F482528
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 827 | 411 | 827 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0238331|Ga0495606_0238331_417_599 |
| Length | 60 |
| Sequence | MGNLALWRPCMSGNRNVLFLIIGALIVGIGVLGYNLYQTKKEPEGLQINVGPSGLKVQNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 214 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 248 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 380 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 381 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 384 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 385 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 386 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 392 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 396 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 397 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 401 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 405 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 406 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 407 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 408 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 411 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.52 |
| Nodule | 0.12 |
| Rhizoplane | 4.59 |
| Rhizosphere | 75.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10081189 | 3300001979 | Bacteria | 849 |
| 2 | JGI24739J22299_10000711 | 3300001989 | Bacteria | 12063 |
| 3 | JGI24737J22298_10000671 | 3300001990 | Bacteria | 12097 |
| 4 | JGI24735J21928_10011428 | 3300002067 | Bacteria | 2814 |
| 5 | JGI24750J21931_1086753 | 3300002070 | Bacteria | 526 |
| 6 | JGI24742J22300_10007644 | 3300002244 | Bacteria | 1785 |
| 7 | JGI25153J46596_10039621 | 3300003215 | Bacteria | 1471 |
| 8 | JGI25153J46596_10105380 | 3300003215 | Bacteria | 656 |
| 9 | rootH2_10243292 | 3300003320 | Bacteria | 1302 |
| 10 | JGI25404J52841_10043842 | 3300003659 | Bacteria | 944 |
| 11 | JGI25404J52841_10050250 | 3300003659 | Bacteria | 876 |
| 12 | Ga0055539_1019512 | 3300003752 | Bacteria | 812 |
| 13 | Ga0055526_1021911 | 3300003771 | Bacteria | 2199 |
| 14 | Ga0070658_10033314 | 3300005327 | Bacteria | 4144 |
| 15 | Ga0070658_10055755 | 3300005327 | Bacteria | 3211 |
| 16 | Ga0070658_10147211 | 3300005327 | Bacteria | 1970 |
| 17 | Ga0070658_10186997 | 3300005327 | Bacteria | 1745 |
| 18 | Ga0070658_10930751 | 3300005327 | Bacteria | 756 |
| 19 | Ga0070658_11931186 | 3300005327 | Bacteria | 510 |
| 20 | Ga0070676_10226832 | 3300005328 | Bacteria | 1236 |
| 21 | Ga0070683_100127791 | 3300005329 | Bacteria | 2404 |
| 22 | Ga0068869_100192169 | 3300005334 | Bacteria | 1606 |
| 23 | Ga0070666_10861941 | 3300005335 | Bacteria | 669 |
| 24 | Ga0070680_100019388 | 3300005336 | Bacteria | 5389 |
| 25 | Ga0070680_100182285 | 3300005336 | Bacteria | 1769 |
| 26 | Ga0070680_101020236 | 3300005336 | Bacteria | 715 |
| 27 | Ga0068868_100270054 | 3300005338 | Bacteria | 1437 |
| 28 | Ga0070660_100017380 | 3300005339 | Bacteria | 5242 |
| 29 | Ga0070660_100536723 | 3300005339 | Bacteria | 975 |
| 30 | Ga0070660_100958988 | 3300005339 | Bacteria | 722 |
| 31 | Ga0070687_101335039 | 3300005343 | Bacteria | 534 |
| 32 | Ga0070661_100477578 | 3300005344 | Bacteria | 995 |
| 33 | Ga0070661_100583923 | 3300005344 | Bacteria | 902 |
| 34 | Ga0070661_101601202 | 3300005344 | Bacteria | 551 |
| 35 | Ga0070692_10665210 | 3300005345 | Bacteria | 697 |
| 36 | Ga0070668_100059516 | 3300005347 | Bacteria | 2956 |
| 37 | Ga0070668_100272754 | 3300005347 | Bacteria | 1410 |
| 38 | Ga0070668_100514643 | 3300005347 | Bacteria | 1038 |
| 39 | Ga0070669_100598439 | 3300005353 | Bacteria | 923 |
| 40 | Ga0070669_101343276 | 3300005353 | Bacteria | 619 |
| 41 | Ga0070671_100554398 | 3300005355 | Bacteria | 991 |
| 42 | Ga0070674_100116307 | 3300005356 | Bacteria | 1973 |
| 43 | Ga0070674_100153161 | 3300005356 | Bacteria | 1741 |
| 44 | Ga0070673_101368516 | 3300005364 | Bacteria | 666 |
| 45 | Ga0070688_100075427 | 3300005365 | Bacteria | 2168 |
| 46 | Ga0070659_100182108 | 3300005366 | Bacteria | 1725 |
| 47 | Ga0070667_100035592 | 3300005367 | Bacteria | 4172 |
| 48 | Ga0070667_100656102 | 3300005367 | Bacteria | 969 |
| 49 | Ga0070667_101841181 | 3300005367 | Bacteria | 570 |
| 50 | Ga0070709_10013858 | 3300005434 | Bacteria | 4545 |
| 51 | Ga0070714_100056261 | 3300005435 | Bacteria | 3364 |
| 52 | Ga0070714_100172047 | 3300005435 | Bacteria | 1966 |
| 53 | Ga0070714_100181179 | 3300005435 | Bacteria | 1917 |
| 54 | Ga0070714_101028318 | 3300005435 | Bacteria | 802 |
| 55 | Ga0070713_100003948 | 3300005436 | Bacteria | 9858 |
| 56 | Ga0070713_100039476 | 3300005436 | Bacteria | 3832 |
| 57 | Ga0070713_100144116 | 3300005436 | Bacteria | 2113 |
| 58 | Ga0070713_100961658 | 3300005436 | Bacteria | 823 |
| 59 | Ga0070713_101636543 | 3300005436 | Bacteria | 625 |
| 60 | Ga0070710_10262506 | 3300005437 | Bacteria | 1114 |
| 61 | Ga0070710_10964758 | 3300005437 | Bacteria | 619 |
| 62 | Ga0070701_10072143 | 3300005438 | Bacteria | 1848 |
| 63 | Ga0070711_100094825 | 3300005439 | Bacteria | 2158 |
| 64 | Ga0070705_101883062 | 3300005440 | Bacteria | 509 |
| 65 | Ga0070700_100038740 | 3300005441 | Bacteria | 2907 |
| 66 | Ga0070708_100916202 | 3300005445 | Bacteria | 823 |
| 67 | Ga0070663_100158555 | 3300005455 | Bacteria | 1740 |
| 68 | Ga0070663_100158845 | 3300005455 | Bacteria | 1739 |
| 69 | Ga0070678_100241507 | 3300005456 | Bacteria | 1510 |
| 70 | Ga0070678_101544770 | 3300005456 | Bacteria | 622 |
| 71 | Ga0070662_100215552 | 3300005457 | Bacteria | 1529 |
| 72 | Ga0070662_100474818 | 3300005457 | Bacteria | 1040 |
| 73 | Ga0070681_10221437 | 3300005458 | Bacteria | 1807 |
| 74 | Ga0070681_10340182 | 3300005458 | Bacteria | 1410 |
| 75 | Ga0068867_100032263 | 3300005459 | Bacteria | 3786 |
| 76 | Ga0068867_101102885 | 3300005459 | Bacteria | 725 |
| 77 | Ga0068867_101551831 | 3300005459 | Bacteria | 618 |
| 78 | Ga0070706_100820102 | 3300005467 | Bacteria | 861 |
| 79 | Ga0070707_100545466 | 3300005468 | Bacteria | 1122 |
| 80 | Ga0070679_100214947 | 3300005530 | Bacteria | 1885 |
| 81 | Ga0070679_100348953 | 3300005530 | Bacteria | 1428 |
| 82 | Ga0070679_100417674 | 3300005530 | Bacteria | 1287 |
| 83 | Ga0070679_101421379 | 3300005530 | Bacteria | 640 |
| 84 | Ga0070684_100004374 | 3300005535 | Bacteria | 10739 |
| 85 | Ga0070697_100049851 | 3300005536 | Bacteria | 3398 |
| 86 | Ga0070697_100557988 | 3300005536 | Bacteria | 1005 |
| 87 | Ga0068853_100015197 | 3300005539 | Bacteria | 6328 |
| 88 | Ga0068853_100020983 | 3300005539 | Bacteria | 5437 |
| 89 | Ga0068853_100087112 | 3300005539 | Bacteria | 2739 |
| 90 | Ga0068853_100246247 | 3300005539 | Bacteria | 1639 |
| 91 | Ga0068853_100617193 | 3300005539 | Bacteria | 1030 |
| 92 | Ga0070672_100110347 | 3300005543 | Bacteria | 2241 |
| 93 | Ga0070672_100214550 | 3300005543 | Bacteria | 1613 |
| 94 | Ga0070686_100100328 | 3300005544 | Bacteria | 1954 |
| 95 | Ga0070695_100615170 | 3300005545 | Bacteria | 854 |
| 96 | Ga0070696_101233525 | 3300005546 | Bacteria | 633 |
| 97 | Ga0070665_100196951 | 3300005548 | Bacteria | 2016 |
| 98 | Ga0070665_102670157 | 3300005548 | Bacteria | 500 |
| 99 | Ga0070704_100800681 | 3300005549 | Bacteria | 842 |
| 100 | Ga0068855_100010315 | 3300005563 | Bacteria | 11267 |
| 101 | Ga0068855_100031543 | 3300005563 | Bacteria | 6329 |
| 102 | Ga0068855_100070306 | 3300005563 | Bacteria | 4073 |
| 103 | Ga0068855_100275945 | 3300005563 | Bacteria | 1868 |
| 104 | Ga0068855_100759385 | 3300005563 | Bacteria | 1033 |
| 105 | Ga0068855_101702135 | 3300005563 | Bacteria | 643 |
| 106 | Ga0070664_101426098 | 3300005564 | Bacteria | 655 |
| 107 | Ga0068857_100003351 | 3300005577 | Bacteria | 13343 |
| 108 | Ga0068857_100114201 | 3300005577 | Bacteria | 2429 |
| 109 | Ga0068857_100129080 | 3300005577 | Bacteria | 2279 |
| 110 | Ga0068854_100004647 | 3300005578 | Bacteria | 8666 |
| 111 | Ga0068854_100010537 | 3300005578 | Bacteria | 5997 |
| 112 | Ga0068854_100975830 | 3300005578 | Bacteria | 749 |
| 113 | Ga0068854_101985224 | 3300005578 | Bacteria | 536 |
| 114 | Ga0068856_100009171 | 3300005614 | Bacteria | 9620 |
| 115 | Ga0068856_100330866 | 3300005614 | Bacteria | 1541 |
| 116 | Ga0068856_100610703 | 3300005614 | Bacteria | 1111 |
| 117 | Ga0068856_101083935 | 3300005614 | Bacteria | 819 |
| 118 | Ga0070702_100120700 | 3300005615 | Bacteria | 1640 |
| 119 | Ga0070702_101439731 | 3300005615 | Bacteria | 565 |
| 120 | Ga0068852_100077939 | 3300005616 | Bacteria | 2931 |
| 121 | Ga0068852_100084688 | 3300005616 | Bacteria | 2822 |
| 122 | Ga0068852_100159336 | 3300005616 | Bacteria | 2106 |
| 123 | Ga0068852_100355585 | 3300005616 | Bacteria | 1431 |
| 124 | Ga0068852_100406165 | 3300005616 | Bacteria | 1341 |
| 125 | Ga0068866_10128540 | 3300005718 | Bacteria | 1437 |
| 126 | Ga0068861_100016364 | 3300005719 | Bacteria | 5247 |
| 127 | Ga0068861_100193846 | 3300005719 | Bacteria | 1701 |
| 128 | Ga0068851_10026729 | 3300005834 | Bacteria | 2839 |
| 129 | Ga0068851_10042900 | 3300005834 | Bacteria | 2278 |
| 130 | Ga0068863_100153114 | 3300005841 | Bacteria | 2207 |
| 131 | Ga0068858_100221497 | 3300005842 | Bacteria | 1792 |
| 132 | Ga0068858_100629407 | 3300005842 | Bacteria | 1042 |
| 133 | Ga0068860_100779965 | 3300005843 | Bacteria | 968 |
| 134 | Ga0068860_102627596 | 3300005843 | Bacteria | 522 |
| 135 | Ga0068862_100194967 | 3300005844 | Bacteria | 1824 |
| 136 | Ga0068862_100252914 | 3300005844 | Bacteria | 1606 |
| 137 | Ga0068862_100766773 | 3300005844 | Bacteria | 940 |
| 138 | Ga0081455_10002419 | 3300005937 | Bacteria | 22263 |
| 139 | Ga0081455_10003658 | 3300005937 | Bacteria | 17616 |
| 140 | Ga0081455_10125266 | 3300005937 | Bacteria | 2018 |
| 141 | Ga0081540_1002804 | 3300005983 | Bacteria | 14119 |
| 142 | Ga0081540_1004519 | 3300005983 | Bacteria | 10561 |
| 143 | Ga0081540_1048457 | 3300005983 | Bacteria | 2128 |
| 144 | Ga0081540_1074125 | 3300005983 | Bacteria | 1561 |
| 145 | Ga0081540_1206006 | 3300005983 | Bacteria | 711 |
| 146 | Ga0081540_1237291 | 3300005983 | Bacteria | 641 |
| 147 | Ga0081539_10060955 | 3300005985 | Bacteria | 2069 |
| 148 | Ga0070717_10011433 | 3300006028 | Bacteria | 6742 |
| 149 | Ga0070717_10348221 | 3300006028 | Bacteria | 1324 |
| 150 | Ga0070717_10648051 | 3300006028 | Bacteria | 959 |
| 151 | Ga0070717_10676922 | 3300006028 | Bacteria | 937 |
| 152 | Ga0075365_10639125 | 3300006038 | Bacteria | 752 |
| 153 | Ga0075365_11259125 | 3300006038 | Bacteria | 520 |
| 154 | Ga0070715_10075193 | 3300006163 | Bacteria | 1519 |
| 155 | Ga0070715_10886706 | 3300006163 | Bacteria | 548 |
| 156 | Ga0070716_100007220 | 3300006173 | Bacteria | 5464 |
| 157 | Ga0070716_100067550 | 3300006173 | Bacteria | 2088 |
| 158 | Ga0070712_100032824 | 3300006175 | Bacteria | 3508 |
| 159 | Ga0070712_100627082 | 3300006175 | Bacteria | 912 |
| 160 | Ga0070712_101656083 | 3300006175 | Bacteria | 560 |
| 161 | Ga0075362_10078151 | 3300006177 | Bacteria | 1522 |
| 162 | Ga0075367_10504098 | 3300006178 | Bacteria | 768 |
| 163 | Ga0075369_10364066 | 3300006186 | Bacteria | 679 |
| 164 | Ga0075366_10758140 | 3300006195 | Bacteria | 603 |
| 165 | Ga0097621_100306101 | 3300006237 | Bacteria | 1405 |
| 166 | Ga0097621_100491236 | 3300006237 | Bacteria | 1111 |
| 167 | Ga0068871_100215269 | 3300006358 | Bacteria | 1663 |
| 168 | Ga0068871_102307727 | 3300006358 | Bacteria | 513 |
| 169 | Ga0075428_101694586 | 3300006844 | Bacteria | 660 |
| 170 | Ga0075433_11873910 | 3300006852 | Bacteria | 515 |
| 171 | Ga0075434_100998236 | 3300006871 | Bacteria | 851 |
| 172 | Ga0075434_102536305 | 3300006871 | Bacteria | 514 |
| 173 | Ga0068865_100097401 | 3300006881 | Bacteria | 2147 |
| 174 | Ga0099794_10059552 | 3300007265 | Bacteria | 1853 |
| 175 | Ga0099794_10653890 | 3300007265 | Bacteria | 558 |
| 176 | Ga0099795_10024518 | 3300007788 | Bacteria | 2013 |
| 177 | Ga0099795_10264014 | 3300007788 | Bacteria | 746 |
| 178 | Ga0099795_10525200 | 3300007788 | Bacteria | 555 |
| 179 | Ga0105240_10028738 | 3300009093 | Bacteria | 7254 |
| 180 | Ga0105240_10047953 | 3300009093 | Bacteria | 5402 |
| 181 | Ga0105240_10189207 | 3300009093 | Bacteria | 2421 |
| 182 | Ga0105240_10461369 | 3300009093 | Bacteria | 1419 |
| 183 | Ga0105240_11355183 | 3300009093 | Bacteria | 749 |
| 184 | Ga0105240_11611118 | 3300009093 | Bacteria | 679 |
| 185 | Ga0111539_10093931 | 3300009094 | Bacteria | 3523 |
| 186 | Ga0111539_13504050 | 3300009094 | Bacteria | 504 |
| 187 | Ga0105245_10093236 | 3300009098 | Bacteria | 2774 |
| 188 | Ga0105245_11177621 | 3300009098 | Bacteria | 814 |
| 189 | Ga0105245_11268877 | 3300009098 | Bacteria | 785 |
| 190 | Ga0105247_10240343 | 3300009101 | Bacteria | 1234 |
| 191 | Ga0105243_10093348 | 3300009148 | Bacteria | 2483 |
| 192 | Ga0105243_10967365 | 3300009148 | Bacteria | 851 |
| 193 | Ga0105243_11963456 | 3300009148 | Bacteria | 619 |
| 194 | Ga0105243_12355502 | 3300009148 | Unclassified | 570 |
| 195 | Ga0105241_10047352 | 3300009174 | Bacteria | 3269 |
| 196 | Ga0105241_10877138 | 3300009174 | Bacteria | 832 |
| 197 | Ga0105242_10051882 | 3300009176 | Bacteria | 3344 |
| 198 | Ga0105242_10831111 | 3300009176 | Bacteria | 917 |
| 199 | Ga0105242_11913351 | 3300009176 | Bacteria | 634 |
| 200 | Ga0105248_10611999 | 3300009177 | Bacteria | 1229 |
| 201 | Ga0105248_12523632 | 3300009177 | Bacteria | 586 |
| 202 | Ga0105248_13419677 | 3300009177 | Bacteria | 504 |
| 203 | Ga0105237_10005643 | 3300009545 | Bacteria | 14090 |
| 204 | Ga0105237_10014877 | 3300009545 | Bacteria | 8114 |
| 205 | Ga0105237_10029473 | 3300009545 | Bacteria | 5579 |
| 206 | Ga0105237_10248145 | 3300009545 | Bacteria | 1782 |
| 207 | Ga0105237_11174676 | 3300009545 | Bacteria | 774 |
| 208 | Ga0105237_11683781 | 3300009545 | Bacteria | 641 |
| 209 | Ga0105237_12711798 | 3300009545 | Bacteria | 506 |
| 210 | Ga0105238_10001837 | 3300009551 | Bacteria | 21282 |
| 211 | Ga0105238_10014865 | 3300009551 | Bacteria | 7875 |
| 212 | Ga0105238_10018123 | 3300009551 | Bacteria | 7159 |
| 213 | Ga0105238_10407771 | 3300009551 | Bacteria | 1353 |
| 214 | Ga0105249_10044480 | 3300009553 | Bacteria | 4037 |
| 215 | Ga0105249_12493091 | 3300009553 | Bacteria | 590 |
| 216 | Ga0105249_13485995 | 3300009553 | Bacteria | 506 |
| 217 | Ga0099796_10032904 | 3300010159 | Bacteria | 1703 |
| 218 | Ga0099796_10085197 | 3300010159 | Bacteria | 1166 |
| 219 | Ga0105239_10023538 | 3300010375 | Bacteria | 6784 |
| 220 | Ga0105239_10063511 | 3300010375 | Bacteria | 4054 |
| 221 | Ga0105239_10085653 | 3300010375 | Bacteria | 3473 |
| 222 | Ga0105239_10125840 | 3300010375 | Bacteria | 2848 |
| 223 | Ga0105239_11872700 | 3300010375 | Bacteria | 695 |
| 224 | Ga0105239_12128009 | 3300010375 | Bacteria | 652 |
| 225 | Ga0105239_12247290 | 3300010375 | Bacteria | 634 |
| 226 | Ga0105239_13226338 | 3300010375 | Bacteria | 531 |
| 227 | Ga0105246_10280991 | 3300011119 | Bacteria | 1335 |
| 228 | Ga0105246_10341466 | 3300011119 | Bacteria | 1224 |
| 229 | Ga0105246_10446928 | 3300011119 | Bacteria | 1085 |
| 230 | Ga0105246_11299457 | 3300011119 | Bacteria | 674 |
| 231 | Ga0105246_12433840 | 3300011119 | Bacteria | 514 |
| 232 | Ga0157319_1005298 | 3300012497 | Bacteria | 883 |
| 233 | Ga0157370_10027385 | 3300013104 | Bacteria | 5620 |
| 234 | Ga0157370_10257438 | 3300013104 | Bacteria | 1613 |
| 235 | Ga0157369_10026982 | 3300013105 | Bacteria | 6370 |
| 236 | Ga0157369_10723343 | 3300013105 | Bacteria | 1025 |
| 237 | Ga0157374_11835973 | 3300013296 | Bacteria | 632 |
| 238 | Ga0157378_10030150 | 3300013297 | Bacteria | 4792 |
| 239 | Ga0157378_11054735 | 3300013297 | Bacteria | 849 |
| 240 | Ga0163162_10119163 | 3300013306 | Bacteria | 2742 |
| 241 | Ga0157375_10379311 | 3300013308 | Bacteria | 1580 |
| 242 | Ga0157375_11704681 | 3300013308 | Bacteria | 746 |
| 243 | Ga0157375_12892231 | 3300013308 | Bacteria | 574 |
| 244 | Ga0157375_13109143 | 3300013308 | Bacteria | 554 |
| 245 | Ga0163163_11603738 | 3300014325 | Bacteria | 712 |
| 246 | Ga0163163_11760596 | 3300014325 | Bacteria | 680 |
| 247 | Ga0163163_12689759 | 3300014325 | Bacteria | 555 |
| 248 | Ga0157380_10412787 | 3300014326 | Bacteria | 1285 |
| 249 | Ga0157380_10686294 | 3300014326 | Bacteria | 1027 |
| 250 | Ga0157380_12525868 | 3300014326 | Bacteria | 580 |
| 251 | Ga0182008_10713716 | 3300014497 | Bacteria | 574 |
| 252 | Ga0157379_10291308 | 3300014968 | Bacteria | 1487 |
| 253 | Ga0157379_11314991 | 3300014968 | Bacteria | 698 |
| 254 | Ga0157376_10081108 | 3300014969 | Bacteria | 2785 |
| 255 | Ga0157376_11355528 | 3300014969 | Bacteria | 742 |
| 256 | Ga0163161_10442897 | 3300017792 | Bacteria | 1049 |
| 257 | Ga0213876_10041155 | 3300021384 | Bacteria | 2442 |
| 258 | Ga0209677_100235 | 3300025253 | Bacteria | 38918 |
| 259 | Ga0209564_1009747 | 3300025295 | Bacteria | 4521 |
| 260 | Ga0209758_1001576 | 3300025297 | Bacteria | 26090 |
| 261 | Ga0209758_1007649 | 3300025297 | Bacteria | 7285 |
| 262 | Ga0209758_1121224 | 3300025297 | Bacteria | 705 |
| 263 | Ga0207656_10063389 | 3300025321 | Bacteria | 1627 |
| 264 | Ga0207656_10151391 | 3300025321 | Bacteria | 1099 |
| 265 | Ga0207692_10073593 | 3300025898 | Bacteria | 1808 |
| 266 | Ga0207692_10230096 | 3300025898 | Bacteria | 1103 |
| 267 | Ga0207642_10008842 | 3300025899 | Bacteria | 3477 |
| 268 | Ga0207710_10152399 | 3300025900 | Bacteria | 1122 |
| 269 | Ga0207710_10594277 | 3300025900 | Bacteria | 578 |
| 270 | Ga0207688_10124104 | 3300025901 | Bacteria | 1509 |
| 271 | Ga0207680_10984507 | 3300025903 | Bacteria | 604 |
| 272 | Ga0207647_10002624 | 3300025904 | Bacteria | 13593 |
| 273 | Ga0207685_10282414 | 3300025905 | Bacteria | 815 |
| 274 | Ga0207699_10402923 | 3300025906 | Bacteria | 974 |
| 275 | Ga0207699_11067732 | 3300025906 | Bacteria | 598 |
| 276 | Ga0207699_11254661 | 3300025906 | Bacteria | 549 |
| 277 | Ga0207645_10247030 | 3300025907 | Bacteria | 1180 |
| 278 | Ga0207705_10113159 | 3300025909 | Bacteria | 2007 |
| 279 | Ga0207705_10260891 | 3300025909 | Bacteria | 1323 |
| 280 | Ga0207705_11479457 | 3300025909 | Bacteria | 515 |
| 281 | Ga0207684_10937158 | 3300025910 | Bacteria | 727 |
| 282 | Ga0207654_10003876 | 3300025911 | Bacteria | 7539 |
| 283 | Ga0207654_10940540 | 3300025911 | Bacteria | 627 |
| 284 | Ga0207707_10059270 | 3300025912 | Bacteria | 3331 |
| 285 | Ga0207707_10092716 | 3300025912 | Bacteria | 2639 |
| 286 | Ga0207695_10004042 | 3300025913 | Bacteria | 20184 |
| 287 | Ga0207695_10012960 | 3300025913 | Bacteria | 9965 |
| 288 | Ga0207695_10335570 | 3300025913 | Bacteria | 1400 |
| 289 | Ga0207671_10015510 | 3300025914 | Bacteria | 5960 |
| 290 | Ga0207671_10031399 | 3300025914 | Bacteria | 3958 |
| 291 | Ga0207671_10103241 | 3300025914 | Bacteria | 2162 |
| 292 | Ga0207671_10405141 | 3300025914 | Bacteria | 1085 |
| 293 | Ga0207671_10414576 | 3300025914 | Bacteria | 1071 |
| 294 | Ga0207671_10473748 | 3300025914 | Bacteria | 998 |
| 295 | Ga0207693_10011177 | 3300025915 | Bacteria | 7268 |
| 296 | Ga0207693_10033297 | 3300025915 | Bacteria | 4067 |
| 297 | Ga0207693_10093209 | 3300025915 | Bacteria | 2361 |
| 298 | Ga0207663_10080161 | 3300025916 | Bacteria | 2134 |
| 299 | Ga0207663_10795145 | 3300025916 | Bacteria | 753 |
| 300 | Ga0207663_11079689 | 3300025916 | Bacteria | 645 |
| 301 | Ga0207660_10017864 | 3300025917 | Bacteria | 4720 |
| 302 | Ga0207660_10133415 | 3300025917 | Bacteria | 1892 |
| 303 | Ga0207660_10289639 | 3300025917 | Bacteria | 1302 |
| 304 | Ga0207660_10756931 | 3300025917 | Bacteria | 793 |
| 305 | Ga0207660_10874562 | 3300025917 | Bacteria | 733 |
| 306 | Ga0207657_10004981 | 3300025919 | Bacteria | 13971 |
| 307 | Ga0207657_10599984 | 3300025919 | Bacteria | 859 |
| 308 | Ga0207657_10915518 | 3300025919 | Bacteria | 675 |
| 309 | Ga0207657_10918921 | 3300025919 | Bacteria | 674 |
| 310 | Ga0207649_10189962 | 3300025920 | Bacteria | 1444 |
| 311 | Ga0207652_10015155 | 3300025921 | Bacteria | 6255 |
| 312 | Ga0207652_10444209 | 3300025921 | Bacteria | 1169 |
| 313 | Ga0207652_11090715 | 3300025921 | Bacteria | 699 |
| 314 | Ga0207681_10317196 | 3300025923 | Bacteria | 1238 |
| 315 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 316 | Ga0207694_10042681 | 3300025924 | Bacteria | 3499 |
| 317 | Ga0207694_10048492 | 3300025924 | Bacteria | 3286 |
| 318 | Ga0207650_11173134 | 3300025925 | Bacteria | 654 |
| 319 | Ga0207687_11118216 | 3300025927 | Bacteria | 677 |
| 320 | Ga0207687_11319200 | 3300025927 | Bacteria | 620 |
| 321 | Ga0207687_11319635 | 3300025927 | Bacteria | 620 |
| 322 | Ga0207700_10055551 | 3300025928 | Bacteria | 2977 |
| 323 | Ga0207700_10275884 | 3300025928 | Bacteria | 1444 |
| 324 | Ga0207700_10322022 | 3300025928 | Bacteria | 1340 |
| 325 | Ga0207700_11003127 | 3300025928 | Bacteria | 747 |
| 326 | Ga0207700_11086488 | 3300025928 | Bacteria | 715 |
| 327 | Ga0207664_10037970 | 3300025929 | Bacteria | 3731 |
| 328 | Ga0207664_10058930 | 3300025929 | Bacteria | 3056 |
| 329 | Ga0207664_10883372 | 3300025929 | Bacteria | 803 |
| 330 | Ga0207644_10063190 | 3300025931 | Bacteria | 2688 |
| 331 | Ga0207644_10619743 | 3300025931 | Bacteria | 899 |
| 332 | Ga0207644_11631659 | 3300025931 | Bacteria | 541 |
| 333 | Ga0207690_10026152 | 3300025932 | Bacteria | 3673 |
| 334 | Ga0207690_10230047 | 3300025932 | Bacteria | 1423 |
| 335 | Ga0207706_10051098 | 3300025933 | Bacteria | 3651 |
| 336 | Ga0207706_10884245 | 3300025933 | Bacteria | 755 |
| 337 | Ga0207706_10889116 | 3300025933 | Bacteria | 753 |
| 338 | Ga0207686_10283393 | 3300025934 | Bacteria | 1224 |
| 339 | Ga0207709_10008505 | 3300025935 | Bacteria | 5678 |
| 340 | Ga0207709_10067048 | 3300025935 | Bacteria | 2263 |
| 341 | Ga0207670_11276726 | 3300025936 | Bacteria | 622 |
| 342 | Ga0207669_10125578 | 3300025937 | Bacteria | 1752 |
| 343 | Ga0207669_10176802 | 3300025937 | Bacteria | 1525 |
| 344 | Ga0207669_11027750 | 3300025937 | Bacteria | 693 |
| 345 | Ga0207704_10051070 | 3300025938 | Bacteria | 2498 |
| 346 | Ga0207704_10851129 | 3300025938 | Bacteria | 764 |
| 347 | Ga0207665_10246166 | 3300025939 | Bacteria | 1319 |
| 348 | Ga0207665_10259030 | 3300025939 | Bacteria | 1288 |
| 349 | Ga0207691_10034519 | 3300025940 | Bacteria | 4702 |
| 350 | Ga0207691_11181823 | 3300025940 | Bacteria | 635 |
| 351 | Ga0207711_11200023 | 3300025941 | Bacteria | 700 |
| 352 | Ga0207689_10275231 | 3300025942 | Bacteria | 1394 |
| 353 | Ga0207689_11173315 | 3300025942 | Bacteria | 647 |
| 354 | Ga0207661_10167569 | 3300025944 | Bacteria | 1910 |
| 355 | Ga0207679_10653027 | 3300025945 | Bacteria | 951 |
| 356 | Ga0207667_10013948 | 3300025949 | Bacteria | 9181 |
| 357 | Ga0207667_10078267 | 3300025949 | Bacteria | 3427 |
| 358 | Ga0207667_10207544 | 3300025949 | Bacteria | 2008 |
| 359 | Ga0207667_10490751 | 3300025949 | Bacteria | 1246 |
| 360 | Ga0207667_10767889 | 3300025949 | Bacteria | 962 |
| 361 | Ga0207667_10921839 | 3300025949 | Bacteria | 864 |
| 362 | Ga0207651_11154374 | 3300025960 | Bacteria | 695 |
| 363 | Ga0207712_10129613 | 3300025961 | Bacteria | 1920 |
| 364 | Ga0207668_10038360 | 3300025972 | Bacteria | 3214 |
| 365 | Ga0207668_10417169 | 3300025972 | Bacteria | 1138 |
| 366 | Ga0207668_10450331 | 3300025972 | Bacteria | 1098 |
| 367 | Ga0207640_10907455 | 3300025981 | Bacteria | 770 |
| 368 | Ga0207658_10571410 | 3300025986 | Bacteria | 1013 |
| 369 | Ga0207658_11795392 | 3300025986 | Bacteria | 559 |
| 370 | Ga0207658_11796391 | 3300025986 | Bacteria | 559 |
| 371 | Ga0207658_11981575 | 3300025986 | Bacteria | 530 |
| 372 | Ga0207703_10446060 | 3300026035 | Bacteria | 1208 |
| 373 | Ga0207703_10958593 | 3300026035 | Bacteria | 820 |
| 374 | Ga0207639_10016076 | 3300026041 | Bacteria | 5287 |
| 375 | Ga0207639_10022946 | 3300026041 | Bacteria | 4500 |
| 376 | Ga0207639_10200670 | 3300026041 | Bacteria | 1710 |
| 377 | Ga0207639_10294007 | 3300026041 | Bacteria | 1433 |
| 378 | Ga0207639_10626828 | 3300026041 | Bacteria | 993 |
| 379 | Ga0207678_10058598 | 3300026067 | Bacteria | 3313 |
| 380 | Ga0207678_10160182 | 3300026067 | Bacteria | 1922 |
| 381 | Ga0207678_10185583 | 3300026067 | Bacteria | 1776 |
| 382 | Ga0207678_10250454 | 3300026067 | Bacteria | 1517 |
| 383 | Ga0207678_11797514 | 3300026067 | Bacteria | 537 |
| 384 | Ga0207708_10054831 | 3300026075 | Bacteria | 3039 |
| 385 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 386 | Ga0207702_10003315 | 3300026078 | Bacteria | 14804 |
| 387 | Ga0207702_11087798 | 3300026078 | Bacteria | 793 |
| 388 | Ga0207702_12200052 | 3300026078 | Bacteria | 540 |
| 389 | Ga0207648_10037161 | 3300026089 | Bacteria | 4288 |
| 390 | Ga0207648_11467912 | 3300026089 | Bacteria | 641 |
| 391 | Ga0207676_10147521 | 3300026095 | Bacteria | 2022 |
| 392 | Ga0207674_10001889 | 3300026116 | Bacteria | 26658 |
| 393 | Ga0207674_10004659 | 3300026116 | Bacteria | 16461 |
| 394 | Ga0207674_10005787 | 3300026116 | Bacteria | 14663 |
| 395 | Ga0207674_11151868 | 3300026116 | Bacteria | 745 |
| 396 | Ga0207675_100063476 | 3300026118 | Bacteria | 3451 |
| 397 | Ga0207675_100393127 | 3300026118 | Bacteria | 1365 |
| 398 | Ga0207675_101747017 | 3300026118 | Bacteria | 642 |
| 399 | Ga0207683_10377778 | 3300026121 | Bacteria | 1302 |
| 400 | Ga0207698_10160918 | 3300026142 | Bacteria | 1963 |
| 401 | Ga0207698_10211937 | 3300026142 | Bacteria | 1744 |
| 402 | Ga0207698_10215367 | 3300026142 | Bacteria | 1731 |
| 403 | Ga0207698_11666658 | 3300026142 | Bacteria | 653 |
| 404 | Ga0209179_1004345 | 3300027512 | Bacteria | 2132 |
| 405 | Ga0209588_1063920 | 3300027671 | Bacteria | 1189 |
| 406 | Ga0209813_10096797 | 3300027866 | Bacteria | 999 |
| 407 | Ga0268266_10004442 | 3300028379 | Bacteria | 13419 |
| 408 | Ga0268266_10816346 | 3300028379 | Bacteria | 901 |
| 409 | Ga0268265_11407848 | 3300028380 | Bacteria | 699 |
| 410 | Ga0268265_12288545 | 3300028380 | Bacteria | 547 |
| 411 | Ga0268264_11338603 | 3300028381 | Bacteria | 726 |
| 412 | Ga0268264_12318401 | 3300028381 | Bacteria | 544 |
| 413 | Ga0307517_10390735 | 3300028786 | Bacteria | 740 |
| 414 | Ga0265338_10769484 | 3300028800 | Bacteria | 661 |
| 415 | Ga0307511_10049805 | 3300030521 | Bacteria | 3383 |
| 416 | Ga0265330_10035542 | 3300031235 | Bacteria | 2223 |
| 417 | Ga0265330_10119307 | 3300031235 | Bacteria | 1124 |
| 418 | Ga0265332_10006188 | 3300031238 | Bacteria | 5455 |
| 419 | Ga0265332_10113260 | 3300031238 | Bacteria | 1141 |
| 420 | Ga0265328_10255064 | 3300031239 | Bacteria | 672 |
| 421 | Ga0265325_10022232 | 3300031241 | Bacteria | 3477 |
| 422 | Ga0265340_10002614 | 3300031247 | Bacteria | 10238 |
| 423 | Ga0265339_10100248 | 3300031249 | Bacteria | 1508 |
| 424 | Ga0265331_10035274 | 3300031250 | Bacteria | 2462 |
| 425 | Ga0265316_10140574 | 3300031344 | Bacteria | 1814 |
| 426 | Ga0265316_10155117 | 3300031344 | Bacteria | 1714 |
| 427 | Ga0307509_10038177 | 3300031507 | Bacteria | 5241 |
| 428 | Ga0307509_10218560 | 3300031507 | Bacteria | 1721 |
| 429 | Ga0307509_10347977 | 3300031507 | Bacteria | 1206 |
| 430 | Ga0307509_10671558 | 3300031507 | Bacteria | 704 |
| 431 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 432 | Ga0307508_10164958 | 3300031616 | Bacteria | 1818 |
| 433 | Ga0265314_10047125 | 3300031711 | Bacteria | 3036 |
| 434 | Ga0265314_10226595 | 3300031711 | Bacteria | 1087 |
| 435 | Ga0265342_10263205 | 3300031712 | Bacteria | 917 |
| 436 | Ga0307516_10109129 | 3300031730 | Bacteria | 2573 |
| 437 | Ga0307516_10147601 | 3300031730 | Bacteria | 2116 |
| 438 | Ga0307413_10055169 | 3300031824 | Bacteria | 2416 |
