F482521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 827 | 296 | 827 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300041496|Ga0451839_1503600|Ga0451839_1503600_85_507 |
| Length | 140 |
| Sequence | LKIGPAVDQQSDAPQRASNLPIPRWEFIALCAALMALNLVLLLWLLLRPRTFQVLIGLSLLSYAVNLFIFSVGSLSVGKEPIVKPGLAADLLNYTDPLPQSLVLTAIVIGFATTALFLVVLLALRGLSGGDHVDGQEERP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 205 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 216 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 217 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 218 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 219 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 220 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 225 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 277 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 293 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 294 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 295 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.38 |
| Nodule | 0.24 |
| Rhizoplane | 5.68 |
| Rhizosphere | 82.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10103843 | 3300003187 | Bacteria | 759 |
| 2 | rootH1_10353698 | 3300003323 | Bacteria | 1112 |
| 3 | Ga0055524_1003649 | 3300003775 | Bacteria | 7391 |
| 4 | Ga0055536_1049658 | 3300003781 | Bacteria | 930 |
| 5 | Ga0055536_1061605 | 3300003781 | Bacteria | 774 |
| 6 | Ga0055530_10003649 | 3300003791 | Bacteria | 8624 |
| 7 | Ga0055530_10003998 | 3300003791 | Bacteria | 7932 |
| 8 | Ga0055530_10004641 | 3300003791 | Bacteria | 6977 |
| 9 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 10 | Ga0055531_10000421 | 3300003794 | Bacteria | 40086 |
| 11 | Ga0055531_10010758 | 3300003794 | Bacteria | 4504 |
| 12 | Ga0055531_10018284 | 3300003794 | Bacteria | 2901 |
| 13 | Ga0055531_10019683 | 3300003794 | Bacteria | 2715 |
| 14 | Ga0065715_10141067 | 3300005293 | Bacteria | 1853 |
| 15 | Ga0070658_10263175 | 3300005327 | Bacteria | 1465 |
| 16 | Ga0070658_11130657 | 3300005327 | Bacteria | 681 |
| 17 | Ga0070658_11996095 | 3300005327 | Bacteria | 501 |
| 18 | Ga0070676_10003611 | 3300005328 | Bacteria | 8087 |
| 19 | Ga0070676_10026546 | 3300005328 | Bacteria | 3279 |
| 20 | Ga0070676_10043216 | 3300005328 | Bacteria | 2618 |
| 21 | Ga0070683_100033377 | 3300005329 | Bacteria | 4693 |
| 22 | Ga0070683_100034914 | 3300005329 | Bacteria | 4596 |
| 23 | Ga0070683_100229993 | 3300005329 | Bacteria | 1763 |
| 24 | Ga0070683_100252252 | 3300005329 | Bacteria | 1678 |
| 25 | Ga0070683_101460838 | 3300005329 | Bacteria | 657 |
| 26 | Ga0070690_100267869 | 3300005330 | Bacteria | 1214 |
| 27 | Ga0070670_100007539 | 3300005331 | Bacteria | 9235 |
| 28 | Ga0070670_100063864 | 3300005331 | Bacteria | 3159 |
| 29 | Ga0070670_100080214 | 3300005331 | Bacteria | 2804 |
| 30 | Ga0070670_100080990 | 3300005331 | Bacteria | 2790 |
| 31 | Ga0070670_100298203 | 3300005331 | Bacteria | 1409 |
| 32 | Ga0070670_100305713 | 3300005331 | Bacteria | 1392 |
| 33 | Ga0070670_100559334 | 3300005331 | Bacteria | 1021 |
| 34 | Ga0070670_100575611 | 3300005331 | Bacteria | 1006 |
| 35 | Ga0070670_101015510 | 3300005331 | Bacteria | 755 |
| 36 | Ga0070670_102177256 | 3300005331 | Bacteria | 511 |
| 37 | Ga0070677_10000436 | 3300005333 | Bacteria | 14318 |
| 38 | Ga0070677_10024851 | 3300005333 | Bacteria | 2232 |
| 39 | Ga0070677_10079066 | 3300005333 | Bacteria | 1402 |
| 40 | Ga0070677_10139840 | 3300005333 | Bacteria | 1115 |
| 41 | Ga0070677_10168012 | 3300005333 | Bacteria | 1034 |
| 42 | Ga0070677_10447102 | 3300005333 | Bacteria | 690 |
| 43 | Ga0068869_100008346 | 3300005334 | Bacteria | 6674 |
| 44 | Ga0070666_10974089 | 3300005335 | Bacteria | 629 |
| 45 | Ga0070680_100000586 | 3300005336 | Bacteria | 25133 |
| 46 | Ga0070680_100026731 | 3300005336 | Bacteria | 4616 |
| 47 | Ga0070680_100218356 | 3300005336 | Bacteria | 1609 |
| 48 | Ga0070680_100976905 | 3300005336 | Bacteria | 731 |
| 49 | Ga0068868_100007643 | 3300005338 | Bacteria | 7709 |
| 50 | Ga0068868_100011468 | 3300005338 | Bacteria | 6454 |
| 51 | Ga0068868_100128987 | 3300005338 | Bacteria | 2068 |
| 52 | Ga0068868_100223824 | 3300005338 | Bacteria | 1576 |
| 53 | Ga0070660_100049595 | 3300005339 | Bacteria | 3227 |
| 54 | Ga0070660_100210885 | 3300005339 | Bacteria | 1577 |
| 55 | Ga0070660_100473174 | 3300005339 | Bacteria | 1041 |
| 56 | Ga0070660_101183750 | 3300005339 | Bacteria | 648 |
| 57 | Ga0070689_100003713 | 3300005340 | Bacteria | 10208 |
| 58 | Ga0070689_100474273 | 3300005340 | Bacteria | 1068 |
| 59 | Ga0070661_100016902 | 3300005344 | Bacteria | 5165 |
| 60 | Ga0070661_101122403 | 3300005344 | Bacteria | 656 |
| 61 | Ga0070692_10917465 | 3300005345 | Bacteria | 607 |
| 62 | Ga0070668_100066238 | 3300005347 | Bacteria | 2802 |
| 63 | Ga0070669_100001794 | 3300005353 | Bacteria | 15423 |
| 64 | Ga0070669_100009265 | 3300005353 | Bacteria | 7015 |
| 65 | Ga0070669_100094109 | 3300005353 | Bacteria | 2251 |
| 66 | Ga0070669_100861574 | 3300005353 | Bacteria | 772 |
| 67 | Ga0070669_101522233 | 3300005353 | Bacteria | 582 |
| 68 | Ga0070669_101858097 | 3300005353 | Bacteria | 526 |
| 69 | Ga0070675_100001129 | 3300005354 | Bacteria | 19296 |
| 70 | Ga0070675_100003991 | 3300005354 | Bacteria | 11198 |
| 71 | Ga0070675_100035873 | 3300005354 | Bacteria | 4032 |
| 72 | Ga0070675_100047113 | 3300005354 | Bacteria | 3532 |
| 73 | Ga0070675_100408737 | 3300005354 | Bacteria | 1212 |
| 74 | Ga0070675_101327260 | 3300005354 | Bacteria | 663 |
| 75 | Ga0070675_101675986 | 3300005354 | Bacteria | 587 |
| 76 | Ga0070675_101868671 | 3300005354 | Bacteria | 554 |
| 77 | Ga0070675_101901554 | 3300005354 | Bacteria | 549 |
| 78 | Ga0070671_100000637 | 3300005355 | Bacteria | 25074 |
| 79 | Ga0070671_100009827 | 3300005355 | Bacteria | 7679 |
| 80 | Ga0070671_100035766 | 3300005355 | Bacteria | 4115 |
| 81 | Ga0070671_100037552 | 3300005355 | Bacteria | 4017 |
| 82 | Ga0070671_100052027 | 3300005355 | Bacteria | 3406 |
| 83 | Ga0070671_100104878 | 3300005355 | Bacteria | 2373 |
| 84 | Ga0070671_100212318 | 3300005355 | Bacteria | 1642 |
| 85 | Ga0070671_100378974 | 3300005355 | Bacteria | 1209 |
| 86 | Ga0070671_100597997 | 3300005355 | Bacteria | 953 |
| 87 | Ga0070671_100739078 | 3300005355 | Bacteria | 855 |
| 88 | Ga0070674_100003396 | 3300005356 | Bacteria | 8926 |
| 89 | Ga0070674_100021549 | 3300005356 | Bacteria | 4140 |
| 90 | Ga0070674_100241010 | 3300005356 | Bacteria | 1416 |
| 91 | Ga0070674_101563728 | 3300005356 | Bacteria | 594 |
| 92 | Ga0070673_100000618 | 3300005364 | Bacteria | 19459 |
| 93 | Ga0070673_100385853 | 3300005364 | Bacteria | 1250 |
| 94 | Ga0070673_100396751 | 3300005364 | Bacteria | 1233 |
| 95 | Ga0070688_100797903 | 3300005365 | Bacteria | 738 |
| 96 | Ga0070659_100000299 | 3300005366 | Bacteria | 38761 |
| 97 | Ga0070659_100033130 | 3300005366 | Bacteria | 4011 |
| 98 | Ga0070659_100281647 | 3300005366 | Bacteria | 1383 |
| 99 | Ga0070659_100685033 | 3300005366 | Bacteria | 885 |
| 100 | Ga0070659_101536019 | 3300005366 | Bacteria | 594 |
| 101 | Ga0070667_100032332 | 3300005367 | Bacteria | 4363 |
| 102 | Ga0070667_100718734 | 3300005367 | Bacteria | 925 |
| 103 | Ga0070667_100725245 | 3300005367 | Bacteria | 921 |
| 104 | Ga0070667_101085143 | 3300005367 | Bacteria | 748 |
| 105 | Ga0070701_10384898 | 3300005438 | Bacteria | 885 |
| 106 | Ga0070701_10989354 | 3300005438 | Bacteria | 586 |
| 107 | Ga0070700_101300051 | 3300005441 | Bacteria | 611 |
| 108 | Ga0070700_102007548 | 3300005441 | Bacteria | 502 |
| 109 | Ga0070694_101731628 | 3300005444 | Bacteria | 532 |
| 110 | Ga0070663_100009180 | 3300005455 | Bacteria | 6115 |
| 111 | Ga0070663_100539036 | 3300005455 | Bacteria | 974 |
| 112 | Ga0070663_101587416 | 3300005455 | Bacteria | 583 |
| 113 | Ga0070678_100004039 | 3300005456 | Bacteria | 8262 |
| 114 | Ga0070678_100060875 | 3300005456 | Bacteria | 2781 |
| 115 | Ga0070678_100078372 | 3300005456 | Bacteria | 2496 |
| 116 | Ga0070678_100236081 | 3300005456 | Bacteria | 1526 |
| 117 | Ga0070678_100244477 | 3300005456 | Bacteria | 1502 |
| 118 | Ga0070678_100911468 | 3300005456 | Bacteria | 804 |
| 119 | Ga0070678_101583914 | 3300005456 | Bacteria | 615 |
| 120 | Ga0070662_100002167 | 3300005457 | Bacteria | 12031 |
| 121 | Ga0070662_100004791 | 3300005457 | Bacteria | 8570 |
| 122 | Ga0070662_100177981 | 3300005457 | Bacteria | 1675 |
| 123 | Ga0070662_100539811 | 3300005457 | Bacteria | 976 |
| 124 | Ga0070662_101439074 | 3300005457 | Bacteria | 594 |
| 125 | Ga0070681_10005198 | 3300005458 | Bacteria | 12564 |
| 126 | Ga0070681_10031407 | 3300005458 | Bacteria | 5333 |
| 127 | Ga0070681_10053100 | 3300005458 | Bacteria | 4039 |
| 128 | Ga0070681_10324507 | 3300005458 | Bacteria | 1449 |
| 129 | Ga0068867_100000875 | 3300005459 | Bacteria | 20338 |
| 130 | Ga0068867_100011058 | 3300005459 | Bacteria | 6366 |
| 131 | Ga0068867_100057964 | 3300005459 | Bacteria | 2869 |
| 132 | Ga0068867_100067260 | 3300005459 | Bacteria | 2671 |
| 133 | Ga0068867_100553034 | 3300005459 | Bacteria | 997 |
| 134 | Ga0068867_101162066 | 3300005459 | Bacteria | 707 |
| 135 | Ga0070685_10259823 | 3300005466 | Bacteria | 1154 |
| 136 | Ga0070685_10636438 | 3300005466 | Bacteria | 771 |
| 137 | Ga0070685_11307428 | 3300005466 | Bacteria | 554 |
| 138 | Ga0070679_100000494 | 3300005530 | Bacteria | 33601 |
| 139 | Ga0070679_100016024 | 3300005530 | Bacteria | 7219 |
| 140 | Ga0070679_100025313 | 3300005530 | Bacteria | 5822 |
| 141 | Ga0070679_100058607 | 3300005530 | Bacteria | 3837 |
| 142 | Ga0070679_100180437 | 3300005530 | Bacteria | 2084 |
| 143 | Ga0070679_101436969 | 3300005530 | Bacteria | 636 |
| 144 | Ga0070684_100260809 | 3300005535 | Bacteria | 1585 |
| 145 | Ga0070684_100364840 | 3300005535 | Bacteria | 1329 |
| 146 | Ga0068853_100001261 | 3300005539 | Bacteria | 18108 |
| 147 | Ga0068853_100039194 | 3300005539 | Bacteria | 4041 |
| 148 | Ga0068853_100249060 | 3300005539 | Bacteria | 1630 |
| 149 | Ga0068853_100391325 | 3300005539 | Bacteria | 1300 |
| 150 | Ga0068853_100507614 | 3300005539 | Bacteria | 1139 |
| 151 | Ga0070672_100000400 | 3300005543 | Bacteria | 25060 |
| 152 | Ga0070672_100045480 | 3300005543 | Bacteria | 3396 |
| 153 | Ga0070672_100064606 | 3300005543 | Bacteria | 2892 |
| 154 | Ga0070672_100156876 | 3300005543 | Bacteria | 1885 |
| 155 | Ga0070672_100383619 | 3300005543 | Bacteria | 1202 |
| 156 | Ga0070672_101022668 | 3300005543 | Bacteria | 733 |
| 157 | Ga0070672_101221836 | 3300005543 | Bacteria | 670 |
| 158 | Ga0070696_101066061 | 3300005546 | Bacteria | 678 |
| 159 | Ga0070693_100009475 | 3300005547 | Bacteria | 4845 |
| 160 | Ga0070693_100011659 | 3300005547 | Bacteria | 4430 |
| 161 | Ga0070693_100464487 | 3300005547 | Bacteria | 891 |
| 162 | Ga0070693_100477283 | 3300005547 | Bacteria | 880 |
| 163 | Ga0070665_101002257 | 3300005548 | Bacteria | 847 |
| 164 | Ga0068855_100000309 | 3300005563 | Bacteria | 60596 |
| 165 | Ga0068855_100063382 | 3300005563 | Bacteria | 4313 |
| 166 | Ga0068855_100190443 | 3300005563 | Bacteria | 2314 |
| 167 | Ga0068855_100194874 | 3300005563 | Bacteria | 2283 |
| 168 | Ga0070664_100000031 | 3300005564 | Bacteria | 88513 |
| 169 | Ga0070664_100004875 | 3300005564 | Bacteria | 10755 |
| 170 | Ga0070664_100074046 | 3300005564 | Bacteria | 2922 |
| 171 | Ga0070664_100136575 | 3300005564 | Bacteria | 2156 |
| 172 | Ga0070664_100436422 | 3300005564 | Bacteria | 1201 |
| 173 | Ga0070664_100702991 | 3300005564 | Bacteria | 942 |
| 174 | Ga0070664_100703397 | 3300005564 | Bacteria | 942 |
| 175 | Ga0070664_100773506 | 3300005564 | Bacteria | 897 |
| 176 | Ga0070664_100953427 | 3300005564 | Bacteria | 805 |
| 177 | Ga0068857_100010752 | 3300005577 | Bacteria | 7964 |
| 178 | Ga0068857_100030589 | 3300005577 | Bacteria | 4755 |
| 179 | Ga0068854_100003381 | 3300005578 | Bacteria | 9941 |
| 180 | Ga0068854_100159916 | 3300005578 | Bacteria | 1743 |
| 181 | Ga0068854_100239014 | 3300005578 | Bacteria | 1445 |
| 182 | Ga0068854_100851303 | 3300005578 | Bacteria | 798 |
| 183 | Ga0068854_101314675 | 3300005578 | Bacteria | 651 |
| 184 | Ga0068856_100026185 | 3300005614 | Bacteria | 5687 |
| 185 | Ga0068856_100147656 | 3300005614 | Bacteria | 2359 |
| 186 | Ga0068856_100175772 | 3300005614 | Bacteria | 2153 |
| 187 | Ga0068856_100256675 | 3300005614 | Bacteria | 1763 |
| 188 | Ga0068856_101031093 | 3300005614 | Bacteria | 841 |
| 189 | Ga0070702_100030098 | 3300005615 | Bacteria | 2957 |
| 190 | Ga0070702_100208896 | 3300005615 | Bacteria | 1298 |
| 191 | Ga0070702_100466673 | 3300005615 | Bacteria | 919 |
| 192 | Ga0070702_100541886 | 3300005615 | Bacteria | 862 |
| 193 | Ga0068852_100001773 | 3300005616 | Bacteria | 14690 |
| 194 | Ga0068852_100039595 | 3300005616 | Bacteria | 3969 |
| 195 | Ga0068852_100115864 | 3300005616 | Bacteria | 2444 |
| 196 | Ga0068852_100183913 | 3300005616 | Bacteria | 1967 |
| 197 | Ga0068852_100480101 | 3300005616 | Bacteria | 1235 |
| 198 | Ga0068852_100481378 | 3300005616 | Bacteria | 1233 |
| 199 | Ga0068852_100758413 | 3300005616 | Bacteria | 983 |
| 200 | Ga0068852_101155003 | 3300005616 | Bacteria | 795 |
| 201 | Ga0068859_100236647 | 3300005617 | Bacteria | 1915 |
| 202 | Ga0068864_100002319 | 3300005618 | Bacteria | 15745 |
| 203 | Ga0068864_100010339 | 3300005618 | Bacteria | 7707 |
| 204 | Ga0068864_100143930 | 3300005618 | Bacteria | 2153 |
| 205 | Ga0068864_102530601 | 3300005618 | Bacteria | 519 |
| 206 | Ga0068866_11013914 | 3300005718 | Bacteria | 590 |
| 207 | Ga0068866_11395829 | 3300005718 | Bacteria | 512 |
| 208 | Ga0068861_100001606 | 3300005719 | Bacteria | 14396 |
| 209 | Ga0068861_100054926 | 3300005719 | Bacteria | 3036 |
| 210 | Ga0068861_100101587 | 3300005719 | Bacteria | 2288 |
| 211 | Ga0068861_100531966 | 3300005719 | Bacteria | 1068 |
| 212 | Ga0068861_101705137 | 3300005719 | Bacteria | 623 |
| 213 | Ga0068851_10010030 | 3300005834 | Bacteria | 4412 |
| 214 | Ga0068851_10089765 | 3300005834 | Bacteria | 1617 |
| 215 | Ga0068851_10145029 | 3300005834 | Bacteria | 1294 |
| 216 | Ga0068851_10236155 | 3300005834 | Bacteria | 1032 |
| 217 | Ga0068851_10374718 | 3300005834 | Bacteria | 833 |
| 218 | Ga0068851_10532135 | 3300005834 | Bacteria | 708 |
| 219 | Ga0068870_10006793 | 3300005840 | Bacteria | 5071 |
| 220 | Ga0068870_10042702 | 3300005840 | Bacteria | 2362 |
| 221 | Ga0068870_10128761 | 3300005840 | Bacteria | 1468 |
| 222 | Ga0068870_11013112 | 3300005840 | Bacteria | 593 |
| 223 | Ga0068863_100009106 | 3300005841 | Bacteria | 9694 |
| 224 | Ga0068863_100500600 | 3300005841 | Bacteria | 1196 |
| 225 | Ga0068858_100025977 | 3300005842 | Bacteria | 5446 |
| 226 | Ga0068858_100053674 | 3300005842 | Bacteria | 3728 |
| 227 | Ga0068860_101099543 | 3300005843 | Bacteria | 814 |
| 228 | Ga0068862_100249447 | 3300005844 | Bacteria | 1617 |
| 229 | Ga0068862_100259758 | 3300005844 | Bacteria | 1585 |
| 230 | Ga0068862_101480318 | 3300005844 | Bacteria | 684 |
| 231 | Ga0081455_10389566 | 3300005937 | Bacteria | 971 |
| 232 | Ga0070717_12138186 | 3300006028 | Bacteria | 503 |
| 233 | Ga0075365_10886406 | 3300006038 | Bacteria | 629 |
| 234 | Ga0075364_10010694 | 3300006051 | Bacteria | 5550 |
| 235 | Ga0075364_10066606 | 3300006051 | Bacteria | 2366 |
| 236 | Ga0075367_10635618 | 3300006178 | Bacteria | 679 |
| 237 | Ga0075367_10755755 | 3300006178 | Bacteria | 619 |
| 238 | Ga0075369_10046118 | 3300006186 | Bacteria | 1876 |
| 239 | Ga0075366_10018918 | 3300006195 | Bacteria | 3981 |
| 240 | Ga0075366_10098444 | 3300006195 | Bacteria | 1754 |
| 241 | Ga0075366_10153202 | 3300006195 | Bacteria | 1396 |
| 242 | Ga0075366_10780386 | 3300006195 | Bacteria | 594 |
| 243 | Ga0097621_100001028 | 3300006237 | Bacteria | 19599 |
| 244 | Ga0097621_100001820 | 3300006237 | Bacteria | 14645 |
| 245 | Ga0097621_100025288 | 3300006237 | Bacteria | 4643 |
| 246 | Ga0075370_10234150 | 3300006353 | Bacteria | 1087 |
| 247 | Ga0075370_10516446 | 3300006353 | Bacteria | 721 |
| 248 | Ga0068871_100023518 | 3300006358 | Bacteria | 4769 |
| 249 | Ga0068871_100075366 | 3300006358 | Bacteria | 2785 |
| 250 | Ga0068871_100095080 | 3300006358 | Bacteria | 2488 |
| 251 | Ga0068871_100228184 | 3300006358 | Bacteria | 1615 |
| 252 | Ga0068871_102122932 | 3300006358 | Bacteria | 535 |
| 253 | Ga0075428_100432013 | 3300006844 | Bacteria | 1411 |
| 254 | Ga0075430_100009987 | 3300006846 | Bacteria | 8031 |
| 255 | Ga0075429_100531279 | 3300006880 | Bacteria | 1031 |
| 256 | Ga0068865_100310014 | 3300006881 | Bacteria | 1266 |
| 257 | Ga0068865_100347227 | 3300006881 | Bacteria | 1201 |
| 258 | Ga0068865_100676437 | 3300006881 | Bacteria | 880 |
| 259 | Ga0068865_102053755 | 3300006881 | Bacteria | 519 |
| 260 | Ga0097620_100236633 | 3300006931 | Bacteria | 1915 |
| 261 | Ga0079104_1000323 | 3300006946 | Bacteria | 58919 |
| 262 | Ga0105240_10001586 | 3300009093 | Bacteria | 38590 |
| 263 | Ga0105240_10029765 | 3300009093 | Bacteria | 7106 |
| 264 | Ga0105240_10118570 | 3300009093 | Bacteria | 3189 |
| 265 | Ga0105240_11044183 | 3300009093 | Bacteria | 872 |
| 266 | Ga0111539_10288905 | 3300009094 | Bacteria | 1908 |
| 267 | Ga0111539_11478023 | 3300009094 | Bacteria | 788 |
| 268 | Ga0111539_11549336 | 3300009094 | Bacteria | 769 |
| 269 | Ga0105245_10001868 | 3300009098 | Bacteria | 19142 |
| 270 | Ga0105245_11047526 | 3300009098 | Bacteria | 861 |
| 271 | Ga0105243_10178818 | 3300009148 | Bacteria | 1843 |
| 272 | Ga0105243_10698514 | 3300009148 | Bacteria | 988 |
| 273 | Ga0105241_10018397 | 3300009174 | Bacteria | 5140 |
| 274 | Ga0105241_10364206 | 3300009174 | Bacteria | 1259 |
| 275 | Ga0105242_10609812 | 3300009176 | Bacteria | 1055 |
| 276 | Ga0105242_11330563 | 3300009176 | Bacteria | 743 |
| 277 | Ga0105242_12119337 | 3300009176 | Bacteria | 606 |
| 278 | Ga0105248_10000754 | 3300009177 | Bacteria | 36253 |
| 279 | Ga0105248_10694062 | 3300009177 | Bacteria | 1148 |
| 280 | Ga0105248_10754771 | 3300009177 | Bacteria | 1098 |
| 281 | Ga0105248_10779785 | 3300009177 | Bacteria | 1079 |
| 282 | Ga0105237_10200033 | 3300009545 | Bacteria | 1997 |
| 283 | Ga0105238_10001396 | 3300009551 | Bacteria | 24223 |
| 284 | Ga0105238_10002093 | 3300009551 | Bacteria | 20156 |
| 285 | Ga0105238_10030317 | 3300009551 | Bacteria | 5505 |
| 286 | Ga0105238_10033433 | 3300009551 | Bacteria | 5234 |
| 287 | Ga0105238_11032618 | 3300009551 | Unclassified | 843 |
| 288 | Ga0105249_10677211 | 3300009553 | Bacteria | 1090 |
| 289 | Ga0105249_11980538 | 3300009553 | Bacteria | 655 |
| 290 | Ga0105033_125090 | 3300009986 | Bacteria | 547 |
| 291 | Ga0105239_11131907 | 3300010375 | Bacteria | 901 |
| 292 | Ga0105246_10148056 | 3300011119 | Bacteria | 1774 |
| 293 | Ga0105246_12176250 | 3300011119 | Bacteria | 539 |
| 294 | Ga0157319_1030212 | 3300012497 | Bacteria | 581 |
| 295 | Ga0157373_10746776 | 3300013100 | Bacteria | 719 |
| 296 | Ga0157371_10191126 | 3300013102 | Bacteria | 1466 |
| 297 | Ga0157370_10001132 | 3300013104 | Bacteria | 33324 |
| 298 | Ga0157370_10017855 | 3300013104 | Bacteria | 7150 |
| 299 | Ga0157370_10075988 | 3300013104 | Bacteria | 3165 |
| 300 | Ga0157370_11325608 | 3300013104 | Bacteria | 648 |
| 301 | Ga0157370_11369806 | 3300013104 | Bacteria | 637 |
| 302 | Ga0157369_10022325 | 3300013105 | Bacteria | 7064 |
| 303 | Ga0157369_10051767 | 3300013105 | Bacteria | 4443 |
| 304 | Ga0157369_10112241 | 3300013105 | Bacteria | 2896 |
| 305 | Ga0157369_10136461 | 3300013105 | Bacteria | 2597 |
| 306 | Ga0157374_10027879 | 3300013296 | Bacteria | 5099 |
| 307 | Ga0157374_10041915 | 3300013296 | Bacteria | 4221 |
| 308 | Ga0157374_10119421 | 3300013296 | Bacteria | 2543 |
| 309 | Ga0157374_10478640 | 3300013296 | Bacteria | 1248 |
| 310 | Ga0157378_10263095 | 3300013297 | Bacteria | 1656 |
| 311 | Ga0163162_10001583 | 3300013306 | Bacteria | 21267 |
| 312 | Ga0163162_10524149 | 3300013306 | Bacteria | 1314 |
| 313 | Ga0163162_11300898 | 3300013306 | Bacteria | 826 |
| 314 | Ga0163162_11319016 | 3300013306 | Bacteria | 820 |
| 315 | Ga0157372_10001146 | 3300013307 | Bacteria | 28770 |
| 316 | Ga0157372_10019925 | 3300013307 | Bacteria | 7231 |
| 317 | Ga0157372_10057931 | 3300013307 | Bacteria | 4331 |
| 318 | Ga0157372_11077643 | 3300013307 | Bacteria | 930 |
| 319 | Ga0157372_11213207 | 3300013307 | Bacteria | 872 |
| 320 | Ga0157375_10139776 | 3300013308 | Bacteria | 2548 |
| 321 | Ga0157375_10190922 | 3300013308 | Bacteria | 2203 |
| 322 | Ga0157375_10261605 | 3300013308 | Bacteria | 1892 |
| 323 | Ga0157375_10570924 | 3300013308 | Bacteria | 1292 |
| 324 | Ga0157375_10763906 | 3300013308 | Bacteria | 1117 |
| 325 | Ga0157375_11312931 | 3300013308 | Bacteria | 851 |
| 326 | Ga0163163_10030620 | 3300014325 | Bacteria | 5187 |
| 327 | Ga0163163_10048001 | 3300014325 | Bacteria | 4197 |
| 328 | Ga0163163_11385009 | 3300014325 | Bacteria | 765 |
| 329 | Ga0157380_10274037 | 3300014326 | Bacteria | 1540 |
| 330 | Ga0157380_10329498 | 3300014326 | Bacteria | 1419 |
| 331 | Ga0157380_10386691 | 3300014326 | Bacteria | 1322 |
| 332 | Ga0157380_10533037 | 3300014326 | Bacteria | 1148 |
| 333 | Ga0157377_10699618 | 3300014745 | Bacteria | 736 |
| 334 | Ga0157379_10004830 | 3300014968 | Bacteria | 11576 |
| 335 | Ga0157379_11285034 | 3300014968 | Bacteria | 706 |
| 336 | Ga0157376_10000239 | 3300014969 | Bacteria | 38460 |
| 337 | Ga0157376_10029763 | 3300014969 | Bacteria | 4353 |
| 338 | Ga0157376_10130674 | 3300014969 | Bacteria | 2240 |
| 339 | Ga0182007_10243198 | 3300015262 | Bacteria | 643 |
| 340 | Ga0163161_10011060 | 3300017792 | Bacteria | 6250 |
| 341 | Ga0163161_10051203 | 3300017792 | Bacteria | 2990 |
| 342 | Ga0163161_10053006 | 3300017792 | Bacteria | 2941 |
| 343 | Ga0163161_10925239 | 3300017792 | Bacteria | 740 |
| 344 | Ga0163161_11271185 | 3300017792 | Bacteria | 639 |
| 345 | Ga0209130_1002397 | 3300025284 | Bacteria | 9477 |
| 346 | Ga0209675_1020775 | 3300025291 | Bacteria | 1769 |
| 347 | Ga0209675_1025961 | 3300025291 | Bacteria | 1467 |
| 348 | Ga0209676_1001669 | 3300025292 | Bacteria | 19275 |
| 349 | Ga0209676_1003028 | 3300025292 | Bacteria | 10897 |
| 350 | Ga0209025_1000401 | 3300025294 | Bacteria | 88709 |
| 351 | Ga0209025_1190719 | 3300025294 | Bacteria | 515 |
| 352 | Ga0209564_1012372 | 3300025295 | Bacteria | 3724 |
| 353 | Ga0209564_1031657 | 3300025295 | Bacteria | 1611 |
| 354 | Ga0209758_1008210 | 3300025297 | Bacteria | 6839 |
| 355 | Ga0209050_1000583 | 3300025298 | Bacteria | 59089 |
| 356 | Ga0209050_1003787 | 3300025298 | Bacteria | 10810 |
| 357 | Ga0209050_1005409 | 3300025298 | Bacteria | 8053 |
| 358 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 359 | Ga0209256_1000178 | 3300025299 | Bacteria | 125165 |
| 360 | Ga0209256_1001335 | 3300025299 | Bacteria | 26336 |
| 361 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 362 | Ga0209051_1022792 | 3300025303 | Bacteria | 2625 |
| 363 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 364 | Ga0209257_1000400 | 3300025304 | Bacteria | 84778 |
| 365 | Ga0209257_1000498 | 3300025304 | Bacteria | 70112 |
| 366 | Ga0209257_1010761 | 3300025304 | Bacteria | 4552 |
| 367 | Ga0207697_10001625 | 3300025315 | Bacteria | 12141 |
| 368 | Ga0207697_10029344 | 3300025315 | Bacteria | 2251 |
| 369 | Ga0207656_10009912 | 3300025321 | Bacteria | 3549 |
| 370 | Ga0207656_10212944 | 3300025321 | Bacteria | 937 |
| 371 | Ga0207682_10000563 | 3300025893 | Bacteria | 17166 |
| 372 | Ga0207682_10006506 | 3300025893 | Bacteria | 4700 |
| 373 | Ga0207682_10009090 | 3300025893 | Bacteria | 3925 |
| 374 | Ga0207682_10016549 | 3300025893 | Bacteria | 2877 |
| 375 | Ga0207682_10123240 | 3300025893 | Bacteria | 1151 |
| 376 | Ga0207682_10364121 | 3300025893 | Bacteria | 682 |
| 377 | Ga0207688_10033375 | 3300025901 | Bacteria | 2846 |
| 378 | Ga0207688_10291234 | 3300025901 | Bacteria | 997 |
| 379 | Ga0207688_10385579 | 3300025901 | Bacteria | 867 |
| 380 | Ga0207680_10161244 | 3300025903 | Bacteria | 1504 |
| 381 | Ga0207680_10545438 | 3300025903 | Bacteria | 828 |
| 382 | Ga0207645_10054247 | 3300025907 | Bacteria | 2560 |
| 383 | Ga0207645_10085797 | 3300025907 | Bacteria | 2022 |
| 384 | Ga0207645_10262169 | 3300025907 | Bacteria | 1145 |
| 385 | Ga0207645_10307518 | 3300025907 | Bacteria | 1056 |
| 386 | Ga0207643_10010469 | 3300025908 | Bacteria | 4995 |
| 387 | Ga0207643_10126588 | 3300025908 | Bacteria | 1517 |
| 388 | Ga0207643_10208576 | 3300025908 | Bacteria | 1192 |
| 389 | Ga0207705_10362683 | 3300025909 | Bacteria | 1117 |
| 390 | Ga0207705_10424295 | 3300025909 | Bacteria | 1030 |
| 391 | Ga0207705_10483172 | 3300025909 | Bacteria | 961 |
| 392 | Ga0207654_10050927 | 3300025911 | Bacteria | 2381 |
| 393 | Ga0207707_10000287 | 3300025912 | Bacteria | 53641 |
| 394 | Ga0207707_10011739 | 3300025912 | Bacteria | 7623 |
| 395 | Ga0207707_10040426 | 3300025912 | Bacteria | 4073 |
| 396 | Ga0207707_10145809 | 3300025912 | Bacteria | 2069 |
| 397 | Ga0207707_10521286 | 3300025912 | Bacteria | 1012 |
| 398 | Ga0207695_10012750 | 3300025913 | Bacteria | 10063 |
| 399 | Ga0207695_10044326 | 3300025913 | Bacteria | 4732 |
| 400 | Ga0207695_10560117 | 3300025913 | Bacteria | 1024 |
| 401 | Ga0207695_11115976 | 3300025913 | Bacteria | 668 |
| 402 | Ga0207671_10480744 | 3300025914 | Bacteria | 990 |
| 403 | Ga0207660_10005852 | 3300025917 | Bacteria | 7981 |
| 404 | Ga0207660_10041393 | 3300025917 | Bacteria | 3228 |
| 405 | Ga0207660_10117727 | 3300025917 | Bacteria | 2008 |
| 406 | Ga0207660_10828924 | 3300025917 | Bacteria | 755 |
| 407 | Ga0207657_10023128 | 3300025919 | Bacteria | 5794 |
| 408 | Ga0207657_10202480 | 3300025919 | Bacteria | 1596 |
| 409 | Ga0207657_10932216 | 3300025919 | Bacteria | 668 |
| 410 | Ga0207649_10004693 | 3300025920 | Bacteria | 7392 |
| 411 | Ga0207649_10014193 | 3300025920 | Bacteria | 4458 |
| 412 | Ga0207649_10095333 | 3300025920 | Bacteria | 1958 |
| 413 | Ga0207649_10412082 | 3300025920 | Bacteria | 1013 |
| 414 | Ga0207649_10413521 | 3300025920 | Bacteria | 1012 |
| 415 | Ga0207649_10827497 | 3300025920 | Bacteria | 724 |
| 416 | Ga0207652_10005817 | 3300025921 | Bacteria | 10000 |
| 417 | Ga0207652_10046539 | 3300025921 | Bacteria | 3701 |
| 418 | Ga0207652_10059126 | 3300025921 | Bacteria | 3304 |
| 419 | Ga0207652_10187214 | 3300025921 | Bacteria | 1861 |
| 420 | Ga0207652_10736225 | 3300025921 | Bacteria | 878 |
| 421 | Ga0207652_11254293 | 3300025921 | Bacteria | 643 |
| 422 | Ga0207652_11263709 | 3300025921 | Bacteria | 641 |
| 423 | Ga0207681_10109314 | 3300025923 | Bacteria | 2008 |
| 424 | Ga0207681_10121383 | 3300025923 | Bacteria | 1917 |
| 425 | Ga0207694_10005307 | 3300025924 | Bacteria | 9931 |
| 426 | Ga0207694_10047004 | 3300025924 | Bacteria | 3337 |
| 427 | Ga0207694_10306590 | 3300025924 | Bacteria | 1308 |
| 428 | Ga0207650_10001487 | 3300025925 | Bacteria | 16806 |
| 429 | Ga0207650_10022541 | 3300025925 | Bacteria | 4457 |
| 430 | Ga0207650_10040917 | 3300025925 | Bacteria | 3394 |
| 431 | Ga0207650_10049495 | 3300025925 | Bacteria | 3103 |
| 432 | Ga0207650_10054873 | 3300025925 | Bacteria | 2957 |
| 433 | Ga0207650_10243718 | 3300025925 | Bacteria | 1453 |
| 434 | Ga0207650_10603214 | 3300025925 | Bacteria | 923 |
| 435 | Ga0207650_10750948 | 3300025925 | Bacteria | 825 |
| 436 | Ga0207650_11703724 | 3300025925 | Bacteria | 534 |
| 437 | Ga0207659_10000842 | 3300025926 | Bacteria | 18164 |
| 438 | Ga0207659_10009447 | 3300025926 | Bacteria | 6095 |
| 439 | Ga0207659_10039817 | 3300025926 | Bacteria | 3282 |
| 440 | Ga0207659_10050449 | 3300025926 | Bacteria | 2956 |
| 441 | Ga0207659_10058256 | 3300025926 | Bacteria | 2772 |
| 442 | Ga0207659_10159418 | 3300025926 | Bacteria | 1770 |
| 443 | Ga0207644_10000239 | 3300025931 | Bacteria | 37746 |
| 444 | Ga0207644_10001162 | 3300025931 | Bacteria | 16884 |
| 445 | Ga0207644_10055205 | 3300025931 | Bacteria | 2863 |
| 446 | Ga0207644_10081456 | 3300025931 | Bacteria | 2392 |
| 447 | Ga0207644_10358012 | 3300025931 | Bacteria | 1186 |
| 448 | Ga0207690_10004609 | 3300025932 | Bacteria | 8151 |
| 449 | Ga0207690_10037289 | 3300025932 | Bacteria | 3155 |
| 450 | Ga0207690_10265733 | 3300025932 | Bacteria | 1331 |
| 451 | Ga0207690_10570877 | 3300025932 | Bacteria | 921 |
| 452 | Ga0207706_10001645 | 3300025933 | Bacteria | 22114 |
| 453 | Ga0207706_10018070 | 3300025933 | Bacteria | 6344 |
| 454 | Ga0207706_10156228 | 3300025933 | Bacteria | 2006 |
| 455 | Ga0207686_10958455 | 3300025934 | Bacteria | 693 |
| 456 | Ga0207709_10271086 | 3300025935 | Bacteria | 1249 |
| 457 | Ga0207670_10008010 | 3300025936 | Bacteria | 5938 |
| 458 | Ga0207669_10000691 | 3300025937 | Bacteria | 14547 |
| 459 | Ga0207669_10003216 | 3300025937 | Bacteria | 7059 |
| 460 | Ga0207669_10165937 | 3300025937 | Bacteria | 1566 |
| 461 | Ga0207669_11024990 | 3300025937 | Bacteria | 694 |
| 462 | Ga0207669_11208669 | 3300025937 | Bacteria | 640 |
| 463 | Ga0207704_10029915 | 3300025938 | Bacteria | 3046 |
| 464 | Ga0207691_10004292 | 3300025940 | Bacteria | 13846 |
| 465 | Ga0207691_10016122 | 3300025940 | Bacteria | 7097 |
| 466 | Ga0207691_10301632 | 3300025940 | Bacteria | 1376 |
| 467 | Ga0207691_10325210 | 3300025940 | Bacteria | 1318 |
| 468 | Ga0207691_10400419 | 3300025940 | Bacteria | 1171 |
| 469 | Ga0207691_10457116 | 3300025940 | Bacteria | 1086 |
| 470 | Ga0207691_11232899 | 3300025940 | Bacteria | 619 |
| 471 | Ga0207711_10001648 | 3300025941 | Bacteria | 20599 |
| 472 | Ga0207689_10001354 | 3300025942 | Bacteria | 23520 |
| 473 | Ga0207661_10045569 | 3300025944 | Bacteria | 3472 |
| 474 | Ga0207661_10221684 | 3300025944 | Bacteria | 1672 |
| 475 | Ga0207679_10000127 | 3300025945 | Bacteria | 62374 |
| 476 | Ga0207679_10002362 | 3300025945 | Bacteria | 11613 |
| 477 | Ga0207679_10003480 | 3300025945 | Bacteria | 9732 |
| 478 | Ga0207679_10023601 | 3300025945 | Bacteria | 4208 |
| 479 | Ga0207679_10052355 | 3300025945 | Bacteria | 2994 |
| 480 | Ga0207679_10103188 | 3300025945 | Bacteria | 2234 |
| 481 | Ga0207679_10481540 | 3300025945 | Bacteria | 1105 |
| 482 | Ga0207679_11030432 | 3300025945 | Bacteria | 755 |
| 483 | Ga0207679_11787250 | 3300025945 | Bacteria | 562 |
| 484 | Ga0207667_10005072 | 3300025949 | Bacteria | 16091 |
| 485 | Ga0207667_10053783 | 3300025949 | Bacteria | 4235 |
| 486 | Ga0207667_10142742 | 3300025949 | Bacteria | 2465 |
| 487 | Ga0207667_11779758 | 3300025949 | Bacteria | 581 |
| 488 | Ga0207651_10001068 | 3300025960 | Bacteria | 12168 |
| 489 | Ga0207651_10009955 | 3300025960 | Bacteria | 5240 |
| 490 | Ga0207651_10177425 | 3300025960 | Bacteria | 1686 |
| 491 | Ga0207651_11720394 | 3300025960 | Bacteria | 565 |
| 492 | Ga0207668_10273271 | 3300025972 | Bacteria | 1382 |
| 493 | Ga0207668_11724567 | 3300025972 | Bacteria | 565 |
| 494 | Ga0207640_10140847 | 3300025981 | Bacteria | 1758 |
| 495 | Ga0207640_10300138 | 3300025981 | Bacteria | 1270 |
| 496 | Ga0207640_10337025 | 3300025981 | Bacteria | 1207 |
| 497 | Ga0207640_10366067 | 3300025981 | Bacteria | 1163 |
| 498 | Ga0207640_10828043 | 3300025981 | Bacteria | 804 |
| 499 | Ga0207640_10922757 | 3300025981 | Bacteria | 764 |
| 500 | Ga0207640_11171199 | 3300025981 | Bacteria | 682 |
| 501 | Ga0207640_11738277 | 3300025981 | Bacteria | 563 |
| 502 | Ga0207658_10199097 | 3300025986 | Bacteria | 1671 |
| 503 | Ga0207677_10002459 | 3300026023 | Bacteria | 9739 |
| 504 | Ga0207677_10090591 | 3300026023 | Bacteria | 2223 |
| 505 | Ga0207677_10890784 | 3300026023 | Bacteria | 802 |
| 506 | Ga0207677_11116929 | 3300026023 | Bacteria | 719 |
| 507 | Ga0207677_11392180 | 3300026023 | Bacteria | 646 |
| 508 | Ga0207703_10033505 | 3300026035 | Bacteria | 4073 |
| 509 | Ga0207703_10071135 | 3300026035 | Bacteria | 2873 |
| 510 | Ga0207639_10035006 | 3300026041 | Bacteria | 3715 |
| 511 | Ga0207639_10864969 | 3300026041 | Bacteria | 844 |
| 512 | Ga0207639_11111393 | 3300026041 | Bacteria | 741 |
| 513 | Ga0207678_10003424 | 3300026067 | Bacteria | 14286 |
| 514 | Ga0207678_10019215 | 3300026067 | Bacteria | 6000 |
| 515 | Ga0207678_10296096 | 3300026067 | Bacteria | 1390 |
| 516 | Ga0207678_10367488 | 3300026067 | Bacteria | 1242 |
| 517 | Ga0207678_11339138 | 3300026067 | Bacteria | 633 |
| 518 | Ga0207678_11697997 | 3300026067 | Bacteria | 555 |
| 519 | Ga0207708_10407295 | 3300026075 | Bacteria | 1126 |
| 520 | Ga0207708_10580508 | 3300026075 | Bacteria | 948 |
| 521 | Ga0207708_10580539 | 3300026075 | Bacteria | 948 |
| 522 | Ga0207702_10020021 | 3300026078 | Bacteria | 5544 |
| 523 | Ga0207702_10024769 | 3300026078 | Bacteria | 4978 |
| 524 | Ga0207702_10059200 | 3300026078 | Bacteria | 3262 |
| 525 | Ga0207702_10063945 | 3300026078 | Bacteria | 3148 |
| 526 | Ga0207702_10120098 | 3300026078 | Bacteria | 2351 |
| 527 | Ga0207702_10759491 | 3300026078 | Bacteria | 957 |
| 528 | Ga0207641_10047192 | 3300026088 | Bacteria | 3631 |
| 529 | Ga0207641_10442962 | 3300026088 | Bacteria | 1254 |
| 530 | Ga0207641_10446518 | 3300026088 | Bacteria | 1249 |
| 531 | Ga0207648_10009235 | 3300026089 | Bacteria | 9471 |
| 532 | Ga0207648_10027124 | 3300026089 | Bacteria | 5087 |
| 533 | Ga0207648_10028071 | 3300026089 | Bacteria | 4991 |
| 534 | Ga0207648_10094182 | 3300026089 | Bacteria | 2619 |
| 535 | Ga0207648_10106694 | 3300026089 | Bacteria | 2458 |
| 536 | Ga0207648_10148580 | 3300026089 | Bacteria | 2068 |
| 537 | Ga0207648_10191278 | 3300026089 | Bacteria | 1814 |
| 538 | Ga0207648_10321775 | 3300026089 | Bacteria | 1390 |
| 539 | Ga0207648_11256178 | 3300026089 | Bacteria | 696 |
| 540 | Ga0207676_10010197 | 3300026095 | Bacteria | 6685 |
| 541 | Ga0207676_10151029 | 3300026095 | Bacteria | 2000 |
| 542 | Ga0207676_10164453 | 3300026095 | Bacteria | 1926 |
| 543 | Ga0207676_10961846 | 3300026095 | Bacteria | 840 |
| 544 | Ga0207676_11579721 | 3300026095 | Bacteria | 654 |
| 545 | Ga0207674_10006551 | 3300026116 | Bacteria | 13698 |
| 546 | Ga0207674_10026193 | 3300026116 | Bacteria | 6202 |
| 547 | Ga0207674_10708956 | 3300026116 | Bacteria | 971 |
| 548 | Ga0207675_100000395 | 3300026118 | Bacteria | 41843 |
| 549 | Ga0207675_100052624 | 3300026118 | Bacteria | 3799 |
| 550 | Ga0207675_100135429 | 3300026118 | Bacteria | 2337 |
| 551 | Ga0207675_100651379 | 3300026118 | Bacteria | 1059 |
| 552 | Ga0207675_100706597 | 3300026118 | Bacteria | 1017 |
| 553 | Ga0207675_101424275 | 3300026118 | Bacteria | 714 |
| 554 | Ga0207683_10011601 | 3300026121 | Bacteria | 7524 |
| 555 | Ga0207683_10037943 | 3300026121 | Bacteria | 4196 |
| 556 | Ga0207683_10073610 | 3300026121 | Bacteria | 3022 |
| 557 | Ga0207683_10087860 | 3300026121 | Bacteria | 2765 |
| 558 | Ga0207683_10129492 | 3300026121 | Bacteria | 2269 |
| 559 | Ga0207683_10348112 | 3300026121 | Bacteria | 1360 |
| 560 | Ga0207683_11546316 | 3300026121 | Bacteria | 612 |
| 561 | Ga0207698_10006452 | 3300026142 | Bacteria | 7322 |
| 562 | Ga0207698_10033642 | 3300026142 | Bacteria | 3727 |
| 563 | Ga0207698_10101184 | 3300026142 | Bacteria | 2389 |
| 564 | Ga0207698_10303445 | 3300026142 | Bacteria | 1487 |
| 565 | Ga0207698_10429117 | 3300026142 | Bacteria | 1270 |
| 566 | Ga0207698_10431509 | 3300026142 | Bacteria | 1267 |
| 567 | Ga0207698_10496969 | 3300026142 | Bacteria | 1186 |
| 568 | Ga0209281_1000195 | 3300027111 | Bacteria | 139144 |
| 569 | Ga0209981_1034852 | 3300027378 | Bacteria | 744 |
| 570 | Ga0209999_1013149 | 3300027543 | Bacteria | 1502 |
| 571 | Ga0209999_1076242 | 3300027543 | Bacteria | 645 |
| 572 | Ga0209970_1000073 | 3300027614 | Bacteria | 13735 |
| 573 | Ga0209983_1110297 | 3300027665 | Bacteria | 625 |
| 574 | Ga0209974_10064116 | 3300027876 | Bacteria | 1246 |
| 575 | Ga0268266_10199398 | 3300028379 | Bacteria | 1831 |
| 576 | Ga0268266_10453066 | 3300028379 | Bacteria | 1220 |
| 577 | Ga0268265_10348012 | 3300028380 | Bacteria | 1352 |
| 578 | Ga0268265_10350606 | 3300028380 | Bacteria | 1348 |
| 579 | Ga0268265_10552585 | 3300028380 | Bacteria | 1093 |
| 580 | Ga0268265_11256575 | 3300028380 | Bacteria | 739 |
| 581 | Ga0268264_10418014 | 3300028381 | Bacteria | 1292 |
| 582 | Ga0268264_10420655 | 3300028381 | Bacteria | 1288 |
| 583 | Ga0307517_10125093 | 3300028786 | Bacteria | 1880 |
| 584 | Ga0307515_10242171 | 3300028794 | Bacteria | 1572 |
| 585 | Ga0307408_100150198 | 3300031548 | Bacteria | 1838 |
| 586 | Ga0307408_100222787 | 3300031548 | Bacteria | 1540 |
| 587 | Ga0307408_100489674 | 3300031548 | Bacteria | 1074 |
| 588 | Ga0307408_101102231 | 3300031548 | Bacteria | 736 |
| 589 | Ga0307408_101230812 | 3300031548 | Bacteria | 699 |
| 590 | Ga0307516_10002337 | 3300031730 | Bacteria | 25506 |
| 591 | Ga0307516_10002395 | 3300031730 | Bacteria | 25122 |
| 592 | Ga0307516_10937801 | 3300031730 | Bacteria | 534 |
| 593 | Ga0307405_10139165 | 3300031731 | Bacteria | 1690 |
| 594 | Ga0307405_10172313 | 3300031731 | Bacteria | 1545 |
| 595 | Ga0307405_10562760 | 3300031731 | Bacteria | 924 |
| 596 | Ga0307405_10611725 | 3300031731 | Bacteria | 891 |
| 597 | Ga0307413_10042250 | 3300031824 | Bacteria | 2677 |
| 598 | Ga0307413_10614009 | 3300031824 | Bacteria | 892 |
| 599 | Ga0307410_11334483 | 3300031852 | Bacteria | 628 |
| 600 | Ga0307410_11636441 | 3300031852 | Bacteria | 569 |
| 601 | Ga0307406_10004461 | 3300031901 | Bacteria | 7619 |
| 602 | Ga0307406_10640917 | 3300031901 | Bacteria | 881 |
| 603 | Ga0307406_11337169 | 3300031901 | Bacteria | 626 |
| 604 | Ga0307407_10072833 | 3300031903 | Bacteria | 2050 |
| 605 | Ga0307407_10885152 | 3300031903 | Bacteria | 684 |
| 606 | Ga0307407_11127042 | 3300031903 | Bacteria | 611 |
| 607 | Ga0307412_10020707 | 3300031911 | Bacteria | 4006 |
| 608 | Ga0307412_10179849 | 3300031911 | Bacteria | 1590 |
| 609 | Ga0307412_10355907 | 3300031911 | Bacteria | 1177 |
| 610 | Ga0307412_10681519 | 3300031911 | Bacteria | 880 |
| 611 | Ga0307412_11465726 | 3300031911 | Bacteria | 619 |
| 612 | Ga0307409_100106596 | 3300031995 | Bacteria | 2339 |
| 613 | Ga0307409_100428983 | 3300031995 | Bacteria | 1270 |
| 614 | Ga0307409_102310032 | 3300031995 | Bacteria | 567 |
| 615 | Ga0307409_102761737 | 3300031995 | Bacteria | 519 |
| 616 | Ga0307416_100064527 | 3300032002 | Bacteria | 3005 |
| 617 | Ga0307416_100147090 | 3300032002 | Bacteria | 2153 |
| 618 | Ga0307416_100205141 | 3300032002 | Bacteria | 1874 |
| 619 | Ga0307416_100782445 | 3300032002 | Bacteria | 1049 |
| 620 | Ga0307416_100964547 | 3300032002 | Bacteria | 955 |
| 621 | Ga0307416_101653800 | 3300032002 | Bacteria | 745 |
| 622 | Ga0307416_101676497 | 3300032002 | Bacteria | 740 |
| 623 | Ga0307414_10057499 | 3300032004 | Bacteria | 2734 |
| 624 | Ga0307414_10451059 | 3300032004 | Bacteria | 1128 |
| 625 | Ga0307414_10893411 | 3300032004 | Bacteria | 814 |
| 626 | Ga0307411_10001621 | 3300032005 | Bacteria | 9376 |
| 627 | Ga0307411_10055286 | 3300032005 | Bacteria | 2611 |
| 628 | Ga0307411_10202507 | 3300032005 | Bacteria | 1526 |
| 629 | Ga0307411_10360430 | 3300032005 | Bacteria | 1189 |
| 630 | Ga0307411_10836729 | 3300032005 | Bacteria | 813 |
| 631 | Ga0307411_11578435 | 3300032005 | Bacteria | 605 |
| 632 | Ga0307415_100263029 | 3300032126 | Bacteria | 1409 |
| 633 | Ga0307415_100827488 | 3300032126 | Bacteria | 847 |
| 634 | Ga0307510_10486625 | 3300033180 | Bacteria | 676 |
| 635 | Ga0373932_0051412 | 3300035112 | Bacteria | 1224 |
| 636 | Ga0373931_0011887 | 3300035691 | Bacteria | 4211 |
| 637 | Ga0395899_0862013 | 3300037312 | Bacteria | 555 |
| 638 | Ga0395900_0297437 | 3300037418 | Bacteria | 1601 |
| 639 | Ga0395898_0809902 | 3300037466 | Bacteria | 877 |
| 640 | Ga0395905_0008484 | 3300037471 | Bacteria | 10131 |
| 641 | Ga0395905_0353557 | 3300037471 | Bacteria | 1361 |
| 642 | Ga0439439_0040025 | 3300041406 | Bacteria | 1212 |
| 643 | Ga0439461_0090850 | 3300041410 | Bacteria | 732 |
| 644 | Ga0451787_826069 | 3300041441 | Bacteria | 524 |
| 645 | Ga0451789_0082674 | 3300041443 | Bacteria | 554 |
| 646 | Ga0451789_0190724 | 3300041443 | Bacteria | 622 |
| 647 | Ga0451789_1092815 | 3300041443 | Bacteria | 570 |
| 648 | Ga0451791_0052799 | 3300041451 | Bacteria | 1141 |
| 649 | Ga0451791_1403387 | 3300041451 | Bacteria | 1223 |
| 650 | Ga0451791_1836382 | 3300041451 | Bacteria | 658 |
| 651 | Ga0451793_0719068 | 3300041452 | Bacteria | 502 |
| 652 | Ga0451793_1085354 | 3300041452 | Bacteria | 1308 |
| 653 | Ga0451797_0735469 | 3300041453 | Bacteria | 969 |
| 654 | Ga0451797_0986766 | 3300041453 | Bacteria | 1006 |
| 655 | Ga0451797_1293458 | 3300041453 | Bacteria | 1373 |
| 656 | Ga0451797_1536375 | 3300041453 | Bacteria | 521 |
| 657 | Ga0451795_0117693 | 3300041456 | Bacteria | 616 |
| 658 | Ga0451795_0517502 | 3300041456 | Bacteria | 669 |
| 659 | Ga0451800_0337247 | 3300041459 | Bacteria | 555 |
| 660 | Ga0451800_1579281 | 3300041459 | Bacteria | 897 |
| 661 | Ga0451802_0035716 | 3300041460 | Bacteria | 1057 |
| 662 | Ga0451802_0549967 | 3300041460 | Bacteria | 627 |
| 663 | Ga0451802_0897781 | 3300041460 | Bacteria | 655 |
| 664 | Ga0451802_1073611 | 3300041460 | Bacteria | 1082 |
| 665 | Ga0451804_0232158 | 3300041463 | Bacteria | 692 |
| 666 | Ga0451804_1035732 | 3300041463 | Bacteria | 773 |
| 667 | Ga0451807_0166802 | 3300041486 | Bacteria | 647 |
| 668 | Ga0451807_0510672 | 3300041486 | Bacteria | 533 |
| 669 | Ga0451807_0680237 | 3300041486 | Bacteria | 537 |
| 670 | Ga0451807_0753404 | 3300041486 | Bacteria | 8364 |
| 671 | Ga0451807_1086543 | 3300041486 | Bacteria | 553 |
| 672 | Ga0451807_1229690 | 3300041486 | Bacteria | 561 |
| 673 | Ga0451807_1374150 | 3300041486 | Bacteria | 1686 |
| 674 | Ga0451807_1717545 | 3300041486 | Bacteria | 512 |
| 675 | Ga0451833_0846255 | 3300041491 | Bacteria | 502 |
| 676 | Ga0451835_1258364 | 3300041492 | Bacteria | 948 |
| 677 | Ga0451837_0131608 | 3300041494 | Bacteria | 1646 |
| 678 | Ga0451837_1622431 | 3300041494 | Bacteria | 527 |
| 679 | Ga0451839_1503600 | 3300041496 | Bacteria | 604 |
| 680 | Ga0451839_1532241 | 3300041496 | Bacteria | 668 |
| 681 | Ga0451839_1622057 | 3300041496 | Bacteria | 600 |
| 682 | Ga0451841_0547980 | 3300041498 | Bacteria | 1509 |
| 683 | Ga0451849_0481405 | 3300041505 | Bacteria | 1101 |
| 684 | Ga0451849_1015217 | 3300041505 | Bacteria | 683 |
| 685 | Ga0451851_0957127 | 3300041507 | Bacteria | 565 |
| 686 | Ga0451843_0875201 | 3300041509 | Bacteria | 681 |
| 687 | Ga0451843_1115108 | 3300041509 | Bacteria | 988 |
| 688 | Ga0451843_1770695 | 3300041509 | Bacteria | 593 |
| 689 | Ga0451853_0998724 | 3300041512 | Bacteria | 661 |
| 690 | Ga0451853_1582152 | 3300041512 | Bacteria | 2375 |
| 691 | Ga0451853_1694975 | 3300041512 | Bacteria | 616 |
| 692 | Ga0451853_1820425 | 3300041512 | Bacteria | 1634 |
| 693 | Ga0451853_1823316 | 3300041512 | Bacteria | 518 |
| 694 | Ga0451853_1973013 | 3300041512 | Bacteria | 929 |
| 695 | Ga0451853_2455328 | 3300041512 | Bacteria | 603 |
| 696 | Ga0451853_3284776 | 3300041512 | Bacteria | 654 |
| 697 | Ga0451853_3568330 | 3300041512 | Bacteria | 540 |
| 698 | Ga0451853_3576675 | 3300041512 | Bacteria | 672 |
| 699 | Ga0451853_3746272 | 3300041512 | Bacteria | 602 |
| 700 | Ga0451853_3981066 | 3300041512 | Bacteria | 963 |
| 701 | Ga0450920_031078 | 3300042122 | Bacteria | 1052 |
| 702 | Ga0450918_000311 | 3300042531 | Bacteria | 10885 |
| 703 | Ga0451577_0001649 | 3300042876 | Bacteria | 28892 |
| 704 | Ga0451577_0160062 | 3300042876 | Bacteria | 2027 |
| 705 | Ga0466972_0037411 | 3300044658 | Bacteria | 2373 |
| 706 | Ga0466972_0155017 | 3300044658 | Bacteria | 1076 |
| 707 | Ga0453684_1544414 | 3300044712 | Bacteria | 683 |
| 708 | Ga0453684_1554695 | 3300044712 | Bacteria | 681 |
| 709 | Ga0466960_0032293 | 3300044901 | Bacteria | 2423 |
| 710 | Ga0451576_0026355 | 3300045051 | Bacteria | 6254 |
| 711 | Ga0451576_0256771 | 3300045051 | Bacteria | 1827 |
| 712 | Ga0495580_0939561 | 3300046472 | Bacteria | 554 |
| 713 | Ga0495632_0053249 | 3300046519 | Bacteria | 1988 |
| 714 | Ga0495621_0101175 | 3300046539 | Bacteria | 1097 |
| 715 | Ga0495668_0383848 | 3300046616 | Bacteria | 772 |
| 716 | Ga0495625_0002783 | 3300046660 | Bacteria | 18441 |
| 717 | Ga0495588_0589968 | 3300046674 | Bacteria | 582 |
| 718 | Ga0495658_0384566 | 3300046683 | Bacteria | 894 |
| 719 | Ga0495686_0005461 | 3300047472 | Bacteria | 10016 |
| 720 | Ga0495686_0051627 | 3300047472 | Bacteria | 2580 |
| 721 | Ga0496100_1434732 | 3300048903 | Bacteria | 545 |
| 722 | Ga0496101_0008877 | 3300048904 | Bacteria | 6581 |
| 723 | Ga0496102_0012845 | 3300048905 | Bacteria | 7249 |
| 724 | Ga0496103_0038510 | 3300048906 | Bacteria | 2934 |
| 725 | Ga0496104_0161291 | 3300048907 | Bacteria | 2151 |
| 726 | Ga0496105_0276837 | 3300048908 | Bacteria | 1354 |
| 727 | Ga0496107_0006067 | 3300048910 | Bacteria | 8296 |
| 728 | Ga0496108_0026763 | 3300048911 | Bacteria | 4760 |
| 729 | Ga0496108_0547105 | 3300048911 | Bacteria | 1010 |
| 730 | Ga0496109_0007706 | 3300048912 | Bacteria | 9124 |
| 731 | Ga0496110_0003217 | 3300048913 | Bacteria | 12439 |
| 732 | Ga0496112_0087318 | 3300048915 | Bacteria | 3086 |
| 733 | Ga0496113_0324923 | 3300048916 | Bacteria | 1233 |
| 734 | Ga0496114_0078800 | 3300048917 | Bacteria | 2780 |
| 735 | Ga0496114_0125863 | 3300048917 | Bacteria | 2209 |
| 736 | Ga0496115_0069982 | 3300048918 | Bacteria | 2843 |
| 737 | Ga0496122_0113276 | 3300048925 | Bacteria | 1773 |
| 738 | Ga0501031_0044720 | 3300049568 | Bacteria | 2890 |
| 739 | Ga0501031_0226570 | 3300049568 | Bacteria | 1217 |
| 740 | Ga0501032_0003810 | 3300049569 | Bacteria | 11449 |
| 741 | Ga0501032_0125102 | 3300049569 | Bacteria | 1699 |
| 742 | Ga0501033_0000158 | 3300049570 | Bacteria | 64817 |
| 743 | Ga0501033_0274077 | 3300049570 | Bacteria | 1192 |
| 744 | Ga0501034_0114078 | 3300049571 | Bacteria | 2691 |
| 745 | Ga0501034_0452323 | 3300049571 | Bacteria | 1202 |
| 746 | Ga0501034_1063569 | 3300049571 | Bacteria | 691 |
| 747 | Ga0501036_1483257 | 3300049572 | Bacteria | 549 |
| 748 | Ga0501037_0000166 | 3300049573 | Bacteria | 62316 |
| 749 | Ga0501038_0289831 | 3300049574 | Bacteria | 1287 |
| 750 | Ga0501038_0977480 | 3300049574 | Bacteria | 622 |
| 751 | Ga0501038_0988119 | 3300049574 | Bacteria | 618 |
| 752 | Ga0501039_0386494 | 3300049575 | Bacteria | 1099 |
| 753 | Ga0501039_1540318 | 3300049575 | Bacteria | 511 |
| 754 | Ga0501042_0421701 | 3300049578 | Bacteria | 967 |
| 755 | Ga0501042_0648077 | 3300049578 | Bacteria | 768 |
| 756 | Ga0501042_0959787 | 3300049578 | Bacteria | 623 |
| 757 | Ga0501043_0000030 | 3300049579 | Bacteria | 142422 |
| 758 | Ga0501043_0000573 | 3300049579 | Bacteria | 32893 |
| 759 | Ga0501043_0474864 | 3300049579 | Bacteria | 937 |
| 760 | Ga0501046_0000752 | 3300049580 | Bacteria | 31319 |
| 761 | Ga0501047_0000298 | 3300049581 | Bacteria | 57038 |
| 762 | Ga0501047_0069572 | 3300049581 | Bacteria | 3389 |
| 763 | Ga0501047_0168906 | 3300049581 | Bacteria | 2057 |
| 764 | Ga0501047_0569797 | 3300049581 | Bacteria | 956 |
| 765 | Ga0501048_0008752 | 3300049582 | Bacteria | 7627 |
| 766 | Ga0501048_0803953 | 3300049582 | Bacteria | 676 |
| 767 | Ga0501067_0124055 | 3300049583 | Bacteria | 1437 |
| 768 | Ga0501068_0015560 | 3300049584 | Bacteria | 4371 |
| 769 | Ga0501069_0000006 | 3300049585 | Bacteria | 184515 |
| 770 | Ga0501069_0231477 | 3300049585 | Bacteria | 1076 |
| 771 | Ga0501070_0000689 | 3300049586 | Bacteria | 30986 |
| 772 | Ga0501070_0006860 | 3300049586 | Bacteria | 9690 |
| 773 | Ga0501070_0065853 | 3300049586 | Bacteria | 3000 |
| 774 | Ga0501070_0336070 | 3300049586 | Bacteria | 1227 |
| 775 | Ga0501071_0012971 | 3300049587 | Bacteria | 5669 |
| 776 | Ga0501071_0748600 | 3300049587 | Bacteria | 753 |
| 777 | Ga0501072_0010730 | 3300049588 | Bacteria | 6981 |
| 778 | Ga0501072_0373838 | 3300049588 | Bacteria | 1131 |
| 779 | Ga0501072_1308411 | 3300049588 | Bacteria | 562 |
| 780 | Ga0501073_0004070 | 3300049589 | Bacteria | 10978 |
| 781 | Ga0501073_0028436 | 3300049589 | Bacteria | 3995 |
| 782 | Ga0501073_0181721 | 3300049589 | Bacteria | 1456 |
| 783 | Ga0501073_0213515 | 3300049589 | Bacteria | 1333 |
| 784 | Ga0501074_0000026 | 3300049590 | Bacteria | 68218 |
| 785 | Ga0501074_0329609 | 3300049590 | Bacteria | 1084 |
| 786 | Ga0501074_0765263 | 3300049590 | Bacteria | 681 |
| 787 | Ga0501076_0811100 | 3300049592 | Bacteria | 772 |
| 788 | Ga0501198_000049 | 3300049649 | Bacteria | 38025 |
| 789 | Ga0501222_000057 | 3300049662 | Bacteria | 38026 |
| 790 | Ga0501079_0031863 | 3300049741 | Bacteria | 4052 |
| 791 | Ga0501079_0521760 | 3300049741 | Bacteria | 934 |
| 792 | Ga0501080_0002110 | 3300049742 | Bacteria | 17252 |
| 793 | Ga0501080_0026620 | 3300049742 | Bacteria | 5373 |
| 794 | Ga0501083_0000129 | 3300049744 | Bacteria | 51513 |
| 795 | Ga0501083_0051574 | 3300049744 | Bacteria | 2766 |
| 796 | Ga0501083_0452003 | 3300049744 | Bacteria | 836 |
| 797 | Ga0501035_0000017 | 3300049822 | Bacteria | 241915 |
| 798 | Ga0501035_0137795 | 3300049822 | Bacteria | 2123 |
| 799 | Ga0501035_0406615 | 3300049822 | Bacteria | 1132 |
| 800 | Ga0501035_0892317 | 3300049822 | Bacteria | 704 |
| 801 | Ga0501044_0000034 | 3300049823 | Bacteria | 164058 |
| 802 | Ga0501044_0038216 | 3300049823 | Bacteria | 5013 |
| 803 | Ga0501044_0323757 | 3300049823 | Bacteria | 1465 |
| 804 | Ga0501044_0515763 | 3300049823 | Bacteria | 1095 |
| 805 | Ga0501045_0001157 | 3300049824 | Bacteria | 17488 |
| 806 | Ga0501045_0986218 | 3300049824 | Bacteria | 618 |
| 807 | nmdc:mga0yw44_279045_c1 | 3300050492 | Bacteria | 1116 |
| 808 | nmdc:mga0yw44_733674_c1 | 3300050492 | Bacteria | 671 |
| 809 | nmdc:mga0k408_23129_c1 | 3300050493 | Bacteria | 1518 |
| 810 | nmdc:mga0k408_41987_c1 | 3300050493 | Bacteria | 2634 |
| 811 | nmdc:mga0k408_760854_c1 | 3300050493 | Bacteria | 566 |
| 812 | nmdc:mga06z11_168128_c1 | 3300050494 | Bacteria | 1257 |
| 813 | nmdc:mga06z11_934928_c1 | 3300050494 | Bacteria | 528 |
| 814 | nmdc:mga07m45_205813_c1 | 3300050496 | Bacteria | 1145 |
| 815 | nmdc:mga07m45_550076_c1 | 3300050496 | Bacteria | 667 |
| 816 | nmdc:mga07m45_75493_c1 | 3300050496 | Bacteria | 1920 |
| 817 | nmdc:mga09592_787246_c1 | 3300050508 | Bacteria | 805 |
| 818 | nmdc:mga08y16_1329778_c1 | 3300050511 | Bacteria | 684 |
| 819 | nmdc:mga08y16_150394_c1 | 3300050511 | Bacteria | 2420 |
| 820 | nmdc:mga0rr50_315903_c1 | 3300050513 | Bacteria | 1309 |
| 821 | nmdc:mga0sz30_28160_c1 | 3300050516 | Bacteria | 2310 |
| 822 | Ga0500593_000325 | 3300053117 | Bacteria | 19228 |
| 823 | Ga0500642_0011345 | 3300053130 | Bacteria | 3183 |
| 824 | Ga0500652_000110 | 3300053131 | Bacteria | 32301 |
| 825 | Ga0500622_0065330 | 3300053156 | Bacteria | 1849 |
| 826 | Ga0501082_0005123 | 3300060353 | Bacteria | 11408 |
| 827 | Ga0501082_1129798 | 3300060353 | Archaea | 685 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_1503600 | Ga0451839_1503600_85_507 | 110 |
| 2 | 3300005353 | Ga0070669_101858097 | Ga0070669_1018580971 | 112 |
| 3 | 3300005530 | Ga0070679_100180437 | Ga0070679_1001804371 | 112 |
| 4 | 3300005535 | Ga0070684_100260809 | Ga0070684_1002608092 | 112 |
| 5 | 3300005564 | Ga0070664_100000031 | Ga0070664_10000003134 | 112 |
| 6 | 3300005577 | Ga0068857_100030589 | Ga0068857_1000305892 | 112 |
| 7 | 3300009094 | Ga0111539_10288905 | Ga0111539_102889052 | 112 |
| 8 | 3300025912 | Ga0207707_10521286 | Ga0207707_105212862 | 112 |
| 9 | 3300025920 | Ga0207649_10014193 | Ga0207649_100141932 | 112 |
| 10 | 3300025945 | Ga0207679_10000127 | Ga0207679_1000012730 | 112 |
| 11 | 3300026116 | Ga0207674_10026193 | Ga0207674_100261932 | 112 |
| 12 | 3300041512 | Ga0451853_1582152 | Ga0451853_1582152_507_845 | 112 |
| 13 | 3300042876 | Ga0451577_0160062 | Ga0451577_0160062_1377_1715 | 112 |
| 14 | 3300044712 | Ga0453684_1544414 | Ga0453684_1544414_214_552 | 112 |
| 15 | 3300045051 | Ga0451576_0026355 | Ga0451576_0026355_5795_6133 | 112 |
| 16 | 3300050511 | nmdc:mga08y16_150394_c1 | nmdc:mga08y16_150394_c1_916_1254 | 112 |
| 17 | 3300005336 | Ga0070680_100976905 | Ga0070680_1009769052 | 113 |
| 18 | 3300005339 | Ga0070660_101183750 | Ga0070660_1011837502 | 113 |
| 19 | 3300005354 | Ga0070675_100035873 | Ga0070675_1000358733 | 113 |
| 20 | 3300005364 | Ga0070673_100396751 | Ga0070673_1003967512 | 113 |
| 21 | 3300005366 | Ga0070659_101536019 | Ga0070659_1015360191 | 113 |
| 22 | 3300005444 | Ga0070694_101731628 | Ga0070694_1017316282 | 113 |
| 23 | 3300005455 | Ga0070663_100539036 | Ga0070663_1005390362 | 113 |
| 24 | 3300005466 | Ga0070685_10259823 | Ga0070685_102598232 | 113 |
| 25 | 3300005539 | Ga0068853_100391325 | Ga0068853_1003913252 | 113 |
| 26 | 3300005547 | Ga0070693_100477283 | Ga0070693_1004772831 | 113 |
| 27 | 3300005563 | Ga0068855_100190443 | Ga0068855_1001904432 | 113 |
| 28 | 3300005616 | Ga0068852_100039595 | Ga0068852_1000395952 | 113 |
| 29 | 3300005616 | Ga0068852_100481378 | Ga0068852_1004813782 | 113 |
| 30 | 3300005843 | Ga0068860_101099543 | Ga0068860_1010995431 | 113 |
| 31 | 3300005844 | Ga0068862_100259758 | Ga0068862_1002597582 | 113 |
| 32 | 3300009093 | Ga0105240_10118570 | Ga0105240_101185703 | 113 |
| 33 | 3300009986 | Ga0105033_125090 | Ga0105033_1250901 | 113 |
| 34 | 3300013104 | Ga0157370_10017855 | Ga0157370_100178552 | 113 |
| 35 | 3300013104 | Ga0157370_11325608 | Ga0157370_113256082 | 113 |
| 36 | 3300013104 | Ga0157370_11369806 | Ga0157370_113698062 | 113 |
| 37 | 3300013307 | Ga0157372_10019925 | Ga0157372_100199252 | 113 |
| 38 | 3300013308 | Ga0157375_10261605 | Ga0157375_102616052 | 113 |
| 39 | 3300025907 | Ga0207645_10262169 | Ga0207645_102621692 | 113 |
| 40 | 3300025913 | Ga0207695_10560117 | Ga0207695_105601172 | 113 |
| 41 | 3300025917 | Ga0207660_10828924 | Ga0207660_108289242 | 113 |
| 42 | 3300025949 | Ga0207667_11779758 | Ga0207667_117797582 | 113 |
| 43 | 3300026067 | Ga0207678_10019215 | Ga0207678_100192154 | 113 |
| 44 | 3300026089 | Ga0207648_10106694 | Ga0207648_101066942 | 113 |
| 45 | 3300026089 | Ga0207648_11256178 | Ga0207648_112561782 | 113 |
| 46 | 3300026118 | Ga0207675_100651379 | Ga0207675_1006513792 | 113 |
| 47 | 3300026142 | Ga0207698_10101184 | Ga0207698_101011842 | 113 |
| 48 | 3300028381 | Ga0268264_10418014 | Ga0268264_104180142 | 113 |
| 49 | 3300031903 | Ga0307407_10885152 | Ga0307407_108851521 | 113 |
| 50 | 3300031995 | Ga0307409_100428983 | Ga0307409_1004289832 | 113 |
| 51 | 3300032126 | Ga0307415_100263029 | Ga0307415_1002630292 | 113 |
| 52 | 3300048925 | Ga0496122_0113276 | Ga0496122_0113276_27_371 | 113 |
| 53 | 3300049568 | Ga0501031_0044720 | Ga0501031_0044720_2124_2468 | 113 |
| 54 | 3300049568 | Ga0501031_0226570 | Ga0501031_0226570_548_892 | 113 |
| 55 | 3300049569 | Ga0501032_0003810 | Ga0501032_0003810_3211_3555 | 113 |
| 56 | 3300049569 | Ga0501032_0125102 | Ga0501032_0125102_1131_1472 | 113 |
| 57 | 3300049570 | Ga0501033_0000158 | Ga0501033_0000158_34174_34518 | 113 |
| 58 | 3300049570 | Ga0501033_0274077 | Ga0501033_0274077_543_887 | 113 |
| 59 | 3300049572 | Ga0501036_1483257 | Ga0501036_1483257_84_428 | 113 |
| 60 | 3300049573 | Ga0501037_0000166 | Ga0501037_0000166_34877_35221 | 113 |
| 61 | 3300049574 | Ga0501038_0289831 | Ga0501038_0289831_766_1110 | 113 |
| 62 | 3300049574 | Ga0501038_0977480 | Ga0501038_0977480_260_604 | 113 |
| 63 | 3300049575 | Ga0501039_0386494 | Ga0501039_0386494_156_500 | 113 |
| 64 | 3300049579 | Ga0501043_0000030 | Ga0501043_0000030_39980_40324 | 113 |
| 65 | 3300049579 | Ga0501043_0474864 | Ga0501043_0474864_353_697 | 113 |
| 66 | 3300049581 | Ga0501047_0168906 | Ga0501047_0168906_1259_1603 | 113 |
| 67 | 3300049582 | Ga0501048_0803953 | Ga0501048_0803953_321_665 | 113 |
| 68 | 3300049583 | Ga0501067_0124055 | Ga0501067_0124055_100_444 | 113 |
| 69 | 3300049584 | Ga0501068_0015560 | Ga0501068_0015560_2295_2639 | 113 |
| 70 | 3300049585 | Ga0501069_0000006 | Ga0501069_0000006_37950_38294 | 113 |
| 71 | 3300049585 | Ga0501069_0231477 | Ga0501069_0231477_76_420 | 113 |
| 72 | 3300049586 | Ga0501070_0000689 | Ga0501070_0000689_15253_15597 | 113 |
| 73 | 3300049586 | Ga0501070_0065853 | Ga0501070_0065853_1381_1725 | 113 |
| 74 | 3300049587 | Ga0501071_0012971 | Ga0501071_0012971_5230_5574 | 113 |
| 75 | 3300049588 | Ga0501072_1308411 | Ga0501072_1308411_151_495 | 113 |
| 76 | 3300049589 | Ga0501073_0028436 | Ga0501073_0028436_512_856 | 113 |
| 77 | 3300049589 | Ga0501073_0213515 | Ga0501073_0213515_296_640 | 113 |
| 78 | 3300049590 | Ga0501074_0000026 | Ga0501074_0000026_38568_38912 | 113 |
| 79 | 3300049592 | Ga0501076_0811100 | Ga0501076_0811100_96_440 | 113 |
| 80 | 3300049741 | Ga0501079_0521760 | Ga0501079_0521760_77_421 | 113 |
| 81 | 3300049742 | Ga0501080_0002110 | Ga0501080_0002110_1012_1356 | 113 |
| 82 | 3300049744 | Ga0501083_0000129 | Ga0501083_0000129_14087_14431 | 113 |
| 83 | 3300049744 | Ga0501083_0452003 | Ga0501083_0452003_129_470 | 113 |
| 84 | 3300049822 | Ga0501035_0000017 | Ga0501035_0000017_146029_146373 | 113 |
| 85 | 3300049822 | Ga0501035_0137795 | Ga0501035_0137795_220_564 | 113 |
| 86 | 3300049822 | Ga0501035_0892317 | Ga0501035_0892317_215_559 | 113 |
| 87 | 3300049823 | Ga0501044_0000034 | Ga0501044_0000034_93541_93885 | 113 |
| 88 | 3300049823 | Ga0501044_0038216 | Ga0501044_0038216_1041_1385 | 113 |
| 89 | 3300049823 | Ga0501044_0323757 | Ga0501044_0323757_1086_1427 | 113 |
| 90 | 3300060353 | Ga0501082_0005123 | Ga0501082_0005123_6492_6836 | 113 |
| 91 | 3300003187 | JGI25151J46595_10103843 | JGI25151J46595_101038432 | 114 |
| 92 | 3300003323 | rootH1_10353698 | rootH1_103536982 | 114 |
| 93 | 3300003775 | Ga0055524_1003649 | Ga0055524_100364910 | 114 |
| 94 | 3300003781 | Ga0055536_1049658 | Ga0055536_10496582 | 114 |
| 95 | 3300003781 | Ga0055536_1061605 | Ga0055536_10616052 | 114 |
| 96 | 3300003791 | Ga0055530_10003649 | Ga0055530_1000364911 | 114 |
| 97 | 3300003791 | Ga0055530_10003998 | Ga0055530_100039982 | 114 |
| 98 | 3300003791 | Ga0055530_10004641 | Ga0055530_100046412 | 114 |
| 99 | 3300003792 | Ga0055540_1000011 | Ga0055540_100001112 | 114 |
| 100 | 3300003794 | Ga0055531_10000421 | Ga0055531_100004212 | 114 |
| 101 | 3300003794 | Ga0055531_10010758 | Ga0055531_100107582 | 114 |
| 102 | 3300003794 | Ga0055531_10018284 | Ga0055531_100182842 | 114 |
| 103 | 3300003794 | Ga0055531_10019683 | Ga0055531_100196832 | 114 |
| 104 | 3300005293 | Ga0065715_10141067 | Ga0065715_101410672 | 114 |
| 105 | 3300005327 | Ga0070658_10263175 | Ga0070658_102631751 | 114 |
| 106 | 3300005327 | Ga0070658_11130657 | Ga0070658_111306571 | 114 |
| 107 | 3300005327 | Ga0070658_11996095 | Ga0070658_119960951 | 114 |
| 108 | 3300005328 | Ga0070676_10003611 | Ga0070676_100036112 | 114 |
| 109 | 3300005328 | Ga0070676_10026546 | Ga0070676_100265462 | 114 |
| 110 | 3300005328 | Ga0070676_10043216 | Ga0070676_100432162 | 114 |
| 111 | 3300005329 | Ga0070683_100033377 | Ga0070683_1000333772 | 114 |
| 112 | 3300005329 | Ga0070683_100034914 | Ga0070683_1000349144 | 114 |
| 113 | 3300005329 | Ga0070683_100229993 | Ga0070683_1002299932 | 114 |
| 114 | 3300005329 | Ga0070683_100252252 | Ga0070683_1002522522 | 114 |
| 115 | 3300005329 | Ga0070683_101460838 | Ga0070683_1014608381 | 114 |
| 116 | 3300005330 | Ga0070690_100267869 | Ga0070690_1002678691 | 114 |
| 117 | 3300005331 | Ga0070670_100007539 | Ga0070670_10000753910 | 114 |
| 118 | 3300005331 | Ga0070670_100063864 | Ga0070670_1000638642 | 114 |
| 119 | 3300005331 | Ga0070670_100080214 | Ga0070670_1000802143 | 114 |
| 120 | 3300005331 | Ga0070670_100080990 | Ga0070670_1000809902 | 114 |
| 121 | 3300005331 | Ga0070670_100298203 | Ga0070670_1002982031 | 114 |
| 122 | 3300005331 | Ga0070670_100305713 | Ga0070670_1003057132 | 114 |
| 123 | 3300005331 | Ga0070670_100559334 | Ga0070670_1005593341 | 114 |
| 124 | 3300005331 | Ga0070670_100575611 | Ga0070670_1005756112 | 114 |
| 125 | 3300005331 | Ga0070670_101015510 | Ga0070670_1010155102 | 114 |
| 126 | 3300005331 | Ga0070670_102177256 | Ga0070670_1021772561 | 114 |
| 127 | 3300005333 | Ga0070677_10000436 | Ga0070677_100004362 | 114 |
| 128 | 3300005333 | Ga0070677_10024851 | Ga0070677_100248512 | 114 |
| 129 | 3300005333 | Ga0070677_10079066 | Ga0070677_100790662 | 114 |
| 130 | 3300005333 | Ga0070677_10139840 | Ga0070677_101398402 | 114 |
| 131 | 3300005333 | Ga0070677_10168012 | Ga0070677_101680122 | 114 |
| 132 | 3300005333 | Ga0070677_10447102 | Ga0070677_104471022 | 114 |
| 133 | 3300005334 | Ga0068869_100008346 | Ga0068869_1000083466 | 114 |
| 134 | 3300005335 | Ga0070666_10974089 | Ga0070666_109740891 | 114 |
| 135 | 3300005336 | Ga0070680_100000586 | Ga0070680_10000058616 | 114 |
| 136 | 3300005336 | Ga0070680_100026731 | Ga0070680_1000267312 | 114 |
| 137 | 3300005336 | Ga0070680_100218356 | Ga0070680_1002183562 | 114 |
| 138 | 3300005338 | Ga0068868_100007643 | Ga0068868_1000076437 | 114 |
| 139 | 3300005338 | Ga0068868_100011468 | Ga0068868_1000114688 | 114 |
| 140 | 3300005338 | Ga0068868_100128987 | Ga0068868_1001289872 | 114 |
| 141 | 3300005338 | Ga0068868_100223824 | Ga0068868_1002238242 | 114 |
| 142 | 3300005339 | Ga0070660_100049595 | Ga0070660_1000495952 | 114 |
| 143 | 3300005339 | Ga0070660_100210885 | Ga0070660_1002108852 | 114 |
| 144 | 3300005339 | Ga0070660_100473174 | Ga0070660_1004731742 | 114 |
| 145 | 3300005340 | Ga0070689_100003713 | Ga0070689_1000037136 | 114 |
| 146 | 3300005340 | Ga0070689_100474273 | Ga0070689_1004742732 | 114 |
| 147 | 3300005344 | Ga0070661_100016902 | Ga0070661_1000169021 | 114 |
| 148 | 3300005344 | Ga0070661_101122403 | Ga0070661_1011224032 | 114 |
| 149 | 3300005345 | Ga0070692_10917465 | Ga0070692_109174652 | 114 |
| 150 | 3300005347 | Ga0070668_100066238 | Ga0070668_1000662382 | 114 |
| 151 | 3300005353 | Ga0070669_100001794 | Ga0070669_1000017942 | 114 |
| 152 | 3300005353 | Ga0070669_100009265 | Ga0070669_1000092656 | 114 |
| 153 | 3300005353 | Ga0070669_100094109 | Ga0070669_1000941092 | 114 |
| 154 | 3300005353 | Ga0070669_100861574 | Ga0070669_1008615742 | 114 |
| 155 | 3300005353 | Ga0070669_101522233 | Ga0070669_1015222331 | 114 |
| 156 | 3300005354 | Ga0070675_100001129 | Ga0070675_1000011299 | 114 |
| 157 | 3300005354 | Ga0070675_100003991 | Ga0070675_10000399111 | 114 |
| 158 | 3300005354 | Ga0070675_100047113 | Ga0070675_1000471132 | 114 |
| 159 | 3300005354 | Ga0070675_100408737 | Ga0070675_1004087372 | 114 |
| 160 | 3300005354 | Ga0070675_101327260 | Ga0070675_1013272601 | 114 |
| 161 | 3300005354 | Ga0070675_101675986 | Ga0070675_1016759861 | 114 |
| 162 | 3300005354 | Ga0070675_101868671 | Ga0070675_1018686711 | 114 |
| 163 | 3300005354 | Ga0070675_101901554 | Ga0070675_1019015542 | 114 |
| 164 | 3300005355 | Ga0070671_100000637 | Ga0070671_10000063711 | 114 |
| 165 | 3300005355 | Ga0070671_100009827 | Ga0070671_1000098277 | 114 |
| 166 | 3300005355 | Ga0070671_100035766 | Ga0070671_1000357663 | 114 |
| 167 | 3300005355 | Ga0070671_100037552 | Ga0070671_1000375525 | 114 |
| 168 | 3300005355 | Ga0070671_100052027 | Ga0070671_1000520273 | 114 |
| 169 | 3300005355 | Ga0070671_100104878 | Ga0070671_1001048782 | 114 |
| 170 | 3300005355 | Ga0070671_100212318 | Ga0070671_1002123182 | 114 |
| 171 | 3300005355 | Ga0070671_100378974 | Ga0070671_1003789742 | 114 |
| 172 | 3300005355 | Ga0070671_100597997 | Ga0070671_1005979972 | 114 |
| 173 | 3300005355 | Ga0070671_100739078 | Ga0070671_1007390782 | 114 |
| 174 | 3300005356 | Ga0070674_100003396 | Ga0070674_1000033962 | 114 |
| 175 | 3300005356 | Ga0070674_100021549 | Ga0070674_1000215492 | 114 |
| 176 | 3300005356 | Ga0070674_100241010 | Ga0070674_1002410102 | 114 |
| 177 | 3300005356 | Ga0070674_101563728 | Ga0070674_1015637282 | 114 |
| 178 | 3300005364 | Ga0070673_100000618 | Ga0070673_1000006189 | 114 |
| 179 | 3300005364 | Ga0070673_100385853 | Ga0070673_1003858532 | 114 |
| 180 | 3300005365 | Ga0070688_100797903 | Ga0070688_1007979032 | 114 |
| 181 | 3300005366 | Ga0070659_100000299 | Ga0070659_10000029924 | 114 |
| 182 | 3300005366 | Ga0070659_100033130 | Ga0070659_1000331302 | 114 |
| 183 | 3300005366 | Ga0070659_100281647 | Ga0070659_1002816471 | 114 |
| 184 | 3300005366 | Ga0070659_100685033 | Ga0070659_1006850332 | 114 |
| 185 | 3300005367 | Ga0070667_100032332 | Ga0070667_1000323323 | 114 |
| 186 | 3300005367 | Ga0070667_100718734 | Ga0070667_1007187342 | 114 |
| 187 | 3300005367 | Ga0070667_100725245 | Ga0070667_1007252452 | 114 |
| 188 | 3300005367 | Ga0070667_101085143 | Ga0070667_1010851431 | 114 |
| 189 | 3300005438 | Ga0070701_10384898 | Ga0070701_103848982 | 114 |
| 190 | 3300005438 | Ga0070701_10989354 | Ga0070701_109893542 | 114 |
| 191 | 3300005441 | Ga0070700_101300051 | Ga0070700_1013000511 | 114 |
| 192 | 3300005441 | Ga0070700_102007548 | Ga0070700_1020075481 | 114 |
| 193 | 3300005455 | Ga0070663_100009180 | Ga0070663_1000091804 | 114 |
| 194 | 3300005455 | Ga0070663_101587416 | Ga0070663_1015874162 | 114 |
| 195 | 3300005456 | Ga0070678_100004039 | Ga0070678_1000040392 | 114 |
| 196 | 3300005456 | Ga0070678_100060875 | Ga0070678_1000608752 | 114 |
| 197 | 3300005456 | Ga0070678_100078372 | Ga0070678_1000783722 | 114 |
| 198 | 3300005456 | Ga0070678_100236081 | Ga0070678_1002360812 | 114 |
| 199 | 3300005456 | Ga0070678_100244477 | Ga0070678_1002444772 | 114 |
| 200 | 3300005456 | Ga0070678_100911468 | Ga0070678_1009114681 | 114 |
| 201 | 3300005456 | Ga0070678_101583914 | Ga0070678_1015839142 | 114 |
| 202 | 3300005457 | Ga0070662_100002167 | Ga0070662_10000216714 | 114 |
| 203 | 3300005457 | Ga0070662_100004791 | Ga0070662_10000479112 | 114 |
| 204 | 3300005457 | Ga0070662_100177981 | Ga0070662_1001779812 | 114 |
| 205 | 3300005457 | Ga0070662_100539811 | Ga0070662_1005398112 | 114 |
| 206 | 3300005457 | Ga0070662_101439074 | Ga0070662_1014390741 | 114 |
| 207 | 3300005458 | Ga0070681_10005198 | Ga0070681_100051986 | 114 |
| 208 | 3300005458 | Ga0070681_10031407 | Ga0070681_100314072 | 114 |
| 209 | 3300005458 | Ga0070681_10053100 | Ga0070681_100531002 | 114 |
| 210 | 3300005458 | Ga0070681_10324507 | Ga0070681_103245072 | 114 |
| 211 | 3300005459 | Ga0068867_100000875 | Ga0068867_10000087514 | 114 |
| 212 | 3300005459 | Ga0068867_100011058 | Ga0068867_1000110585 | 114 |
| 213 | 3300005459 | Ga0068867_100057964 | Ga0068867_1000579642 | 114 |
| 214 | 3300005459 | Ga0068867_100067260 | Ga0068867_1000672602 | 114 |
| 215 | 3300005459 | Ga0068867_100553034 | Ga0068867_1005530341 | 114 |
| 216 | 3300005459 | Ga0068867_101162066 | Ga0068867_1011620662 | 114 |
| 217 | 3300005466 | Ga0070685_10636438 | Ga0070685_106364382 | 114 |
| 218 | 3300005466 | Ga0070685_11307428 | Ga0070685_113074281 | 114 |
| 219 | 3300005530 | Ga0070679_100000494 | Ga0070679_10000049434 | 114 |
| 220 | 3300005530 | Ga0070679_100016024 | Ga0070679_1000160242 | 114 |
| 221 | 3300005530 | Ga0070679_100025313 | Ga0070679_1000253133 | 114 |
| 222 | 3300005530 | Ga0070679_100058607 | Ga0070679_1000586073 | 114 |
| 223 | 3300005530 | Ga0070679_101436969 | Ga0070679_1014369691 | 114 |
| 224 | 3300005535 | Ga0070684_100364840 | Ga0070684_1003648402 | 114 |
| 225 | 3300005539 | Ga0068853_100001261 | Ga0068853_1000012616 | 114 |
| 226 | 3300005539 | Ga0068853_100039194 | Ga0068853_1000391946 | 114 |
| 227 | 3300005539 | Ga0068853_100249060 | Ga0068853_1002490602 | 114 |
| 228 | 3300005539 | Ga0068853_100507614 | Ga0068853_1005076142 | 114 |
| 229 | 3300005543 | Ga0070672_100000400 | Ga0070672_10000040016 | 114 |
| 230 | 3300005543 | Ga0070672_100045480 | Ga0070672_1000454805 | 114 |
| 231 | 3300005543 | Ga0070672_100064606 | Ga0070672_1000646062 | 114 |
| 232 | 3300005543 | Ga0070672_100156876 | Ga0070672_1001568762 | 114 |
| 233 | 3300005543 | Ga0070672_100383619 | Ga0070672_1003836192 | 114 |
| 234 | 3300005543 | Ga0070672_101022668 | Ga0070672_1010226682 | 114 |
| 235 | 3300005543 | Ga0070672_101221836 | Ga0070672_1012218362 | 114 |
| 236 | 3300005546 | Ga0070696_101066061 | Ga0070696_1010660612 | 114 |
| 237 | 3300005547 | Ga0070693_100009475 | Ga0070693_1000094752 | 114 |
| 238 | 3300005547 | Ga0070693_100011659 | Ga0070693_1000116592 | 114 |
| 239 | 3300005547 | Ga0070693_100464487 | Ga0070693_1004644871 | 114 |
| 240 | 3300005548 | Ga0070665_101002257 | Ga0070665_1010022572 | 114 |
| 241 | 3300005563 | Ga0068855_100000309 | Ga0068855_10000030919 | 114 |
| 242 | 3300005563 | Ga0068855_100063382 | Ga0068855_1000633822 | 114 |
| 243 | 3300005563 | Ga0068855_100194874 | Ga0068855_1001948742 | 114 |
| 244 | 3300005564 | Ga0070664_100004875 | Ga0070664_10000487513 | 114 |
| 245 | 3300005564 | Ga0070664_100074046 | Ga0070664_1000740462 | 114 |
| 246 | 3300005564 | Ga0070664_100136575 | Ga0070664_1001365752 | 114 |
| 247 | 3300005564 | Ga0070664_100436422 | Ga0070664_1004364222 | 114 |
| 248 | 3300005564 | Ga0070664_100702991 | Ga0070664_1007029912 | 114 |
| 249 | 3300005564 | Ga0070664_100703397 | Ga0070664_1007033972 | 114 |
| 250 | 3300005564 | Ga0070664_100773506 | Ga0070664_1007735062 | 114 |
| 251 | 3300005564 | Ga0070664_100953427 | Ga0070664_1009534271 | 114 |
| 252 | 3300005577 | Ga0068857_100010752 | Ga0068857_1000107527 | 114 |
| 253 | 3300005578 | Ga0068854_100003381 | Ga0068854_1000033817 | 114 |
| 254 | 3300005578 | Ga0068854_100159916 | Ga0068854_1001599162 | 114 |
| 255 | 3300005578 | Ga0068854_100239014 | Ga0068854_1002390142 | 114 |
| 256 | 3300005578 | Ga0068854_100851303 | Ga0068854_1008513032 | 114 |
| 257 | 3300005578 | Ga0068854_101314675 | Ga0068854_1013146752 | 114 |
| 258 | 3300005614 | Ga0068856_100026185 | Ga0068856_1000261852 | 114 |
| 259 | 3300005614 | Ga0068856_100147656 | Ga0068856_1001476562 | 114 |
| 260 | 3300005614 | Ga0068856_100175772 | Ga0068856_1001757721 | 114 |
| 261 | 3300005614 | Ga0068856_100256675 | Ga0068856_1002566752 | 114 |
| 262 | 3300005614 | Ga0068856_101031093 | Ga0068856_1010310932 | 114 |
| 263 | 3300005615 | Ga0070702_100030098 | Ga0070702_1000300982 | 114 |
| 264 | 3300005615 | Ga0070702_100208896 | Ga0070702_1002088962 | 114 |
| 265 | 3300005615 | Ga0070702_100466673 | Ga0070702_1004666732 | 114 |
| 266 | 3300005615 | Ga0070702_100541886 | Ga0070702_1005418861 | 114 |
| 267 | 3300005616 | Ga0068852_100001773 | Ga0068852_10000177313 | 114 |
| 268 | 3300005616 | Ga0068852_100115864 | Ga0068852_1001158643 | 114 |
| 269 | 3300005616 | Ga0068852_100183913 | Ga0068852_1001839132 | 114 |
| 270 | 3300005616 | Ga0068852_100480101 | Ga0068852_1004801012 | 114 |
| 271 | 3300005616 | Ga0068852_100758413 | Ga0068852_1007584132 | 114 |
| 272 | 3300005616 | Ga0068852_101155003 | Ga0068852_1011550032 | 114 |
| 273 | 3300005617 | Ga0068859_100236647 | Ga0068859_1002366472 | 114 |
| 274 | 3300005618 | Ga0068864_100002319 | Ga0068864_10000231920 | 114 |
| 275 | 3300005618 | Ga0068864_100010339 | Ga0068864_1000103392 | 114 |
| 276 | 3300005618 | Ga0068864_100143930 | Ga0068864_1001439302 | 114 |
| 277 | 3300005618 | Ga0068864_102530601 | Ga0068864_1025306012 | 114 |
| 278 | 3300005718 | Ga0068866_11013914 | Ga0068866_110139142 | 114 |
| 279 | 3300005718 | Ga0068866_11395829 | Ga0068866_113958291 | 114 |
| 280 | 3300005719 | Ga0068861_100001606 | Ga0068861_10000160613 | 114 |
| 281 | 3300005719 | Ga0068861_100054926 | Ga0068861_1000549262 | 114 |
| 282 | 3300005719 | Ga0068861_100101587 | Ga0068861_1001015872 | 114 |
| 283 | 3300005719 | Ga0068861_100531966 | Ga0068861_1005319662 | 114 |
| 284 | 3300005719 | Ga0068861_101705137 | Ga0068861_1017051372 | 114 |
| 285 | 3300005834 | Ga0068851_10010030 | Ga0068851_100100302 | 114 |
| 286 | 3300005834 | Ga0068851_10089765 | Ga0068851_100897652 | 114 |
| 287 | 3300005834 | Ga0068851_10145029 | Ga0068851_101450292 | 114 |
| 288 | 3300005834 | Ga0068851_10236155 | Ga0068851_102361552 | 114 |
| 289 | 3300005834 | Ga0068851_10374718 | Ga0068851_103747182 | 114 |
| 290 | 3300005834 | Ga0068851_10532135 | Ga0068851_105321352 | 114 |
| 291 | 3300005840 | Ga0068870_10006793 | Ga0068870_100067932 | 114 |
| 292 | 3300005840 | Ga0068870_10042702 | Ga0068870_100427022 | 114 |
| 293 | 3300005840 | Ga0068870_10128761 | Ga0068870_101287612 | 114 |
| 294 | 3300005840 | Ga0068870_11013112 | Ga0068870_110131122 | 114 |
| 295 | 3300005841 | Ga0068863_100009106 | Ga0068863_1000091062 | 114 |
| 296 | 3300005841 | Ga0068863_100500600 | Ga0068863_1005006002 | 114 |
| 297 | 3300005842 | Ga0068858_100025977 | Ga0068858_1000259772 | 114 |
| 298 | 3300005842 | Ga0068858_100053674 | Ga0068858_1000536742 | 114 |
| 299 | 3300005844 | Ga0068862_100249447 | Ga0068862_1002494472 | 114 |
| 300 | 3300005844 | Ga0068862_101480318 | Ga0068862_1014803182 | 114 |
| 301 | 3300005937 | Ga0081455_10389566 | Ga0081455_103895662 | 114 |
| 302 | 3300006028 | Ga0070717_12138186 | Ga0070717_121381861 | 114 |
| 303 | 3300006038 | Ga0075365_10886406 | Ga0075365_108864062 | 114 |
| 304 | 3300006051 | Ga0075364_10010694 | Ga0075364_100106942 | 114 |
| 305 | 3300006051 | Ga0075364_10066606 | Ga0075364_100666061 | 114 |
| 306 | 3300006178 | Ga0075367_10635618 | Ga0075367_106356182 | 114 |
| 307 | 3300006178 | Ga0075367_10755755 | Ga0075367_107557552 | 114 |
| 308 | 3300006186 | Ga0075369_10046118 | Ga0075369_100461182 | 114 |
| 309 | 3300006195 | Ga0075366_10018918 | Ga0075366_100189183 | 114 |
| 310 | 3300006195 | Ga0075366_10098444 | Ga0075366_100984442 | 114 |
| 311 | 3300006195 | Ga0075366_10153202 | Ga0075366_101532022 | 114 |
| 312 | 3300006195 | Ga0075366_10780386 | Ga0075366_107803862 | 114 |
| 313 | 3300006237 | Ga0097621_100001028 | Ga0097621_1000010283 | 114 |
| 314 | 3300006237 | Ga0097621_100001820 | Ga0097621_1000018202 | 114 |
| 315 | 3300006237 | Ga0097621_100025288 | Ga0097621_1000252882 | 114 |
| 316 | 3300006353 | Ga0075370_10234150 | Ga0075370_102341502 | 114 |
| 317 | 3300006353 | Ga0075370_10516446 | Ga0075370_105164462 | 114 |
| 318 | 3300006358 | Ga0068871_100023518 | Ga0068871_1000235182 | 114 |
| 319 | 3300006358 | Ga0068871_100075366 | Ga0068871_1000753662 | 114 |
| 320 | 3300006358 | Ga0068871_100095080 | Ga0068871_1000950802 | 114 |
| 321 | 3300006358 | Ga0068871_100228184 | Ga0068871_1002281842 | 114 |
| 322 | 3300006358 | Ga0068871_102122932 | Ga0068871_1021229322 | 114 |
| 323 | 3300006844 | Ga0075428_100432013 | Ga0075428_1004320131 | 114 |
| 324 | 3300006846 | Ga0075430_100009987 | Ga0075430_1000099873 | 114 |
| 325 | 3300006880 | Ga0075429_100531279 | Ga0075429_1005312792 | 114 |
| 326 | 3300006881 | Ga0068865_100310014 | Ga0068865_1003100141 | 114 |
| 327 | 3300006881 | Ga0068865_100347227 | Ga0068865_1003472271 | 114 |
| 328 | 3300006881 | Ga0068865_100676437 | Ga0068865_1006764372 | 114 |
| 329 | 3300006881 | Ga0068865_102053755 | Ga0068865_1020537552 | 114 |
| 330 | 3300006931 | Ga0097620_100236633 | Ga0097620_1002366332 | 114 |
| 331 | 3300006946 | Ga0079104_1000323 | Ga0079104_100032320 | 114 |
| 332 | 3300009093 | Ga0105240_10001586 | Ga0105240_1000158620 | 114 |
| 333 | 3300009093 | Ga0105240_10029765 | Ga0105240_100297657 | 114 |
| 334 | 3300009093 | Ga0105240_11044183 | Ga0105240_110441832 | 114 |
| 335 | 3300009094 | Ga0111539_11478023 | Ga0111539_114780232 | 114 |
| 336 | 3300009094 | Ga0111539_11549336 | Ga0111539_115493362 | 114 |
| 337 | 3300009098 | Ga0105245_10001868 | Ga0105245_1000186813 | 114 |
| 338 | 3300009098 | Ga0105245_11047526 | Ga0105245_110475262 | 114 |
| 339 | 3300009148 | Ga0105243_10178818 | Ga0105243_101788182 | 114 |
| 340 | 3300009148 | Ga0105243_10698514 | Ga0105243_106985142 | 114 |
| 341 | 3300009174 | Ga0105241_10018397 | Ga0105241_100183973 | 114 |
| 342 | 3300009174 | Ga0105241_10364206 | Ga0105241_103642063 | 114 |
| 343 | 3300009176 | Ga0105242_10609812 | Ga0105242_106098122 | 114 |
| 344 | 3300009176 | Ga0105242_11330563 | Ga0105242_113305632 | 114 |
| 345 | 3300009176 | Ga0105242_12119337 | Ga0105242_121193372 | 114 |
| 346 | 3300009177 | Ga0105248_10000754 | Ga0105248_1000075420 | 114 |
| 347 | 3300009177 | Ga0105248_10694062 | Ga0105248_106940621 | 114 |
| 348 | 3300009177 | Ga0105248_10754771 | Ga0105248_107547712 | 114 |
| 349 | 3300009177 | Ga0105248_10779785 | Ga0105248_107797852 | 114 |
| 350 | 3300009545 | Ga0105237_10200033 | Ga0105237_102000332 | 114 |
| 351 | 3300009551 | Ga0105238_10001396 | Ga0105238_100013964 | 114 |
| 352 | 3300009551 | Ga0105238_10002093 | Ga0105238_1000209313 | 114 |
| 353 | 3300009551 | Ga0105238_10030317 | Ga0105238_100303178 | 114 |
| 354 | 3300009551 | Ga0105238_10033433 | Ga0105238_100334332 | 114 |
| 355 | 3300009551 | Ga0105238_11032618 | Ga0105238_110326182 | 114 |
| 356 | 3300009553 | Ga0105249_10677211 | Ga0105249_106772112 | 114 |
| 357 | 3300009553 | Ga0105249_11980538 | Ga0105249_119805382 | 114 |
| 358 | 3300010375 | Ga0105239_11131907 | Ga0105239_111319072 | 114 |
| 359 | 3300011119 | Ga0105246_10148056 | Ga0105246_101480562 | 114 |
| 360 | 3300011119 | Ga0105246_12176250 | Ga0105246_121762501 | 114 |
| 361 | 3300012497 | Ga0157319_1030212 | Ga0157319_10302122 | 114 |
| 362 | 3300013100 | Ga0157373_10746776 | Ga0157373_107467762 | 114 |
| 363 | 3300013102 | Ga0157371_10191126 | Ga0157371_101911261 | 114 |
| 364 | 3300013104 | Ga0157370_10001132 | Ga0157370_100011322 | 114 |
| 365 | 3300013104 | Ga0157370_10075988 | Ga0157370_100759882 | 114 |
| 366 | 3300013105 | Ga0157369_10022325 | Ga0157369_100223252 | 114 |
| 367 | 3300013105 | Ga0157369_10051767 | Ga0157369_100517675 | 114 |
| 368 | 3300013105 | Ga0157369_10112241 | Ga0157369_101122412 | 114 |
| 369 | 3300013105 | Ga0157369_10136461 | Ga0157369_101364612 | 114 |
| 370 | 3300013296 | Ga0157374_10027879 | Ga0157374_100278793 | 114 |
| 371 | 3300013296 | Ga0157374_10041915 | Ga0157374_100419152 | 114 |
| 372 | 3300013296 | Ga0157374_10119421 | Ga0157374_101194212 | 114 |
| 373 | 3300013296 | Ga0157374_10478640 | Ga0157374_104786402 | 114 |
| 374 | 3300013297 | Ga0157378_10263095 | Ga0157378_102630952 | 114 |
| 375 | 3300013306 | Ga0163162_10001583 | Ga0163162_100015838 | 114 |
| 376 | 3300013306 | Ga0163162_10524149 | Ga0163162_105241492 | 114 |
| 377 | 3300013306 | Ga0163162_11300898 | Ga0163162_113008981 | 114 |
| 378 | 3300013306 | Ga0163162_11319016 | Ga0163162_113190162 | 114 |
| 379 | 3300013307 | Ga0157372_10001146 | Ga0157372_1000114624 | 114 |
| 380 | 3300013307 | Ga0157372_10057931 | Ga0157372_100579312 | 114 |
| 381 | 3300013307 | Ga0157372_11077643 | Ga0157372_110776432 | 114 |
| 382 | 3300013307 | Ga0157372_11213207 | Ga0157372_112132072 | 114 |
| 383 | 3300013308 | Ga0157375_10139776 | Ga0157375_101397761 | 114 |
| 384 | 3300013308 | Ga0157375_10190922 | Ga0157375_101909222 | 114 |
| 385 | 3300013308 | Ga0157375_10570924 | Ga0157375_105709242 | 114 |
| 386 | 3300013308 | Ga0157375_10763906 | Ga0157375_107639062 | 114 |
| 387 | 3300013308 | Ga0157375_11312931 | Ga0157375_113129312 | 114 |
| 388 | 3300014325 | Ga0163163_10030620 | Ga0163163_100306203 | 114 |
| 389 | 3300014325 | Ga0163163_10048001 | Ga0163163_100480012 | 114 |
| 390 | 3300014325 | Ga0163163_11385009 | Ga0163163_113850092 | 114 |
| 391 | 3300014326 | Ga0157380_10274037 | Ga0157380_102740372 | 114 |
| 392 | 3300014326 | Ga0157380_10329498 | Ga0157380_103294983 | 114 |
| 393 | 3300014326 | Ga0157380_10386691 | Ga0157380_103866912 | 114 |
| 394 | 3300014326 | Ga0157380_10533037 | Ga0157380_105330372 | 114 |
| 395 | 3300014745 | Ga0157377_10699618 | Ga0157377_106996182 | 114 |
| 396 | 3300014968 | Ga0157379_10004830 | Ga0157379_1000483012 | 114 |
| 397 | 3300014968 | Ga0157379_11285034 | Ga0157379_112850342 | 114 |
| 398 | 3300014969 | Ga0157376_10000239 | Ga0157376_1000023917 | 114 |
| 399 | 3300014969 | Ga0157376_10029763 | Ga0157376_100297632 | 114 |
| 400 | 3300014969 | Ga0157376_10130674 | Ga0157376_101306741 | 114 |
| 401 | 3300015262 | Ga0182007_10243198 | Ga0182007_102431982 | 114 |
| 402 | 3300017792 | Ga0163161_10011060 | Ga0163161_100110608 | 114 |
| 403 | 3300017792 | Ga0163161_10051203 | Ga0163161_100512032 | 114 |
| 404 | 3300017792 | Ga0163161_10053006 | Ga0163161_100530062 | 114 |
| 405 | 3300017792 | Ga0163161_10925239 | Ga0163161_109252392 | 114 |
| 406 | 3300017792 | Ga0163161_11271185 | Ga0163161_112711851 | 114 |
| 407 | 3300025284 | Ga0209130_1002397 | Ga0209130_100239711 | 114 |
| 408 | 3300025291 | Ga0209675_1020775 | Ga0209675_10207752 | 114 |
| 409 | 3300025291 | Ga0209675_1025961 | Ga0209675_10259612 | 114 |
| 410 | 3300025292 | Ga0209676_1001669 | Ga0209676_100166918 | 114 |
| 411 | 3300025292 | Ga0209676_1003028 | Ga0209676_100302811 | 114 |
| 412 | 3300025294 | Ga0209025_1000401 | Ga0209025_100040145 | 114 |
| 413 | 3300025294 | Ga0209025_1190719 | Ga0209025_11907192 | 114 |
| 414 | 3300025295 | Ga0209564_1012372 | Ga0209564_10123725 | 114 |
| 415 | 3300025295 | Ga0209564_1031657 | Ga0209564_10316572 | 114 |
| 416 | 3300025297 | Ga0209758_1008210 | Ga0209758_10082103 | 114 |
| 417 | 3300025298 | Ga0209050_1000583 | Ga0209050_100058342 | 114 |
| 418 | 3300025298 | Ga0209050_1003787 | Ga0209050_100378710 | 114 |
| 419 | 3300025298 | Ga0209050_1005409 | Ga0209050_10054097 | 114 |
| 420 | 3300025299 | Ga0209256_1000113 | Ga0209256_100011337 | 114 |
| 421 | 3300025299 | Ga0209256_1000178 | Ga0209256_100017824 | 114 |
| 422 | 3300025299 | Ga0209256_1001335 | Ga0209256_100133519 | 114 |
| 423 | 3300025303 | Ga0209051_1000020 | Ga0209051_100002012 | 114 |
| 424 | 3300025303 | Ga0209051_1022792 | Ga0209051_10227922 | 114 |
| 425 | 3300025304 | Ga0209257_1000085 | Ga0209257_100008512 | 114 |
| 426 | 3300025304 | Ga0209257_1000400 | Ga0209257_100040042 | 114 |
| 427 | 3300025304 | Ga0209257_1000498 | Ga0209257_100049873 | 114 |
| 428 | 3300025304 | Ga0209257_1010761 | Ga0209257_10107612 | 114 |
| 429 | 3300025315 | Ga0207697_10001625 | Ga0207697_100016256 | 114 |
| 430 | 3300025315 | Ga0207697_10029344 | Ga0207697_100293442 | 114 |
| 431 | 3300025321 | Ga0207656_10009912 | Ga0207656_100099122 | 114 |
| 432 | 3300025321 | Ga0207656_10212944 | Ga0207656_102129442 | 114 |
| 433 | 3300025893 | Ga0207682_10000563 | Ga0207682_1000056313 | 114 |
| 434 | 3300025893 | Ga0207682_10006506 | Ga0207682_100065067 | 114 |
| 435 | 3300025893 | Ga0207682_10009090 | Ga0207682_100090902 | 114 |
| 436 | 3300025893 | Ga0207682_10016549 | Ga0207682_100165492 | 114 |
| 437 | 3300025893 | Ga0207682_10123240 | Ga0207682_101232402 | 114 |
| 438 | 3300025893 | Ga0207682_10364121 | Ga0207682_103641212 | 114 |
| 439 | 3300025901 | Ga0207688_10033375 | Ga0207688_100333752 | 114 |
| 440 | 3300025901 | Ga0207688_10291234 | Ga0207688_102912341 | 114 |
| 441 | 3300025901 | Ga0207688_10385579 | Ga0207688_103855792 | 114 |
| 442 | 3300025903 | Ga0207680_10161244 | Ga0207680_101612442 | 114 |
| 443 | 3300025903 | Ga0207680_10545438 | Ga0207680_105454383 | 114 |
| 444 | 3300025907 | Ga0207645_10054247 | Ga0207645_100542472 | 114 |
| 445 | 3300025907 | Ga0207645_10085797 | Ga0207645_100857972 | 114 |
| 446 | 3300025907 | Ga0207645_10307518 | Ga0207645_103075182 | 114 |
| 447 | 3300025908 | Ga0207643_10010469 | Ga0207643_100104692 | 114 |
| 448 | 3300025908 | Ga0207643_10126588 | Ga0207643_101265882 | 114 |
| 449 | 3300025908 | Ga0207643_10208576 | Ga0207643_102085762 | 114 |
| 450 | 3300025909 | Ga0207705_10362683 | Ga0207705_103626832 | 114 |
| 451 | 3300025909 | Ga0207705_10424295 | Ga0207705_104242952 | 114 |
| 452 | 3300025909 | Ga0207705_10483172 | Ga0207705_104831722 | 114 |
| 453 | 3300025911 | Ga0207654_10050927 | Ga0207654_100509272 | 114 |
| 454 | 3300025912 | Ga0207707_10000287 | Ga0207707_100002876 | 114 |
| 455 | 3300025912 | Ga0207707_10011739 | Ga0207707_100117397 | 114 |
| 456 | 3300025912 | Ga0207707_10040426 | Ga0207707_100404261 | 114 |
| 457 | 3300025912 | Ga0207707_10145809 | Ga0207707_101458092 | 114 |
| 458 | 3300025913 | Ga0207695_10012750 | Ga0207695_100127503 | 114 |
| 459 | 3300025913 | Ga0207695_10044326 | Ga0207695_100443266 | 114 |
| 460 | 3300025913 | Ga0207695_11115976 | Ga0207695_111159762 | 114 |
| 461 | 3300025914 | Ga0207671_10480744 | Ga0207671_104807442 | 114 |
| 462 | 3300025917 | Ga0207660_10005852 | Ga0207660_100058522 | 114 |
| 463 | 3300025917 | Ga0207660_10041393 | Ga0207660_100413932 | 114 |
| 464 | 3300025917 | Ga0207660_10117727 | Ga0207660_101177272 | 114 |
| 465 | 3300025919 | Ga0207657_10023128 | Ga0207657_100231287 | 114 |
| 466 | 3300025919 | Ga0207657_10202480 | Ga0207657_102024802 | 114 |
| 467 | 3300025919 | Ga0207657_10932216 | Ga0207657_109322162 | 114 |
| 468 | 3300025920 | Ga0207649_10004693 | Ga0207649_100046934 | 114 |
| 469 | 3300025920 | Ga0207649_10095333 | Ga0207649_100953332 | 114 |
| 470 | 3300025920 | Ga0207649_10412082 | Ga0207649_104120822 | 114 |
| 471 | 3300025920 | Ga0207649_10413521 | Ga0207649_104135211 | 114 |
| 472 | 3300025920 | Ga0207649_10827497 | Ga0207649_108274971 | 114 |
| 473 | 3300025921 | Ga0207652_10005817 | Ga0207652_100058175 | 114 |
| 474 | 3300025921 | Ga0207652_10046539 | Ga0207652_100465393 | 114 |
| 475 | 3300025921 | Ga0207652_10059126 | Ga0207652_100591262 | 114 |
| 476 | 3300025921 | Ga0207652_10187214 | Ga0207652_101872142 | 114 |
| 477 | 3300025921 | Ga0207652_10736225 | Ga0207652_107362252 | 114 |
| 478 | 3300025921 | Ga0207652_11254293 | Ga0207652_112542931 | 114 |
| 479 | 3300025921 | Ga0207652_11263709 | Ga0207652_112637092 | 114 |
| 480 | 3300025923 | Ga0207681_10109314 | Ga0207681_101093142 | 114 |
| 481 | 3300025923 | Ga0207681_10121383 | Ga0207681_101213832 | 114 |
| 482 | 3300025924 | Ga0207694_10005307 | Ga0207694_1000530712 | 114 |
| 483 | 3300025924 | Ga0207694_10047004 | Ga0207694_100470041 | 114 |
| 484 | 3300025924 | Ga0207694_10306590 | Ga0207694_103065902 | 114 |
| 485 | 3300025925 | Ga0207650_10001487 | Ga0207650_100014877 | 114 |
| 486 | 3300025925 | Ga0207650_10022541 | Ga0207650_100225412 | 114 |
| 487 | 3300025925 | Ga0207650_10040917 | Ga0207650_100409172 | 114 |
| 488 | 3300025925 | Ga0207650_10049495 | Ga0207650_100494952 | 114 |
| 489 | 3300025925 | Ga0207650_10054873 | Ga0207650_100548732 | 114 |
| 490 | 3300025925 | Ga0207650_10243718 | Ga0207650_102437182 | 114 |
| 491 | 3300025925 | Ga0207650_10603214 | Ga0207650_106032141 | 114 |
| 492 | 3300025925 | Ga0207650_10750948 | Ga0207650_107509481 | 114 |
| 493 | 3300025925 | Ga0207650_11703724 | Ga0207650_117037242 | 114 |
| 494 | 3300025926 | Ga0207659_10000842 | Ga0207659_1000084214 | 114 |
| 495 | 3300025926 | Ga0207659_10009447 | Ga0207659_100094473 | 114 |
| 496 | 3300025926 | Ga0207659_10039817 | Ga0207659_100398172 | 114 |
| 497 | 3300025926 | Ga0207659_10050449 | Ga0207659_100504495 | 114 |
| 498 | 3300025926 | Ga0207659_10058256 | Ga0207659_100582563 | 114 |
| 499 | 3300025926 | Ga0207659_10159418 | Ga0207659_101594182 | 114 |
| 500 | 3300025931 | Ga0207644_10000239 | Ga0207644_1000023922 | 114 |
| 501 | 3300025931 | Ga0207644_10001162 | Ga0207644_1000116210 | 114 |
| 502 | 3300025931 | Ga0207644_10055205 | Ga0207644_100552052 | 114 |
| 503 | 3300025931 | Ga0207644_10081456 | Ga0207644_100814562 | 114 |
| 504 | 3300025931 | Ga0207644_10358012 | Ga0207644_103580122 | 114 |
| 505 | 3300025932 | Ga0207690_10004609 | Ga0207690_100046098 | 114 |
| 506 | 3300025932 | Ga0207690_10037289 | Ga0207690_100372892 | 114 |
| 507 | 3300025932 | Ga0207690_10265733 | Ga0207690_102657331 | 114 |
| 508 | 3300025932 | Ga0207690_10570877 | Ga0207690_105708772 | 114 |
| 509 | 3300025933 | Ga0207706_10001645 | Ga0207706_1000164524 | 114 |
| 510 | 3300025933 | Ga0207706_10018070 | Ga0207706_100180707 | 114 |
| 511 | 3300025933 | Ga0207706_10156228 | Ga0207706_101562282 | 114 |
| 512 | 3300025934 | Ga0207686_10958455 | Ga0207686_109584552 | 114 |
| 513 | 3300025935 | Ga0207709_10271086 | Ga0207709_102710862 | 114 |
| 514 | 3300025936 | Ga0207670_10008010 | Ga0207670_100080106 | 114 |
| 515 | 3300025937 | Ga0207669_10000691 | Ga0207669_1000069110 | 114 |
| 516 | 3300025937 | Ga0207669_10003216 | Ga0207669_100032167 | 114 |
| 517 | 3300025937 | Ga0207669_10165937 | Ga0207669_101659372 | 114 |
| 518 | 3300025937 | Ga0207669_11024990 | Ga0207669_110249902 | 114 |
| 519 | 3300025937 | Ga0207669_11208669 | Ga0207669_112086692 | 114 |
| 520 | 3300025938 | Ga0207704_10029915 | Ga0207704_100299152 | 114 |
| 521 | 3300025940 | Ga0207691_10004292 | Ga0207691_1000429214 | 114 |
| 522 | 3300025940 | Ga0207691_10016122 | Ga0207691_100161222 | 114 |
| 523 | 3300025940 | Ga0207691_10301632 | Ga0207691_103016322 | 114 |
| 524 | 3300025940 | Ga0207691_10325210 | Ga0207691_103252102 | 114 |
| 525 | 3300025940 | Ga0207691_10400419 | Ga0207691_104004192 | 114 |
| 526 | 3300025940 | Ga0207691_10457116 | Ga0207691_104571162 | 114 |
| 527 | 3300025940 | Ga0207691_11232899 | Ga0207691_112328991 | 114 |
| 528 | 3300025941 | Ga0207711_10001648 | Ga0207711_100016489 | 114 |
| 529 | 3300025942 | Ga0207689_10001354 | Ga0207689_100013543 | 114 |
| 530 | 3300025944 | Ga0207661_10045569 | Ga0207661_100455692 | 114 |
| 531 | 3300025944 | Ga0207661_10221684 | Ga0207661_102216842 | 114 |
| 532 | 3300025945 | Ga0207679_10002362 | Ga0207679_1000236211 | 114 |
| 533 | 3300025945 | Ga0207679_10003480 | Ga0207679_100034806 | 114 |
| 534 | 3300025945 | Ga0207679_10023601 | Ga0207679_100236012 | 114 |
| 535 | 3300025945 | Ga0207679_10052355 | Ga0207679_100523553 | 114 |
| 536 | 3300025945 | Ga0207679_10103188 | Ga0207679_101031881 | 114 |
| 537 | 3300025945 | Ga0207679_10481540 | Ga0207679_104815402 | 114 |
| 538 | 3300025945 | Ga0207679_11030432 | Ga0207679_110304322 | 114 |
| 539 | 3300025945 | Ga0207679_11787250 | Ga0207679_117872501 | 114 |
| 540 | 3300025949 | Ga0207667_10005072 | Ga0207667_100050725 | 114 |
| 541 | 3300025949 | Ga0207667_10053783 | Ga0207667_100537833 | 114 |
| 542 | 3300025949 | Ga0207667_10142742 | Ga0207667_101427422 | 114 |
| 543 | 3300025960 | Ga0207651_10001068 | Ga0207651_1000106811 | 114 |
| 544 | 3300025960 | Ga0207651_10009955 | Ga0207651_100099557 | 114 |
| 545 | 3300025960 | Ga0207651_10177425 | Ga0207651_101774251 | 114 |
| 546 | 3300025960 | Ga0207651_11720394 | Ga0207651_117203942 | 114 |
| 547 | 3300025972 | Ga0207668_10273271 | Ga0207668_102732712 | 114 |
| 548 | 3300025972 | Ga0207668_11724567 | Ga0207668_117245672 | 114 |
| 549 | 3300025981 | Ga0207640_10140847 | Ga0207640_101408471 | 114 |
| 550 | 3300025981 | Ga0207640_10300138 | Ga0207640_103001382 | 114 |
| 551 | 3300025981 | Ga0207640_10337025 | Ga0207640_103370252 | 114 |
| 552 | 3300025981 | Ga0207640_10366067 | Ga0207640_103660672 | 114 |
| 553 | 3300025981 | Ga0207640_10828043 | Ga0207640_108280432 | 114 |
| 554 | 3300025981 | Ga0207640_10922757 | Ga0207640_109227572 | 114 |
| 555 | 3300025981 | Ga0207640_11171199 | Ga0207640_111711992 | 114 |
| 556 | 3300025981 | Ga0207640_11738277 | Ga0207640_117382772 | 114 |
| 557 | 3300025986 | Ga0207658_10199097 | Ga0207658_101990972 | 114 |
| 558 | 3300026023 | Ga0207677_10002459 | Ga0207677_1000245910 | 114 |
| 559 | 3300026023 | Ga0207677_10090591 | Ga0207677_100905912 | 114 |
| 560 | 3300026023 | Ga0207677_10890784 | Ga0207677_108907842 | 114 |
| 561 | 3300026023 | Ga0207677_11116929 | Ga0207677_111169292 | 114 |
| 562 | 3300026023 | Ga0207677_11392180 | Ga0207677_113921801 | 114 |
| 563 | 3300026035 | Ga0207703_10033505 | Ga0207703_100335054 | 114 |
| 564 | 3300026035 | Ga0207703_10071135 | Ga0207703_100711352 | 114 |
| 565 | 3300026041 | Ga0207639_10035006 | Ga0207639_100350062 | 114 |
| 566 | 3300026041 | Ga0207639_10864969 | Ga0207639_108649692 | 114 |
| 567 | 3300026041 | Ga0207639_11111393 | Ga0207639_111113932 | 114 |
| 568 | 3300026067 | Ga0207678_10003424 | Ga0207678_100034246 | 114 |
| 569 | 3300026067 | Ga0207678_10296096 | Ga0207678_102960962 | 114 |
| 570 | 3300026067 | Ga0207678_10367488 | Ga0207678_103674882 | 114 |
| 571 | 3300026067 | Ga0207678_11339138 | Ga0207678_113391381 | 114 |
| 572 | 3300026067 | Ga0207678_11697997 | Ga0207678_116979972 | 114 |
| 573 | 3300026075 | Ga0207708_10407295 | Ga0207708_104072952 | 114 |
| 574 | 3300026075 | Ga0207708_10580508 | Ga0207708_105805082 | 114 |
| 575 | 3300026075 | Ga0207708_10580539 | Ga0207708_105805392 | 114 |
| 576 | 3300026078 | Ga0207702_10020021 | Ga0207702_100200212 | 114 |
| 577 | 3300026078 | Ga0207702_10024769 | Ga0207702_100247694 | 114 |
| 578 | 3300026078 | Ga0207702_10059200 | Ga0207702_100592002 | 114 |
| 579 | 3300026078 | Ga0207702_10063945 | Ga0207702_100639453 | 114 |
| 580 | 3300026078 | Ga0207702_10120098 | Ga0207702_101200982 | 114 |
| 581 | 3300026078 | Ga0207702_10759491 | Ga0207702_107594912 | 114 |
| 582 | 3300026088 | Ga0207641_10047192 | Ga0207641_100471923 | 114 |
| 583 | 3300026088 | Ga0207641_10442962 | Ga0207641_104429622 | 114 |
| 584 | 3300026088 | Ga0207641_10446518 | Ga0207641_104465182 | 114 |
| 585 | 3300026089 | Ga0207648_10009235 | Ga0207648_100092352 | 114 |
| 586 | 3300026089 | Ga0207648_10027124 | Ga0207648_100271246 | 114 |
| 587 | 3300026089 | Ga0207648_10028071 | Ga0207648_100280712 | 114 |
| 588 | 3300026089 | Ga0207648_10094182 | Ga0207648_100941822 | 114 |
| 589 | 3300026089 | Ga0207648_10148580 | Ga0207648_101485802 | 114 |
| 590 | 3300026089 | Ga0207648_10191278 | Ga0207648_101912782 | 114 |
| 591 | 3300026089 | Ga0207648_10321775 | Ga0207648_103217752 | 114 |
| 592 | 3300026095 | Ga0207676_10010197 | Ga0207676_100101972 | 114 |
| 593 | 3300026095 | Ga0207676_10151029 | Ga0207676_101510292 | 114 |
| 594 | 3300026095 | Ga0207676_10164453 | Ga0207676_101644532 | 114 |
| 595 | 3300026095 | Ga0207676_10961846 | Ga0207676_109618462 | 114 |
| 596 | 3300026095 | Ga0207676_11579721 | Ga0207676_115797212 | 114 |
| 597 | 3300026116 | Ga0207674_10006551 | Ga0207674_100065517 | 114 |
| 598 | 3300026116 | Ga0207674_10708956 | Ga0207674_107089562 | 114 |
| 599 | 3300026118 | Ga0207675_100000395 | Ga0207675_10000039524 | 114 |
| 600 | 3300026118 | Ga0207675_100052624 | Ga0207675_1000526242 | 114 |
| 601 | 3300026118 | Ga0207675_100135429 | Ga0207675_1001354292 | 114 |
| 602 | 3300026118 | Ga0207675_100706597 | Ga0207675_1007065972 | 114 |
| 603 | 3300026118 | Ga0207675_101424275 | Ga0207675_1014242752 | 114 |
| 604 | 3300026121 | Ga0207683_10011601 | Ga0207683_100116013 | 114 |
| 605 | 3300026121 | Ga0207683_10037943 | Ga0207683_100379432 | 114 |
| 606 | 3300026121 | Ga0207683_10073610 | Ga0207683_100736102 | 114 |
| 607 | 3300026121 | Ga0207683_10087860 | Ga0207683_100878603 | 114 |
| 608 | 3300026121 | Ga0207683_10129492 | Ga0207683_101294922 | 114 |
| 609 | 3300026121 | Ga0207683_10348112 | Ga0207683_103481122 | 114 |
| 610 | 3300026121 | Ga0207683_11546316 | Ga0207683_115463162 | 114 |
| 611 | 3300026142 | Ga0207698_10006452 | Ga0207698_100064525 | 114 |
| 612 | 3300026142 | Ga0207698_10033642 | Ga0207698_100336422 | 114 |
| 613 | 3300026142 | Ga0207698_10303445 | Ga0207698_103034451 | 114 |
| 614 | 3300026142 | Ga0207698_10429117 | Ga0207698_104291172 | 114 |
| 615 | 3300026142 | Ga0207698_10431509 | Ga0207698_104315092 | 114 |
| 616 | 3300026142 | Ga0207698_10496969 | Ga0207698_104969692 | 114 |
| 617 | 3300027111 | Ga0209281_1000195 | Ga0209281_100019587 | 114 |
| 618 | 3300027378 | Ga0209981_1034852 | Ga0209981_10348522 | 114 |
| 619 | 3300027543 | Ga0209999_1013149 | Ga0209999_10131492 | 114 |
| 620 | 3300027543 | Ga0209999_1076242 | Ga0209999_10762422 | 114 |
| 621 | 3300027614 | Ga0209970_1000073 | Ga0209970_100007317 | 114 |
| 622 | 3300027665 | Ga0209983_1110297 | Ga0209983_11102972 | 114 |
| 623 | 3300027876 | Ga0209974_10064116 | Ga0209974_100641162 | 114 |
| 624 | 3300028379 | Ga0268266_10199398 | Ga0268266_101993982 | 114 |
| 625 | 3300028379 | Ga0268266_10453066 | Ga0268266_104530662 | 114 |
| 626 | 3300028380 | Ga0268265_10348012 | Ga0268265_103480122 | 114 |
| 627 | 3300028380 | Ga0268265_10350606 | Ga0268265_103506062 | 114 |
| 628 | 3300028380 | Ga0268265_10552585 | Ga0268265_105525852 | 114 |
| 629 | 3300028380 | Ga0268265_11256575 | Ga0268265_112565752 | 114 |
| 630 | 3300028381 | Ga0268264_10420655 | Ga0268264_104206551 | 114 |
| 631 | 3300028786 | Ga0307517_10125093 | Ga0307517_101250932 | 114 |
| 632 | 3300028794 | Ga0307515_10242171 | Ga0307515_102421712 | 114 |
| 633 | 3300031548 | Ga0307408_100150198 | Ga0307408_1001501982 | 114 |
| 634 | 3300031548 | Ga0307408_100222787 | Ga0307408_1002227872 | 114 |
| 635 | 3300031548 | Ga0307408_100489674 | Ga0307408_1004896742 | 114 |
| 636 | 3300031548 | Ga0307408_101102231 | Ga0307408_1011022312 | 114 |
| 637 | 3300031548 | Ga0307408_101230812 | Ga0307408_1012308122 | 114 |
| 638 | 3300031730 | Ga0307516_10002337 | Ga0307516_1000233719 | 114 |
| 639 | 3300031730 | Ga0307516_10002395 | Ga0307516_1000239511 | 114 |
| 640 | 3300031730 | Ga0307516_10937801 | Ga0307516_109378012 | 114 |
| 641 | 3300031731 | Ga0307405_10139165 | Ga0307405_101391652 | 114 |
| 642 | 3300031731 | Ga0307405_10172313 | Ga0307405_101723132 | 114 |
| 643 | 3300031731 | Ga0307405_10562760 | Ga0307405_105627602 | 114 |
| 644 | 3300031731 | Ga0307405_10611725 | Ga0307405_106117252 | 114 |
| 645 | 3300031824 | Ga0307413_10042250 | Ga0307413_100422502 | 114 |
| 646 | 3300031824 | Ga0307413_10614009 | Ga0307413_106140092 | 114 |
| 647 | 3300031852 | Ga0307410_11334483 | Ga0307410_113344832 | 114 |
| 648 | 3300031852 | Ga0307410_11636441 | Ga0307410_116364411 | 114 |
| 649 | 3300031901 | Ga0307406_10004461 | Ga0307406_100044619 | 114 |
| 650 | 3300031901 | Ga0307406_10640917 | Ga0307406_106409172 | 114 |
| 651 | 3300031901 | Ga0307406_11337169 | Ga0307406_113371691 | 114 |
| 652 | 3300031903 | Ga0307407_10072833 | Ga0307407_100728332 | 114 |
| 653 | 3300031903 | Ga0307407_11127042 | Ga0307407_111270422 | 114 |
| 654 | 3300031911 | Ga0307412_10020707 | Ga0307412_100207072 | 114 |
| 655 | 3300031911 | Ga0307412_10179849 | Ga0307412_101798492 | 114 |
| 656 | 3300031911 | Ga0307412_10355907 | Ga0307412_103559072 | 114 |
| 657 | 3300031911 | Ga0307412_10681519 | Ga0307412_106815192 | 114 |
| 658 | 3300031911 | Ga0307412_11465726 | Ga0307412_114657262 | 114 |
| 659 | 3300031995 | Ga0307409_100106596 | Ga0307409_1001065962 | 114 |
| 660 | 3300031995 | Ga0307409_102310032 | Ga0307409_1023100322 | 114 |
| 661 | 3300031995 | Ga0307409_102761737 | Ga0307409_1027617371 | 114 |
| 662 | 3300032002 | Ga0307416_100064527 | Ga0307416_1000645272 | 114 |
| 663 | 3300032002 | Ga0307416_100147090 | Ga0307416_1001470902 | 114 |
| 664 | 3300032002 | Ga0307416_100205141 | Ga0307416_1002051412 | 114 |
| 665 | 3300032002 | Ga0307416_100782445 | Ga0307416_1007824452 | 114 |
| 666 | 3300032002 | Ga0307416_100964547 | Ga0307416_1009645472 | 114 |
| 667 | 3300032002 | Ga0307416_101653800 | Ga0307416_1016538001 | 114 |
| 668 | 3300032002 | Ga0307416_101676497 | Ga0307416_1016764972 | 114 |
| 669 | 3300032004 | Ga0307414_10057499 | Ga0307414_100574992 | 114 |
| 670 | 3300032004 | Ga0307414_10451059 | Ga0307414_104510592 | 114 |
| 671 | 3300032004 | Ga0307414_10893411 | Ga0307414_108934112 | 114 |
| 672 | 3300032005 | Ga0307411_10001621 | Ga0307411_100016213 | 114 |
| 673 | 3300032005 | Ga0307411_10055286 | Ga0307411_100552862 | 114 |
| 674 | 3300032005 | Ga0307411_10202507 | Ga0307411_102025071 | 114 |
| 675 | 3300032005 | Ga0307411_10360430 | Ga0307411_103604302 | 114 |
| 676 | 3300032005 | Ga0307411_10836729 | Ga0307411_108367292 | 114 |
| 677 | 3300032005 | Ga0307411_11578435 | Ga0307411_115784352 | 114 |
| 678 | 3300032126 | Ga0307415_100827488 | Ga0307415_1008274882 | 114 |
| 679 | 3300033180 | Ga0307510_10486625 | Ga0307510_104866252 | 114 |
| 680 | 3300035112 | Ga0373932_0051412 | Ga0373932_0051412_63_407 | 114 |
| 681 | 3300035691 | Ga0373931_0011887 | Ga0373931_0011887_35_379 | 114 |
| 682 | 3300037312 | Ga0395899_0862013 | Ga0395899_0862013_12_356 | 114 |
| 683 | 3300037418 | Ga0395900_0297437 | Ga0395900_0297437_106_450 | 114 |
| 684 | 3300037466 | Ga0395898_0809902 | Ga0395898_0809902_231_575 | 114 |
| 685 | 3300037471 | Ga0395905_0008484 | Ga0395905_0008484_9337_9735 | 114 |
| 686 | 3300037471 | Ga0395905_0353557 | Ga0395905_0353557_33_377 | 114 |
| 687 | 3300041406 | Ga0439439_0040025 | Ga0439439_0040025_837_1190 | 114 |
| 688 | 3300041410 | Ga0439461_0090850 | Ga0439461_0090850_304_648 | 114 |
| 689 | 3300041441 | Ga0451787_826069 | Ga0451787_826069_59_403 | 114 |
| 690 | 3300041443 | Ga0451789_0082674 | Ga0451789_0082674_40_384 | 114 |
| 691 | 3300041443 | Ga0451789_0190724 | Ga0451789_0190724_105_449 | 114 |
| 692 | 3300041443 | Ga0451789_1092815 | Ga0451789_1092815_76_420 | 114 |
| 693 | 3300041451 | Ga0451791_0052799 | Ga0451791_0052799_313_657 | 114 |
| 694 | 3300041451 | Ga0451791_1403387 | Ga0451791_1403387_443_787 | 114 |
| 695 | 3300041451 | Ga0451791_1836382 | Ga0451791_1836382_132_476 | 114 |
| 696 | 3300041452 | Ga0451793_0719068 | Ga0451793_0719068_54_398 | 114 |
| 697 | 3300041452 | Ga0451793_1085354 | Ga0451793_1085354_305_649 | 114 |
| 698 | 3300041453 | Ga0451797_0735469 | Ga0451797_0735469_71_415 | 114 |
| 699 | 3300041453 | Ga0451797_0986766 | Ga0451797_0986766_265_609 | 114 |
| 700 | 3300041453 | Ga0451797_1293458 | Ga0451797_1293458_902_1246 | 114 |
| 701 | 3300041453 | Ga0451797_1536375 | Ga0451797_1536375_91_435 | 114 |
| 702 | 3300041456 | Ga0451795_0117693 | Ga0451795_0117693_47_391 | 114 |
| 703 | 3300041456 | Ga0451795_0517502 | Ga0451795_0517502_242_586 | 114 |
| 704 | 3300041459 | Ga0451800_0337247 | Ga0451800_0337247_83_427 | 114 |
| 705 | 3300041459 | Ga0451800_1579281 | Ga0451800_1579281_435_779 | 114 |
| 706 | 3300041460 | Ga0451802_0035716 | Ga0451802_0035716_656_1000 | 114 |
| 707 | 3300041460 | Ga0451802_0549967 | Ga0451802_0549967_240_584 | 114 |
| 708 | 3300041460 | Ga0451802_0897781 | Ga0451802_0897781_223_567 | 114 |
| 709 | 3300041460 | Ga0451802_1073611 | Ga0451802_1073611_387_731 | 114 |
| 710 | 3300041463 | Ga0451804_0232158 | Ga0451804_0232158_76_420 | 114 |
| 711 | 3300041463 | Ga0451804_1035732 | Ga0451804_1035732_96_440 | 114 |
| 712 | 3300041486 | Ga0451807_0166802 | Ga0451807_0166802_125_469 | 114 |
| 713 | 3300041486 | Ga0451807_0510672 | Ga0451807_0510672_73_417 | 114 |
| 714 | 3300041486 | Ga0451807_0680237 | Ga0451807_0680237_119_463 | 114 |
| 715 | 3300041486 | Ga0451807_0753404 | Ga0451807_0753404_4317_4661 | 114 |
| 716 | 3300041486 | Ga0451807_1086543 | Ga0451807_1086543_99_443 | 114 |
| 717 | 3300041486 | Ga0451807_1229690 | Ga0451807_1229690_125_469 | 114 |
| 718 | 3300041486 | Ga0451807_1374150 | Ga0451807_1374150_487_831 | 114 |
| 719 | 3300041486 | Ga0451807_1717545 | Ga0451807_1717545_65_409 | 114 |
| 720 | 3300041491 | Ga0451833_0846255 | Ga0451833_0846255_10_354 | 114 |
| 721 | 3300041492 | Ga0451835_1258364 | Ga0451835_1258364_564_908 | 114 |
| 722 | 3300041494 | Ga0451837_0131608 | Ga0451837_0131608_491_835 | 114 |
| 723 | 3300041494 | Ga0451837_1622431 | Ga0451837_1622431_131_475 | 114 |
| 724 | 3300041496 | Ga0451839_1532241 | Ga0451839_1532241_290_634 | 114 |
| 725 | 3300041496 | Ga0451839_1622057 | Ga0451839_1622057_44_388 | 114 |
| 726 | 3300041498 | Ga0451841_0547980 | Ga0451841_0547980_65_409 | 114 |
| 727 | 3300041505 | Ga0451849_0481405 | Ga0451849_0481405_401_745 | 114 |
| 728 | 3300041505 | Ga0451849_1015217 | Ga0451849_1015217_298_642 | 114 |
| 729 | 3300041507 | Ga0451851_0957127 | Ga0451851_0957127_53_397 | 114 |
| 730 | 3300041509 | Ga0451843_0875201 | Ga0451843_0875201_217_561 | 114 |
| 731 | 3300041509 | Ga0451843_1115108 | Ga0451843_1115108_550_894 | 114 |
| 732 | 3300041509 | Ga0451843_1770695 | Ga0451843_1770695_116_463 | 114 |
| 733 | 3300041512 | Ga0451853_0998724 | Ga0451853_0998724_233_577 | 114 |
| 734 | 3300041512 | Ga0451853_1694975 | Ga0451853_1694975_54_398 | 114 |
| 735 | 3300041512 | Ga0451853_1820425 | Ga0451853_1820425_622_969 | 114 |
| 736 | 3300041512 | Ga0451853_1823316 | Ga0451853_1823316_51_395 | 114 |
| 737 | 3300041512 | Ga0451853_1973013 | Ga0451853_1973013_105_449 | 114 |
| 738 | 3300041512 | Ga0451853_2455328 | Ga0451853_2455328_11_355 | 114 |
| 739 | 3300041512 | Ga0451853_3284776 | Ga0451853_3284776_95_439 | 114 |
| 740 | 3300041512 | Ga0451853_3568330 | Ga0451853_3568330_133_480 | 114 |
| 741 | 3300041512 | Ga0451853_3576675 | Ga0451853_3576675_292_636 | 114 |
| 742 | 3300041512 | Ga0451853_3746272 | Ga0451853_3746272_146_490 | 114 |
| 743 | 3300041512 | Ga0451853_3981066 | Ga0451853_3981066_24_368 | 114 |
| 744 | 3300042122 | Ga0450920_031078 | Ga0450920_031078_445_789 | 114 |
| 745 | 3300042531 | Ga0450918_000311 | Ga0450918_000311_969_1313 | 114 |
| 746 | 3300042876 | Ga0451577_0001649 | Ga0451577_0001649_26541_26885 | 114 |
| 747 | 3300044658 | Ga0466972_0037411 | Ga0466972_0037411_1997_2341 | 114 |
| 748 | 3300044658 | Ga0466972_0155017 | Ga0466972_0155017_687_1031 | 114 |
| 749 | 3300044712 | Ga0453684_1554695 | Ga0453684_1554695_318_662 | 114 |
| 750 | 3300044901 | Ga0466960_0032293 | Ga0466960_0032293_80_424 | 114 |
| 751 | 3300045051 | Ga0451576_0256771 | Ga0451576_0256771_1228_1572 | 114 |
| 752 | 3300046472 | Ga0495580_0939561 | Ga0495580_0939561_92_436 | 114 |
| 753 | 3300046519 | Ga0495632_0053249 | Ga0495632_0053249_218_562 | 114 |
| 754 | 3300046539 | Ga0495621_0101175 | Ga0495621_0101175_307_651 | 114 |
| 755 | 3300046616 | Ga0495668_0383848 | Ga0495668_0383848_39_383 | 114 |
| 756 | 3300046660 | Ga0495625_0002783 | Ga0495625_0002783_10024_10368 | 114 |
| 757 | 3300046674 | Ga0495588_0589968 | Ga0495588_0589968_44_388 | 114 |
| 758 | 3300046683 | Ga0495658_0384566 | Ga0495658_0384566_232_576 | 114 |
| 759 | 3300047472 | Ga0495686_0005461 | Ga0495686_0005461_2826_3170 | 114 |
| 760 | 3300047472 | Ga0495686_0051627 | Ga0495686_0051627_1565_1909 | 114 |
| 761 | 3300048903 | Ga0496100_1434732 | Ga0496100_1434732_158_502 | 114 |
| 762 | 3300048904 | Ga0496101_0008877 | Ga0496101_0008877_4329_4673 | 114 |
| 763 | 3300048905 | Ga0496102_0012845 | Ga0496102_0012845_551_895 | 114 |
| 764 | 3300048906 | Ga0496103_0038510 | Ga0496103_0038510_813_1157 | 114 |
| 765 | 3300048907 | Ga0496104_0161291 | Ga0496104_0161291_925_1269 | 114 |
| 766 | 3300048908 | Ga0496105_0276837 | Ga0496105_0276837_157_501 | 114 |
| 767 | 3300048910 | Ga0496107_0006067 | Ga0496107_0006067_3417_3761 | 114 |
| 768 | 3300048911 | Ga0496108_0026763 | Ga0496108_0026763_255_599 | 114 |
| 769 | 3300048911 | Ga0496108_0547105 | Ga0496108_0547105_94_441 | 114 |
| 770 | 3300048912 | Ga0496109_0007706 | Ga0496109_0007706_3592_3936 | 114 |
| 771 | 3300048913 | Ga0496110_0003217 | Ga0496110_0003217_6207_6551 | 114 |
| 772 | 3300048915 | Ga0496112_0087318 | Ga0496112_0087318_858_1202 | 114 |
| 773 | 3300048916 | Ga0496113_0324923 | Ga0496113_0324923_639_983 | 114 |
| 774 | 3300048917 | Ga0496114_0078800 | Ga0496114_0078800_168_512 | 114 |
| 775 | 3300048917 | Ga0496114_0125863 | Ga0496114_0125863_1539_1883 | 114 |
| 776 | 3300048918 | Ga0496115_0069982 | Ga0496115_0069982_1873_2217 | 114 |
| 777 | 3300049571 | Ga0501034_0114078 | Ga0501034_0114078_121_465 | 114 |
| 778 | 3300049571 | Ga0501034_0452323 | Ga0501034_0452323_639_983 | 114 |
| 779 | 3300049571 | Ga0501034_1063569 | Ga0501034_1063569_165_509 | 114 |
| 780 | 3300049574 | Ga0501038_0988119 | Ga0501038_0988119_193_537 | 114 |
| 781 | 3300049575 | Ga0501039_1540318 | Ga0501039_1540318_101_445 | 114 |
| 782 | 3300049578 | Ga0501042_0421701 | Ga0501042_0421701_40_384 | 114 |
| 783 | 3300049578 | Ga0501042_0648077 | Ga0501042_0648077_286_633 | 114 |
| 784 | 3300049578 | Ga0501042_0959787 | Ga0501042_0959787_123_470 | 114 |
| 785 | 3300049579 | Ga0501043_0000573 | Ga0501043_0000573_21181_21525 | 114 |
| 786 | 3300049580 | Ga0501046_0000752 | Ga0501046_0000752_21229_21573 | 114 |
| 787 | 3300049581 | Ga0501047_0000298 | Ga0501047_0000298_21128_21472 | 114 |
| 788 | 3300049581 | Ga0501047_0069572 | Ga0501047_0069572_758_1102 | 114 |
| 789 | 3300049581 | Ga0501047_0569797 | Ga0501047_0569797_478_822 | 114 |
| 790 | 3300049582 | Ga0501048_0008752 | Ga0501048_0008752_3412_3756 | 114 |
| 791 | 3300049586 | Ga0501070_0006860 | Ga0501070_0006860_6104_6448 | 114 |
| 792 | 3300049586 | Ga0501070_0336070 | Ga0501070_0336070_605_949 | 114 |
| 793 | 3300049587 | Ga0501071_0748600 | Ga0501071_0748600_276_620 | 114 |
| 794 | 3300049588 | Ga0501072_0010730 | Ga0501072_0010730_5603_5947 | 114 |
| 795 | 3300049588 | Ga0501072_0373838 | Ga0501072_0373838_331_675 | 114 |
| 796 | 3300049589 | Ga0501073_0004070 | Ga0501073_0004070_9579_9923 | 114 |
| 797 | 3300049589 | Ga0501073_0181721 | Ga0501073_0181721_813_1157 | 114 |
| 798 | 3300049590 | Ga0501074_0329609 | Ga0501074_0329609_636_980 | 114 |
| 799 | 3300049590 | Ga0501074_0765263 | Ga0501074_0765263_305_652 | 114 |
| 800 | 3300049649 | Ga0501198_000049 | Ga0501198_000049_2906_3250 | 114 |
| 801 | 3300049662 | Ga0501222_000057 | Ga0501222_000057_2906_3250 | 114 |
| 802 | 3300049741 | Ga0501079_0031863 | Ga0501079_0031863_713_1057 | 114 |
| 803 | 3300049742 | Ga0501080_0026620 | Ga0501080_0026620_1520_1864 | 114 |
| 804 | 3300049744 | Ga0501083_0051574 | Ga0501083_0051574_303_647 | 114 |
| 805 | 3300049822 | Ga0501035_0406615 | Ga0501035_0406615_537_881 | 114 |
| 806 | 3300049823 | Ga0501044_0515763 | Ga0501044_0515763_469_813 | 114 |
| 807 | 3300049824 | Ga0501045_0001157 | Ga0501045_0001157_10264_10608 | 114 |
| 808 | 3300049824 | Ga0501045_0986218 | Ga0501045_0986218_206_550 | 114 |
| 809 | 3300050492 | nmdc:mga0yw44_279045_c1 | nmdc:mga0yw44_279045_c1_597_941 | 114 |
| 810 | 3300050492 | nmdc:mga0yw44_733674_c1 | nmdc:mga0yw44_733674_c1_57_401 | 114 |
| 811 | 3300050493 | nmdc:mga0k408_23129_c1 | nmdc:mga0k408_23129_c1_1141_1485 | 114 |
| 812 | 3300050493 | nmdc:mga0k408_41987_c1 | nmdc:mga0k408_41987_c1_992_1336 | 114 |
| 813 | 3300050493 | nmdc:mga0k408_760854_c1 | nmdc:mga0k408_760854_c1_155_499 | 114 |
| 814 | 3300050494 | nmdc:mga06z11_168128_c1 | nmdc:mga06z11_168128_c1_322_666 | 114 |
| 815 | 3300050494 | nmdc:mga06z11_934928_c1 | nmdc:mga06z11_934928_c1_66_410 | 114 |
| 816 | 3300050496 | nmdc:mga07m45_205813_c1 | nmdc:mga07m45_205813_c1_269_613 | 114 |
| 817 | 3300050496 | nmdc:mga07m45_550076_c1 | nmdc:mga07m45_550076_c1_157_501 | 114 |
| 818 | 3300050496 | nmdc:mga07m45_75493_c1 | nmdc:mga07m45_75493_c1_450_794 | 114 |
| 819 | 3300050508 | nmdc:mga09592_787246_c1 | nmdc:mga09592_787246_c1_30_374 | 114 |
| 820 | 3300050511 | nmdc:mga08y16_1329778_c1 | nmdc:mga08y16_1329778_c1_70_414 | 114 |
| 821 | 3300050513 | nmdc:mga0rr50_315903_c1 | nmdc:mga0rr50_315903_c1_953_1297 | 114 |
| 822 | 3300050516 | nmdc:mga0sz30_28160_c1 | nmdc:mga0sz30_28160_c1_477_821 | 114 |
| 823 | 3300053117 | Ga0500593_000325 | Ga0500593_000325_12940_13284 | 114 |
| 824 | 3300053130 | Ga0500642_0011345 | Ga0500642_0011345_2583_2927 | 114 |
| 825 | 3300053131 | Ga0500652_000110 | Ga0500652_000110_3895_4239 | 114 |
| 826 | 3300053156 | Ga0500622_0065330 | Ga0500622_0065330_444_788 | 114 |
| 827 | 3300060353 | Ga0501082_1129798 | Ga0501082_1129798_205_549 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ec2-assembly1.cif.gz_C | kcsa with v76ester+g77da mutations | 0.4884 | 24 | 106 |
| 7qru-assembly1.cif.gz_C | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.4692 | 1 | 114 |
| 7qru-assembly1.cif.gz_C | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.4593 | 1 | 114 |
| 5d57-assembly2.cif.gz_F | in meso x-ray crystallography structure of diacylglycerol kinase, dgka, at 100 k | 0.4267 | 24 | 99 |
| 5ec2-assembly1.cif.gz_C | kcsa with v76ester+g77da mutations | 0.4246 | 24 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5d56E00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6287 | 2 | 99 | 1.10.287.3610 |
| 5d56E00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6016 | 2 | 99 | 1.10.287.3610 |
| 4uyoF00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5848 | 6 | 99 | 1.10.287.3610 |
| 4uyoF00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5332 | 6 | 99 | 1.10.287.3610 |
| af_Q2FZV3_3_109_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4998 | 7 | 108 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6SJT5-F1-model_v4 | Uncharacterized protein | 0.5661 | 2 | 99 |
GO:0016020
|
| AF-A0A1F2T9X3-F1-model_v4 | Cation:proton antiporter | 0.5607 | 25 | 114 |
GO:0005886
|
| AF-D0WYG6-F1-model_v4 | deleted | 0.5584 | 25 | 114 |
|
| AF-A0A841BMK6-F1-model_v4 | Mannose/fructose/N-acetylgalactosamine-specific phosphotransferase system component IIC | 0.5487 | 1 | 106 |
GO:0016020
GO:0016740 |
| AF-A0A1F2T9X3-F1-model_v4 | Cation:proton antiporter | 0.5246 | 25 | 114 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar