
824 3300053735 Ga0500596_033617 Ga0500596_033617_44_196 50
825 3300053737 Ga0500601_005425 Ga0500601_005425_618_770 50
826 3300055283 Ga0500661_000867 Ga0500661_000867_722_874 50
827 3300055283 Ga0500661_017471 Ga0500661_017471_763_915 50

Feature Viewer

pLDDT pTM Quality
80.56 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map