| 439 | Ga0307413_11159284 | 3300031824 | Bacteria | 670 |
| 440 | Ga0307410_10598894 | 3300031852 | Bacteria | 919 |
| 441 | Ga0307407_10505054 | 3300031903 | Bacteria | 887 |
| 442 | Ga0307412_10806642 | 3300031911 | Bacteria | 815 |
| 443 | Ga0307409_101901686 | 3300031995 | Bacteria | 624 |
| 444 | Ga0307414_10364317 | 3300032004 | Bacteria | 1245 |
| 445 | Ga0307411_12288974 | 3300032005 | Bacteria | 507 |
| 446 | Ga0307415_100627553 | 3300032126 | Bacteria | 960 |
| 447 | Ga0307507_10035312 | 3300033179 | Bacteria | 5138 |
| 448 | Ga0307510_10142653 | 3300033180 | Bacteria | 2035 |
| 449 | Ga0307510_10494591 | 3300033180 | Bacteria | 665 |
| 450 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 451 | Ga0316215_1016541 | 3300033544 | Bacteria | 742 |
| 452 | Ga0316215_1030587 | 3300033544 | Bacteria | 558 |
| 453 | Ga0316215_1034504 | 3300033544 | Bacteria | 528 |
| 454 | Ga0373926_0024531 | 3300035083 | Bacteria | 2101 |
| 455 | Ga0373934_0001166 | 3300035086 | Bacteria | 9586 |
| 456 | Ga0373934_0434512 | 3300035086 | Bacteria | 550 |
| 457 | Ga0373944_0103137 | 3300035089 | Bacteria | 966 |
| 458 | Ga0373923_0008553 | 3300035111 | Bacteria | 3657 |
| 459 | Ga0373923_0548369 | 3300035111 | Bacteria | 566 |
| 460 | Ga0373932_0167563 | 3300035112 | Bacteria | 763 |
| 461 | Ga0373936_0043565 | 3300035113 | Bacteria | 1804 |
| 462 | Ga0373936_0095072 | 3300035113 | Bacteria | 1253 |
| 463 | Ga0373936_0136528 | 3300035113 | Bacteria | 1057 |
| 464 | Ga0373939_0334682 | 3300035114 | Bacteria | 612 |
| 465 | Ga0373953_0003332 | 3300035117 | Bacteria | 4982 |
| 466 | Ga0373953_0331693 | 3300035117 | Bacteria | 666 |
| 467 | Ga0373953_0429982 | 3300035117 | Bacteria | 582 |
| 468 | Ga0373954_0007921 | 3300035118 | Bacteria | 4653 |
| 469 | Ga0373954_0319627 | 3300035118 | Bacteria | 766 |
| 470 | Ga0373956_0001159 | 3300035119 | Bacteria | 10897 |
| 471 | Ga0373957_0009755 | 3300035120 | Bacteria | 3149 |
| 472 | Ga0373943_0013016 | 3300035170 | Bacteria | 3753 |
| 473 | Ga0373946_0063490 | 3300035171 | Bacteria | 1577 |
| 474 | Ga0373955_0003515 | 3300035172 | Bacteria | 6895 |
| 475 | Ga0373955_0406131 | 3300035172 | Bacteria | 828 |
| 476 | Ga0373924_0013420 | 3300035410 | Bacteria | 3079 |
| 477 | Ga0373924_0045234 | 3300035410 | Bacteria | 1811 |
| 478 | Ga0373935_0000701 | 3300035692 | Bacteria | 17791 |
| 479 | Ga0373935_0191650 | 3300035692 | Bacteria | 1408 |
| 480 | Ga0373935_0499099 | 3300035692 | Bacteria | 883 |
| 481 | Ga0373935_0684413 | 3300035692 | Bacteria | 754 |
| 482 | Ga0373935_0754217 | 3300035692 | Bacteria | 717 |
| 483 | Ga0373935_1441226 | 3300035692 | Bacteria | 515 |
| 484 | Ga0373927_0001744 | 3300035695 | Bacteria | 16246 |
| 485 | Ga0373927_0007540 | 3300035695 | Bacteria | 7359 |
| 486 | Ga0373927_0013004 | 3300035695 | Bacteria | 5535 |
| 487 | Ga0373927_0551897 | 3300035695 | Bacteria | 761 |
| 488 | Ga0373933_0008789 | 3300035724 | Bacteria | 5508 |
| 489 | Ga0373933_0030554 | 3300035724 | Bacteria | 3120 |
| 490 | Ga0373933_1165185 | 3300035724 | Bacteria | 508 |
| 491 | Ga0373947_0005322 | 3300035725 | Bacteria | 7521 |
| 492 | Ga0373947_0161160 | 3300035725 | Bacteria | 1451 |
| 493 | Ga0373947_0330820 | 3300035725 | Bacteria | 1020 |
| 494 | Ga0373937_0067053 | 3300036401 | Bacteria | 3306 |
| 495 | Ga0373937_0246381 | 3300036401 | Bacteria | 1684 |
| 496 | Ga0373937_1823718 | 3300036401 | Bacteria | 555 |
| 497 | Ga0310110_015967 | 3300036535 | Bacteria | 1070 |
| 498 | Ga0373925_0004587 | 3300037068 | Bacteria | 10437 |
| 499 | Ga0373925_0206849 | 3300037068 | Bacteria | 1562 |
| 500 | Ga0373925_0277464 | 3300037068 | Bacteria | 1349 |
| 501 | Ga0395900_0583962 | 3300037418 | Bacteria | 1059 |
| 502 | Ga0395898_0121218 | 3300037466 | Bacteria | 2506 |
| 503 | Ga0395905_0043982 | 3300037471 | Bacteria | 4191 |
| 504 | Ga0436364_0609221 | 3300037853 | Bacteria | 1332 |
| 505 | Ga0436365_1678992 | 3300039437 | Bacteria | 2667 |
| 506 | Ga0439465_0425671 | 3300041413 | Bacteria | 507 |
| 507 | Ga0451791_0310822 | 3300041451 | Bacteria | 844 |
| 508 | Ga0451791_1004722 | 3300041451 | Bacteria | 557 |
| 509 | Ga0451797_0286223 | 3300041453 | Bacteria | 616 |
| 510 | Ga0451802_1199996 | 3300041460 | Bacteria | 688 |
| 511 | Ga0451802_1963004 | 3300041460 | Bacteria | 707 |
| 512 | Ga0451807_0794862 | 3300041486 | Bacteria | 638 |
| 513 | Ga0451833_0692571 | 3300041491 | Bacteria | 838 |
| 514 | Ga0451843_1671675 | 3300041509 | Bacteria | 1284 |
| 515 | Ga0495592_0008975 | 3300046454 | Bacteria | 7511 |
| 516 | Ga0495592_0856949 | 3300046454 | Bacteria | 536 |
| 517 | Ga0495603_0000624 | 3300046455 | Bacteria | 19835 |
| 518 | Ga0495603_0164144 | 3300046455 | Bacteria | 1288 |
| 519 | Ga0495629_0001961 | 3300046459 | Bacteria | 16039 |
| 520 | Ga0495629_0004200 | 3300046459 | Bacteria | 10815 |
| 521 | Ga0495629_0699485 | 3300046459 | Bacteria | 673 |
| 522 | Ga0495641_0010879 | 3300046461 | Bacteria | 5230 |
| 523 | Ga0495651_0039274 | 3300046462 | Bacteria | 3686 |
| 524 | Ga0495651_0099650 | 3300046462 | Bacteria | 2166 |
| 525 | Ga0495653_0000923 | 3300046463 | Bacteria | 22739 |
| 526 | Ga0495580_0008876 | 3300046472 | Bacteria | 7954 |
| 527 | Ga0495582_0000739 | 3300046473 | Bacteria | 18050 |
| 528 | Ga0495605_0031514 | 3300046474 | Bacteria | 2708 |
| 529 | Ga0495639_0000335 | 3300046475 | Bacteria | 22677 |
| 530 | Ga0495662_0008807 | 3300046476 | Bacteria | 4962 |
| 531 | Ga0495662_0232035 | 3300046476 | Bacteria | 910 |
| 532 | Ga0495662_0410665 | 3300046476 | Bacteria | 665 |
| 533 | Ga0495664_0054559 | 3300046477 | Bacteria | 2376 |
| 534 | Ga0495664_0301238 | 3300046477 | Bacteria | 968 |
| 535 | Ga0495664_0889492 | 3300046477 | Bacteria | 521 |
| 536 | Ga0495664_0947145 | 3300046477 | Bacteria | 502 |
| 537 | Ga0495584_0610427 | 3300046491 | Bacteria | 556 |
| 538 | Ga0495584_0716314 | 3300046491 | Bacteria | 510 |
| 539 | Ga0495594_0004402 | 3300046499 | Bacteria | 7249 |
| 540 | Ga0495594_0166097 | 3300046499 | Bacteria | 1255 |
| 541 | Ga0495596_0180855 | 3300046500 | Bacteria | 820 |
| 542 | Ga0495607_0231301 | 3300046501 | Bacteria | 899 |
| 543 | Ga0495606_0238331 | 3300046507 | Bacteria | 1016 |
| 544 | Ga0495608_0003276 | 3300046511 | Bacteria | 11569 |
| 545 | Ga0495618_0172687 | 3300046514 | Bacteria | 1375 |
| 546 | Ga0495628_0043887 | 3300046516 | Bacteria | 3559 |
| 547 | Ga0495628_0073081 | 3300046516 | Bacteria | 2672 |
| 548 | Ga0495630_0010570 | 3300046517 | Bacteria | 6669 |
| 549 | Ga0495631_0245681 | 3300046518 | Bacteria | 763 |
| 550 | Ga0495643_0252352 | 3300046522 | Bacteria | 823 |
| 551 | Ga0495644_0099049 | 3300046523 | Bacteria | 1102 |
| 552 | Ga0495648_0006521 | 3300046524 | Bacteria | 9507 |
| 553 | Ga0495648_0030230 | 3300046524 | Bacteria | 3584 |
| 554 | Ga0495666_0264561 | 3300046526 | Bacteria | 782 |
| 555 | Ga0495666_0525020 | 3300046526 | Bacteria | 528 |
| 556 | Ga0495652_0002339 | 3300046529 | Bacteria | 19668 |
| 557 | Ga0495652_0109021 | 3300046529 | Bacteria | 2230 |
| 558 | Ga0495652_0345840 | 3300046529 | Bacteria | 1067 |
| 559 | Ga0495665_0005791 | 3300046531 | Bacteria | 6669 |
| 560 | Ga0495640_0000826 | 3300046533 | Bacteria | 23573 |
| 561 | Ga0495640_0375237 | 3300046533 | Bacteria | 875 |
| 562 | Ga0495586_0220580 | 3300046535 | Bacteria | 1078 |
| 563 | Ga0495587_0032759 | 3300046536 | Bacteria | 3139 |
| 564 | Ga0495598_0258399 | 3300046537 | Bacteria | 647 |
| 565 | Ga0495645_0194641 | 3300046543 | Bacteria | 1379 |
| 566 | Ga0495645_0595835 | 3300046543 | Bacteria | 680 |
| 567 | Ga0495622_0028887 | 3300046557 | Bacteria | 2591 |
| 568 | Ga0495622_0133936 | 3300046557 | Bacteria | 1127 |
| 569 | Ga0495667_0009056 | 3300046559 | Bacteria | 6764 |
| 570 | Ga0495656_0170013 | 3300046615 | Bacteria | 1065 |
| 571 | Ga0495634_0001338 | 3300046642 | Bacteria | 22465 |
| 572 | Ga0495634_0007240 | 3300046642 | Bacteria | 8363 |
| 573 | Ga0495611_0443550 | 3300046648 | Bacteria | 592 |
| 574 | Ga0495625_0615905 | 3300046660 | Bacteria | 650 |
| 575 | Ga0495635_0000187 | 3300046663 | Bacteria | 39002 |
| 576 | Ga0495635_0006608 | 3300046663 | Bacteria | 8094 |
| 577 | Ga0495659_0101276 | 3300046664 | Bacteria | 1116 |
| 578 | Ga0495588_0014639 | 3300046674 | Bacteria | 3759 |
| 579 | Ga0495588_0418607 | 3300046674 | Bacteria | 703 |
| 580 | Ga0495657_0024857 | 3300046675 | Bacteria | 4258 |
| 581 | Ga0495657_0057670 | 3300046675 | Bacteria | 2581 |
| 582 | Ga0495657_0111670 | 3300046675 | Bacteria | 1731 |
| 583 | Ga0495657_0123835 | 3300046675 | Bacteria | 1626 |
| 584 | Ga0495599_0002320 | 3300046678 | Bacteria | 11052 |
| 585 | Ga0495623_0007791 | 3300046679 | Bacteria | 6962 |
| 586 | Ga0495623_0640593 | 3300046679 | Bacteria | 549 |
| 587 | Ga0495646_0021219 | 3300046680 | Bacteria | 4106 |
| 588 | Ga0495647_0002967 | 3300046681 | Bacteria | 5389 |
| 589 | Ga0495658_0000047 | 3300046683 | Bacteria | 59626 |
| 590 | Ga0495669_0030372 | 3300046684 | Bacteria | 2372 |
| 591 | Ga0495613_0001031 | 3300046689 | Bacteria | 21255 |
| 592 | Ga0495613_0014828 | 3300046689 | Bacteria | 5784 |
| 593 | Ga0495613_0535560 | 3300046689 | Bacteria | 785 |
| 594 | Ga0495624_0002051 | 3300046690 | Bacteria | 15345 |
| 595 | Ga0495649_0367371 | 3300046694 | Bacteria | 725 |
| 596 | Ga0495589_0348573 | 3300046794 | Bacteria | 682 |
| 597 | Ga0495600_0013920 | 3300046809 | Bacteria | 5068 |
| 598 | Ga0495600_0086049 | 3300046809 | Bacteria | 2051 |
| 599 | Ga0495600_0170817 | 3300046809 | Bacteria | 1403 |
| 600 | Ga0495581_0000563 | 3300047315 | Bacteria | 19241 |
| 601 | Ga0495604_0010697 | 3300047317 | Bacteria | 7282 |
| 602 | Ga0495674_0001402 | 3300047319 | Bacteria | 23571 |
| 603 | Ga0495674_0046806 | 3300047319 | Bacteria | 3839 |
| 604 | Ga0495674_0994502 | 3300047319 | Bacteria | 643 |
| 605 | Ga0495674_1427849 | 3300047319 | Bacteria | 515 |
| 606 | Ga0495672_0018107 | 3300047320 | Bacteria | 4688 |
| 607 | Ga0495672_0543610 | 3300047320 | Bacteria | 510 |
| 608 | Ga0495676_0245695 | 3300047321 | Bacteria | 1223 |
| 609 | Ga0495680_0030674 | 3300047322 | Bacteria | 4386 |
| 610 | Ga0495680_0080724 | 3300047322 | Bacteria | 2457 |
| 611 | Ga0495680_0593325 | 3300047322 | Bacteria | 742 |
| 612 | Ga0495680_0717500 | 3300047322 | Unclassified | 659 |
| 613 | Ga0495680_0953237 | 3300047322 | Bacteria | 551 |
| 614 | Ga0495683_0319158 | 3300047323 | Bacteria | 663 |
| 615 | Ga0495675_0005669 | 3300047444 | Bacteria | 7628 |
| 616 | Ga0495675_0493852 | 3300047444 | Bacteria | 704 |
| 617 | Ga0495684_0001482 | 3300047471 | Bacteria | 18783 |
| 618 | Ga0495684_0008519 | 3300047471 | Bacteria | 7942 |
| 619 | Ga0495686_0095836 | 3300047472 | Bacteria | 1797 |
| 620 | Ga0495686_0168919 | 3300047472 | Bacteria | 1273 |
| 621 | Ga0495593_0000723 | 3300047673 | Bacteria | 19146 |
| 622 | Ga0495593_0006359 | 3300047673 | Bacteria | 6928 |
| 623 | Ga0495602_0043621 | 3300048088 | Bacteria | 4075 |
| 624 | Ga0495614_0270017 | 3300048089 | Bacteria | 781 |
| 625 | Ga0496100_0796674 | 3300048903 | Bacteria | 740 |
| 626 | Ga0496102_0032393 | 3300048905 | Bacteria | 4695 |
| 627 | Ga0496102_0292270 | 3300048905 | Bacteria | 1536 |
| 628 | Ga0496102_0598873 | 3300048905 | Bacteria | 1025 |
| 629 | Ga0496102_1001474 | 3300048905 | Bacteria | 756 |
| 630 | Ga0496102_1138956 | 3300048905 | Bacteria | 700 |
| 631 | Ga0496104_0010232 | 3300048907 | Bacteria | 8375 |
| 632 | Ga0496104_0385388 | 3300048907 | Bacteria | 1314 |
| 633 | Ga0496104_0483799 | 3300048907 | Bacteria | 1149 |
| 634 | Ga0496105_1196982 | 3300048908 | Bacteria | 559 |
| 635 | Ga0496106_0000540 | 3300048909 | Bacteria | 26830 |
| 636 | Ga0496106_0348444 | 3300048909 | Bacteria | 1190 |
| 637 | Ga0496106_0514071 | 3300048909 | Bacteria | 962 |
| 638 | Ga0496106_0841907 | 3300048909 | Bacteria | 726 |
| 639 | Ga0496106_0894556 | 3300048909 | Bacteria | 701 |
| 640 | Ga0496107_0456423 | 3300048910 | Bacteria | 949 |
| 641 | Ga0496108_0245050 | 3300048911 | Bacteria | 1559 |
| 642 | Ga0496108_0354000 | 3300048911 | Bacteria | 1281 |
| 643 | Ga0496109_0551964 | 3300048912 | Bacteria | 1087 |
| 644 | Ga0496110_0013566 | 3300048913 | Bacteria | 6743 |
| 645 | Ga0496111_0071275 | 3300048914 | Bacteria | 2529 |
| 646 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 647 | Ga0496112_0484197 | 3300048915 | Bacteria | 1173 |
| 648 | Ga0496112_0584444 | 3300048915 | Bacteria | 1049 |
| 649 | Ga0496113_0163739 | 3300048916 | Bacteria | 1759 |
| 650 | Ga0496113_0246939 | 3300048916 | Bacteria | 1424 |
| 651 | Ga0496114_0234191 | 3300048917 | Bacteria | 1614 |
| 652 | Ga0496114_0916999 | 3300048917 | Bacteria | 758 |
| 653 | Ga0496115_0234694 | 3300048918 | Bacteria | 1512 |
| 654 | Ga0496115_0276440 | 3300048918 | Bacteria | 1379 |
| 655 | Ga0496115_0370766 | 3300048918 | Bacteria | 1165 |
| 656 | Ga0496115_0526797 | 3300048918 | Bacteria | 947 |
| 657 | Ga0496116_0369747 | 3300048919 | Bacteria | 648 |
| 658 | Ga0496116_0483301 | 3300048919 | Bacteria | 520 |
| 659 | Ga0496117_0037191 | 3300048920 | Bacteria | 3630 |
| 660 | Ga0496118_0006481 | 3300048921 | Bacteria | 12851 |
| 661 | Ga0496118_0022090 | 3300048921 | Bacteria | 5576 |
| 662 | Ga0496118_0052105 | 3300048921 | Bacteria | 3125 |
| 663 | Ga0496118_0453900 | 3300048921 | Bacteria | 650 |
| 664 | Ga0496119_0139502 | 3300048922 | Bacteria | 1311 |
| 665 | Ga0496119_0157482 | 3300048922 | Bacteria | 1211 |
| 666 | Ga0496119_0218062 | 3300048922 | Bacteria | 978 |
| 667 | Ga0496119_0226198 | 3300048922 | Bacteria | 955 |
| 668 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 669 | Ga0496121_0002176 | 3300048924 | Bacteria | 30692 |
| 670 | Ga0496121_0005356 | 3300048924 | Bacteria | 16491 |
| 671 | Ga0496121_0027220 | 3300048924 | Bacteria | 5356 |
| 672 | Ga0496121_0062407 | 3300048924 | Bacteria | 3052 |
| 673 | Ga0496121_0106637 | 3300048924 | Bacteria | 2148 |
| 674 | Ga0496121_0206017 | 3300048924 | Bacteria | 1397 |
| 675 | Ga0496121_0226379 | 3300048924 | Bacteria | 1313 |
| 676 | Ga0496121_0276535 | 3300048924 | Bacteria | 1151 |
| 677 | Ga0496121_0668145 | 3300048924 | Bacteria | 630 |
| 678 | Ga0496122_0038748 | 3300048925 | Bacteria | 3811 |
| 679 | Ga0496122_0331913 | 3300048925 | Bacteria | 803 |
| 680 | Ga0496122_0343466 | 3300048925 | Bacteria | 783 |
| 681 | Ga0496122_0605092 | 3300048925 | Bacteria | 512 |
| 682 | Ga0496123_0101339 | 3300048926 | Bacteria | 1674 |
| 683 | Ga0496123_0300052 | 3300048926 | Bacteria | 767 |
| 684 | Ga0496124_0001010 | 3300048927 | Bacteria | 44569 |
| 685 | Ga0496124_0141277 | 3300048927 | Bacteria | 1900 |
| 686 | Ga0496124_0299355 | 3300048927 | Bacteria | 1163 |
| 687 | Ga0496125_0000272 | 3300048928 | Bacteria | 105490 |
| 688 | Ga0496125_0006804 | 3300048928 | Bacteria | 12277 |
| 689 | Ga0496125_0026319 | 3300048928 | Bacteria | 5305 |
| 690 | Ga0496125_0440152 | 3300048928 | Bacteria | 750 |
| 691 | Ga0496125_0522979 | 3300048928 | Bacteria | 663 |
| 692 | Ga0496126_0002820 | 3300048929 | Bacteria | 22789 |
| 693 | Ga0496126_0010869 | 3300048929 | Bacteria | 9486 |
| 694 | Ga0496126_0017190 | 3300048929 | Bacteria | 7213 |
| 695 | Ga0496126_0022319 | 3300048929 | Bacteria | 6161 |
| 696 | Ga0496126_0037772 | 3300048929 | Bacteria | 4502 |
| 697 | Ga0496126_0051196 | 3300048929 | Bacteria | 3760 |
| 698 | Ga0496126_0085595 | 3300048929 | Bacteria | 2779 |
| 699 | Ga0496126_0130347 | 3300048929 | Bacteria | 2173 |
| 700 | Ga0496126_0132118 | 3300048929 | Bacteria | 2156 |
| 701 | Ga0496126_0162002 | 3300048929 | Bacteria | 1911 |
| 702 | Ga0496126_0322251 | 3300048929 | Bacteria | 1270 |
| 703 | Ga0496126_0529996 | 3300048929 | Bacteria | 937 |
| 704 | Ga0496126_0763561 | 3300048929 | Bacteria | 745 |
| 705 | Ga0496126_0855724 | 3300048929 | Bacteria | 693 |
| 706 | Ga0496126_0876333 | 3300048929 | Bacteria | 683 |
| 707 | Ga0501031_0225489 | 3300049568 | Bacteria | 1220 |
| 708 | Ga0501031_0764065 | 3300049568 | Bacteria | 620 |
| 709 | Ga0501032_0029893 | 3300049569 | Bacteria | 3737 |
| 710 | Ga0501033_0013873 | 3300049570 | Bacteria | 6131 |
| 711 | Ga0501033_0701666 | 3300049570 | Bacteria | 688 |
| 712 | Ga0501034_0184180 | 3300049571 | Bacteria | 2052 |
| 713 | Ga0501034_0447118 | 3300049571 | Bacteria | 1210 |
| 714 | Ga0501036_0066886 | 3300049572 | Bacteria | 3041 |
| 715 | Ga0501036_0506913 | 3300049572 | Bacteria | 1004 |
| 716 | Ga0501037_0008746 | 3300049573 | Bacteria | 7421 |
| 717 | Ga0501037_0318506 | 3300049573 | Bacteria | 1077 |
| 718 | Ga0501037_0334073 | 3300049573 | Bacteria | 1047 |
| 719 | Ga0501038_0140923 | 3300049574 | Bacteria | 1972 |
| 720 | Ga0501038_1007107 | 3300049574 | Unclassified | 611 |
| 721 | Ga0501039_0101591 | 3300049575 | Bacteria | 2244 |
| 722 | Ga0501042_0291495 | 3300049578 | Bacteria | 1179 |
| 723 | Ga0501043_0070101 | 3300049579 | Bacteria | 2753 |
| 724 | Ga0501043_1205816 | 3300049579 | Bacteria | 531 |
| 725 | Ga0501046_0099277 | 3300049580 | Bacteria | 2235 |
| 726 | Ga0501046_0304009 | 3300049580 | Bacteria | 1164 |
| 727 | Ga0501047_0055504 | 3300049581 | Bacteria | 3830 |
| 728 | Ga0501048_0081995 | 3300049582 | Bacteria | 2275 |
| 729 | Ga0501067_0061344 | 3300049583 | Bacteria | 2082 |
| 730 | Ga0501067_0476014 | 3300049583 | Bacteria | 698 |
| 731 | Ga0501067_0739114 | 3300049583 | Bacteria | 554 |
| 732 | Ga0501068_0125629 | 3300049584 | Bacteria | 1602 |
| 733 | Ga0501069_0167758 | 3300049585 | Bacteria | 1266 |
| 734 | Ga0501070_0076502 | 3300049586 | Bacteria | 2771 |
| 735 | Ga0501071_0108660 | 3300049587 | Bacteria | 2049 |
| 736 | Ga0501072_0689879 | 3300049588 | Bacteria | 803 |
| 737 | Ga0501072_0812623 | 3300049588 | Bacteria | 732 |
| 738 | Ga0501072_0840148 | 3300049588 | Bacteria | 718 |
| 739 | Ga0501073_0342449 | 3300049589 | Bacteria | 1032 |
| 740 | Ga0501074_0114738 | 3300049590 | Bacteria | 1927 |
| 741 | Ga0501079_0499874 | 3300049741 | Bacteria | 956 |
| 742 | Ga0501080_0084317 | 3300049742 | Bacteria | 2952 |
| 743 | Ga0501035_0079019 | 3300049822 | Bacteria | 2906 |
| 744 | Ga0501035_0091301 | 3300049822 | Bacteria | 2680 |
| 745 | Ga0501035_0316247 | 3300049822 | Bacteria | 1313 |
| 746 | Ga0501044_0110279 | 3300049823 | Bacteria | 2760 |
| 747 | Ga0501044_0211670 | 3300049823 | Bacteria | 1892 |
| 748 | Ga0501044_1584184 | 3300049823 | Bacteria | 520 |
| 749 | Ga0501045_0333804 | 3300049824 | Bacteria | 1128 |
| 750 | nmdc:mga03683_440359_c1 | 3300050489 | Bacteria | 626 |
| 751 | nmdc:mga03n38_107010_c1 | 3300050490 | Bacteria | 1357 |
| 752 | nmdc:mga00v17_295619_c1 | 3300050491 | Bacteria | 1052 |
| 753 | nmdc:mga00v17_473662_c1 | 3300050491 | Bacteria | 812 |
| 754 | nmdc:mga0yw44_1188402_c1 | 3300050492 | Bacteria | 515 |
| 755 | nmdc:mga0k408_894330_c1 | 3300050493 | Bacteria | 515 |
| 756 | nmdc:mga06z11_15312_c1 | 3300050494 | Bacteria | 3420 |
| 757 | nmdc:mga07m45_548575_c1 | 3300050496 | Bacteria | 668 |
| 758 | nmdc:mga07m45_98117_c1 | 3300050496 | Bacteria | 1682 |
| 759 | nmdc:mga08y16_671424_c1 | 3300050511 | Bacteria | 1038 |
| 760 | nmdc:mga0n895_405781_c1 | 3300050512 | Bacteria | 1378 |
| 761 | nmdc:mga0n895_606732_c1 | 3300050512 | Bacteria | 1096 |
| 762 | Ga0500635_0020115 | 3300053080 | Bacteria | 2040 |
| 763 | Ga0500635_0097419 | 3300053080 | Bacteria | 1078 |
| 764 | Ga0495655_0339768 | 3300053083 | Bacteria | 523 |
| 765 | Ga0495595_0005251 | 3300053084 | Bacteria | 5231 |
| 766 | Ga0495619_0002231 | 3300053085 | Bacteria | 12815 |
| 767 | Ga0495619_0035165 | 3300053085 | Bacteria | 3259 |
| 768 | Ga0500647_0069387 | 3300053091 | Bacteria | 1695 |
| 769 | Ga0500647_0189726 | 3300053091 | Bacteria | 938 |
| 770 | Ga0500651_0257544 | 3300053093 | Bacteria | 1012 |
| 771 | Ga0500651_0313457 | 3300053093 | Bacteria | 897 |
| 772 | Ga0500566_0000938 | 3300053094 | Bacteria | 16701 |
| 773 | Ga0500566_0001308 | 3300053094 | Bacteria | 14522 |
| 774 | Ga0500566_0134949 | 3300053094 | Bacteria | 1316 |
| 775 | Ga0500640_003151 | 3300053095 | Bacteria | 5670 |
| 776 | Ga0500650_0166768 | 3300053098 | Bacteria | 1014 |
| 777 | Ga0500554_043366 | 3300053102 | Bacteria | 1389 |
| 778 | Ga0500554_051279 | 3300053102 | Bacteria | 1299 |
| 779 | Ga0500558_199236 | 3300053106 | Bacteria | 699 |
| 780 | Ga0500572_000217 | 3300053111 | Bacteria | 20413 |
| 781 | Ga0500592_037622 | 3300053116 | Bacteria | 782 |
| 782 | Ga0500595_000324 | 3300053119 | Bacteria | 31413 |
| 783 | Ga0500595_002617 | 3300053119 | Bacteria | 8763 |
| 784 | Ga0500595_006868 | 3300053119 | Bacteria | 4785 |
| 785 | Ga0500595_025854 | 3300053119 | Bacteria | 2029 |
| 786 | Ga0500595_042239 | 3300053119 | Bacteria | 1460 |
| 787 | Ga0500597_397152 | 3300053120 | Bacteria | 525 |
| 788 | Ga0500608_051766 | 3300053122 | Bacteria | 1972 |
| 789 | Ga0500614_005804 | 3300053123 | Bacteria | 2593 |
| 790 | Ga0500652_065775 | 3300053131 | Bacteria | 1497 |
| 791 | Ga0500559_0001486 | 3300053136 | Bacteria | 13223 |
| 792 | Ga0500559_0018761 | 3300053136 | Bacteria | 2921 |
| 793 | Ga0500559_0287895 | 3300053136 | Bacteria | 772 |
| 794 | Ga0500559_0315713 | 3300053136 | Bacteria | 733 |
| 795 | Ga0500568_0056098 | 3300053139 | Bacteria | 1536 |
| 796 | Ga0500573_0015719 | 3300053140 | Bacteria | 4293 |
| 797 | Ga0500590_195182 | 3300053148 | Bacteria | 863 |
| 798 | Ga0500603_000507 | 3300053150 | Bacteria | 9880 |
| 799 | Ga0500603_011705 | 3300053150 | Bacteria | 2003 |
| 800 | Ga0500603_058945 | 3300053150 | Bacteria | 1069 |
| 801 | Ga0500603_179537 | 3300053150 | Bacteria | 665 |
| 802 | Ga0500619_312113 | 3300053154 | Bacteria | 505 |
| 803 | Ga0500627_0118630 | 3300053158 | Bacteria | 1192 |
| 804 | Ga0500630_000537 | 3300053159 | Bacteria | 17060 |
| 805 | Ga0500638_000078 | 3300053162 | Bacteria | 17252 |
| 806 | Ga0500638_002399 | 3300053162 | Bacteria | 6506 |
| 807 | Ga0500638_061923 | 3300053162 | Bacteria | 1797 |
| 808 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 809 | Ga0500639_115377 | 3300053163 | Bacteria | 1299 |
| 810 | Ga0500636_0008443 | 3300053177 | Bacteria | 5973 |
| 811 | Ga0500636_0019204 | 3300053177 | Bacteria | 4044 |
| 812 | Ga0500636_0066084 | 3300053177 | Bacteria | 2103 |
| 813 | Ga0500636_0162190 | 3300053177 | Bacteria | 1217 |
| 814 | Ga0500636_0186634 | 3300053177 | Bacteria | 1108 |
| 815 | Ga0500637_0000088 | 3300053178 | Bacteria | 33146 |
| 816 | Ga0500637_0030575 | 3300053178 | Bacteria | 2997 |
| 817 | Ga0500637_0117642 | 3300053178 | Bacteria | 1542 |
| 818 | Ga0500637_0289334 | 3300053178 | Bacteria | 898 |
| 819 | Ga0500570_143918 | 3300053724 | Bacteria | 868 |
| 820 | Ga0500576_095614 | 3300053725 | Bacteria | 1224 |
| 821 | Ga0500657_129993 | 3300053728 | Bacteria | 979 |
| 822 | Ga0500645_083395 | 3300053730 | Bacteria | 911 |
| 823 | Ga0500596_000054 | 3300053735 | Bacteria | 15502 |
| 824 | Ga0500596_033617 | 3300053735 | Bacteria | 801 |
| 825 | Ga0500601_005425 | 3300053737 | Bacteria | 1395 |
| 826 | Ga0500661_000867 | 3300055283 | Bacteria | 5651 |
| 827 | Ga0500661_017471 | 3300055283 | Bacteria | 1282 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025906 | Ga0207699_11067732 | Ga0207699_110677322 | 48 |
| 2 | 3300048910 | Ga0496107_0456423 | Ga0496107_0456423_704_850 | 48 |
| 3 | 3300048924 | Ga0496121_0002176 | Ga0496121_0002176_30347_30493 | 48 |
| 4 | 3300048929 | Ga0496126_0051196 | Ga0496126_0051196_3534_3680 | 48 |
| 5 | 3300049568 | Ga0501031_0225489 | Ga0501031_0225489_962_1108 | 48 |
| 6 | 3300049569 | Ga0501032_0029893 | Ga0501032_0029893_2736_2882 | 48 |
| 7 | 3300049570 | Ga0501033_0013873 | Ga0501033_0013873_4272_4418 | 48 |
| 8 | 3300049570 | Ga0501033_0701666 | Ga0501033_0701666_16_162 | 48 |
| 9 | 3300049571 | Ga0501034_0184180 | Ga0501034_0184180_1896_2042 | 48 |
| 10 | 3300049571 | Ga0501034_0447118 | Ga0501034_0447118_541_687 | 48 |
| 11 | 3300049572 | Ga0501036_0066886 | Ga0501036_0066886_395_541 | 48 |
| 12 | 3300049573 | Ga0501037_0008746 | Ga0501037_0008746_5415_5561 | 48 |
| 13 | 3300049573 | Ga0501037_0334073 | Ga0501037_0334073_658_804 | 48 |
| 14 | 3300049574 | Ga0501038_0140923 | Ga0501038_0140923_622_768 | 48 |
| 15 | 3300049574 | Ga0501038_1007107 | Ga0501038_1007107_184_330 | 48 |
| 16 | 3300049575 | Ga0501039_0101591 | Ga0501039_0101591_414_560 | 48 |
| 17 | 3300049578 | Ga0501042_0291495 | Ga0501042_0291495_320_466 | 48 |
| 18 | 3300049579 | Ga0501043_0070101 | Ga0501043_0070101_1034_1180 | 48 |
| 19 | 3300049580 | Ga0501046_0099277 | Ga0501046_0099277_1833_1979 | 48 |
| 20 | 3300049580 | Ga0501046_0304009 | Ga0501046_0304009_32_178 | 48 |
| 21 | 3300049581 | Ga0501047_0055504 | Ga0501047_0055504_1285_1431 | 48 |
| 22 | 3300049582 | Ga0501048_0081995 | Ga0501048_0081995_80_226 | 48 |
| 23 | 3300049583 | Ga0501067_0476014 | Ga0501067_0476014_196_342 | 48 |
| 24 | 3300049584 | Ga0501068_0125629 | Ga0501068_0125629_967_1113 | 48 |
| 25 | 3300049585 | Ga0501069_0167758 | Ga0501069_0167758_326_472 | 48 |
| 26 | 3300049586 | Ga0501070_0076502 | Ga0501070_0076502_2033_2179 | 48 |
| 27 | 3300049587 | Ga0501071_0108660 | Ga0501071_0108660_1788_1934 | 48 |
| 28 | 3300049588 | Ga0501072_0689879 | Ga0501072_0689879_204_350 | 48 |
| 29 | 3300049589 | Ga0501073_0342449 | Ga0501073_0342449_90_236 | 48 |
| 30 | 3300049590 | Ga0501074_0114738 | Ga0501074_0114738_938_1084 | 48 |
| 31 | 3300049741 | Ga0501079_0499874 | Ga0501079_0499874_44_190 | 48 |
| 32 | 3300049742 | Ga0501080_0084317 | Ga0501080_0084317_1102_1248 | 48 |
| 33 | 3300049822 | Ga0501035_0079019 | Ga0501035_0079019_861_1007 | 48 |
| 34 | 3300049822 | Ga0501035_0091301 | Ga0501035_0091301_1134_1280 | 48 |
| 35 | 3300049823 | Ga0501044_0110279 | Ga0501044_0110279_2250_2396 | 48 |
| 36 | 3300049823 | Ga0501044_0211670 | Ga0501044_0211670_1714_1860 | 48 |
| 37 | 3300049824 | Ga0501045_0333804 | Ga0501045_0333804_329_475 | 48 |
| 38 | 3300005327 | Ga0070658_10930751 | Ga0070658_109307511 | 49 |
| 39 | 3300005355 | Ga0070671_100554398 | Ga0070671_1005543982 | 49 |
| 40 | 3300005367 | Ga0070667_100035592 | Ga0070667_1000355924 | 49 |
| 41 | 3300005435 | Ga0070714_100056261 | Ga0070714_1000562613 | 49 |
| 42 | 3300005436 | Ga0070713_100144116 | Ga0070713_1001441164 | 49 |
| 43 | 3300005844 | Ga0068862_100194967 | Ga0068862_1001949672 | 49 |
| 44 | 3300009101 | Ga0105247_10240343 | Ga0105247_102403432 | 49 |
| 45 | 3300025916 | Ga0207663_10795145 | Ga0207663_107951452 | 49 |
| 46 | 3300025928 | Ga0207700_10322022 | Ga0207700_103220222 | 49 |
| 47 | 3300025929 | Ga0207664_10037970 | Ga0207664_100379703 | 49 |
| 48 | 3300025931 | Ga0207644_10619743 | Ga0207644_106197432 | 49 |
| 49 | 3300025986 | Ga0207658_10571410 | Ga0207658_105714102 | 49 |
| 50 | 3300033442 | Ga0315911_1000001 | Ga0315911_100000187 | 49 |
| 51 | 3300047320 | Ga0495672_0018107 | Ga0495672_0018107_437_586 | 49 |
| 52 | 3300048924 | Ga0496121_0276535 | Ga0496121_0276535_401_550 | 49 |
| 53 | 3300048924 | Ga0496121_0668145 | Ga0496121_0668145_367_516 | 49 |
| 54 | 3300001979 | JGI24740J21852_10081189 | JGI24740J21852_100811892 | 50 |
| 55 | 3300001989 | JGI24739J22299_10000711 | JGI24739J22299_1000071116 | 50 |
| 56 | 3300001990 | JGI24737J22298_10000671 | JGI24737J22298_1000067114 | 50 |
| 57 | 3300002067 | JGI24735J21928_10011428 | JGI24735J21928_100114285 | 50 |
| 58 | 3300002070 | JGI24750J21931_1086753 | JGI24750J21931_10867531 | 50 |
| 59 | 3300002244 | JGI24742J22300_10007644 | JGI24742J22300_100076441 | 50 |
| 60 | 3300003215 | JGI25153J46596_10039621 | JGI25153J46596_100396212 | 50 |
| 61 | 3300003215 | JGI25153J46596_10105380 | JGI25153J46596_101053802 | 50 |
| 62 | 3300003320 | rootH2_10243292 | rootH2_102432922 | 50 |
| 63 | 3300003659 | JGI25404J52841_10043842 | JGI25404J52841_100438423 | 50 |
| 64 | 3300003659 | JGI25404J52841_10050250 | JGI25404J52841_100502503 | 50 |
| 65 | 3300003752 | Ga0055539_1019512 | Ga0055539_10195122 | 50 |
| 66 | 3300003771 | Ga0055526_1021911 | Ga0055526_10219115 | 50 |
| 67 | 3300005327 | Ga0070658_10033314 | Ga0070658_100333145 | 50 |
| 68 | 3300005327 | Ga0070658_10055755 | Ga0070658_100557554 | 50 |
| 69 | 3300005327 | Ga0070658_10147211 | Ga0070658_101472113 | 50 |
| 70 | 3300005327 | Ga0070658_10186997 | Ga0070658_101869973 | 50 |
| 71 | 3300005327 | Ga0070658_11931186 | Ga0070658_119311861 | 50 |
| 72 | 3300005328 | Ga0070676_10226832 | Ga0070676_102268323 | 50 |
| 73 | 3300005329 | Ga0070683_100127791 | Ga0070683_1001277912 | 50 |
| 74 | 3300005334 | Ga0068869_100192169 | Ga0068869_1001921692 | 50 |
| 75 | 3300005335 | Ga0070666_10861941 | Ga0070666_108619411 | 50 |
| 76 | 3300005336 | Ga0070680_100019388 | Ga0070680_1000193883 | 50 |
| 77 | 3300005336 | Ga0070680_100182285 | Ga0070680_1001822853 | 50 |
| 78 | 3300005336 | Ga0070680_101020236 | Ga0070680_1010202362 | 50 |
| 79 | 3300005338 | Ga0068868_100270054 | Ga0068868_1002700542 | 50 |
| 80 | 3300005339 | Ga0070660_100017380 | Ga0070660_1000173806 | 50 |
| 81 | 3300005339 | Ga0070660_100536723 | Ga0070660_1005367232 | 50 |
| 82 | 3300005339 | Ga0070660_100958988 | Ga0070660_1009589882 | 50 |
| 83 | 3300005343 | Ga0070687_101335039 | Ga0070687_1013350392 | 50 |
| 84 | 3300005344 | Ga0070661_100477578 | Ga0070661_1004775782 | 50 |
| 85 | 3300005344 | Ga0070661_100583923 | Ga0070661_1005839232 | 50 |
| 86 | 3300005344 | Ga0070661_101601202 | Ga0070661_1016012022 | 50 |
| 87 | 3300005345 | Ga0070692_10665210 | Ga0070692_106652102 | 50 |
| 88 | 3300005347 | Ga0070668_100059516 | Ga0070668_1000595162 | 50 |
| 89 | 3300005347 | Ga0070668_100272754 | Ga0070668_1002727543 | 50 |
| 90 | 3300005347 | Ga0070668_100514643 | Ga0070668_1005146432 | 50 |
| 91 | 3300005353 | Ga0070669_100598439 | Ga0070669_1005984393 | 50 |
| 92 | 3300005353 | Ga0070669_101343276 | Ga0070669_1013432762 | 50 |
| 93 | 3300005356 | Ga0070674_100116307 | Ga0070674_1001163073 | 50 |
| 94 | 3300005356 | Ga0070674_100153161 | Ga0070674_1001531613 | 50 |
| 95 | 3300005364 | Ga0070673_101368516 | Ga0070673_1013685162 | 50 |
| 96 | 3300005365 | Ga0070688_100075427 | Ga0070688_1000754273 | 50 |
| 97 | 3300005366 | Ga0070659_100182108 | Ga0070659_1001821082 | 50 |
| 98 | 3300005367 | Ga0070667_100656102 | Ga0070667_1006561023 | 50 |
| 99 | 3300005367 | Ga0070667_101841181 | Ga0070667_1018411812 | 50 |
| 100 | 3300005434 | Ga0070709_10013858 | Ga0070709_100138588 | 50 |
| 101 | 3300005435 | Ga0070714_100172047 | Ga0070714_1001720472 | 50 |
| 102 | 3300005435 | Ga0070714_100181179 | Ga0070714_1001811792 | 50 |
| 103 | 3300005435 | Ga0070714_101028318 | Ga0070714_1010283182 | 50 |
| 104 | 3300005436 | Ga0070713_100003948 | Ga0070713_10000394814 | 50 |
| 105 | 3300005436 | Ga0070713_100039476 | Ga0070713_1000394762 | 50 |
| 106 | 3300005436 | Ga0070713_100961658 | Ga0070713_1009616581 | 50 |
| 107 | 3300005436 | Ga0070713_101636543 | Ga0070713_1016365432 | 50 |
| 108 | 3300005437 | Ga0070710_10262506 | Ga0070710_102625062 | 50 |
| 109 | 3300005437 | Ga0070710_10964758 | Ga0070710_109647582 | 50 |
| 110 | 3300005438 | Ga0070701_10072143 | Ga0070701_100721433 | 50 |
| 111 | 3300005439 | Ga0070711_100094825 | Ga0070711_1000948252 | 50 |
| 112 | 3300005440 | Ga0070705_101883062 | Ga0070705_1018830622 | 50 |
| 113 | 3300005441 | Ga0070700_100038740 | Ga0070700_1000387403 | 50 |
| 114 | 3300005445 | Ga0070708_100916202 | Ga0070708_1009162021 | 50 |
| 115 | 3300005455 | Ga0070663_100158555 | Ga0070663_1001585552 | 50 |
| 116 | 3300005455 | Ga0070663_100158845 | Ga0070663_1001588453 | 50 |
| 117 | 3300005456 | Ga0070678_100241507 | Ga0070678_1002415071 | 50 |
| 118 | 3300005456 | Ga0070678_101544770 | Ga0070678_1015447702 | 50 |
| 119 | 3300005457 | Ga0070662_100215552 | Ga0070662_1002155523 | 50 |
| 120 | 3300005457 | Ga0070662_100474818 | Ga0070662_1004748182 | 50 |
| 121 | 3300005458 | Ga0070681_10221437 | Ga0070681_102214372 | 50 |
| 122 | 3300005458 | Ga0070681_10340182 | Ga0070681_103401823 | 50 |
| 123 | 3300005459 | Ga0068867_100032263 | Ga0068867_1000322633 | 50 |
| 124 | 3300005459 | Ga0068867_101102885 | Ga0068867_1011028851 | 50 |
| 125 | 3300005459 | Ga0068867_101551831 | Ga0068867_1015518312 | 50 |
| 126 | 3300005467 | Ga0070706_100820102 | Ga0070706_1008201022 | 50 |
| 127 | 3300005468 | Ga0070707_100545466 | Ga0070707_1005454662 | 50 |
| 128 | 3300005530 | Ga0070679_100214947 | Ga0070679_1002149473 | 50 |
| 129 | 3300005530 | Ga0070679_100348953 | Ga0070679_1003489532 | 50 |
| 130 | 3300005530 | Ga0070679_100417674 | Ga0070679_1004176743 | 50 |
| 131 | 3300005530 | Ga0070679_101421379 | Ga0070679_1014213792 | 50 |
| 132 | 3300005535 | Ga0070684_100004374 | Ga0070684_1000043745 | 50 |
| 133 | 3300005536 | Ga0070697_100049851 | Ga0070697_1000498514 | 50 |
| 134 | 3300005536 | Ga0070697_100557988 | Ga0070697_1005579882 | 50 |
| 135 | 3300005539 | Ga0068853_100015197 | Ga0068853_1000151977 | 50 |
| 136 | 3300005539 | Ga0068853_100020983 | Ga0068853_1000209836 | 50 |
| 137 | 3300005539 | Ga0068853_100087112 | Ga0068853_1000871122 | 50 |
| 138 | 3300005539 | Ga0068853_100246247 | Ga0068853_1002462473 | 50 |
| 139 | 3300005539 | Ga0068853_100617193 | Ga0068853_1006171932 | 50 |
| 140 | 3300005543 | Ga0070672_100110347 | Ga0070672_1001103472 | 50 |
| 141 | 3300005543 | Ga0070672_100214550 | Ga0070672_1002145502 | 50 |
| 142 | 3300005544 | Ga0070686_100100328 | Ga0070686_1001003283 | 50 |
| 143 | 3300005545 | Ga0070695_100615170 | Ga0070695_1006151702 | 50 |
| 144 | 3300005546 | Ga0070696_101233525 | Ga0070696_1012335252 | 50 |
| 145 | 3300005548 | Ga0070665_100196951 | Ga0070665_1001969512 | 50 |
| 146 | 3300005548 | Ga0070665_102670157 | Ga0070665_1026701572 | 50 |
| 147 | 3300005549 | Ga0070704_100800681 | Ga0070704_1008006812 | 50 |
| 148 | 3300005563 | Ga0068855_100010315 | Ga0068855_10001031511 | 50 |
| 149 | 3300005563 | Ga0068855_100031543 | Ga0068855_1000315434 | 50 |
| 150 | 3300005563 | Ga0068855_100070306 | Ga0068855_1000703066 | 50 |
| 151 | 3300005563 | Ga0068855_100275945 | Ga0068855_1002759452 | 50 |
| 152 | 3300005563 | Ga0068855_100759385 | Ga0068855_1007593852 | 50 |
| 153 | 3300005563 | Ga0068855_101702135 | Ga0068855_1017021352 | 50 |
| 154 | 3300005564 | Ga0070664_101426098 | Ga0070664_1014260983 | 50 |
| 155 | 3300005577 | Ga0068857_100003351 | Ga0068857_1000033519 | 50 |
| 156 | 3300005577 | Ga0068857_100114201 | Ga0068857_1001142015 | 50 |
| 157 | 3300005577 | Ga0068857_100129080 | Ga0068857_1001290802 | 50 |
| 158 | 3300005578 | Ga0068854_100004647 | Ga0068854_1000046471 | 50 |
| 159 | 3300005578 | Ga0068854_100010537 | Ga0068854_1000105373 | 50 |
| 160 | 3300005578 | Ga0068854_100975830 | Ga0068854_1009758302 | 50 |
| 161 | 3300005578 | Ga0068854_101985224 | Ga0068854_1019852242 | 50 |
| 162 | 3300005614 | Ga0068856_100009171 | Ga0068856_10000917112 | 50 |
| 163 | 3300005614 | Ga0068856_100330866 | Ga0068856_1003308663 | 50 |
| 164 | 3300005614 | Ga0068856_100610703 | Ga0068856_1006107032 | 50 |
| 165 | 3300005614 | Ga0068856_101083935 | Ga0068856_1010839352 | 50 |
| 166 | 3300005615 | Ga0070702_100120700 | Ga0070702_1001207003 | 50 |
| 167 | 3300005615 | Ga0070702_101439731 | Ga0070702_1014397312 | 50 |
| 168 | 3300005616 | Ga0068852_100077939 | Ga0068852_1000779392 | 50 |
| 169 | 3300005616 | Ga0068852_100084688 | Ga0068852_1000846882 | 50 |
| 170 | 3300005616 | Ga0068852_100159336 | Ga0068852_1001593362 | 50 |
| 171 | 3300005616 | Ga0068852_100355585 | Ga0068852_1003555852 | 50 |
| 172 | 3300005616 | Ga0068852_100406165 | Ga0068852_1004061653 | 50 |
| 173 | 3300005718 | Ga0068866_10128540 | Ga0068866_101285402 | 50 |
| 174 | 3300005719 | Ga0068861_100016364 | Ga0068861_1000163644 | 50 |
| 175 | 3300005719 | Ga0068861_100193846 | Ga0068861_1001938463 | 50 |
| 176 | 3300005834 | Ga0068851_10026729 | Ga0068851_100267294 | 50 |
| 177 | 3300005834 | Ga0068851_10042900 | Ga0068851_100429002 | 50 |
| 178 | 3300005841 | Ga0068863_100153114 | Ga0068863_1001531142 | 50 |
| 179 | 3300005842 | Ga0068858_100221497 | Ga0068858_1002214975 | 50 |
| 180 | 3300005842 | Ga0068858_100629407 | Ga0068858_1006294072 | 50 |
| 181 | 3300005843 | Ga0068860_100779965 | Ga0068860_1007799652 | 50 |
| 182 | 3300005843 | Ga0068860_102627596 | Ga0068860_1026275961 | 50 |
| 183 | 3300005844 | Ga0068862_100252914 | Ga0068862_1002529143 | 50 |
| 184 | 3300005844 | Ga0068862_100766773 | Ga0068862_1007667733 | 50 |
| 185 | 3300005937 | Ga0081455_10002419 | Ga0081455_100024195 | 50 |
| 186 | 3300005937 | Ga0081455_10003658 | Ga0081455_100036582 | 50 |
| 187 | 3300005937 | Ga0081455_10125266 | Ga0081455_101252663 | 50 |
| 188 | 3300005983 | Ga0081540_1002804 | Ga0081540_100280410 | 50 |
| 189 | 3300005983 | Ga0081540_1004519 | Ga0081540_10045193 | 50 |
| 190 | 3300005983 | Ga0081540_1048457 | Ga0081540_10484573 | 50 |
| 191 | 3300005983 | Ga0081540_1074125 | Ga0081540_10741253 | 50 |
| 192 | 3300005983 | Ga0081540_1206006 | Ga0081540_12060062 | 50 |
| 193 | 3300005983 | Ga0081540_1237291 | Ga0081540_12372912 | 50 |
| 194 | 3300005985 | Ga0081539_10060955 | Ga0081539_100609552 | 50 |
| 195 | 3300006028 | Ga0070717_10011433 | Ga0070717_100114332 | 50 |
| 196 | 3300006028 | Ga0070717_10348221 | Ga0070717_103482214 | 50 |
| 197 | 3300006028 | Ga0070717_10648051 | Ga0070717_106480513 | 50 |
| 198 | 3300006028 | Ga0070717_10676922 | Ga0070717_106769222 | 50 |
| 199 | 3300006038 | Ga0075365_10639125 | Ga0075365_106391253 | 50 |
| 200 | 3300006038 | Ga0075365_11259125 | Ga0075365_112591252 | 50 |
| 201 | 3300006163 | Ga0070715_10075193 | Ga0070715_100751932 | 50 |
| 202 | 3300006163 | Ga0070715_10886706 | Ga0070715_108867061 | 50 |
| 203 | 3300006173 | Ga0070716_100007220 | Ga0070716_1000072207 | 50 |
| 204 | 3300006173 | Ga0070716_100067550 | Ga0070716_1000675502 | 50 |
| 205 | 3300006175 | Ga0070712_100032824 | Ga0070712_1000328244 | 50 |
| 206 | 3300006175 | Ga0070712_100627082 | Ga0070712_1006270822 | 50 |
| 207 | 3300006175 | Ga0070712_101656083 | Ga0070712_1016560832 | 50 |
| 208 | 3300006177 | Ga0075362_10078151 | Ga0075362_100781512 | 50 |
| 209 | 3300006178 | Ga0075367_10504098 | Ga0075367_105040982 | 50 |
| 210 | 3300006186 | Ga0075369_10364066 | Ga0075369_103640662 | 50 |
| 211 | 3300006195 | Ga0075366_10758140 | Ga0075366_107581402 | 50 |
| 212 | 3300006237 | Ga0097621_100306101 | Ga0097621_1003061013 | 50 |
| 213 | 3300006237 | Ga0097621_100491236 | Ga0097621_1004912361 | 50 |
| 214 | 3300006358 | Ga0068871_100215269 | Ga0068871_1002152692 | 50 |
| 215 | 3300006358 | Ga0068871_102307727 | Ga0068871_1023077272 | 50 |
| 216 | 3300006844 | Ga0075428_101694586 | Ga0075428_1016945862 | 50 |
| 217 | 3300006852 | Ga0075433_11873910 | Ga0075433_118739101 | 50 |
| 218 | 3300006871 | Ga0075434_100998236 | Ga0075434_1009982362 | 50 |
| 219 | 3300006871 | Ga0075434_102536305 | Ga0075434_1025363052 | 50 |
| 220 | 3300006881 | Ga0068865_100097401 | Ga0068865_1000974012 | 50 |
| 221 | 3300007265 | Ga0099794_10059552 | Ga0099794_100595523 | 50 |
| 222 | 3300007265 | Ga0099794_10653890 | Ga0099794_106538901 | 50 |
| 223 | 3300007788 | Ga0099795_10024518 | Ga0099795_100245182 | 50 |
| 224 | 3300007788 | Ga0099795_10264014 | Ga0099795_102640142 | 50 |
| 225 | 3300007788 | Ga0099795_10525200 | Ga0099795_105252002 | 50 |
| 226 | 3300009093 | Ga0105240_10028738 | Ga0105240_100287382 | 50 |
| 227 | 3300009093 | Ga0105240_10047953 | Ga0105240_100479532 | 50 |
| 228 | 3300009093 | Ga0105240_10189207 | Ga0105240_101892071 | 50 |
| 229 | 3300009093 | Ga0105240_10461369 | Ga0105240_104613692 | 50 |
| 230 | 3300009093 | Ga0105240_11355183 | Ga0105240_113551833 | 50 |
| 231 | 3300009093 | Ga0105240_11611118 | Ga0105240_116111182 | 50 |
| 232 | 3300009094 | Ga0111539_10093931 | Ga0111539_100939312 | 50 |
| 233 | 3300009094 | Ga0111539_13504050 | Ga0111539_135040502 | 50 |
| 234 | 3300009098 | Ga0105245_10093236 | Ga0105245_100932362 | 50 |
| 235 | 3300009098 | Ga0105245_11177621 | Ga0105245_111776211 | 50 |
| 236 | 3300009098 | Ga0105245_11268877 | Ga0105245_112688772 | 50 |
| 237 | 3300009148 | Ga0105243_10093348 | Ga0105243_100933483 | 50 |
| 238 | 3300009148 | Ga0105243_10967365 | Ga0105243_109673653 | 50 |
| 239 | 3300009148 | Ga0105243_11963456 | Ga0105243_119634562 | 50 |
| 240 | 3300009148 | Ga0105243_12355502 | Ga0105243_123555021 | 50 |
| 241 | 3300009174 | Ga0105241_10047352 | Ga0105241_100473526 | 50 |
| 242 | 3300009174 | Ga0105241_10877138 | Ga0105241_108771381 | 50 |
| 243 | 3300009176 | Ga0105242_10051882 | Ga0105242_100518823 | 50 |
| 244 | 3300009176 | Ga0105242_10831111 | Ga0105242_108311113 | 50 |
| 245 | 3300009176 | Ga0105242_11913351 | Ga0105242_119133512 | 50 |
| 246 | 3300009177 | Ga0105248_10611999 | Ga0105248_106119991 | 50 |
| 247 | 3300009177 | Ga0105248_12523632 | Ga0105248_125236322 | 50 |
| 248 | 3300009177 | Ga0105248_13419677 | Ga0105248_134196772 | 50 |
| 249 | 3300009545 | Ga0105237_10005643 | Ga0105237_100056432 | 50 |
| 250 | 3300009545 | Ga0105237_10014877 | Ga0105237_100148774 | 50 |
| 251 | 3300009545 | Ga0105237_10029473 | Ga0105237_100294733 | 50 |
| 252 | 3300009545 | Ga0105237_10248145 | Ga0105237_102481452 | 50 |
| 253 | 3300009545 | Ga0105237_11174676 | Ga0105237_111746762 | 50 |
| 254 | 3300009545 | Ga0105237_11683781 | Ga0105237_116837812 | 50 |
| 255 | 3300009545 | Ga0105237_12711798 | Ga0105237_127117982 | 50 |
| 256 | 3300009551 | Ga0105238_10001837 | Ga0105238_1000183715 | 50 |
| 257 | 3300009551 | Ga0105238_10014865 | Ga0105238_100148656 | 50 |
| 258 | 3300009551 | Ga0105238_10018123 | Ga0105238_1001812311 | 50 |
| 259 | 3300009551 | Ga0105238_10407771 | Ga0105238_104077712 | 50 |
| 260 | 3300009553 | Ga0105249_10044480 | Ga0105249_100444804 | 50 |
| 261 | 3300009553 | Ga0105249_12493091 | Ga0105249_124930912 | 50 |
| 262 | 3300009553 | Ga0105249_13485995 | Ga0105249_134859952 | 50 |
| 263 | 3300010159 | Ga0099796_10032904 | Ga0099796_100329042 | 50 |
| 264 | 3300010159 | Ga0099796_10085197 | Ga0099796_100851973 | 50 |
| 265 | 3300010375 | Ga0105239_10023538 | Ga0105239_100235384 | 50 |
| 266 | 3300010375 | Ga0105239_10063511 | Ga0105239_100635116 | 50 |
| 267 | 3300010375 | Ga0105239_10085653 | Ga0105239_100856533 | 50 |
| 268 | 3300010375 | Ga0105239_10125840 | Ga0105239_101258403 | 50 |
| 269 | 3300010375 | Ga0105239_11872700 | Ga0105239_118727002 | 50 |
| 270 | 3300010375 | Ga0105239_12128009 | Ga0105239_121280091 | 50 |
| 271 | 3300010375 | Ga0105239_12247290 | Ga0105239_122472901 | 50 |
| 272 | 3300010375 | Ga0105239_13226338 | Ga0105239_132263382 | 50 |
| 273 | 3300011119 | Ga0105246_10280991 | Ga0105246_102809912 | 50 |
| 274 | 3300011119 | Ga0105246_10341466 | Ga0105246_103414662 | 50 |
| 275 | 3300011119 | Ga0105246_10446928 | Ga0105246_104469282 | 50 |
| 276 | 3300011119 | Ga0105246_11299457 | Ga0105246_112994572 | 50 |
| 277 | 3300011119 | Ga0105246_12433840 | Ga0105246_124338402 | 50 |
| 278 | 3300012497 | Ga0157319_1005298 | Ga0157319_10052983 | 50 |
| 279 | 3300013104 | Ga0157370_10027385 | Ga0157370_100273856 | 50 |
| 280 | 3300013104 | Ga0157370_10257438 | Ga0157370_102574382 | 50 |
| 281 | 3300013105 | Ga0157369_10026982 | Ga0157369_100269824 | 50 |
| 282 | 3300013105 | Ga0157369_10723343 | Ga0157369_107233433 | 50 |
| 283 | 3300013296 | Ga0157374_11835973 | Ga0157374_118359732 | 50 |
| 284 | 3300013297 | Ga0157378_10030150 | Ga0157378_100301507 | 50 |
| 285 | 3300013297 | Ga0157378_11054735 | Ga0157378_110547353 | 50 |
| 286 | 3300013306 | Ga0163162_10119163 | Ga0163162_101191634 | 50 |
| 287 | 3300013308 | Ga0157375_10379311 | Ga0157375_103793113 | 50 |
| 288 | 3300013308 | Ga0157375_11704681 | Ga0157375_117046812 | 50 |
| 289 | 3300013308 | Ga0157375_12892231 | Ga0157375_128922311 | 50 |
| 290 | 3300013308 | Ga0157375_13109143 | Ga0157375_131091431 | 50 |
| 291 | 3300014325 | Ga0163163_11603738 | Ga0163163_116037382 | 50 |
| 292 | 3300014325 | Ga0163163_11760596 | Ga0163163_117605962 | 50 |
| 293 | 3300014325 | Ga0163163_12689759 | Ga0163163_126897592 | 50 |
| 294 | 3300014326 | Ga0157380_10412787 | Ga0157380_104127873 | 50 |
| 295 | 3300014326 | Ga0157380_10686294 | Ga0157380_106862942 | 50 |
| 296 | 3300014326 | Ga0157380_12525868 | Ga0157380_125258681 | 50 |
| 297 | 3300014497 | Ga0182008_10713716 | Ga0182008_107137162 | 50 |
| 298 | 3300014968 | Ga0157379_10291308 | Ga0157379_102913082 | 50 |
| 299 | 3300014968 | Ga0157379_11314991 | Ga0157379_113149912 | 50 |
| 300 | 3300014969 | Ga0157376_10081108 | Ga0157376_100811082 | 50 |
| 301 | 3300014969 | Ga0157376_11355528 | Ga0157376_113555281 | 50 |
| 302 | 3300017792 | Ga0163161_10442897 | Ga0163161_104428972 | 50 |
| 303 | 3300021384 | Ga0213876_10041155 | Ga0213876_100411552 | 50 |
| 304 | 3300025253 | Ga0209677_100235 | Ga0209677_10023544 | 50 |
| 305 | 3300025295 | Ga0209564_1009747 | Ga0209564_10097472 | 50 |
| 306 | 3300025297 | Ga0209758_1001576 | Ga0209758_100157613 | 50 |
| 307 | 3300025297 | Ga0209758_1007649 | Ga0209758_10076493 | 50 |
| 308 | 3300025297 | Ga0209758_1121224 | Ga0209758_11212241 | 50 |
| 309 | 3300025321 | Ga0207656_10063389 | Ga0207656_100633894 | 50 |
| 310 | 3300025321 | Ga0207656_10151391 | Ga0207656_101513912 | 50 |
| 311 | 3300025898 | Ga0207692_10073593 | Ga0207692_100735932 | 50 |
| 312 | 3300025898 | Ga0207692_10230096 | Ga0207692_102300962 | 50 |
| 313 | 3300025899 | Ga0207642_10008842 | Ga0207642_100088424 | 50 |
| 314 | 3300025900 | Ga0207710_10152399 | Ga0207710_101523994 | 50 |
| 315 | 3300025900 | Ga0207710_10594277 | Ga0207710_105942771 | 50 |
| 316 | 3300025901 | Ga0207688_10124104 | Ga0207688_101241042 | 50 |
| 317 | 3300025903 | Ga0207680_10984507 | Ga0207680_109845072 | 50 |
| 318 | 3300025904 | Ga0207647_10002624 | Ga0207647_1000262412 | 50 |
| 319 | 3300025905 | Ga0207685_10282414 | Ga0207685_102824142 | 50 |
| 320 | 3300025906 | Ga0207699_10402923 | Ga0207699_104029231 | 50 |
| 321 | 3300025906 | Ga0207699_11254661 | Ga0207699_112546611 | 50 |
| 322 | 3300025907 | Ga0207645_10247030 | Ga0207645_102470303 | 50 |
| 323 | 3300025909 | Ga0207705_10113159 | Ga0207705_101131591 | 50 |
| 324 | 3300025909 | Ga0207705_10260891 | Ga0207705_102608912 | 50 |
| 325 | 3300025909 | Ga0207705_11479457 | Ga0207705_114794572 | 50 |
| 326 | 3300025910 | Ga0207684_10937158 | Ga0207684_109371581 | 50 |
| 327 | 3300025911 | Ga0207654_10003876 | Ga0207654_1000387610 | 50 |
| 328 | 3300025911 | Ga0207654_10940540 | Ga0207654_109405401 | 50 |
| 329 | 3300025912 | Ga0207707_10059270 | Ga0207707_100592705 | 50 |
| 330 | 3300025912 | Ga0207707_10092716 | Ga0207707_100927163 | 50 |
| 331 | 3300025913 | Ga0207695_10004042 | Ga0207695_1000404215 | 50 |
| 332 | 3300025913 | Ga0207695_10012960 | Ga0207695_100129601 | 50 |
| 333 | 3300025913 | Ga0207695_10335570 | Ga0207695_103355702 | 50 |
| 334 | 3300025914 | Ga0207671_10015510 | Ga0207671_100155108 | 50 |
| 335 | 3300025914 | Ga0207671_10031399 | Ga0207671_100313994 | 50 |
| 336 | 3300025914 | Ga0207671_10103241 | Ga0207671_101032412 | 50 |
| 337 | 3300025914 | Ga0207671_10405141 | Ga0207671_104051411 | 50 |
| 338 | 3300025914 | Ga0207671_10414576 | Ga0207671_104145763 | 50 |
| 339 | 3300025914 | Ga0207671_10473748 | Ga0207671_104737482 | 50 |
| 340 | 3300025915 | Ga0207693_10011177 | Ga0207693_100111774 | 50 |
| 341 | 3300025915 | Ga0207693_10033297 | Ga0207693_100332978 | 50 |
| 342 | 3300025915 | Ga0207693_10093209 | Ga0207693_100932094 | 50 |
| 343 | 3300025916 | Ga0207663_10080161 | Ga0207663_100801616 | 50 |
| 344 | 3300025916 | Ga0207663_11079689 | Ga0207663_110796891 | 50 |
| 345 | 3300025917 | Ga0207660_10017864 | Ga0207660_100178647 | 50 |
| 346 | 3300025917 | Ga0207660_10133415 | Ga0207660_101334153 | 50 |
| 347 | 3300025917 | Ga0207660_10289639 | Ga0207660_102896393 | 50 |
| 348 | 3300025917 | Ga0207660_10756931 | Ga0207660_107569312 | 50 |
| 349 | 3300025917 | Ga0207660_10874562 | Ga0207660_108745622 | 50 |
| 350 | 3300025919 | Ga0207657_10004981 | Ga0207657_1000498114 | 50 |
| 351 | 3300025919 | Ga0207657_10599984 | Ga0207657_105999842 | 50 |
| 352 | 3300025919 | Ga0207657_10915518 | Ga0207657_109155183 | 50 |
| 353 | 3300025919 | Ga0207657_10918921 | Ga0207657_109189211 | 50 |
| 354 | 3300025920 | Ga0207649_10189962 | Ga0207649_101899622 | 50 |
| 355 | 3300025921 | Ga0207652_10015155 | Ga0207652_100151556 | 50 |
| 356 | 3300025921 | Ga0207652_10444209 | Ga0207652_104442092 | 50 |
| 357 | 3300025921 | Ga0207652_11090715 | Ga0207652_110907152 | 50 |
| 358 | 3300025923 | Ga0207681_10317196 | Ga0207681_103171962 | 50 |
| 359 | 3300025924 | Ga0207694_10000082 | Ga0207694_1000008279 | 50 |
| 360 | 3300025924 | Ga0207694_10042681 | Ga0207694_100426813 | 50 |
| 361 | 3300025924 | Ga0207694_10048492 | Ga0207694_100484924 | 50 |
| 362 | 3300025925 | Ga0207650_11173134 | Ga0207650_111731341 | 50 |
| 363 | 3300025927 | Ga0207687_11118216 | Ga0207687_111182162 | 50 |
| 364 | 3300025927 | Ga0207687_11319200 | Ga0207687_113192002 | 50 |
| 365 | 3300025927 | Ga0207687_11319635 | Ga0207687_113196352 | 50 |
| 366 | 3300025928 | Ga0207700_10055551 | Ga0207700_100555511 | 50 |
| 367 | 3300025928 | Ga0207700_10275884 | Ga0207700_102758843 | 50 |
| 368 | 3300025928 | Ga0207700_11003127 | Ga0207700_110031272 | 50 |
| 369 | 3300025928 | Ga0207700_11086488 | Ga0207700_110864883 | 50 |
| 370 | 3300025929 | Ga0207664_10058930 | Ga0207664_100589302 | 50 |
| 371 | 3300025929 | Ga0207664_10883372 | Ga0207664_108833722 | 50 |
| 372 | 3300025931 | Ga0207644_10063190 | Ga0207644_100631907 | 50 |
| 373 | 3300025931 | Ga0207644_11631659 | Ga0207644_116316592 | 50 |
| 374 | 3300025932 | Ga0207690_10026152 | Ga0207690_100261522 | 50 |
| 375 | 3300025932 | Ga0207690_10230047 | Ga0207690_102300473 | 50 |
| 376 | 3300025933 | Ga0207706_10051098 | Ga0207706_100510984 | 50 |
| 377 | 3300025933 | Ga0207706_10884245 | Ga0207706_108842452 | 50 |
| 378 | 3300025933 | Ga0207706_10889116 | Ga0207706_108891161 | 50 |
| 379 | 3300025934 | Ga0207686_10283393 | Ga0207686_102833933 | 50 |
| 380 | 3300025935 | Ga0207709_10008505 | Ga0207709_100085053 | 50 |
| 381 | 3300025935 | Ga0207709_10067048 | Ga0207709_100670484 | 50 |
| 382 | 3300025936 | Ga0207670_11276726 | Ga0207670_112767262 | 50 |
| 383 | 3300025937 | Ga0207669_10125578 | Ga0207669_101255782 | 50 |
| 384 | 3300025937 | Ga0207669_10176802 | Ga0207669_101768022 | 50 |
| 385 | 3300025937 | Ga0207669_11027750 | Ga0207669_110277502 | 50 |
| 386 | 3300025938 | Ga0207704_10051070 | Ga0207704_100510703 | 50 |
| 387 | 3300025938 | Ga0207704_10851129 | Ga0207704_108511291 | 50 |
| 388 | 3300025939 | Ga0207665_10246166 | Ga0207665_102461662 | 50 |
| 389 | 3300025939 | Ga0207665_10259030 | Ga0207665_102590302 | 50 |
| 390 | 3300025940 | Ga0207691_10034519 | Ga0207691_100345192 | 50 |
| 391 | 3300025940 | Ga0207691_11181823 | Ga0207691_111818232 | 50 |
| 392 | 3300025941 | Ga0207711_11200023 | Ga0207711_112000232 | 50 |
| 393 | 3300025942 | Ga0207689_10275231 | Ga0207689_102752312 | 50 |
| 394 | 3300025942 | Ga0207689_11173315 | Ga0207689_111733152 | 50 |
| 395 | 3300025944 | Ga0207661_10167569 | Ga0207661_101675694 | 50 |
| 396 | 3300025945 | Ga0207679_10653027 | Ga0207679_106530272 | 50 |
| 397 | 3300025949 | Ga0207667_10013948 | Ga0207667_100139485 | 50 |
| 398 | 3300025949 | Ga0207667_10078267 | Ga0207667_100782672 | 50 |
| 399 | 3300025949 | Ga0207667_10207544 | Ga0207667_102075443 | 50 |
| 400 | 3300025949 | Ga0207667_10490751 | Ga0207667_104907512 | 50 |
| 401 | 3300025949 | Ga0207667_10767889 | Ga0207667_107678892 | 50 |
| 402 | 3300025949 | Ga0207667_10921839 | Ga0207667_109218391 | 50 |
| 403 | 3300025960 | Ga0207651_11154374 | Ga0207651_111543741 | 50 |
| 404 | 3300025961 | Ga0207712_10129613 | Ga0207712_101296133 | 50 |
| 405 | 3300025972 | Ga0207668_10038360 | Ga0207668_100383603 | 50 |
| 406 | 3300025972 | Ga0207668_10417169 | Ga0207668_104171692 | 50 |
| 407 | 3300025972 | Ga0207668_10450331 | Ga0207668_104503313 | 50 |
| 408 | 3300025981 | Ga0207640_10907455 | Ga0207640_109074552 | 50 |
| 409 | 3300025986 | Ga0207658_11795392 | Ga0207658_117953921 | 50 |
| 410 | 3300025986 | Ga0207658_11796391 | Ga0207658_117963911 | 50 |
| 411 | 3300025986 | Ga0207658_11981575 | Ga0207658_119815752 | 50 |
| 412 | 3300026035 | Ga0207703_10446060 | Ga0207703_104460602 | 50 |
| 413 | 3300026035 | Ga0207703_10958593 | Ga0207703_109585932 | 50 |
| 414 | 3300026041 | Ga0207639_10016076 | Ga0207639_100160766 | 50 |
| 415 | 3300026041 | Ga0207639_10022946 | Ga0207639_100229464 | 50 |
| 416 | 3300026041 | Ga0207639_10200670 | Ga0207639_102006704 | 50 |
| 417 | 3300026041 | Ga0207639_10294007 | Ga0207639_102940072 | 50 |
| 418 | 3300026041 | Ga0207639_10626828 | Ga0207639_106268283 | 50 |
| 419 | 3300026067 | Ga0207678_10058598 | Ga0207678_100585983 | 50 |
| 420 | 3300026067 | Ga0207678_10160182 | Ga0207678_101601822 | 50 |
| 421 | 3300026067 | Ga0207678_10185583 | Ga0207678_101855832 | 50 |
| 422 | 3300026067 | Ga0207678_10250454 | Ga0207678_102504544 | 50 |
| 423 | 3300026067 | Ga0207678_11797514 | Ga0207678_117975142 | 50 |
| 424 | 3300026075 | Ga0207708_10054831 | Ga0207708_100548312 | 50 |
| 425 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002342 | 50 |
| 426 | 3300026078 | Ga0207702_10003315 | Ga0207702_1000331510 | 50 |
| 427 | 3300026078 | Ga0207702_11087798 | Ga0207702_110877982 | 50 |
| 428 | 3300026078 | Ga0207702_12200052 | Ga0207702_122000521 | 50 |
| 429 | 3300026089 | Ga0207648_10037161 | Ga0207648_100371616 | 50 |
| 430 | 3300026089 | Ga0207648_11467912 | Ga0207648_114679121 | 50 |
| 431 | 3300026095 | Ga0207676_10147521 | Ga0207676_101475215 | 50 |
| 432 | 3300026116 | Ga0207674_10001889 | Ga0207674_1000188911 | 50 |
| 433 | 3300026116 | Ga0207674_10004659 | Ga0207674_100046595 | 50 |
| 434 | 3300026116 | Ga0207674_10005787 | Ga0207674_1000578711 | 50 |
| 435 | 3300026116 | Ga0207674_11151868 | Ga0207674_111518682 | 50 |
| 436 | 3300026118 | Ga0207675_100063476 | Ga0207675_1000634765 | 50 |
| 437 | 3300026118 | Ga0207675_100393127 | Ga0207675_1003931272 | 50 |
| 438 | 3300026118 | Ga0207675_101747017 | Ga0207675_1017470172 | 50 |
| 439 | 3300026121 | Ga0207683_10377778 | Ga0207683_103777783 | 50 |
| 440 | 3300026142 | Ga0207698_10160918 | Ga0207698_101609183 | 50 |
| 441 | 3300026142 | Ga0207698_10211937 | Ga0207698_102119373 | 50 |
| 442 | 3300026142 | Ga0207698_10215367 | Ga0207698_102153673 | 50 |
| 443 | 3300026142 | Ga0207698_11666658 | Ga0207698_116666582 | 50 |
| 444 | 3300027512 | Ga0209179_1004345 | Ga0209179_10043452 | 50 |
| 445 | 3300027671 | Ga0209588_1063920 | Ga0209588_10639203 | 50 |
| 446 | 3300027866 | Ga0209813_10096797 | Ga0209813_100967972 | 50 |
| 447 | 3300028379 | Ga0268266_10004442 | Ga0268266_100044423 | 50 |
| 448 | 3300028379 | Ga0268266_10816346 | Ga0268266_108163463 | 50 |
| 449 | 3300028380 | Ga0268265_11407848 | Ga0268265_114078481 | 50 |
| 450 | 3300028380 | Ga0268265_12288545 | Ga0268265_122885452 | 50 |
| 451 | 3300028381 | Ga0268264_11338603 | Ga0268264_113386032 | 50 |
| 452 | 3300028381 | Ga0268264_12318401 | Ga0268264_123184011 | 50 |
| 453 | 3300028786 | Ga0307517_10390735 | Ga0307517_103907353 | 50 |
| 454 | 3300028800 | Ga0265338_10769484 | Ga0265338_107694842 | 50 |
| 455 | 3300030521 | Ga0307511_10049805 | Ga0307511_100498054 | 50 |
| 456 | 3300031235 | Ga0265330_10035542 | Ga0265330_100355422 | 50 |
| 457 | 3300031235 | Ga0265330_10119307 | Ga0265330_101193072 | 50 |
| 458 | 3300031238 | Ga0265332_10006188 | Ga0265332_100061882 | 50 |
| 459 | 3300031238 | Ga0265332_10113260 | Ga0265332_101132602 | 50 |
| 460 | 3300031239 | Ga0265328_10255064 | Ga0265328_102550642 | 50 |
| 461 | 3300031241 | Ga0265325_10022232 | Ga0265325_100222324 | 50 |
| 462 | 3300031247 | Ga0265340_10002614 | Ga0265340_1000261414 | 50 |
| 463 | 3300031249 | Ga0265339_10100248 | Ga0265339_101002482 | 50 |
| 464 | 3300031250 | Ga0265331_10035274 | Ga0265331_100352742 | 50 |
| 465 | 3300031344 | Ga0265316_10140574 | Ga0265316_101405742 | 50 |
| 466 | 3300031344 | Ga0265316_10155117 | Ga0265316_101551172 | 50 |
| 467 | 3300031507 | Ga0307509_10038177 | Ga0307509_100381772 | 50 |
| 468 | 3300031507 | Ga0307509_10218560 | Ga0307509_102185602 | 50 |
| 469 | 3300031507 | Ga0307509_10347977 | Ga0307509_103479772 | 50 |
| 470 | 3300031507 | Ga0307509_10671558 | Ga0307509_106715582 | 50 |
| 471 | 3300031616 | Ga0307508_10000009 | Ga0307508_10000009173 | 50 |
| 472 | 3300031616 | Ga0307508_10164958 | Ga0307508_101649582 | 50 |
| 473 | 3300031711 | Ga0265314_10047125 | Ga0265314_100471253 | 50 |
| 474 | 3300031711 | Ga0265314_10226595 | Ga0265314_102265952 | 50 |
| 475 | 3300031712 | Ga0265342_10263205 | Ga0265342_102632052 | 50 |
| 476 | 3300031730 | Ga0307516_10109129 | Ga0307516_101091292 | 50 |
| 477 | 3300031730 | Ga0307516_10147601 | Ga0307516_101476015 | 50 |
| 478 | 3300031824 | Ga0307413_10055169 | Ga0307413_100551692 | 50 |
| 479 | 3300031824 | Ga0307413_11159284 | Ga0307413_111592843 | 50 |
| 480 | 3300031852 | Ga0307410_10598894 | Ga0307410_105988942 | 50 |
| 481 | 3300031903 | Ga0307407_10505054 | Ga0307407_105050542 | 50 |
| 482 | 3300031911 | Ga0307412_10806642 | Ga0307412_108066422 | 50 |
| 483 | 3300031995 | Ga0307409_101901686 | Ga0307409_1019016862 | 50 |
| 484 | 3300032004 | Ga0307414_10364317 | Ga0307414_103643171 | 50 |
| 485 | 3300032005 | Ga0307411_12288974 | Ga0307411_122889742 | 50 |
| 486 | 3300032126 | Ga0307415_100627553 | Ga0307415_1006275532 | 50 |
| 487 | 3300033179 | Ga0307507_10035312 | Ga0307507_100353122 | 50 |
| 488 | 3300033180 | Ga0307510_10142653 | Ga0307510_101426535 | 50 |
| 489 | 3300033180 | Ga0307510_10494591 | Ga0307510_104945912 | 50 |
| 490 | 3300033544 | Ga0316215_1016541 | Ga0316215_10165413 | 50 |
| 491 | 3300033544 | Ga0316215_1030587 | Ga0316215_10305872 | 50 |
| 492 | 3300033544 | Ga0316215_1034504 | Ga0316215_10345042 | 50 |
| 493 | 3300035083 | Ga0373926_0024531 | Ga0373926_0024531_1590_1742 | 50 |
| 494 | 3300035086 | Ga0373934_0001166 | Ga0373934_0001166_1126_1290 | 50 |
| 495 | 3300035086 | Ga0373934_0434512 | Ga0373934_0434512_222_386 | 50 |
| 496 | 3300035089 | Ga0373944_0103137 | Ga0373944_0103137_346_498 | 50 |
| 497 | 3300035111 | Ga0373923_0008553 | Ga0373923_0008553_1450_1614 | 50 |
| 498 | 3300035111 | Ga0373923_0548369 | Ga0373923_0548369_194_346 | 50 |
| 499 | 3300035112 | Ga0373932_0167563 | Ga0373932_0167563_490_642 | 50 |
| 500 | 3300035113 | Ga0373936_0043565 | Ga0373936_0043565_1228_1380 | 50 |
| 501 | 3300035113 | Ga0373936_0095072 | Ga0373936_0095072_583_735 | 50 |
| 502 | 3300035113 | Ga0373936_0136528 | Ga0373936_0136528_431_595 | 50 |
| 503 | 3300035114 | Ga0373939_0334682 | Ga0373939_0334682_428_595 | 50 |
| 504 | 3300035117 | Ga0373953_0003332 | Ga0373953_0003332_2321_2485 | 50 |
| 505 | 3300035117 | Ga0373953_0331693 | Ga0373953_0331693_299_451 | 50 |
| 506 | 3300035117 | Ga0373953_0429982 | Ga0373953_0429982_181_333 | 50 |
| 507 | 3300035118 | Ga0373954_0007921 | Ga0373954_0007921_1540_1704 | 50 |
| 508 | 3300035118 | Ga0373954_0319627 | Ga0373954_0319627_153_305 | 50 |
| 509 | 3300035119 | Ga0373956_0001159 | Ga0373956_0001159_9305_9469 | 50 |
| 510 | 3300035120 | Ga0373957_0009755 | Ga0373957_0009755_2522_2686 | 50 |
| 511 | 3300035170 | Ga0373943_0013016 | Ga0373943_0013016_2040_2192 | 50 |
| 512 | 3300035171 | Ga0373946_0063490 | Ga0373946_0063490_143_295 | 50 |
| 513 | 3300035172 | Ga0373955_0003515 | Ga0373955_0003515_2321_2485 | 50 |
| 514 | 3300035172 | Ga0373955_0406131 | Ga0373955_0406131_218_370 | 50 |
| 515 | 3300035410 | Ga0373924_0013420 | Ga0373924_0013420_2025_2189 | 50 |
| 516 | 3300035410 | Ga0373924_0045234 | Ga0373924_0045234_50_202 | 50 |
| 517 | 3300035692 | Ga0373935_0000701 | Ga0373935_0000701_1724_1876 | 50 |
| 518 | 3300035692 | Ga0373935_0191650 | Ga0373935_0191650_597_749 | 50 |
| 519 | 3300035692 | Ga0373935_0499099 | Ga0373935_0499099_108_272 | 50 |
| 520 | 3300035692 | Ga0373935_0684413 | Ga0373935_0684413_448_612 | 50 |
| 521 | 3300035692 | Ga0373935_0754217 | Ga0373935_0754217_315_467 | 50 |
| 522 | 3300035692 | Ga0373935_1441226 | Ga0373935_1441226_347_499 | 50 |
| 523 | 3300035695 | Ga0373927_0001744 | Ga0373927_0001744_6976_7128 | 50 |
| 524 | 3300035695 | Ga0373927_0007540 | Ga0373927_0007540_4192_4344 | 50 |
| 525 | 3300035695 | Ga0373927_0013004 | Ga0373927_0013004_5014_5178 | 50 |
| 526 | 3300035695 | Ga0373927_0551897 | Ga0373927_0551897_411_575 | 50 |
| 527 | 3300035724 | Ga0373933_0008789 | Ga0373933_0008789_3402_3566 | 50 |
| 528 | 3300035724 | Ga0373933_0030554 | Ga0373933_0030554_1706_1858 | 50 |
| 529 | 3300035724 | Ga0373933_1165185 | Ga0373933_1165185_233_385 | 50 |
| 530 | 3300035725 | Ga0373947_0005322 | Ga0373947_0005322_6386_6538 | 50 |
| 531 | 3300035725 | Ga0373947_0161160 | Ga0373947_0161160_750_902 | 50 |
| 532 | 3300035725 | Ga0373947_0330820 | Ga0373947_0330820_423_575 | 50 |
| 533 | 3300036401 | Ga0373937_0067053 | Ga0373937_0067053_2322_2486 | 50 |
| 534 | 3300036401 | Ga0373937_0246381 | Ga0373937_0246381_1490_1642 | 50 |
| 535 | 3300036401 | Ga0373937_1823718 | Ga0373937_1823718_33_185 | 50 |
| 536 | 3300036535 | Ga0310110_015967 | Ga0310110_015967_890_1054 | 50 |
| 537 | 3300037068 | Ga0373925_0004587 | Ga0373925_0004587_1360_1512 | 50 |
| 538 | 3300037068 | Ga0373925_0206849 | Ga0373925_0206849_645_797 | 50 |
| 539 | 3300037068 | Ga0373925_0277464 | Ga0373925_0277464_254_406 | 50 |
| 540 | 3300037418 | Ga0395900_0583962 | Ga0395900_0583962_446_598 | 50 |
| 541 | 3300037466 | Ga0395898_0121218 | Ga0395898_0121218_961_1113 | 50 |
| 542 | 3300037471 | Ga0395905_0043982 | Ga0395905_0043982_1751_1903 | 50 |
| 543 | 3300037853 | Ga0436364_0609221 | Ga0436364_0609221_59_211 | 50 |
| 544 | 3300039437 | Ga0436365_1678992 | Ga0436365_1678992_1189_1341 | 50 |
| 545 | 3300041413 | Ga0439465_0425671 | Ga0439465_0425671_322_474 | 50 |
| 546 | 3300041451 | Ga0451791_0310822 | Ga0451791_0310822_328_480 | 50 |
| 547 | 3300041451 | Ga0451791_1004722 | Ga0451791_1004722_81_233 | 50 |
| 548 | 3300041453 | Ga0451797_0286223 | Ga0451797_0286223_407_559 | 50 |
| 549 | 3300041460 | Ga0451802_1199996 | Ga0451802_1199996_305_457 | 50 |
| 550 | 3300041460 | Ga0451802_1963004 | Ga0451802_1963004_89_241 | 50 |
| 551 | 3300041486 | Ga0451807_0794862 | Ga0451807_0794862_170_322 | 50 |
| 552 | 3300041491 | Ga0451833_0692571 | Ga0451833_0692571_103_255 | 50 |
| 553 | 3300041509 | Ga0451843_1671675 | Ga0451843_1671675_1069_1221 | 50 |
| 554 | 3300046454 | Ga0495592_0008975 | Ga0495592_0008975_4722_4886 | 50 |
| 555 | 3300046454 | Ga0495592_0856949 | Ga0495592_0856949_96_248 | 50 |
| 556 | 3300046455 | Ga0495603_0000624 | Ga0495603_0000624_4972_5124 | 50 |
| 557 | 3300046455 | Ga0495603_0164144 | Ga0495603_0164144_133_285 | 50 |
| 558 | 3300046459 | Ga0495629_0001961 | Ga0495629_0001961_7089_7241 | 50 |
| 559 | 3300046459 | Ga0495629_0004200 | Ga0495629_0004200_6107_6271 | 50 |
| 560 | 3300046459 | Ga0495629_0699485 | Ga0495629_0699485_56_208 | 50 |
| 561 | 3300046461 | Ga0495641_0010879 | Ga0495641_0010879_556_708 | 50 |
| 562 | 3300046462 | Ga0495651_0039274 | Ga0495651_0039274_1255_1407 | 50 |
| 563 | 3300046462 | Ga0495651_0099650 | Ga0495651_0099650_1182_1346 | 50 |
| 564 | 3300046463 | Ga0495653_0000923 | Ga0495653_0000923_16533_16697 | 50 |
| 565 | 3300046472 | Ga0495580_0008876 | Ga0495580_0008876_7567_7719 | 50 |
| 566 | 3300046473 | Ga0495582_0000739 | Ga0495582_0000739_13257_13409 | 50 |
| 567 | 3300046474 | Ga0495605_0031514 | Ga0495605_0031514_1206_1358 | 50 |
| 568 | 3300046475 | Ga0495639_0000335 | Ga0495639_0000335_16028_16180 | 50 |
| 569 | 3300046476 | Ga0495662_0008807 | Ga0495662_0008807_2137_2289 | 50 |
| 570 | 3300046476 | Ga0495662_0232035 | Ga0495662_0232035_18_182 | 50 |
| 571 | 3300046476 | Ga0495662_0410665 | Ga0495662_0410665_404_556 | 50 |
| 572 | 3300046477 | Ga0495664_0054559 | Ga0495664_0054559_89_241 | 50 |
| 573 | 3300046477 | Ga0495664_0301238 | Ga0495664_0301238_565_729 | 50 |
| 574 | 3300046477 | Ga0495664_0889492 | Ga0495664_0889492_266_418 | 50 |
| 575 | 3300046477 | Ga0495664_0947145 | Ga0495664_0947145_322_474 | 50 |
| 576 | 3300046491 | Ga0495584_0610427 | Ga0495584_0610427_14_166 | 50 |
| 577 | 3300046491 | Ga0495584_0716314 | Ga0495584_0716314_294_446 | 50 |
| 578 | 3300046499 | Ga0495594_0004402 | Ga0495594_0004402_2336_2488 | 50 |
| 579 | 3300046499 | Ga0495594_0166097 | Ga0495594_0166097_105_257 | 50 |
| 580 | 3300046500 | Ga0495596_0180855 | Ga0495596_0180855_643_795 | 50 |
| 581 | 3300046501 | Ga0495607_0231301 | Ga0495607_0231301_120_272 | 50 |
| 582 | 3300046507 | Ga0495606_0238331 | Ga0495606_0238331_417_599 | 50 |
| 583 | 3300046511 | Ga0495608_0003276 | Ga0495608_0003276_5731_5895 | 50 |
| 584 | 3300046514 | Ga0495618_0172687 | Ga0495618_0172687_429_581 | 50 |
| 585 | 3300046516 | Ga0495628_0043887 | Ga0495628_0043887_2932_3096 | 50 |
| 586 | 3300046516 | Ga0495628_0073081 | Ga0495628_0073081_1223_1375 | 50 |
| 587 | 3300046517 | Ga0495630_0010570 | Ga0495630_0010570_6501_6653 | 50 |
| 588 | 3300046518 | Ga0495631_0245681 | Ga0495631_0245681_334_486 | 50 |
| 589 | 3300046522 | Ga0495643_0252352 | Ga0495643_0252352_28_180 | 50 |
| 590 | 3300046523 | Ga0495644_0099049 | Ga0495644_0099049_385_537 | 50 |
| 591 | 3300046524 | Ga0495648_0006521 | Ga0495648_0006521_6849_7001 | 50 |
| 592 | 3300046524 | Ga0495648_0030230 | Ga0495648_0030230_1696_1848 | 50 |
| 593 | 3300046526 | Ga0495666_0264561 | Ga0495666_0264561_533_697 | 50 |
| 594 | 3300046526 | Ga0495666_0525020 | Ga0495666_0525020_298_450 | 50 |
| 595 | 3300046529 | Ga0495652_0002339 | Ga0495652_0002339_13830_13994 | 50 |
| 596 | 3300046529 | Ga0495652_0109021 | Ga0495652_0109021_1531_1683 | 50 |
| 597 | 3300046529 | Ga0495652_0345840 | Ga0495652_0345840_20_172 | 50 |
| 598 | 3300046531 | Ga0495665_0005791 | Ga0495665_0005791_1888_2040 | 50 |
| 599 | 3300046533 | Ga0495640_0000826 | Ga0495640_0000826_20725_20877 | 50 |
| 600 | 3300046533 | Ga0495640_0375237 | Ga0495640_0375237_26_178 | 50 |
| 601 | 3300046535 | Ga0495586_0220580 | Ga0495586_0220580_832_996 | 50 |
| 602 | 3300046536 | Ga0495587_0032759 | Ga0495587_0032759_821_985 | 50 |
| 603 | 3300046537 | Ga0495598_0258399 | Ga0495598_0258399_304_456 | 50 |
| 604 | 3300046543 | Ga0495645_0194641 | Ga0495645_0194641_927_1091 | 50 |
| 605 | 3300046543 | Ga0495645_0595835 | Ga0495645_0595835_12_164 | 50 |
| 606 | 3300046557 | Ga0495622_0028887 | Ga0495622_0028887_1674_1826 | 50 |
| 607 | 3300046557 | Ga0495622_0133936 | Ga0495622_0133936_531_683 | 50 |
| 608 | 3300046559 | Ga0495667_0009056 | Ga0495667_0009056_1054_1218 | 50 |
| 609 | 3300046615 | Ga0495656_0170013 | Ga0495656_0170013_651_803 | 50 |
| 610 | 3300046642 | Ga0495634_0001338 | Ga0495634_0001338_17_169 | 50 |
| 611 | 3300046642 | Ga0495634_0007240 | Ga0495634_0007240_2710_2874 | 50 |
| 612 | 3300046648 | Ga0495611_0443550 | Ga0495611_0443550_74_226 | 50 |
| 613 | 3300046660 | Ga0495625_0615905 | Ga0495625_0615905_138_290 | 50 |
| 614 | 3300046663 | Ga0495635_0000187 | Ga0495635_0000187_31882_32034 | 50 |
| 615 | 3300046663 | Ga0495635_0006608 | Ga0495635_0006608_4418_4582 | 50 |
| 616 | 3300046664 | Ga0495659_0101276 | Ga0495659_0101276_183_335 | 50 |
| 617 | 3300046674 | Ga0495588_0014639 | Ga0495588_0014639_429_581 | 50 |
| 618 | 3300046674 | Ga0495588_0418607 | Ga0495588_0418607_496_660 | 50 |
| 619 | 3300046675 | Ga0495657_0024857 | Ga0495657_0024857_693_857 | 50 |
| 620 | 3300046675 | Ga0495657_0057670 | Ga0495657_0057670_2404_2556 | 50 |
| 621 | 3300046675 | Ga0495657_0111670 | Ga0495657_0111670_355_507 | 50 |
| 622 | 3300046675 | Ga0495657_0123835 | Ga0495657_0123835_437_589 | 50 |
| 623 | 3300046678 | Ga0495599_0002320 | Ga0495599_0002320_1958_2122 | 50 |
| 624 | 3300046679 | Ga0495623_0007791 | Ga0495623_0007791_4772_4936 | 50 |
| 625 | 3300046679 | Ga0495623_0640593 | Ga0495623_0640593_58_210 | 50 |
| 626 | 3300046680 | Ga0495646_0021219 | Ga0495646_0021219_3385_3537 | 50 |
| 627 | 3300046681 | Ga0495647_0002967 | Ga0495647_0002967_2811_2963 | 50 |
| 628 | 3300046683 | Ga0495658_0000047 | Ga0495658_0000047_40992_41144 | 50 |
| 629 | 3300046684 | Ga0495669_0030372 | Ga0495669_0030372_350_502 | 50 |
| 630 | 3300046689 | Ga0495613_0001031 | Ga0495613_0001031_19123_19275 | 50 |
| 631 | 3300046689 | Ga0495613_0014828 | Ga0495613_0014828_5236_5400 | 50 |
| 632 | 3300046689 | Ga0495613_0535560 | Ga0495613_0535560_599_763 | 50 |
| 633 | 3300046690 | Ga0495624_0002051 | Ga0495624_0002051_2781_2933 | 50 |
| 634 | 3300046694 | Ga0495649_0367371 | Ga0495649_0367371_258_410 | 50 |
| 635 | 3300046794 | Ga0495589_0348573 | Ga0495589_0348573_486_638 | 50 |
| 636 | 3300046809 | Ga0495600_0013920 | Ga0495600_0013920_3851_4015 | 50 |
| 637 | 3300046809 | Ga0495600_0086049 | Ga0495600_0086049_1525_1677 | 50 |
| 638 | 3300046809 | Ga0495600_0170817 | Ga0495600_0170817_345_497 | 50 |
| 639 | 3300047315 | Ga0495581_0000563 | Ga0495581_0000563_16683_16835 | 50 |
| 640 | 3300047317 | Ga0495604_0010697 | Ga0495604_0010697_821_985 | 50 |
| 641 | 3300047319 | Ga0495674_0001402 | Ga0495674_0001402_17019_17171 | 50 |
| 642 | 3300047319 | Ga0495674_0046806 | Ga0495674_0046806_380_544 | 50 |
| 643 | 3300047319 | Ga0495674_0994502 | Ga0495674_0994502_67_219 | 50 |
| 644 | 3300047319 | Ga0495674_1427849 | Ga0495674_1427849_92_244 | 50 |
| 645 | 3300047320 | Ga0495672_0543610 | Ga0495672_0543610_156_308 | 50 |
| 646 | 3300047321 | Ga0495676_0245695 | Ga0495676_0245695_771_923 | 50 |
| 647 | 3300047322 | Ga0495680_0030674 | Ga0495680_0030674_3530_3694 | 50 |
| 648 | 3300047322 | Ga0495680_0080724 | Ga0495680_0080724_25_177 | 50 |
| 649 | 3300047322 | Ga0495680_0593325 | Ga0495680_0593325_157_309 | 50 |
| 650 | 3300047322 | Ga0495680_0717500 | Ga0495680_0717500_35_187 | 50 |
| 651 | 3300047322 | Ga0495680_0953237 | Ga0495680_0953237_174_338 | 50 |
| 652 | 3300047323 | Ga0495683_0319158 | Ga0495683_0319158_38_190 | 50 |
| 653 | 3300047444 | Ga0495675_0005669 | Ga0495675_0005669_2183_2347 | 50 |
| 654 | 3300047444 | Ga0495675_0493852 | Ga0495675_0493852_65_229 | 50 |
| 655 | 3300047471 | Ga0495684_0001482 | Ga0495684_0001482_13423_13587 | 50 |
| 656 | 3300047471 | Ga0495684_0008519 | Ga0495684_0008519_7725_7877 | 50 |
| 657 | 3300047472 | Ga0495686_0095836 | Ga0495686_0095836_253_405 | 50 |
| 658 | 3300047472 | Ga0495686_0168919 | Ga0495686_0168919_84_236 | 50 |
| 659 | 3300047673 | Ga0495593_0000723 | Ga0495593_0000723_6633_6785 | 50 |
| 660 | 3300047673 | Ga0495593_0006359 | Ga0495593_0006359_5216_5380 | 50 |
| 661 | 3300048088 | Ga0495602_0043621 | Ga0495602_0043621_821_985 | 50 |
| 662 | 3300048089 | Ga0495614_0270017 | Ga0495614_0270017_228_380 | 50 |
| 663 | 3300048903 | Ga0496100_0796674 | Ga0496100_0796674_521_673 | 50 |
| 664 | 3300048905 | Ga0496102_0032393 | Ga0496102_0032393_1676_1828 | 50 |
| 665 | 3300048905 | Ga0496102_0292270 | Ga0496102_0292270_1347_1499 | 50 |
| 666 | 3300048905 | Ga0496102_0598873 | Ga0496102_0598873_637_789 | 50 |
| 667 | 3300048905 | Ga0496102_1001474 | Ga0496102_1001474_335_487 | 50 |
| 668 | 3300048905 | Ga0496102_1138956 | Ga0496102_1138956_31_183 | 50 |
| 669 | 3300048907 | Ga0496104_0010232 | Ga0496104_0010232_6496_6660 | 50 |
| 670 | 3300048907 | Ga0496104_0385388 | Ga0496104_0385388_195_347 | 50 |
| 671 | 3300048907 | Ga0496104_0483799 | Ga0496104_0483799_617_769 | 50 |
| 672 | 3300048908 | Ga0496105_1196982 | Ga0496105_1196982_117_269 | 50 |
| 673 | 3300048909 | Ga0496106_0000540 | Ga0496106_0000540_18984_19136 | 50 |
| 674 | 3300048909 | Ga0496106_0348444 | Ga0496106_0348444_768_920 | 50 |
| 675 | 3300048909 | Ga0496106_0514071 | Ga0496106_0514071_508_660 | 50 |
| 676 | 3300048909 | Ga0496106_0841907 | Ga0496106_0841907_486_638 | 50 |
| 677 | 3300048909 | Ga0496106_0894556 | Ga0496106_0894556_433_585 | 50 |
| 678 | 3300048911 | Ga0496108_0245050 | Ga0496108_0245050_1355_1507 | 50 |
| 679 | 3300048911 | Ga0496108_0354000 | Ga0496108_0354000_257_421 | 50 |
| 680 | 3300048912 | Ga0496109_0551964 | Ga0496109_0551964_330_482 | 50 |
| 681 | 3300048913 | Ga0496110_0013566 | Ga0496110_0013566_5917_6081 | 50 |
| 682 | 3300048914 | Ga0496111_0071275 | Ga0496111_0071275_16_180 | 50 |
| 683 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_116588_116740 | 50 |
| 684 | 3300048915 | Ga0496112_0484197 | Ga0496112_0484197_962_1126 | 50 |
| 685 | 3300048915 | Ga0496112_0584444 | Ga0496112_0584444_532_684 | 50 |
| 686 | 3300048916 | Ga0496113_0163739 | Ga0496113_0163739_963_1115 | 50 |
| 687 | 3300048916 | Ga0496113_0246939 | Ga0496113_0246939_146_310 | 50 |
| 688 | 3300048917 | Ga0496114_0234191 | Ga0496114_0234191_291_443 | 50 |
| 689 | 3300048917 | Ga0496114_0916999 | Ga0496114_0916999_126_278 | 50 |
| 690 | 3300048918 | Ga0496115_0234694 | Ga0496115_0234694_597_761 | 50 |
| 691 | 3300048918 | Ga0496115_0276440 | Ga0496115_0276440_959_1123 | 50 |
| 692 | 3300048918 | Ga0496115_0370766 | Ga0496115_0370766_394_546 | 50 |
| 693 | 3300048918 | Ga0496115_0526797 | Ga0496115_0526797_700_852 | 50 |
| 694 | 3300048919 | Ga0496116_0369747 | Ga0496116_0369747_306_458 | 50 |
| 695 | 3300048919 | Ga0496116_0483301 | Ga0496116_0483301_101_253 | 50 |
| 696 | 3300048920 | Ga0496117_0037191 | Ga0496117_0037191_2834_2986 | 50 |
| 697 | 3300048921 | Ga0496118_0006481 | Ga0496118_0006481_4607_4759 | 50 |
| 698 | 3300048921 | Ga0496118_0022090 | Ga0496118_0022090_2327_2479 | 50 |
| 699 | 3300048921 | Ga0496118_0052105 | Ga0496118_0052105_684_836 | 50 |
| 700 | 3300048921 | Ga0496118_0453900 | Ga0496118_0453900_365_517 | 50 |
| 701 | 3300048922 | Ga0496119_0139502 | Ga0496119_0139502_555_707 | 50 |
| 702 | 3300048922 | Ga0496119_0157482 | Ga0496119_0157482_1035_1187 | 50 |
| 703 | 3300048922 | Ga0496119_0218062 | Ga0496119_0218062_384_536 | 50 |
| 704 | 3300048922 | Ga0496119_0226198 | Ga0496119_0226198_345_497 | 50 |
| 705 | 3300048924 | Ga0496121_0000456 | Ga0496121_0000456_34622_34774 | 50 |
| 706 | 3300048924 | Ga0496121_0005356 | Ga0496121_0005356_7372_7524 | 50 |
| 707 | 3300048924 | Ga0496121_0027220 | Ga0496121_0027220_559_738 | 50 |
| 708 | 3300048924 | Ga0496121_0062407 | Ga0496121_0062407_1200_1352 | 50 |
| 709 | 3300048924 | Ga0496121_0106637 | Ga0496121_0106637_1765_1917 | 50 |
| 710 | 3300048924 | Ga0496121_0206017 | Ga0496121_0206017_1191_1343 | 50 |
| 711 | 3300048924 | Ga0496121_0226379 | Ga0496121_0226379_948_1100 | 50 |
| 712 | 3300048925 | Ga0496122_0038748 | Ga0496122_0038748_1739_1891 | 50 |
| 713 | 3300048925 | Ga0496122_0331913 | Ga0496122_0331913_155_307 | 50 |
| 714 | 3300048925 | Ga0496122_0343466 | Ga0496122_0343466_505_657 | 50 |
| 715 | 3300048925 | Ga0496122_0605092 | Ga0496122_0605092_216_368 | 50 |
| 716 | 3300048926 | Ga0496123_0101339 | Ga0496123_0101339_47_199 | 50 |
| 717 | 3300048926 | Ga0496123_0300052 | Ga0496123_0300052_298_450 | 50 |
| 718 | 3300048927 | Ga0496124_0001010 | Ga0496124_0001010_1360_1512 | 50 |
| 719 | 3300048927 | Ga0496124_0141277 | Ga0496124_0141277_1474_1626 | 50 |
| 720 | 3300048927 | Ga0496124_0299355 | Ga0496124_0299355_180_332 | 50 |
| 721 | 3300048928 | Ga0496125_0000272 | Ga0496125_0000272_95054_95206 | 50 |
| 722 | 3300048928 | Ga0496125_0006804 | Ga0496125_0006804_1830_1982 | 50 |
| 723 | 3300048928 | Ga0496125_0026319 | Ga0496125_0026319_3964_4116 | 50 |
| 724 | 3300048928 | Ga0496125_0440152 | Ga0496125_0440152_49_201 | 50 |
| 725 | 3300048928 | Ga0496125_0522979 | Ga0496125_0522979_412_564 | 50 |
| 726 | 3300048929 | Ga0496126_0002820 | Ga0496126_0002820_21467_21619 | 50 |
| 727 | 3300048929 | Ga0496126_0010869 | Ga0496126_0010869_5041_5193 | 50 |
| 728 | 3300048929 | Ga0496126_0017190 | Ga0496126_0017190_697_849 | 50 |
| 729 | 3300048929 | Ga0496126_0022319 | Ga0496126_0022319_1520_1672 | 50 |
| 730 | 3300048929 | Ga0496126_0037772 | Ga0496126_0037772_3103_3255 | 50 |
| 731 | 3300048929 | Ga0496126_0085595 | Ga0496126_0085595_1079_1231 | 50 |
| 732 | 3300048929 | Ga0496126_0130347 | Ga0496126_0130347_1377_1529 | 50 |
| 733 | 3300048929 | Ga0496126_0132118 | Ga0496126_0132118_1104_1256 | 50 |
| 734 | 3300048929 | Ga0496126_0162002 | Ga0496126_0162002_1195_1347 | 50 |
| 735 | 3300048929 | Ga0496126_0322251 | Ga0496126_0322251_130_282 | 50 |
| 736 | 3300048929 | Ga0496126_0529996 | Ga0496126_0529996_582_734 | 50 |
| 737 | 3300048929 | Ga0496126_0763561 | Ga0496126_0763561_411_563 | 50 |
| 738 | 3300048929 | Ga0496126_0855724 | Ga0496126_0855724_94_246 | 50 |
| 739 | 3300048929 | Ga0496126_0876333 | Ga0496126_0876333_314_466 | 50 |
| 740 | 3300049568 | Ga0501031_0764065 | Ga0501031_0764065_416_583 | 50 |
| 741 | 3300049572 | Ga0501036_0506913 | Ga0501036_0506913_168_320 | 50 |
| 742 | 3300049573 | Ga0501037_0318506 | Ga0501037_0318506_333_485 | 50 |
| 743 | 3300049579 | Ga0501043_1205816 | Ga0501043_1205816_171_323 | 50 |
| 744 | 3300049583 | Ga0501067_0061344 | Ga0501067_0061344_994_1161 | 50 |
| 745 | 3300049583 | Ga0501067_0739114 | Ga0501067_0739114_79_231 | 50 |
| 746 | 3300049588 | Ga0501072_0812623 | Ga0501072_0812623_240_392 | 50 |
| 747 | 3300049588 | Ga0501072_0840148 | Ga0501072_0840148_352_519 | 50 |
| 748 | 3300049822 | Ga0501035_0316247 | Ga0501035_0316247_111_263 | 50 |
| 749 | 3300049823 | Ga0501044_1584184 | Ga0501044_1584184_149_301 | 50 |
| 750 | 3300050489 | nmdc:mga03683_440359_c1 | nmdc:mga03683_440359_c1_340_492 | 50 |
| 751 | 3300050490 | nmdc:mga03n38_107010_c1 | nmdc:mga03n38_107010_c1_1117_1269 | 50 |
| 752 | 3300050491 | nmdc:mga00v17_295619_c1 | nmdc:mga00v17_295619_c1_480_632 | 50 |
| 753 | 3300050491 | nmdc:mga00v17_473662_c1 | nmdc:mga00v17_473662_c1_645_797 | 50 |
| 754 | 3300050492 | nmdc:mga0yw44_1188402_c1 | nmdc:mga0yw44_1188402_c1_130_282 | 50 |
| 755 | 3300050493 | nmdc:mga0k408_894330_c1 | nmdc:mga0k408_894330_c1_256_408 | 50 |
| 756 | 3300050494 | nmdc:mga06z11_15312_c1 | nmdc:mga06z11_15312_c1_1790_1942 | 50 |
| 757 | 3300050496 | nmdc:mga07m45_548575_c1 | nmdc:mga07m45_548575_c1_402_569 | 50 |
| 758 | 3300050496 | nmdc:mga07m45_98117_c1 | nmdc:mga07m45_98117_c1_98_250 | 50 |
| 759 | 3300050511 | nmdc:mga08y16_671424_c1 | nmdc:mga08y16_671424_c1_170_322 | 50 |
| 760 | 3300050512 | nmdc:mga0n895_405781_c1 | nmdc:mga0n895_405781_c1_1055_1207 | 50 |
| 761 | 3300050512 | nmdc:mga0n895_606732_c1 | nmdc:mga0n895_606732_c1_223_375 | 50 |
| 762 | 3300053080 | Ga0500635_0020115 | Ga0500635_0020115_1700_1852 | 50 |
| 763 | 3300053080 | Ga0500635_0097419 | Ga0500635_0097419_688_840 | 50 |
| 764 | 3300053083 | Ga0495655_0339768 | Ga0495655_0339768_48_200 | 50 |
| 765 | 3300053084 | Ga0495595_0005251 | Ga0495595_0005251_1336_1500 | 50 |
| 766 | 3300053085 | Ga0495619_0002231 | Ga0495619_0002231_9391_9555 | 50 |
| 767 | 3300053085 | Ga0495619_0035165 | Ga0495619_0035165_1521_1673 | 50 |
| 768 | 3300053091 | Ga0500647_0069387 | Ga0500647_0069387_1314_1466 | 50 |
| 769 | 3300053091 | Ga0500647_0189726 | Ga0500647_0189726_160_312 | 50 |
| 770 | 3300053093 | Ga0500651_0257544 | Ga0500651_0257544_77_229 | 50 |
| 771 | 3300053093 | Ga0500651_0313457 | Ga0500651_0313457_451_603 | 50 |
| 772 | 3300053094 | Ga0500566_0000938 | Ga0500566_0000938_7167_7319 | 50 |
| 773 | 3300053094 | Ga0500566_0001308 | Ga0500566_0001308_10101_10253 | 50 |
| 774 | 3300053094 | Ga0500566_0134949 | Ga0500566_0134949_552_704 | 50 |
| 775 | 3300053095 | Ga0500640_003151 | Ga0500640_003151_4430_4582 | 50 |
| 776 | 3300053098 | Ga0500650_0166768 | Ga0500650_0166768_646_798 | 50 |
| 777 | 3300053102 | Ga0500554_043366 | Ga0500554_043366_521_673 | 50 |
| 778 | 3300053102 | Ga0500554_051279 | Ga0500554_051279_139_291 | 50 |
| 779 | 3300053106 | Ga0500558_199236 | Ga0500558_199236_392_544 | 50 |
| 780 | 3300053111 | Ga0500572_000217 | Ga0500572_000217_9457_9609 | 50 |
| 781 | 3300053116 | Ga0500592_037622 | Ga0500592_037622_456_608 | 50 |
| 782 | 3300053119 | Ga0500595_000324 | Ga0500595_000324_25881_26033 | 50 |
| 783 | 3300053119 | Ga0500595_002617 | Ga0500595_002617_4992_5144 | 50 |
| 784 | 3300053119 | Ga0500595_006868 | Ga0500595_006868_2711_2863 | 50 |
| 785 | 3300053119 | Ga0500595_025854 | Ga0500595_025854_1837_1989 | 50 |
| 786 | 3300053119 | Ga0500595_042239 | Ga0500595_042239_646_798 | 50 |
| 787 | 3300053120 | Ga0500597_397152 | Ga0500597_397152_199_351 | 50 |
| 788 | 3300053122 | Ga0500608_051766 | Ga0500608_051766_1763_1915 | 50 |
| 789 | 3300053123 | Ga0500614_005804 | Ga0500614_005804_2108_2260 | 50 |
| 790 | 3300053131 | Ga0500652_065775 | Ga0500652_065775_801_953 | 50 |
| 791 | 3300053136 | Ga0500559_0001486 | Ga0500559_0001486_5140_5292 | 50 |
| 792 | 3300053136 | Ga0500559_0018761 | Ga0500559_0018761_2048_2200 | 50 |
| 793 | 3300053136 | Ga0500559_0287895 | Ga0500559_0287895_97_249 | 50 |
| 794 | 3300053136 | Ga0500559_0315713 | Ga0500559_0315713_454_606 | 50 |
| 795 | 3300053139 | Ga0500568_0056098 | Ga0500568_0056098_767_919 | 50 |
| 796 | 3300053140 | Ga0500573_0015719 | Ga0500573_0015719_935_1087 | 50 |
| 797 | 3300053148 | Ga0500590_195182 | Ga0500590_195182_221_373 | 50 |
| 798 | 3300053150 | Ga0500603_000507 | Ga0500603_000507_8870_9022 | 50 |
| 799 | 3300053150 | Ga0500603_011705 | Ga0500603_011705_380_532 | 50 |
| 800 | 3300053150 | Ga0500603_058945 | Ga0500603_058945_684_836 | 50 |
| 801 | 3300053150 | Ga0500603_179537 | Ga0500603_179537_123_275 | 50 |
| 802 | 3300053154 | Ga0500619_312113 | Ga0500619_312113_68_220 | 50 |
| 803 | 3300053158 | Ga0500627_0118630 | Ga0500627_0118630_679_831 | 50 |
| 804 | 3300053159 | Ga0500630_000537 | Ga0500630_000537_1964_2116 | 50 |
| 805 | 3300053162 | Ga0500638_000078 | Ga0500638_000078_3444_3596 | 50 |
| 806 | 3300053162 | Ga0500638_002399 | Ga0500638_002399_543_695 | 50 |
| 807 | 3300053162 | Ga0500638_061923 | Ga0500638_061923_376_528 | 50 |
| 808 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_10604_10756 | 50 |
| 809 | 3300053163 | Ga0500639_115377 | Ga0500639_115377_457_609 | 50 |
| 810 | 3300053177 | Ga0500636_0008443 | Ga0500636_0008443_5105_5257 | 50 |
| 811 | 3300053177 | Ga0500636_0019204 | Ga0500636_0019204_3497_3649 | 50 |
| 812 | 3300053177 | Ga0500636_0066084 | Ga0500636_0066084_358_510 | 50 |
| 813 | 3300053177 | Ga0500636_0162190 | Ga0500636_0162190_869_1021 | 50 |
| 814 | 3300053177 | Ga0500636_0186634 | Ga0500636_0186634_210_362 | 50 |
| 815 | 3300053178 | Ga0500637_0000088 | Ga0500637_0000088_24780_24932 | 50 |
| 816 | 3300053178 | Ga0500637_0030575 | Ga0500637_0030575_1761_1913 | 50 |
| 817 | 3300053178 | Ga0500637_0117642 | Ga0500637_0117642_585_737 | 50 |
| 818 | 3300053178 | Ga0500637_0289334 | Ga0500637_0289334_115_267 | 50 |
| 819 | 3300053724 | Ga0500570_143918 | Ga0500570_143918_603_755 | 50 |
| 820 | 3300053725 | Ga0500576_095614 | Ga0500576_095614_329_481 | 50 |
| 821 | 3300053728 | Ga0500657_129993 | Ga0500657_129993_768_920 | 50 |
| 822 | 3300053730 | Ga0500645_083395 | Ga0500645_083395_738_890 | 50 |
| 823 | 3300053735 | Ga0500596_000054 | Ga0500596_000054_8830_8982 | 50 |
| 824 | 3300053735 | Ga0500596_033617 | Ga0500596_033617_44_196 | 50 |
| 825 | 3300053737 | Ga0500601_005425 | Ga0500601_005425_618_770 | 50 |
| 826 | 3300055283 | Ga0500661_000867 | Ga0500661_000867_722_874 | 50 |
| 827 | 3300055283 | Ga0500661_017471 | Ga0500661_017471_763_915 | 50 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar