F482521

General Info

Members Datasets Scaffolds Average Seq Length
827 296 827 114

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_1503600|Ga0451839_1503600_85_507
Length 140
Sequence LKIGPAVDQQSDAPQRASNLPIPRWEFIALCAALMALNLVLLLWLLLRPRTFQVLIGLSLLSYAVNLFIFSVGSLSVGKEPIVKPGLAADLLNYTDPLPQSLVLTAIVIGFATTALFLVVLLALRGLSGGDHVDGQEERP

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
277 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0.24
Rhizoplane 5.68
Rhizosphere 82.59
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10103843 3300003187 Bacteria 759
2 rootH1_10353698 3300003323 Bacteria 1112
3 Ga0055524_1003649 3300003775 Bacteria 7391
4 Ga0055536_1049658 3300003781 Bacteria 930
5 Ga0055536_1061605 3300003781 Bacteria 774
6 Ga0055530_10003649 3300003791 Bacteria 8624
7 Ga0055530_10003998 3300003791 Bacteria 7932
8 Ga0055530_10004641 3300003791 Bacteria 6977
9 Ga0055540_1000011 3300003792 Bacteria 282927
10 Ga0055531_10000421 3300003794 Bacteria 40086
11 Ga0055531_10010758 3300003794 Bacteria 4504
12 Ga0055531_10018284 3300003794 Bacteria 2901
13 Ga0055531_10019683 3300003794 Bacteria 2715
14 Ga0065715_10141067 3300005293 Bacteria 1853
15 Ga0070658_10263175 3300005327 Bacteria 1465
16 Ga0070658_11130657 3300005327 Bacteria 681
17 Ga0070658_11996095 3300005327 Bacteria 501
18 Ga0070676_10003611 3300005328 Bacteria 8087
19 Ga0070676_10026546 3300005328 Bacteria 3279
20 Ga0070676_10043216 3300005328 Bacteria 2618
21 Ga0070683_100033377 3300005329 Bacteria 4693
22 Ga0070683_100034914 3300005329 Bacteria 4596
23 Ga0070683_100229993 3300005329 Bacteria 1763
24 Ga0070683_100252252 3300005329 Bacteria 1678
25 Ga0070683_101460838 3300005329 Bacteria 657
26 Ga0070690_100267869 3300005330 Bacteria 1214
27 Ga0070670_100007539 3300005331 Bacteria 9235
28 Ga0070670_100063864 3300005331 Bacteria 3159
29 Ga0070670_100080214 3300005331 Bacteria 2804
30 Ga0070670_100080990 3300005331 Bacteria 2790
31 Ga0070670_100298203 3300005331 Bacteria 1409
32 Ga0070670_100305713 3300005331 Bacteria 1392
33 Ga0070670_100559334 3300005331 Bacteria 1021
34 Ga0070670_100575611 3300005331 Bacteria 1006
35 Ga0070670_101015510 3300005331 Bacteria 755
36 Ga0070670_102177256 3300005331 Bacteria 511
37 Ga0070677_10000436 3300005333 Bacteria 14318
38 Ga0070677_10024851 3300005333 Bacteria 2232
39 Ga0070677_10079066 3300005333 Bacteria 1402
40 Ga0070677_10139840 3300005333 Bacteria 1115
41 Ga0070677_10168012 3300005333 Bacteria 1034
42 Ga0070677_10447102 3300005333 Bacteria 690
43 Ga0068869_100008346 3300005334 Bacteria 6674
44 Ga0070666_10974089 3300005335 Bacteria 629
45 Ga0070680_100000586 3300005336 Bacteria 25133
46 Ga0070680_100026731 3300005336 Bacteria 4616
47 Ga0070680_100218356 3300005336 Bacteria 1609
48 Ga0070680_100976905 3300005336 Bacteria 731
49 Ga0068868_100007643 3300005338 Bacteria 7709
50 Ga0068868_100011468 3300005338 Bacteria 6454
51 Ga0068868_100128987 3300005338 Bacteria 2068
52 Ga0068868_100223824 3300005338 Bacteria 1576
53 Ga0070660_100049595 3300005339 Bacteria 3227
54 Ga0070660_100210885 3300005339 Bacteria 1577
55 Ga0070660_100473174 3300005339 Bacteria 1041
56 Ga0070660_101183750 3300005339 Bacteria 648
57 Ga0070689_100003713 3300005340 Bacteria 10208
58 Ga0070689_100474273 3300005340 Bacteria 1068
59 Ga0070661_100016902 3300005344 Bacteria 5165
60 Ga0070661_101122403 3300005344 Bacteria 656
61 Ga0070692_10917465 3300005345 Bacteria 607
62 Ga0070668_100066238 3300005347 Bacteria 2802
63 Ga0070669_100001794 3300005353 Bacteria 15423
64 Ga0070669_100009265 3300005353 Bacteria 7015
65 Ga0070669_100094109 3300005353 Bacteria 2251
66 Ga0070669_100861574 3300005353 Bacteria 772
67 Ga0070669_101522233 3300005353 Bacteria 582
68 Ga0070669_101858097 3300005353 Bacteria 526
69 Ga0070675_100001129 3300005354 Bacteria 19296
70 Ga0070675_100003991 3300005354 Bacteria 11198
71 Ga0070675_100035873 3300005354 Bacteria 4032
72 Ga0070675_100047113 3300005354 Bacteria 3532
73 Ga0070675_100408737 3300005354 Bacteria 1212
74 Ga0070675_101327260 3300005354 Bacteria 663
75 Ga0070675_101675986 3300005354 Bacteria 587
76 Ga0070675_101868671 3300005354 Bacteria 554
77 Ga0070675_101901554 3300005354 Bacteria 549
78 Ga0070671_100000637 3300005355 Bacteria 25074
79 Ga0070671_100009827 3300005355 Bacteria 7679
80 Ga0070671_100035766 3300005355 Bacteria 4115
81 Ga0070671_100037552 3300005355 Bacteria 4017
82 Ga0070671_100052027 3300005355 Bacteria 3406
83 Ga0070671_100104878 3300005355 Bacteria 2373
84 Ga0070671_100212318 3300005355 Bacteria 1642
85 Ga0070671_100378974 3300005355 Bacteria 1209
86 Ga0070671_100597997 3300005355 Bacteria 953
87 Ga0070671_100739078 3300005355 Bacteria 855
88 Ga0070674_100003396 3300005356 Bacteria 8926
89 Ga0070674_100021549 3300005356 Bacteria 4140
90 Ga0070674_100241010 3300005356 Bacteria 1416
91 Ga0070674_101563728 3300005356 Bacteria 594
92 Ga0070673_100000618 3300005364 Bacteria 19459
93 Ga0070673_100385853 3300005364 Bacteria 1250
94 Ga0070673_100396751 3300005364 Bacteria 1233
95 Ga0070688_100797903 3300005365 Bacteria 738
96 Ga0070659_100000299 3300005366 Bacteria 38761
97 Ga0070659_100033130 3300005366 Bacteria 4011
98 Ga0070659_100281647 3300005366 Bacteria 1383
99 Ga0070659_100685033 3300005366 Bacteria 885
100 Ga0070659_101536019 3300005366 Bacteria 594
101 Ga0070667_100032332 3300005367 Bacteria 4363
102 Ga0070667_100718734 3300005367 Bacteria 925
103 Ga0070667_100725245 3300005367 Bacteria 921
104 Ga0070667_101085143 3300005367 Bacteria 748
105 Ga0070701_10384898 3300005438 Bacteria 885
106 Ga0070701_10989354 3300005438 Bacteria 586
107 Ga0070700_101300051 3300005441 Bacteria 611
108 Ga0070700_102007548 3300005441 Bacteria 502
109 Ga0070694_101731628 3300005444 Bacteria 532
110 Ga0070663_100009180 3300005455 Bacteria 6115
111 Ga0070663_100539036 3300005455 Bacteria 974
112 Ga0070663_101587416 3300005455 Bacteria 583
113 Ga0070678_100004039 3300005456 Bacteria 8262
114 Ga0070678_100060875 3300005456 Bacteria 2781
115 Ga0070678_100078372 3300005456 Bacteria 2496
116 Ga0070678_100236081 3300005456 Bacteria 1526
117 Ga0070678_100244477 3300005456 Bacteria 1502
118 Ga0070678_100911468 3300005456 Bacteria 804
119 Ga0070678_101583914 3300005456 Bacteria 615
120 Ga0070662_100002167 3300005457 Bacteria 12031
121 Ga0070662_100004791 3300005457 Bacteria 8570
122 Ga0070662_100177981 3300005457 Bacteria 1675
123 Ga0070662_100539811 3300005457 Bacteria 976
124 Ga0070662_101439074 3300005457 Bacteria 594
125 Ga0070681_10005198 3300005458 Bacteria 12564
126 Ga0070681_10031407 3300005458 Bacteria 5333
127 Ga0070681_10053100 3300005458 Bacteria 4039
128 Ga0070681_10324507 3300005458 Bacteria 1449
129 Ga0068867_100000875 3300005459 Bacteria 20338
130 Ga0068867_100011058 3300005459 Bacteria 6366
131 Ga0068867_100057964 3300005459 Bacteria 2869
132 Ga0068867_100067260 3300005459 Bacteria 2671
133 Ga0068867_100553034 3300005459 Bacteria 997
134 Ga0068867_101162066 3300005459 Bacteria 707
135 Ga0070685_10259823 3300005466 Bacteria 1154
136 Ga0070685_10636438 3300005466 Bacteria 771
137 Ga0070685_11307428 3300005466 Bacteria 554
138 Ga0070679_100000494 3300005530 Bacteria 33601
139 Ga0070679_100016024 3300005530 Bacteria 7219
140 Ga0070679_100025313 3300005530 Bacteria 5822
141 Ga0070679_100058607 3300005530 Bacteria 3837
142 Ga0070679_100180437 3300005530 Bacteria 2084
143 Ga0070679_101436969 3300005530 Bacteria 636
144 Ga0070684_100260809 3300005535 Bacteria 1585
145 Ga0070684_100364840 3300005535 Bacteria 1329
146 Ga0068853_100001261 3300005539 Bacteria 18108
147 Ga0068853_100039194 3300005539 Bacteria 4041
148 Ga0068853_100249060 3300005539 Bacteria 1630
149 Ga0068853_100391325 3300005539 Bacteria 1300
150 Ga0068853_100507614 3300005539 Bacteria 1139
151 Ga0070672_100000400 3300005543 Bacteria 25060
152 Ga0070672_100045480 3300005543 Bacteria 3396
153 Ga0070672_100064606 3300005543 Bacteria 2892
154 Ga0070672_100156876 3300005543 Bacteria 1885
155 Ga0070672_100383619 3300005543 Bacteria 1202
156 Ga0070672_101022668 3300005543 Bacteria 733
157 Ga0070672_101221836 3300005543 Bacteria 670
158 Ga0070696_101066061 3300005546 Bacteria 678
159 Ga0070693_100009475 3300005547 Bacteria 4845
160 Ga0070693_100011659 3300005547 Bacteria 4430
161 Ga0070693_100464487 3300005547 Bacteria 891
162 Ga0070693_100477283 3300005547 Bacteria 880
163 Ga0070665_101002257 3300005548 Bacteria 847
164 Ga0068855_100000309 3300005563 Bacteria 60596
165 Ga0068855_100063382 3300005563 Bacteria 4313
166 Ga0068855_100190443 3300005563 Bacteria 2314
167 Ga0068855_100194874 3300005563 Bacteria 2283
168 Ga0070664_100000031 3300005564 Bacteria 88513
169 Ga0070664_100004875 3300005564 Bacteria 10755
170 Ga0070664_100074046 3300005564 Bacteria 2922
171 Ga0070664_100136575 3300005564 Bacteria 2156
172 Ga0070664_100436422 3300005564 Bacteria 1201
173 Ga0070664_100702991 3300005564 Bacteria 942
174 Ga0070664_100703397 3300005564 Bacteria 942
175 Ga0070664_100773506 3300005564 Bacteria 897
176 Ga0070664_100953427 3300005564 Bacteria 805
177 Ga0068857_100010752 3300005577 Bacteria 7964
178 Ga0068857_100030589 3300005577 Bacteria 4755
179 Ga0068854_100003381 3300005578 Bacteria 9941
180 Ga0068854_100159916 3300005578 Bacteria 1743
181 Ga0068854_100239014 3300005578 Bacteria 1445
182 Ga0068854_100851303 3300005578 Bacteria 798
183 Ga0068854_101314675 3300005578 Bacteria 651
184 Ga0068856_100026185 3300005614 Bacteria 5687
185 Ga0068856_100147656 3300005614 Bacteria 2359
186 Ga0068856_100175772 3300005614 Bacteria 2153
187 Ga0068856_100256675 3300005614 Bacteria 1763
188 Ga0068856_101031093 3300005614 Bacteria 841
189 Ga0070702_100030098 3300005615 Bacteria 2957
190 Ga0070702_100208896 3300005615 Bacteria 1298
191 Ga0070702_100466673 3300005615 Bacteria 919
192 Ga0070702_100541886 3300005615 Bacteria 862
193 Ga0068852_100001773 3300005616 Bacteria 14690
194 Ga0068852_100039595 3300005616 Bacteria 3969
195 Ga0068852_100115864 3300005616 Bacteria 2444
196 Ga0068852_100183913 3300005616 Bacteria 1967
197 Ga0068852_100480101 3300005616 Bacteria 1235
198 Ga0068852_100481378 3300005616 Bacteria 1233
199 Ga0068852_100758413 3300005616 Bacteria 983
200 Ga0068852_101155003 3300005616 Bacteria 795
201 Ga0068859_100236647 3300005617 Bacteria 1915
202 Ga0068864_100002319 3300005618 Bacteria 15745
203 Ga0068864_100010339 3300005618 Bacteria 7707
204 Ga0068864_100143930 3300005618 Bacteria 2153
205 Ga0068864_102530601 3300005618 Bacteria 519
206 Ga0068866_11013914 3300005718 Bacteria 590
207 Ga0068866_11395829 3300005718 Bacteria 512
208 Ga0068861_100001606 3300005719 Bacteria 14396
209 Ga0068861_100054926 3300005719 Bacteria 3036
210 Ga0068861_100101587 3300005719 Bacteria 2288
211 Ga0068861_100531966 3300005719 Bacteria 1068
212 Ga0068861_101705137 3300005719 Bacteria 623
213 Ga0068851_10010030 3300005834 Bacteria 4412
214 Ga0068851_10089765 3300005834 Bacteria 1617
215 Ga0068851_10145029 3300005834 Bacteria 1294
216 Ga0068851_10236155 3300005834 Bacteria 1032
217 Ga0068851_10374718 3300005834 Bacteria 833
218 Ga0068851_10532135 3300005834 Bacteria 708
219 Ga0068870_10006793 3300005840 Bacteria 5071
220 Ga0068870_10042702 3300005840 Bacteria 2362
221 Ga0068870_10128761 3300005840 Bacteria 1468
222 Ga0068870_11013112 3300005840 Bacteria 593
223 Ga0068863_100009106 3300005841 Bacteria 9694
224 Ga0068863_100500600 3300005841 Bacteria 1196
225 Ga0068858_100025977 3300005842 Bacteria 5446
226 Ga0068858_100053674 3300005842 Bacteria 3728
227 Ga0068860_101099543 3300005843 Bacteria 814
228 Ga0068862_100249447 3300005844 Bacteria 1617
229 Ga0068862_100259758 3300005844 Bacteria 1585
230 Ga0068862_101480318 3300005844 Bacteria 684
231 Ga0081455_10389566 3300005937 Bacteria 971
232 Ga0070717_12138186 3300006028 Bacteria 503
233 Ga0075365_10886406 3300006038 Bacteria 629
234 Ga0075364_10010694 3300006051 Bacteria 5550
235 Ga0075364_10066606 3300006051 Bacteria 2366
236 Ga0075367_10635618 3300006178 Bacteria 679
237 Ga0075367_10755755 3300006178 Bacteria 619
238 Ga0075369_10046118 3300006186 Bacteria 1876
239 Ga0075366_10018918 3300006195 Bacteria 3981
240 Ga0075366_10098444 3300006195 Bacteria 1754
241 Ga0075366_10153202 3300006195 Bacteria 1396
242 Ga0075366_10780386 3300006195 Bacteria 594
243 Ga0097621_100001028 3300006237 Bacteria 19599
244 Ga0097621_100001820 3300006237 Bacteria 14645
245 Ga0097621_100025288 3300006237 Bacteria 4643
246 Ga0075370_10234150 3300006353 Bacteria 1087
247 Ga0075370_10516446 3300006353 Bacteria 721
248 Ga0068871_100023518 3300006358 Bacteria 4769
249 Ga0068871_100075366 3300006358 Bacteria 2785
250 Ga0068871_100095080 3300006358 Bacteria 2488
251 Ga0068871_100228184 3300006358 Bacteria 1615
252 Ga0068871_102122932 3300006358 Bacteria 535
253 Ga0075428_100432013 3300006844 Bacteria 1411
254 Ga0075430_100009987 3300006846 Bacteria 8031
255 Ga0075429_100531279 3300006880 Bacteria 1031
256 Ga0068865_100310014 3300006881 Bacteria 1266
257 Ga0068865_100347227 3300006881 Bacteria 1201
258 Ga0068865_100676437 3300006881 Bacteria 880
259 Ga0068865_102053755 3300006881 Bacteria 519
260 Ga0097620_100236633 3300006931 Bacteria 1915
261 Ga0079104_1000323 3300006946 Bacteria 58919
262 Ga0105240_10001586 3300009093 Bacteria 38590
263 Ga0105240_10029765 3300009093 Bacteria 7106
264 Ga0105240_10118570 3300009093 Bacteria 3189
265 Ga0105240_11044183 3300009093 Bacteria 872
266 Ga0111539_10288905 3300009094 Bacteria 1908
267 Ga0111539_11478023 3300009094 Bacteria 788
268 Ga0111539_11549336 3300009094 Bacteria 769
269 Ga0105245_10001868 3300009098 Bacteria 19142
270 Ga0105245_11047526 3300009098 Bacteria 861
271 Ga0105243_10178818 3300009148 Bacteria 1843
272 Ga0105243_10698514 3300009148 Bacteria 988
273 Ga0105241_10018397 3300009174 Bacteria 5140
274 Ga0105241_10364206 3300009174 Bacteria 1259
275 Ga0105242_10609812 3300009176 Bacteria 1055
276 Ga0105242_11330563 3300009176 Bacteria 743
277 Ga0105242_12119337 3300009176 Bacteria 606
278 Ga0105248_10000754 3300009177 Bacteria 36253
279 Ga0105248_10694062 3300009177 Bacteria 1148
280 Ga0105248_10754771 3300009177 Bacteria 1098
281 Ga0105248_10779785 3300009177 Bacteria 1079
282 Ga0105237_10200033 3300009545 Bacteria 1997
283 Ga0105238_10001396 3300009551 Bacteria 24223
284 Ga0105238_10002093 3300009551 Bacteria 20156
285 Ga0105238_10030317 3300009551 Bacteria 5505
286 Ga0105238_10033433 3300009551 Bacteria 5234
287 Ga0105238_11032618 3300009551 Unclassified 843
288 Ga0105249_10677211 3300009553 Bacteria 1090
289 Ga0105249_11980538 3300009553 Bacteria 655
290 Ga0105033_125090 3300009986 Bacteria 547
291 Ga0105239_11131907 3300010375 Bacteria 901
292 Ga0105246_10148056 3300011119 Bacteria 1774
293 Ga0105246_12176250 3300011119 Bacteria 539
294 Ga0157319_1030212 3300012497 Bacteria 581
295 Ga0157373_10746776 3300013100 Bacteria 719
296 Ga0157371_10191126 3300013102 Bacteria 1466
297 Ga0157370_10001132 3300013104 Bacteria 33324
298 Ga0157370_10017855 3300013104 Bacteria 7150
299 Ga0157370_10075988 3300013104 Bacteria 3165
300 Ga0157370_11325608 3300013104 Bacteria 648
301 Ga0157370_11369806 3300013104 Bacteria 637
302 Ga0157369_10022325 3300013105 Bacteria 7064
303 Ga0157369_10051767 3300013105 Bacteria 4443
304 Ga0157369_10112241 3300013105 Bacteria 2896
305 Ga0157369_10136461 3300013105 Bacteria 2597
306 Ga0157374_10027879 3300013296 Bacteria 5099
307 Ga0157374_10041915 3300013296 Bacteria 4221
308 Ga0157374_10119421 3300013296 Bacteria 2543
309 Ga0157374_10478640 3300013296 Bacteria 1248
310 Ga0157378_10263095 3300013297 Bacteria 1656
311 Ga0163162_10001583 3300013306 Bacteria 21267
312 Ga0163162_10524149 3300013306 Bacteria 1314
313 Ga0163162_11300898 3300013306 Bacteria 826
314 Ga0163162_11319016 3300013306 Bacteria 820
315 Ga0157372_10001146 3300013307 Bacteria 28770
316 Ga0157372_10019925 3300013307 Bacteria 7231
317 Ga0157372_10057931 3300013307 Bacteria 4331
318 Ga0157372_11077643 3300013307 Bacteria 930
319 Ga0157372_11213207 3300013307 Bacteria 872
320 Ga0157375_10139776 3300013308 Bacteria 2548
321 Ga0157375_10190922 3300013308 Bacteria 2203
322 Ga0157375_10261605 3300013308 Bacteria 1892
323 Ga0157375_10570924 3300013308 Bacteria 1292
324 Ga0157375_10763906 3300013308 Bacteria 1117
325 Ga0157375_11312931 3300013308 Bacteria 851
326 Ga0163163_10030620 3300014325 Bacteria 5187
327 Ga0163163_10048001 3300014325 Bacteria 4197
328 Ga0163163_11385009 3300014325 Bacteria 765
329 Ga0157380_10274037 3300014326 Bacteria 1540
330 Ga0157380_10329498 3300014326 Bacteria 1419
331 Ga0157380_10386691 3300014326 Bacteria 1322
332 Ga0157380_10533037 3300014326 Bacteria 1148
333 Ga0157377_10699618 3300014745 Bacteria 736
334 Ga0157379_10004830 3300014968 Bacteria 11576
335 Ga0157379_11285034 3300014968 Bacteria 706
336 Ga0157376_10000239 3300014969 Bacteria 38460
337 Ga0157376_10029763 3300014969 Bacteria 4353
338 Ga0157376_10130674 3300014969 Bacteria 2240
339 Ga0182007_10243198 3300015262 Bacteria 643
340 Ga0163161_10011060 3300017792 Bacteria 6250
341 Ga0163161_10051203 3300017792 Bacteria 2990
342 Ga0163161_10053006 3300017792 Bacteria 2941
343 Ga0163161_10925239 3300017792 Bacteria 740
344 Ga0163161_11271185 3300017792 Bacteria 639
345 Ga0209130_1002397 3300025284 Bacteria 9477
346 Ga0209675_1020775 3300025291 Bacteria 1769
347 Ga0209675_1025961 3300025291 Bacteria 1467
348 Ga0209676_1001669 3300025292 Bacteria 19275
349 Ga0209676_1003028 3300025292 Bacteria 10897
350 Ga0209025_1000401 3300025294 Bacteria 88709
351 Ga0209025_1190719 3300025294 Bacteria 515
352 Ga0209564_1012372 3300025295 Bacteria 3724
353 Ga0209564_1031657 3300025295 Bacteria 1611
354 Ga0209758_1008210 3300025297 Bacteria 6839
355 Ga0209050_1000583 3300025298 Bacteria 59089
356 Ga0209050_1003787 3300025298 Bacteria 10810
357 Ga0209050_1005409 3300025298 Bacteria 8053
358 Ga0209256_1000113 3300025299 Bacteria 175296
359 Ga0209256_1000178 3300025299 Bacteria 125165
360 Ga0209256_1001335 3300025299 Bacteria 26336
361 Ga0209051_1000020 3300025303 Bacteria 508628
362 Ga0209051_1022792 3300025303 Bacteria 2625
363 Ga0209257_1000085 3300025304 Bacteria 291117
364 Ga0209257_1000400 3300025304 Bacteria 84778
365 Ga0209257_1000498 3300025304 Bacteria 70112
366 Ga0209257_1010761 3300025304 Bacteria 4552
367 Ga0207697_10001625 3300025315 Bacteria 12141
368 Ga0207697_10029344 3300025315 Bacteria 2251
369 Ga0207656_10009912 3300025321 Bacteria 3549
370 Ga0207656_10212944 3300025321 Bacteria 937
371 Ga0207682_10000563 3300025893 Bacteria 17166
372 Ga0207682_10006506 3300025893 Bacteria 4700
373 Ga0207682_10009090 3300025893 Bacteria 3925
374 Ga0207682_10016549 3300025893 Bacteria 2877
375 Ga0207682_10123240 3300025893 Bacteria 1151
376 Ga0207682_10364121 3300025893 Bacteria 682
377 Ga0207688_10033375 3300025901 Bacteria 2846
378 Ga0207688_10291234 3300025901 Bacteria 997
379 Ga0207688_10385579 3300025901 Bacteria 867
380 Ga0207680_10161244 3300025903 Bacteria 1504
381 Ga0207680_10545438 3300025903 Bacteria 828
382 Ga0207645_10054247 3300025907 Bacteria 2560
383 Ga0207645_10085797 3300025907 Bacteria 2022
384 Ga0207645_10262169 3300025907 Bacteria 1145
385 Ga0207645_10307518 3300025907 Bacteria 1056
386 Ga0207643_10010469 3300025908 Bacteria 4995
387 Ga0207643_10126588 3300025908 Bacteria 1517
388 Ga0207643_10208576 3300025908 Bacteria 1192
389 Ga0207705_10362683 3300025909 Bacteria 1117
390 Ga0207705_10424295 3300025909 Bacteria 1030
391 Ga0207705_10483172 3300025909 Bacteria 961
392 Ga0207654_10050927 3300025911 Bacteria 2381
393 Ga0207707_10000287 3300025912 Bacteria 53641
394 Ga0207707_10011739 3300025912 Bacteria 7623
395 Ga0207707_10040426 3300025912 Bacteria 4073
396 Ga0207707_10145809 3300025912 Bacteria 2069
397 Ga0207707_10521286 3300025912 Bacteria 1012
398 Ga0207695_10012750 3300025913 Bacteria 10063
399 Ga0207695_10044326 3300025913 Bacteria 4732
400 Ga0207695_10560117 3300025913 Bacteria 1024
401 Ga0207695_11115976 3300025913 Bacteria 668
402 Ga0207671_10480744 3300025914 Bacteria 990
403 Ga0207660_10005852 3300025917 Bacteria 7981
404 Ga0207660_10041393 3300025917 Bacteria 3228
405 Ga0207660_10117727 3300025917 Bacteria 2008
406 Ga0207660_10828924 3300025917 Bacteria 755
407 Ga0207657_10023128 3300025919 Bacteria 5794
408 Ga0207657_10202480 3300025919 Bacteria 1596
409 Ga0207657_10932216 3300025919 Bacteria 668
410 Ga0207649_10004693 3300025920 Bacteria 7392
411 Ga0207649_10014193 3300025920 Bacteria 4458
412 Ga0207649_10095333 3300025920 Bacteria 1958
413 Ga0207649_10412082 3300025920 Bacteria 1013
414 Ga0207649_10413521 3300025920 Bacteria 1012
415 Ga0207649_10827497 3300025920 Bacteria 724
416 Ga0207652_10005817 3300025921 Bacteria 10000
417 Ga0207652_10046539 3300025921 Bacteria 3701
418 Ga0207652_10059126 3300025921 Bacteria 3304
419 Ga0207652_10187214 3300025921 Bacteria 1861
420 Ga0207652_10736225 3300025921 Bacteria 878
421 Ga0207652_11254293 3300025921 Bacteria 643
422 Ga0207652_11263709 3300025921 Bacteria 641
423 Ga0207681_10109314 3300025923 Bacteria 2008
424 Ga0207681_10121383 3300025923 Bacteria 1917
425 Ga0207694_10005307 3300025924 Bacteria 9931
426 Ga0207694_10047004 3300025924 Bacteria 3337
427 Ga0207694_10306590 3300025924 Bacteria 1308
428 Ga0207650_10001487 3300025925 Bacteria 16806
429 Ga0207650_10022541 3300025925 Bacteria 4457
430 Ga0207650_10040917 3300025925 Bacteria 3394
431 Ga0207650_10049495 3300025925 Bacteria 3103
432 Ga0207650_10054873 3300025925 Bacteria 2957
433 Ga0207650_10243718 3300025925 Bacteria 1453
434 Ga0207650_10603214 3300025925 Bacteria 923
435 Ga0207650_10750948 3300025925 Bacteria 825
436 Ga0207650_11703724 3300025925 Bacteria 534
437 Ga0207659_10000842 3300025926 Bacteria 18164
438 Ga0207659_10009447 3300025926 Bacteria 6095
439 Ga0207659_10039817 3300025926 Bacteria 3282
440 Ga0207659_10050449 3300025926 Bacteria 2956
441 Ga0207659_10058256 3300025926 Bacteria 2772
442 Ga0207659_10159418 3300025926 Bacteria 1770
443 Ga0207644_10000239 3300025931 Bacteria 37746
444 Ga0207644_10001162 3300025931 Bacteria 16884
445 Ga0207644_10055205 3300025931 Bacteria 2863
446 Ga0207644_10081456 3300025931 Bacteria 2392
447 Ga0207644_10358012 3300025931 Bacteria 1186
448 Ga0207690_10004609 3300025932 Bacteria 8151
449 Ga0207690_10037289 3300025932 Bacteria 3155
450 Ga0207690_10265733 3300025932 Bacteria 1331
451 Ga0207690_10570877 3300025932 Bacteria 921
452 Ga0207706_10001645 3300025933 Bacteria 22114
453 Ga0207706_10018070 3300025933 Bacteria 6344
454 Ga0207706_10156228 3300025933 Bacteria 2006
455 Ga0207686_10958455 3300025934 Bacteria 693
456 Ga0207709_10271086 3300025935 Bacteria 1249
457 Ga0207670_10008010 3300025936 Bacteria 5938
458 Ga0207669_10000691 3300025937 Bacteria 14547
459 Ga0207669_10003216 3300025937 Bacteria 7059
460 Ga0207669_10165937 3300025937 Bacteria 1566
461 Ga0207669_11024990 3300025937 Bacteria 694
462 Ga0207669_11208669 3300025937 Bacteria 640
463 Ga0207704_10029915 3300025938 Bacteria 3046
464 Ga0207691_10004292 3300025940 Bacteria 13846
465 Ga0207691_10016122 3300025940 Bacteria 7097
466 Ga0207691_10301632 3300025940 Bacteria 1376
467 Ga0207691_10325210 3300025940 Bacteria 1318
468 Ga0207691_10400419 3300025940 Bacteria 1171
469 Ga0207691_10457116 3300025940 Bacteria 1086
470 Ga0207691_11232899 3300025940 Bacteria 619
471 Ga0207711_10001648 3300025941 Bacteria 20599
472 Ga0207689_10001354 3300025942 Bacteria 23520
473 Ga0207661_10045569 3300025944 Bacteria 3472
474 Ga0207661_10221684 3300025944 Bacteria 1672
475 Ga0207679_10000127 3300025945 Bacteria 62374
476 Ga0207679_10002362 3300025945 Bacteria 11613
477 Ga0207679_10003480 3300025945 Bacteria 9732
478 Ga0207679_10023601 3300025945 Bacteria 4208
479 Ga0207679_10052355 3300025945 Bacteria 2994
480 Ga0207679_10103188 3300025945 Bacteria 2234
481 Ga0207679_10481540 3300025945 Bacteria 1105
482 Ga0207679_11030432 3300025945 Bacteria 755
483 Ga0207679_11787250 3300025945 Bacteria 562
484 Ga0207667_10005072 3300025949 Bacteria 16091
485 Ga0207667_10053783 3300025949 Bacteria 4235
486 Ga0207667_10142742 3300025949 Bacteria 2465
487 Ga0207667_11779758 3300025949 Bacteria 581
488 Ga0207651_10001068 3300025960 Bacteria 12168
489 Ga0207651_10009955 3300025960 Bacteria 5240
490 Ga0207651_10177425 3300025960 Bacteria 1686
491 Ga0207651_11720394 3300025960 Bacteria 565
492 Ga0207668_10273271 3300025972 Bacteria 1382
493 Ga0207668_11724567 3300025972 Bacteria 565
494 Ga0207640_10140847 3300025981 Bacteria 1758
495 Ga0207640_10300138 3300025981 Bacteria 1270
496 Ga0207640_10337025 3300025981 Bacteria 1207
497 Ga0207640_10366067 3300025981 Bacteria 1163
498 Ga0207640_10828043 3300025981 Bacteria 804
499 Ga0207640_10922757 3300025981 Bacteria 764
500 Ga0207640_11171199 3300025981 Bacteria 682
501 Ga0207640_11738277 3300025981 Bacteria 563
502 Ga0207658_10199097 3300025986 Bacteria 1671
503 Ga0207677_10002459 3300026023 Bacteria 9739
504 Ga0207677_10090591 3300026023 Bacteria 2223
505 Ga0207677_10890784 3300026023 Bacteria 802
506 Ga0207677_11116929 3300026023 Bacteria 719
507 Ga0207677_11392180 3300026023 Bacteria 646
508 Ga0207703_10033505 3300026035 Bacteria 4073
509 Ga0207703_10071135 3300026035 Bacteria 2873
510 Ga0207639_10035006 3300026041 Bacteria 3715
511 Ga0207639_10864969 3300026041 Bacteria 844
512 Ga0207639_11111393 3300026041 Bacteria 741
513 Ga0207678_10003424 3300026067 Bacteria 14286
514 Ga0207678_10019215 3300026067 Bacteria 6000
515 Ga0207678_10296096 3300026067 Bacteria 1390
516 Ga0207678_10367488 3300026067 Bacteria 1242
517 Ga0207678_11339138 3300026067 Bacteria 633
518 Ga0207678_11697997 3300026067 Bacteria 555
519 Ga0207708_10407295 3300026075 Bacteria 1126
520 Ga0207708_10580508 3300026075 Bacteria 948
521 Ga0207708_10580539 3300026075 Bacteria 948
522 Ga0207702_10020021 3300026078 Bacteria 5544
523 Ga0207702_10024769 3300026078 Bacteria 4978
524 Ga0207702_10059200 3300026078 Bacteria 3262
525 Ga0207702_10063945 3300026078 Bacteria 3148
526 Ga0207702_10120098 3300026078 Bacteria 2351
527 Ga0207702_10759491 3300026078 Bacteria 957
528 Ga0207641_10047192 3300026088 Bacteria 3631
529 Ga0207641_10442962 3300026088 Bacteria 1254
530 Ga0207641_10446518 3300026088 Bacteria 1249
531 Ga0207648_10009235 3300026089 Bacteria 9471
532 Ga0207648_10027124 3300026089 Bacteria 5087
533 Ga0207648_10028071 3300026089 Bacteria 4991
534 Ga0207648_10094182 3300026089 Bacteria 2619
535 Ga0207648_10106694 3300026089 Bacteria 2458
536 Ga0207648_10148580 3300026089 Bacteria 2068
537 Ga0207648_10191278 3300026089 Bacteria 1814
538 Ga0207648_10321775 3300026089 Bacteria 1390
539 Ga0207648_11256178 3300026089 Bacteria 696
540 Ga0207676_10010197 3300026095 Bacteria 6685
541 Ga0207676_10151029 3300026095 Bacteria 2000
542 Ga0207676_10164453 3300026095 Bacteria 1926
543 Ga0207676_10961846 3300026095 Bacteria 840
544 Ga0207676_11579721 3300026095 Bacteria 654
545 Ga0207674_10006551 3300026116 Bacteria 13698
546 Ga0207674_10026193 3300026116 Bacteria 6202
547 Ga0207674_10708956 3300026116 Bacteria 971
548 Ga0207675_100000395 3300026118 Bacteria 41843
549 Ga0207675_100052624 3300026118 Bacteria 3799
550 Ga0207675_100135429 3300026118 Bacteria 2337
551 Ga0207675_100651379 3300026118 Bacteria 1059
552 Ga0207675_100706597 3300026118 Bacteria 1017
553 Ga0207675_101424275 3300026118 Bacteria 714
554 Ga0207683_10011601 3300026121 Bacteria 7524
555 Ga0207683_10037943 3300026121 Bacteria 4196
556 Ga0207683_10073610 3300026121 Bacteria 3022
557 Ga0207683_10087860 3300026121 Bacteria 2765
558 Ga0207683_10129492 3300026121 Bacteria 2269
559 Ga0207683_10348112 3300026121 Bacteria 1360
560 Ga0207683_11546316 3300026121 Bacteria 612
561 Ga0207698_10006452 3300026142 Bacteria 7322
562 Ga0207698_10033642 3300026142 Bacteria 3727
563 Ga0207698_10101184 3300026142 Bacteria 2389
564 Ga0207698_10303445 3300026142 Bacteria 1487
565 Ga0207698_10429117 3300026142 Bacteria 1270
566 Ga0207698_10431509 3300026142 Bacteria 1267
567 Ga0207698_10496969 3300026142 Bacteria 1186
568 Ga0209281_1000195 3300027111 Bacteria 139144
569 Ga0209981_1034852 3300027378 Bacteria 744
570 Ga0209999_1013149 3300027543 Bacteria 1502
571 Ga0209999_1076242 3300027543 Bacteria 645
572 Ga0209970_1000073 3300027614 Bacteria 13735
573 Ga0209983_1110297 3300027665 Bacteria 625
574 Ga0209974_10064116 3300027876 Bacteria 1246
575 Ga0268266_10199398 3300028379 Bacteria 1831
576 Ga0268266_10453066 3300028379 Bacteria 1220
577 Ga0268265_10348012 3300028380 Bacteria 1352
578 Ga0268265_10350606 3300028380 Bacteria 1348
579 Ga0268265_10552585 3300028380 Bacteria 1093
580 Ga0268265_11256575 3300028380 Bacteria 739
581 Ga0268264_10418014 3300028381 Bacteria 1292
582 Ga0268264_10420655 3300028381 Bacteria 1288
583 Ga0307517_10125093 3300028786 Bacteria 1880
584 Ga0307515_10242171 3300028794 Bacteria 1572
585 Ga0307408_100150198 3300031548 Bacteria 1838
586 Ga0307408_100222787 3300031548 Bacteria 1540
587 Ga0307408_100489674 3300031548 Bacteria 1074
588 Ga0307408_101102231 3300031548 Bacteria 736
589 Ga0307408_101230812 3300031548 Bacteria 699
590 Ga0307516_10002337 3300031730 Bacteria 25506
591 Ga0307516_10002395 3300031730 Bacteria 25122
592 Ga0307516_10937801 3300031730 Bacteria 534
593 Ga0307405_10139165 3300031731 Bacteria 1690
594 Ga0307405_10172313 3300031731 Bacteria 1545
595 Ga0307405_10562760 3300031731 Bacteria 924
596 Ga0307405_10611725 3300031731 Bacteria 891
597 Ga0307413_10042250 3300031824 Bacteria 2677
598 Ga0307413_10614009 3300031824 Bacteria 892
599 Ga0307410_11334483 3300031852 Bacteria 628
600 Ga0307410_11636441 3300031852 Bacteria 569
601 Ga0307406_10004461 3300031901 Bacteria 7619
602 Ga0307406_10640917 3300031901 Bacteria 881
603 Ga0307406_11337169 3300031901 Bacteria 626
604 Ga0307407_10072833 3300031903 Bacteria 2050
605 Ga0307407_10885152 3300031903 Bacteria 684
606 Ga0307407_11127042 3300031903 Bacteria 611
607 Ga0307412_10020707 3300031911 Bacteria 4006
608 Ga0307412_10179849 3300031911 Bacteria 1590
609 Ga0307412_10355907 3300031911 Bacteria 1177
610 Ga0307412_10681519 3300031911 Bacteria 880
611 Ga0307412_11465726 3300031911 Bacteria 619
612 Ga0307409_100106596 3300031995 Bacteria 2339
613 Ga0307409_100428983 3300031995 Bacteria 1270
614 Ga0307409_102310032 3300031995 Bacteria 567
615 Ga0307409_102761737 3300031995 Bacteria 519
616 Ga0307416_100064527 3300032002 Bacteria 3005
617 Ga0307416_100147090 3300032002 Bacteria 2153
618 Ga0307416_100205141 3300032002 Bacteria 1874
619 Ga0307416_100782445 3300032002 Bacteria 1049
620 Ga0307416_100964547 3300032002 Bacteria 955
621 Ga0307416_101653800 3300032002 Bacteria 745
622 Ga0307416_101676497 3300032002 Bacteria 740
623 Ga0307414_10057499 3300032004 Bacteria 2734
624 Ga0307414_10451059 3300032004 Bacteria 1128
625 Ga0307414_10893411 3300032004 Bacteria 814
626 Ga0307411_10001621 3300032005 Bacteria 9376
627 Ga0307411_10055286 3300032005 Bacteria 2611
628 Ga0307411_10202507 3300032005 Bacteria 1526
629 Ga0307411_10360430 3300032005 Bacteria 1189
630 Ga0307411_10836729 3300032005 Bacteria 813
631 Ga0307411_11578435 3300032005 Bacteria 605
632 Ga0307415_100263029 3300032126 Bacteria 1409
633 Ga0307415_100827488 3300032126 Bacteria 847
634 Ga0307510_10486625 3300033180 Bacteria 676
635 Ga0373932_0051412 3300035112 Bacteria 1224
636 Ga0373931_0011887 3300035691 Bacteria 4211
637 Ga0395899_0862013 3300037312 Bacteria 555
638 Ga0395900_0297437 3300037418 Bacteria 1601
639 Ga0395898_0809902 3300037466 Bacteria 877
640 Ga0395905_0008484 3300037471 Bacteria 10131
641 Ga0395905_0353557 3300037471 Bacteria 1361
642 Ga0439439_0040025 3300041406 Bacteria 1212
643 Ga0439461_0090850 3300041410 Bacteria 732
644 Ga0451787_826069 3300041441 Bacteria 524
645 Ga0451789_0082674 3300041443 Bacteria 554
646 Ga0451789_0190724 3300041443 Bacteria 622
647 Ga0451789_1092815 3300041443 Bacteria 570
648 Ga0451791_0052799 3300041451 Bacteria 1141
649 Ga0451791_1403387 3300041451 Bacteria 1223
650 Ga0451791_1836382 3300041451 Bacteria 658
651 Ga0451793_0719068 3300041452 Bacteria 502
652 Ga0451793_1085354 3300041452 Bacteria 1308
653 Ga0451797_0735469 3300041453 Bacteria 969
654 Ga0451797_0986766 3300041453 Bacteria 1006
655 Ga0451797_1293458 3300041453 Bacteria 1373
656 Ga0451797_1536375 3300041453 Bacteria 521
657 Ga0451795_0117693 3300041456 Bacteria 616
658 Ga0451795_0517502 3300041456 Bacteria 669
659 Ga0451800_0337247 3300041459 Bacteria 555
660 Ga0451800_1579281 3300041459 Bacteria 897
661 Ga0451802_0035716 3300041460 Bacteria 1057
662 Ga0451802_0549967 3300041460 Bacteria 627
663 Ga0451802_0897781 3300041460 Bacteria 655
664 Ga0451802_1073611 3300041460 Bacteria 1082
665 Ga0451804_0232158 3300041463 Bacteria 692
666 Ga0451804_1035732 3300041463 Bacteria 773
667 Ga0451807_0166802 3300041486 Bacteria 647
668 Ga0451807_0510672 3300041486 Bacteria 533
669 Ga0451807_0680237 3300041486 Bacteria 537
670 Ga0451807_0753404 3300041486 Bacteria 8364
671 Ga0451807_1086543 3300041486 Bacteria 553
672 Ga0451807_1229690 3300041486 Bacteria 561
673 Ga0451807_1374150 3300041486 Bacteria 1686
674 Ga0451807_1717545 3300041486 Bacteria 512
675 Ga0451833_0846255 3300041491 Bacteria 502
676 Ga0451835_1258364 3300041492 Bacteria 948
677 Ga0451837_0131608 3300041494 Bacteria 1646
678 Ga0451837_1622431 3300041494 Bacteria 527
679 Ga0451839_1503600 3300041496 Bacteria 604
680 Ga0451839_1532241 3300041496 Bacteria 668
681 Ga0451839_1622057 3300041496 Bacteria 600
682 Ga0451841_0547980 3300041498 Bacteria 1509
683 Ga0451849_0481405 3300041505 Bacteria 1101
684 Ga0451849_1015217 3300041505 Bacteria 683
685 Ga0451851_0957127 3300041507 Bacteria 565
686 Ga0451843_0875201 3300041509 Bacteria 681
687 Ga0451843_1115108 3300041509 Bacteria 988
688 Ga0451843_1770695 3300041509 Bacteria 593
689 Ga0451853_0998724 3300041512 Bacteria 661
690 Ga0451853_1582152 3300041512 Bacteria 2375
691 Ga0451853_1694975 3300041512 Bacteria 616
692 Ga0451853_1820425 3300041512 Bacteria 1634
693 Ga0451853_1823316 3300041512 Bacteria 518
694 Ga0451853_1973013 3300041512 Bacteria 929
695 Ga0451853_2455328 3300041512 Bacteria 603
696 Ga0451853_3284776 3300041512 Bacteria 654
697 Ga0451853_3568330 3300041512 Bacteria 540
698 Ga0451853_3576675 3300041512 Bacteria 672
699 Ga0451853_3746272 3300041512 Bacteria 602
700 Ga0451853_3981066 3300041512 Bacteria 963
701 Ga0450920_031078 3300042122 Bacteria 1052
702 Ga0450918_000311 3300042531 Bacteria 10885
703 Ga0451577_0001649 3300042876 Bacteria 28892
704 Ga0451577_0160062 3300042876 Bacteria 2027
705 Ga0466972_0037411 3300044658 Bacteria 2373
706 Ga0466972_0155017 3300044658 Bacteria 1076
707 Ga0453684_1544414 3300044712 Bacteria 683
708 Ga0453684_1554695 3300044712 Bacteria 681
709 Ga0466960_0032293 3300044901 Bacteria 2423
710 Ga0451576_0026355 3300045051 Bacteria 6254
711 Ga0451576_0256771 3300045051 Bacteria 1827
712 Ga0495580_0939561 3300046472 Bacteria 554
713 Ga0495632_0053249 3300046519 Bacteria 1988
714 Ga0495621_0101175 3300046539 Bacteria 1097
715 Ga0495668_0383848 3300046616 Bacteria 772
716 Ga0495625_0002783 3300046660 Bacteria 18441
717 Ga0495588_0589968 3300046674 Bacteria 582
718 Ga0495658_0384566 3300046683 Bacteria 894
719 Ga0495686_0005461 3300047472 Bacteria 10016
720 Ga0495686_0051627 3300047472 Bacteria 2580
721 Ga0496100_1434732 3300048903 Bacteria 545
722 Ga0496101_0008877 3300048904 Bacteria 6581
723 Ga0496102_0012845 3300048905 Bacteria 7249
724 Ga0496103_0038510 3300048906 Bacteria 2934
725 Ga0496104_0161291 3300048907 Bacteria 2151
726 Ga0496105_0276837 3300048908 Bacteria 1354
727 Ga0496107_0006067 3300048910 Bacteria 8296
728 Ga0496108_0026763 3300048911 Bacteria 4760
729 Ga0496108_0547105 3300048911 Bacteria 1010
730 Ga0496109_0007706 3300048912 Bacteria 9124
731 Ga0496110_0003217 3300048913 Bacteria 12439
732 Ga0496112_0087318 3300048915 Bacteria 3086
733 Ga0496113_0324923 3300048916 Bacteria 1233
734 Ga0496114_0078800 3300048917 Bacteria 2780
735 Ga0496114_0125863 3300048917 Bacteria 2209
736 Ga0496115_0069982 3300048918 Bacteria 2843
737 Ga0496122_0113276 3300048925 Bacteria 1773
738 Ga0501031_0044720 3300049568 Bacteria 2890
739 Ga0501031_0226570 3300049568 Bacteria 1217
740 Ga0501032_0003810 3300049569 Bacteria 11449
741 Ga0501032_0125102 3300049569 Bacteria 1699
742 Ga0501033_0000158 3300049570 Bacteria 64817
743 Ga0501033_0274077 3300049570 Bacteria 1192
744 Ga0501034_0114078 3300049571 Bacteria 2691
745 Ga0501034_0452323 3300049571 Bacteria 1202
746 Ga0501034_1063569 3300049571 Bacteria 691
747 Ga0501036_1483257 3300049572 Bacteria 549
748 Ga0501037_0000166 3300049573 Bacteria 62316
749 Ga0501038_0289831 3300049574 Bacteria 1287
750 Ga0501038_0977480 3300049574 Bacteria 622
751 Ga0501038_0988119 3300049574 Bacteria 618
752 Ga0501039_0386494 3300049575 Bacteria 1099
753 Ga0501039_1540318 3300049575 Bacteria 511
754 Ga0501042_0421701 3300049578 Bacteria 967
755 Ga0501042_0648077 3300049578 Bacteria 768
756 Ga0501042_0959787 3300049578 Bacteria 623
757 Ga0501043_0000030 3300049579 Bacteria 142422
758 Ga0501043_0000573 3300049579 Bacteria 32893
759 Ga0501043_0474864 3300049579 Bacteria 937
760 Ga0501046_0000752 3300049580 Bacteria 31319
761 Ga0501047_0000298 3300049581 Bacteria 57038
762 Ga0501047_0069572 3300049581 Bacteria 3389
763 Ga0501047_0168906 3300049581 Bacteria 2057
764 Ga0501047_0569797 3300049581 Bacteria 956
765 Ga0501048_0008752 3300049582 Bacteria 7627
766 Ga0501048_0803953 3300049582 Bacteria 676
767 Ga0501067_0124055 3300049583 Bacteria 1437
768 Ga0501068_0015560 3300049584 Bacteria 4371
769 Ga0501069_0000006 3300049585 Bacteria 184515
770 Ga0501069_0231477 3300049585 Bacteria 1076
771 Ga0501070_0000689 3300049586 Bacteria 30986
772 Ga0501070_0006860 3300049586 Bacteria 9690
773 Ga0501070_0065853 3300049586 Bacteria 3000
774 Ga0501070_0336070 3300049586 Bacteria 1227
775 Ga0501071_0012971 3300049587 Bacteria 5669
776 Ga0501071_0748600 3300049587 Bacteria 753
777 Ga0501072_0010730 3300049588 Bacteria 6981
778 Ga0501072_0373838 3300049588 Bacteria 1131
779 Ga0501072_1308411 3300049588 Bacteria 562
780 Ga0501073_0004070 3300049589 Bacteria 10978
781 Ga0501073_0028436 3300049589 Bacteria 3995
782 Ga0501073_0181721 3300049589 Bacteria 1456
783 Ga0501073_0213515 3300049589 Bacteria 1333
784 Ga0501074_0000026 3300049590 Bacteria 68218
785 Ga0501074_0329609 3300049590 Bacteria 1084
786 Ga0501074_0765263 3300049590 Bacteria 681
787 Ga0501076_0811100 3300049592 Bacteria 772
788 Ga0501198_000049 3300049649 Bacteria 38025
789 Ga0501222_000057 3300049662 Bacteria 38026
790 Ga0501079_0031863 3300049741 Bacteria 4052
791 Ga0501079_0521760 3300049741 Bacteria 934
792 Ga0501080_0002110 3300049742 Bacteria 17252
793 Ga0501080_0026620 3300049742 Bacteria 5373
794 Ga0501083_0000129 3300049744 Bacteria 51513
795 Ga0501083_0051574 3300049744 Bacteria 2766
796 Ga0501083_0452003 3300049744 Bacteria 836
797 Ga0501035_0000017 3300049822 Bacteria 241915
798 Ga0501035_0137795 3300049822 Bacteria 2123
799 Ga0501035_0406615 3300049822 Bacteria 1132
800 Ga0501035_0892317 3300049822 Bacteria 704
801 Ga0501044_0000034 3300049823 Bacteria 164058
802 Ga0501044_0038216 3300049823 Bacteria 5013
803 Ga0501044_0323757 3300049823 Bacteria 1465
804 Ga0501044_0515763 3300049823 Bacteria 1095
805 Ga0501045_0001157 3300049824 Bacteria 17488
806 Ga0501045_0986218 3300049824 Bacteria 618
807 nmdc:mga0yw44_279045_c1 3300050492 Bacteria 1116
808 nmdc:mga0yw44_733674_c1 3300050492 Bacteria 671
809 nmdc:mga0k408_23129_c1 3300050493 Bacteria 1518
810 nmdc:mga0k408_41987_c1 3300050493 Bacteria 2634
811 nmdc:mga0k408_760854_c1 3300050493 Bacteria 566
812 nmdc:mga06z11_168128_c1 3300050494 Bacteria 1257
813 nmdc:mga06z11_934928_c1 3300050494 Bacteria 528
814 nmdc:mga07m45_205813_c1 3300050496 Bacteria 1145
815 nmdc:mga07m45_550076_c1 3300050496 Bacteria 667
816 nmdc:mga07m45_75493_c1 3300050496 Bacteria 1920
817 nmdc:mga09592_787246_c1 3300050508 Bacteria 805
818 nmdc:mga08y16_1329778_c1 3300050511 Bacteria 684
819 nmdc:mga08y16_150394_c1 3300050511 Bacteria 2420
820 nmdc:mga0rr50_315903_c1 3300050513 Bacteria 1309
821 nmdc:mga0sz30_28160_c1 3300050516 Bacteria 2310
822 Ga0500593_000325 3300053117 Bacteria 19228
823 Ga0500642_0011345 3300053130 Bacteria 3183
824 Ga0500652_000110 3300053131 Bacteria 32301
825 Ga0500622_0065330 3300053156 Bacteria 1849
826 Ga0501082_0005123 3300060353 Bacteria 11408
827 Ga0501082_1129798 3300060353 Archaea 685

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1503600 Ga0451839_1503600_85_507 110
2 3300005353 Ga0070669_101858097 Ga0070669_1018580971 112
3 3300005530 Ga0070679_100180437 Ga0070679_1001804371 112
4 3300005535 Ga0070684_100260809 Ga0070684_1002608092 112
5 3300005564 Ga0070664_100000031 Ga0070664_10000003134 112
6 3300005577 Ga0068857_100030589 Ga0068857_1000305892 112
7 3300009094 Ga0111539_10288905 Ga0111539_102889052 112
8 3300025912 Ga0207707_10521286 Ga0207707_105212862 112
9 3300025920 Ga0207649_10014193 Ga0207649_100141932 112
10 3300025945 Ga0207679_10000127 Ga0207679_1000012730 112
11 3300026116 Ga0207674_10026193 Ga0207674_100261932 112
12 3300041512 Ga0451853_1582152 Ga0451853_1582152_507_845 112
13 3300042876 Ga0451577_0160062 Ga0451577_0160062_1377_1715 112
14 3300044712 Ga0453684_1544414 Ga0453684_1544414_214_552 112
15 3300045051 Ga0451576_0026355 Ga0451576_0026355_5795_6133 112
16 3300050511 nmdc:mga08y16_150394_c1 nmdc:mga08y16_150394_c1_916_1254 112
17 3300005336 Ga0070680_100976905 Ga0070680_1009769052 113
18 3300005339 Ga0070660_101183750 Ga0070660_1011837502 113
19 3300005354 Ga0070675_100035873 Ga0070675_1000358733 113
20 3300005364 Ga0070673_100396751 Ga0070673_1003967512 113
21 3300005366 Ga0070659_101536019 Ga0070659_1015360191 113
22 3300005444 Ga0070694_101731628 Ga0070694_1017316282 113
23 3300005455 Ga0070663_100539036 Ga0070663_1005390362 113
24 3300005466 Ga0070685_10259823 Ga0070685_102598232 113
25 3300005539 Ga0068853_100391325 Ga0068853_1003913252 113
26 3300005547 Ga0070693_100477283 Ga0070693_1004772831 113
27 3300005563 Ga0068855_100190443 Ga0068855_1001904432 113
28 3300005616 Ga0068852_100039595 Ga0068852_1000395952 113
29 3300005616 Ga0068852_100481378 Ga0068852_1004813782 113
30 3300005843 Ga0068860_101099543 Ga0068860_1010995431 113
31 3300005844 Ga0068862_100259758 Ga0068862_1002597582 113
32 3300009093 Ga0105240_10118570 Ga0105240_101185703 113
33 3300009986 Ga0105033_125090 Ga0105033_1250901 113
34 3300013104 Ga0157370_10017855 Ga0157370_100178552 113
35 3300013104 Ga0157370_11325608 Ga0157370_113256082 113
36 3300013104 Ga0157370_11369806 Ga0157370_113698062 113
37 3300013307 Ga0157372_10019925 Ga0157372_100199252 113
38 3300013308 Ga0157375_10261605 Ga0157375_102616052 113
39 3300025907 Ga0207645_10262169 Ga0207645_102621692 113
40 3300025913 Ga0207695_10560117 Ga0207695_105601172 113
41 3300025917 Ga0207660_10828924 Ga0207660_108289242 113
42 3300025949 Ga0207667_11779758 Ga0207667_117797582 113
43 3300026067 Ga0207678_10019215 Ga0207678_100192154 113
44 3300026089 Ga0207648_10106694 Ga0207648_101066942 113
45 3300026089 Ga0207648_11256178 Ga0207648_112561782 113
46 3300026118 Ga0207675_100651379 Ga0207675_1006513792 113
47 3300026142 Ga0207698_10101184 Ga0207698_101011842 113
48 3300028381 Ga0268264_10418014 Ga0268264_104180142 113
49 3300031903 Ga0307407_10885152 Ga0307407_108851521 113
50 3300031995 Ga0307409_100428983 Ga0307409_1004289832 113
51 3300032126 Ga0307415_100263029 Ga0307415_1002630292 113
52 3300048925 Ga0496122_0113276 Ga0496122_0113276_27_371 113
53 3300049568 Ga0501031_0044720 Ga0501031_0044720_2124_2468 113
54 3300049568 Ga0501031_0226570 Ga0501031_0226570_548_892 113
55 3300049569 Ga0501032_0003810 Ga0501032_0003810_3211_3555 113
56 3300049569 Ga0501032_0125102 Ga0501032_0125102_1131_1472 113
57 3300049570 Ga0501033_0000158 Ga0501033_0000158_34174_34518 113
58 3300049570 Ga0501033_0274077 Ga0501033_0274077_543_887 113
59 3300049572 Ga0501036_1483257 Ga0501036_1483257_84_428 113
60 3300049573 Ga0501037_0000166 Ga0501037_0000166_34877_35221 113
61 3300049574 Ga0501038_0289831 Ga0501038_0289831_766_1110 113
62 3300049574 Ga0501038_0977480 Ga0501038_0977480_260_604 113
63 3300049575 Ga0501039_0386494 Ga0501039_0386494_156_500 113
64 3300049579 Ga0501043_0000030 Ga0501043_0000030_39980_40324 113
65 3300049579 Ga0501043_0474864 Ga0501043_0474864_353_697 113
66 3300049581 Ga0501047_0168906 Ga0501047_0168906_1259_1603 113
67 3300049582 Ga0501048_0803953 Ga0501048_0803953_321_665 113
68 3300049583 Ga0501067_0124055 Ga0501067_0124055_100_444 113
69 3300049584 Ga0501068_0015560 Ga0501068_0015560_2295_2639 113
70 3300049585 Ga0501069_0000006 Ga0501069_0000006_37950_38294 113
71 3300049585 Ga0501069_0231477 Ga0501069_0231477_76_420 113
72 3300049586 Ga0501070_0000689 Ga0501070_0000689_15253_15597 113
73 3300049586 Ga0501070_0065853 Ga0501070_0065853_1381_1725 113
74 3300049587 Ga0501071_0012971 Ga0501071_0012971_5230_5574 113
75 3300049588 Ga0501072_1308411 Ga0501072_1308411_151_495 113
76 3300049589 Ga0501073_0028436 Ga0501073_0028436_512_856 113
77 3300049589 Ga0501073_0213515 Ga0501073_0213515_296_640 113
78 3300049590 Ga0501074_0000026 Ga0501074_0000026_38568_38912 113
79 3300049592 Ga0501076_0811100 Ga0501076_0811100_96_440 113
80 3300049741 Ga0501079_0521760 Ga0501079_0521760_77_421 113
81 3300049742 Ga0501080_0002110 Ga0501080_0002110_1012_1356 113
82 3300049744 Ga0501083_0000129 Ga0501083_0000129_14087_14431 113
83 3300049744 Ga0501083_0452003 Ga0501083_0452003_129_470 113
84 3300049822 Ga0501035_0000017 Ga0501035_0000017_146029_146373 113
85 3300049822 Ga0501035_0137795 Ga0501035_0137795_220_564 113
86 3300049822 Ga0501035_0892317 Ga0501035_0892317_215_559 113
87 3300049823 Ga0501044_0000034 Ga0501044_0000034_93541_93885 113
88 3300049823 Ga0501044_0038216 Ga0501044_0038216_1041_1385 113
89 3300049823 Ga0501044_0323757 Ga0501044_0323757_1086_1427 113
90 3300060353 Ga0501082_0005123 Ga0501082_0005123_6492_6836 113
91 3300003187 JGI25151J46595_10103843 JGI25151J46595_101038432 114
92 3300003323 rootH1_10353698 rootH1_103536982 114
93 3300003775 Ga0055524_1003649 Ga0055524_100364910 114
94 3300003781 Ga0055536_1049658 Ga0055536_10496582 114
95 3300003781 Ga0055536_1061605 Ga0055536_10616052 114
96 3300003791 Ga0055530_10003649 Ga0055530_1000364911 114
97 3300003791 Ga0055530_10003998 Ga0055530_100039982 114
98 3300003791 Ga0055530_10004641 Ga0055530_100046412 114
99 3300003792 Ga0055540_1000011 Ga0055540_100001112 114
100 3300003794 Ga0055531_10000421 Ga0055531_100004212 114
101 3300003794 Ga0055531_10010758 Ga0055531_100107582 114
102 3300003794 Ga0055531_10018284 Ga0055531_100182842 114
103 3300003794 Ga0055531_10019683 Ga0055531_100196832 114
104 3300005293 Ga0065715_10141067 Ga0065715_101410672 114
105 3300005327 Ga0070658_10263175 Ga0070658_102631751 114
106 3300005327 Ga0070658_11130657 Ga0070658_111306571 114
107 3300005327 Ga0070658_11996095 Ga0070658_119960951 114
108 3300005328 Ga0070676_10003611 Ga0070676_100036112 114
109 3300005328 Ga0070676_10026546 Ga0070676_100265462 114
110 3300005328 Ga0070676_10043216 Ga0070676_100432162 114
111 3300005329 Ga0070683_100033377 Ga0070683_1000333772 114
112 3300005329 Ga0070683_100034914 Ga0070683_1000349144 114
113 3300005329 Ga0070683_100229993 Ga0070683_1002299932 114
114 3300005329 Ga0070683_100252252 Ga0070683_1002522522 114
115 3300005329 Ga0070683_101460838 Ga0070683_1014608381 114
116 3300005330 Ga0070690_100267869 Ga0070690_1002678691 114
117 3300005331 Ga0070670_100007539 Ga0070670_10000753910 114
118 3300005331 Ga0070670_100063864 Ga0070670_1000638642 114
119 3300005331 Ga0070670_100080214 Ga0070670_1000802143 114
120 3300005331 Ga0070670_100080990 Ga0070670_1000809902 114
121 3300005331 Ga0070670_100298203 Ga0070670_1002982031 114
122 3300005331 Ga0070670_100305713 Ga0070670_1003057132 114
123 3300005331 Ga0070670_100559334 Ga0070670_1005593341 114
124 3300005331 Ga0070670_100575611 Ga0070670_1005756112 114
125 3300005331 Ga0070670_101015510 Ga0070670_1010155102 114
126 3300005331 Ga0070670_102177256 Ga0070670_1021772561 114
127 3300005333 Ga0070677_10000436 Ga0070677_100004362 114
128 3300005333 Ga0070677_10024851 Ga0070677_100248512 114
129 3300005333 Ga0070677_10079066 Ga0070677_100790662 114
130 3300005333 Ga0070677_10139840 Ga0070677_101398402 114
131 3300005333 Ga0070677_10168012 Ga0070677_101680122 114
132 3300005333 Ga0070677_10447102 Ga0070677_104471022 114
133 3300005334 Ga0068869_100008346 Ga0068869_1000083466 114
134 3300005335 Ga0070666_10974089 Ga0070666_109740891 114
135 3300005336 Ga0070680_100000586 Ga0070680_10000058616 114
136 3300005336 Ga0070680_100026731 Ga0070680_1000267312 114
137 3300005336 Ga0070680_100218356 Ga0070680_1002183562 114
138 3300005338 Ga0068868_100007643 Ga0068868_1000076437 114
139 3300005338 Ga0068868_100011468 Ga0068868_1000114688 114
140 3300005338 Ga0068868_100128987 Ga0068868_1001289872 114
141 3300005338 Ga0068868_100223824 Ga0068868_1002238242 114
142 3300005339 Ga0070660_100049595 Ga0070660_1000495952 114
143 3300005339 Ga0070660_100210885 Ga0070660_1002108852 114
144 3300005339 Ga0070660_100473174 Ga0070660_1004731742 114
145 3300005340 Ga0070689_100003713 Ga0070689_1000037136 114
146 3300005340 Ga0070689_100474273 Ga0070689_1004742732 114
147 3300005344 Ga0070661_100016902 Ga0070661_1000169021 114
148 3300005344 Ga0070661_101122403 Ga0070661_1011224032 114
149 3300005345 Ga0070692_10917465 Ga0070692_109174652 114
150 3300005347 Ga0070668_100066238 Ga0070668_1000662382 114
151 3300005353 Ga0070669_100001794 Ga0070669_1000017942 114
152 3300005353 Ga0070669_100009265 Ga0070669_1000092656 114
153 3300005353 Ga0070669_100094109 Ga0070669_1000941092 114
154 3300005353 Ga0070669_100861574 Ga0070669_1008615742 114
155 3300005353 Ga0070669_101522233 Ga0070669_1015222331 114
156 3300005354 Ga0070675_100001129 Ga0070675_1000011299 114
157 3300005354 Ga0070675_100003991 Ga0070675_10000399111 114
158 3300005354 Ga0070675_100047113 Ga0070675_1000471132 114
159 3300005354 Ga0070675_100408737 Ga0070675_1004087372 114
160 3300005354 Ga0070675_101327260 Ga0070675_1013272601 114
161 3300005354 Ga0070675_101675986 Ga0070675_1016759861 114
162 3300005354 Ga0070675_101868671 Ga0070675_1018686711 114
163 3300005354 Ga0070675_101901554 Ga0070675_1019015542 114
164 3300005355 Ga0070671_100000637 Ga0070671_10000063711 114
165 3300005355 Ga0070671_100009827 Ga0070671_1000098277 114
166 3300005355 Ga0070671_100035766 Ga0070671_1000357663 114
167 3300005355 Ga0070671_100037552 Ga0070671_1000375525 114
168 3300005355 Ga0070671_100052027 Ga0070671_1000520273 114
169 3300005355 Ga0070671_100104878 Ga0070671_1001048782 114
170 3300005355 Ga0070671_100212318 Ga0070671_1002123182 114
171 3300005355 Ga0070671_100378974 Ga0070671_1003789742 114
172 3300005355 Ga0070671_100597997 Ga0070671_1005979972 114
173 3300005355 Ga0070671_100739078 Ga0070671_1007390782 114
174 3300005356 Ga0070674_100003396 Ga0070674_1000033962 114
175 3300005356 Ga0070674_100021549 Ga0070674_1000215492 114
176 3300005356 Ga0070674_100241010 Ga0070674_1002410102 114
177 3300005356 Ga0070674_101563728 Ga0070674_1015637282 114
178 3300005364 Ga0070673_100000618 Ga0070673_1000006189 114
179 3300005364 Ga0070673_100385853 Ga0070673_1003858532 114
180 3300005365 Ga0070688_100797903 Ga0070688_1007979032 114
181 3300005366 Ga0070659_100000299 Ga0070659_10000029924 114
182 3300005366 Ga0070659_100033130 Ga0070659_1000331302 114
183 3300005366 Ga0070659_100281647 Ga0070659_1002816471 114
184 3300005366 Ga0070659_100685033 Ga0070659_1006850332 114
185 3300005367 Ga0070667_100032332 Ga0070667_1000323323 114
186 3300005367 Ga0070667_100718734 Ga0070667_1007187342 114
187 3300005367 Ga0070667_100725245 Ga0070667_1007252452 114
188 3300005367 Ga0070667_101085143 Ga0070667_1010851431 114
189 3300005438 Ga0070701_10384898 Ga0070701_103848982 114
190 3300005438 Ga0070701_10989354 Ga0070701_109893542 114
191 3300005441 Ga0070700_101300051 Ga0070700_1013000511 114
192 3300005441 Ga0070700_102007548 Ga0070700_1020075481 114
193 3300005455 Ga0070663_100009180 Ga0070663_1000091804 114
194 3300005455 Ga0070663_101587416 Ga0070663_1015874162 114
195 3300005456 Ga0070678_100004039 Ga0070678_1000040392 114
196 3300005456 Ga0070678_100060875 Ga0070678_1000608752 114
197 3300005456 Ga0070678_100078372 Ga0070678_1000783722 114
198 3300005456 Ga0070678_100236081 Ga0070678_1002360812 114
199 3300005456 Ga0070678_100244477 Ga0070678_1002444772 114
200 3300005456 Ga0070678_100911468 Ga0070678_1009114681 114
201 3300005456 Ga0070678_101583914 Ga0070678_1015839142 114
202 3300005457 Ga0070662_100002167 Ga0070662_10000216714 114
203 3300005457 Ga0070662_100004791 Ga0070662_10000479112 114
204 3300005457 Ga0070662_100177981 Ga0070662_1001779812 114
205 3300005457 Ga0070662_100539811 Ga0070662_1005398112 114
206 3300005457 Ga0070662_101439074 Ga0070662_1014390741 114
207 3300005458 Ga0070681_10005198 Ga0070681_100051986 114
208 3300005458 Ga0070681_10031407 Ga0070681_100314072 114
209 3300005458 Ga0070681_10053100 Ga0070681_100531002 114
210 3300005458 Ga0070681_10324507 Ga0070681_103245072 114
211 3300005459 Ga0068867_100000875 Ga0068867_10000087514 114
212 3300005459 Ga0068867_100011058 Ga0068867_1000110585 114
213 3300005459 Ga0068867_100057964 Ga0068867_1000579642 114
214 3300005459 Ga0068867_100067260 Ga0068867_1000672602 114
215 3300005459 Ga0068867_100553034 Ga0068867_1005530341 114
216 3300005459 Ga0068867_101162066 Ga0068867_1011620662 114
217 3300005466 Ga0070685_10636438 Ga0070685_106364382 114
218 3300005466 Ga0070685_11307428 Ga0070685_113074281 114
219 3300005530 Ga0070679_100000494 Ga0070679_10000049434 114
220 3300005530 Ga0070679_100016024 Ga0070679_1000160242 114
221 3300005530 Ga0070679_100025313 Ga0070679_1000253133 114
222 3300005530 Ga0070679_100058607 Ga0070679_1000586073 114
223 3300005530 Ga0070679_101436969 Ga0070679_1014369691 114
224 3300005535 Ga0070684_100364840 Ga0070684_1003648402 114
225 3300005539 Ga0068853_100001261 Ga0068853_1000012616 114
226 3300005539 Ga0068853_100039194 Ga0068853_1000391946 114
227 3300005539 Ga0068853_100249060 Ga0068853_1002490602 114
228 3300005539 Ga0068853_100507614 Ga0068853_1005076142 114
229 3300005543 Ga0070672_100000400 Ga0070672_10000040016 114
230 3300005543 Ga0070672_100045480 Ga0070672_1000454805 114
231 3300005543 Ga0070672_100064606 Ga0070672_1000646062 114
232 3300005543 Ga0070672_100156876 Ga0070672_1001568762 114
233 3300005543 Ga0070672_100383619 Ga0070672_1003836192 114
234 3300005543 Ga0070672_101022668 Ga0070672_1010226682 114
235 3300005543 Ga0070672_101221836 Ga0070672_1012218362 114
236 3300005546 Ga0070696_101066061 Ga0070696_1010660612 114
237 3300005547 Ga0070693_100009475 Ga0070693_1000094752 114
238 3300005547 Ga0070693_100011659 Ga0070693_1000116592 114
239 3300005547 Ga0070693_100464487 Ga0070693_1004644871 114
240 3300005548 Ga0070665_101002257 Ga0070665_1010022572 114
241 3300005563 Ga0068855_100000309 Ga0068855_10000030919 114
242 3300005563 Ga0068855_100063382 Ga0068855_1000633822 114
243 3300005563 Ga0068855_100194874 Ga0068855_1001948742 114
244 3300005564 Ga0070664_100004875 Ga0070664_10000487513 114
245 3300005564 Ga0070664_100074046 Ga0070664_1000740462 114
246 3300005564 Ga0070664_100136575 Ga0070664_1001365752 114
247 3300005564 Ga0070664_100436422 Ga0070664_1004364222 114
248 3300005564 Ga0070664_100702991 Ga0070664_1007029912 114
249 3300005564 Ga0070664_100703397 Ga0070664_1007033972 114
250 3300005564 Ga0070664_100773506 Ga0070664_1007735062 114
251 3300005564 Ga0070664_100953427 Ga0070664_1009534271 114
252 3300005577 Ga0068857_100010752 Ga0068857_1000107527 114
253 3300005578 Ga0068854_100003381 Ga0068854_1000033817 114
254 3300005578 Ga0068854_100159916 Ga0068854_1001599162 114
255 3300005578 Ga0068854_100239014 Ga0068854_1002390142 114
256 3300005578 Ga0068854_100851303 Ga0068854_1008513032 114
257 3300005578 Ga0068854_101314675 Ga0068854_1013146752 114
258 3300005614 Ga0068856_100026185 Ga0068856_1000261852 114
259 3300005614 Ga0068856_100147656 Ga0068856_1001476562 114
260 3300005614 Ga0068856_100175772 Ga0068856_1001757721 114
261 3300005614 Ga0068856_100256675 Ga0068856_1002566752 114
262 3300005614 Ga0068856_101031093 Ga0068856_1010310932 114
263 3300005615 Ga0070702_100030098 Ga0070702_1000300982 114
264 3300005615 Ga0070702_100208896 Ga0070702_1002088962 114
265 3300005615 Ga0070702_100466673 Ga0070702_1004666732 114
266 3300005615 Ga0070702_100541886 Ga0070702_1005418861 114
267 3300005616 Ga0068852_100001773 Ga0068852_10000177313 114
268 3300005616 Ga0068852_100115864 Ga0068852_1001158643 114
269 3300005616 Ga0068852_100183913 Ga0068852_1001839132 114
270 3300005616 Ga0068852_100480101 Ga0068852_1004801012 114
271 3300005616 Ga0068852_100758413 Ga0068852_1007584132 114
272 3300005616 Ga0068852_101155003 Ga0068852_1011550032 114
273 3300005617 Ga0068859_100236647 Ga0068859_1002366472 114
274 3300005618 Ga0068864_100002319 Ga0068864_10000231920 114
275 3300005618 Ga0068864_100010339 Ga0068864_1000103392 114
276 3300005618 Ga0068864_100143930 Ga0068864_1001439302 114
277 3300005618 Ga0068864_102530601 Ga0068864_1025306012 114
278 3300005718 Ga0068866_11013914 Ga0068866_110139142 114
279 3300005718 Ga0068866_11395829 Ga0068866_113958291 114
280 3300005719 Ga0068861_100001606 Ga0068861_10000160613 114
281 3300005719 Ga0068861_100054926 Ga0068861_1000549262 114
282 3300005719 Ga0068861_100101587 Ga0068861_1001015872 114
283 3300005719 Ga0068861_100531966 Ga0068861_1005319662 114
284 3300005719 Ga0068861_101705137 Ga0068861_1017051372 114
285 3300005834 Ga0068851_10010030 Ga0068851_100100302 114
286 3300005834 Ga0068851_10089765 Ga0068851_100897652 114
287 3300005834 Ga0068851_10145029 Ga0068851_101450292 114
288 3300005834 Ga0068851_10236155 Ga0068851_102361552 114
289 3300005834 Ga0068851_10374718 Ga0068851_103747182 114
290 3300005834 Ga0068851_10532135 Ga0068851_105321352 114
291 3300005840 Ga0068870_10006793 Ga0068870_100067932 114
292 3300005840 Ga0068870_10042702 Ga0068870_100427022 114
293 3300005840 Ga0068870_10128761 Ga0068870_101287612 114
294 3300005840 Ga0068870_11013112 Ga0068870_110131122 114
295 3300005841 Ga0068863_100009106 Ga0068863_1000091062 114
296 3300005841 Ga0068863_100500600 Ga0068863_1005006002 114
297 3300005842 Ga0068858_100025977 Ga0068858_1000259772 114
298 3300005842 Ga0068858_100053674 Ga0068858_1000536742 114
299 3300005844 Ga0068862_100249447 Ga0068862_1002494472 114
300 3300005844 Ga0068862_101480318 Ga0068862_1014803182 114
301 3300005937 Ga0081455_10389566 Ga0081455_103895662 114
302 3300006028 Ga0070717_12138186 Ga0070717_121381861 114
303 3300006038 Ga0075365_10886406 Ga0075365_108864062 114
304 3300006051 Ga0075364_10010694 Ga0075364_100106942 114
305 3300006051 Ga0075364_10066606 Ga0075364_100666061 114
306 3300006178 Ga0075367_10635618 Ga0075367_106356182 114
307 3300006178 Ga0075367_10755755 Ga0075367_107557552 114
308 3300006186 Ga0075369_10046118 Ga0075369_100461182 114
309 3300006195 Ga0075366_10018918 Ga0075366_100189183 114
310 3300006195 Ga0075366_10098444 Ga0075366_100984442 114
311 3300006195 Ga0075366_10153202 Ga0075366_101532022 114
312 3300006195 Ga0075366_10780386 Ga0075366_107803862 114
313 3300006237 Ga0097621_100001028 Ga0097621_1000010283 114
314 3300006237 Ga0097621_100001820 Ga0097621_1000018202 114
315 3300006237 Ga0097621_100025288 Ga0097621_1000252882 114
316 3300006353 Ga0075370_10234150 Ga0075370_102341502 114
317 3300006353 Ga0075370_10516446 Ga0075370_105164462 114
318 3300006358 Ga0068871_100023518 Ga0068871_1000235182 114
319 3300006358 Ga0068871_100075366 Ga0068871_1000753662 114
320 3300006358 Ga0068871_100095080 Ga0068871_1000950802 114
321 3300006358 Ga0068871_100228184 Ga0068871_1002281842 114
322 3300006358 Ga0068871_102122932 Ga0068871_1021229322 114
323 3300006844 Ga0075428_100432013 Ga0075428_1004320131 114
324 3300006846 Ga0075430_100009987 Ga0075430_1000099873 114
325 3300006880 Ga0075429_100531279 Ga0075429_1005312792 114
326 3300006881 Ga0068865_100310014 Ga0068865_1003100141 114
327 3300006881 Ga0068865_100347227 Ga0068865_1003472271 114
328 3300006881 Ga0068865_100676437 Ga0068865_1006764372 114
329 3300006881 Ga0068865_102053755 Ga0068865_1020537552 114
330 3300006931 Ga0097620_100236633 Ga0097620_1002366332 114
331 3300006946 Ga0079104_1000323 Ga0079104_100032320 114
332 3300009093 Ga0105240_10001586 Ga0105240_1000158620 114
333 3300009093 Ga0105240_10029765 Ga0105240_100297657 114
334 3300009093 Ga0105240_11044183 Ga0105240_110441832 114
335 3300009094 Ga0111539_11478023 Ga0111539_114780232 114
336 3300009094 Ga0111539_11549336 Ga0111539_115493362 114
337 3300009098 Ga0105245_10001868 Ga0105245_1000186813 114
338 3300009098 Ga0105245_11047526 Ga0105245_110475262 114
339 3300009148 Ga0105243_10178818 Ga0105243_101788182 114
340 3300009148 Ga0105243_10698514 Ga0105243_106985142 114
341 3300009174 Ga0105241_10018397 Ga0105241_100183973 114
342 3300009174 Ga0105241_10364206 Ga0105241_103642063 114
343 3300009176 Ga0105242_10609812 Ga0105242_106098122 114
344 3300009176 Ga0105242_11330563 Ga0105242_113305632 114
345 3300009176 Ga0105242_12119337 Ga0105242_121193372 114
346 3300009177 Ga0105248_10000754 Ga0105248_1000075420 114
347 3300009177 Ga0105248_10694062 Ga0105248_106940621 114
348 3300009177 Ga0105248_10754771 Ga0105248_107547712 114
349 3300009177 Ga0105248_10779785 Ga0105248_107797852 114
350 3300009545 Ga0105237_10200033 Ga0105237_102000332 114
351 3300009551 Ga0105238_10001396 Ga0105238_100013964 114
352 3300009551 Ga0105238_10002093 Ga0105238_1000209313 114
353 3300009551 Ga0105238_10030317 Ga0105238_100303178 114
354 3300009551 Ga0105238_10033433 Ga0105238_100334332 114
355 3300009551 Ga0105238_11032618 Ga0105238_110326182 114
356 3300009553 Ga0105249_10677211 Ga0105249_106772112 114
357 3300009553 Ga0105249_11980538 Ga0105249_119805382 114
358 3300010375 Ga0105239_11131907 Ga0105239_111319072 114
359 3300011119 Ga0105246_10148056 Ga0105246_101480562 114
360 3300011119 Ga0105246_12176250 Ga0105246_121762501 114
361 3300012497 Ga0157319_1030212 Ga0157319_10302122 114
362 3300013100 Ga0157373_10746776 Ga0157373_107467762 114
363 3300013102 Ga0157371_10191126 Ga0157371_101911261 114
364 3300013104 Ga0157370_10001132 Ga0157370_100011322 114
365 3300013104 Ga0157370_10075988 Ga0157370_100759882 114
366 3300013105 Ga0157369_10022325 Ga0157369_100223252 114
367 3300013105 Ga0157369_10051767 Ga0157369_100517675 114
368 3300013105 Ga0157369_10112241 Ga0157369_101122412 114
369 3300013105 Ga0157369_10136461 Ga0157369_101364612 114
370 3300013296 Ga0157374_10027879 Ga0157374_100278793 114
371 3300013296 Ga0157374_10041915 Ga0157374_100419152 114
372 3300013296 Ga0157374_10119421 Ga0157374_101194212 114
373 3300013296 Ga0157374_10478640 Ga0157374_104786402 114
374 3300013297 Ga0157378_10263095 Ga0157378_102630952 114
375 3300013306 Ga0163162_10001583 Ga0163162_100015838 114
376 3300013306 Ga0163162_10524149 Ga0163162_105241492 114
377 3300013306 Ga0163162_11300898 Ga0163162_113008981 114
378 3300013306 Ga0163162_11319016 Ga0163162_113190162 114
379 3300013307 Ga0157372_10001146 Ga0157372_1000114624 114
380 3300013307 Ga0157372_10057931 Ga0157372_100579312 114
381 3300013307 Ga0157372_11077643 Ga0157372_110776432 114
382 3300013307 Ga0157372_11213207 Ga0157372_112132072 114
383 3300013308 Ga0157375_10139776 Ga0157375_101397761 114
384 3300013308 Ga0157375_10190922 Ga0157375_101909222 114
385 3300013308 Ga0157375_10570924 Ga0157375_105709242 114
386 3300013308 Ga0157375_10763906 Ga0157375_107639062 114
387 3300013308 Ga0157375_11312931 Ga0157375_113129312 114
388 3300014325 Ga0163163_10030620 Ga0163163_100306203 114
389 3300014325 Ga0163163_10048001 Ga0163163_100480012 114
390 3300014325 Ga0163163_11385009 Ga0163163_113850092 114
391 3300014326 Ga0157380_10274037 Ga0157380_102740372 114
392 3300014326 Ga0157380_10329498 Ga0157380_103294983 114
393 3300014326 Ga0157380_10386691 Ga0157380_103866912 114
394 3300014326 Ga0157380_10533037 Ga0157380_105330372 114
395 3300014745 Ga0157377_10699618 Ga0157377_106996182 114
396 3300014968 Ga0157379_10004830 Ga0157379_1000483012 114
397 3300014968 Ga0157379_11285034 Ga0157379_112850342 114
398 3300014969 Ga0157376_10000239 Ga0157376_1000023917 114
399 3300014969 Ga0157376_10029763 Ga0157376_100297632 114
400 3300014969 Ga0157376_10130674 Ga0157376_101306741 114
401 3300015262 Ga0182007_10243198 Ga0182007_102431982 114
402 3300017792 Ga0163161_10011060 Ga0163161_100110608 114
403 3300017792 Ga0163161_10051203 Ga0163161_100512032 114
404 3300017792 Ga0163161_10053006 Ga0163161_100530062 114
405 3300017792 Ga0163161_10925239 Ga0163161_109252392 114
406 3300017792 Ga0163161_11271185 Ga0163161_112711851 114
407 3300025284 Ga0209130_1002397 Ga0209130_100239711 114
408 3300025291 Ga0209675_1020775 Ga0209675_10207752 114
409 3300025291 Ga0209675_1025961 Ga0209675_10259612 114
410 3300025292 Ga0209676_1001669 Ga0209676_100166918 114
411 3300025292 Ga0209676_1003028 Ga0209676_100302811 114
412 3300025294 Ga0209025_1000401 Ga0209025_100040145 114
413 3300025294 Ga0209025_1190719 Ga0209025_11907192 114
414 3300025295 Ga0209564_1012372 Ga0209564_10123725 114
415 3300025295 Ga0209564_1031657 Ga0209564_10316572 114
416 3300025297 Ga0209758_1008210 Ga0209758_10082103 114
417 3300025298 Ga0209050_1000583 Ga0209050_100058342 114
418 3300025298 Ga0209050_1003787 Ga0209050_100378710 114
419 3300025298 Ga0209050_1005409 Ga0209050_10054097 114
420 3300025299 Ga0209256_1000113 Ga0209256_100011337 114
421 3300025299 Ga0209256_1000178 Ga0209256_100017824 114
422 3300025299 Ga0209256_1001335 Ga0209256_100133519 114
423 3300025303 Ga0209051_1000020 Ga0209051_100002012 114
424 3300025303 Ga0209051_1022792 Ga0209051_10227922 114
425 3300025304 Ga0209257_1000085 Ga0209257_100008512 114
426 3300025304 Ga0209257_1000400 Ga0209257_100040042 114
427 3300025304 Ga0209257_1000498 Ga0209257_100049873 114
428 3300025304 Ga0209257_1010761 Ga0209257_10107612 114
429 3300025315 Ga0207697_10001625 Ga0207697_100016256 114
430 3300025315 Ga0207697_10029344 Ga0207697_100293442 114
431 3300025321 Ga0207656_10009912 Ga0207656_100099122 114
432 3300025321 Ga0207656_10212944 Ga0207656_102129442 114
433 3300025893 Ga0207682_10000563 Ga0207682_1000056313 114
434 3300025893 Ga0207682_10006506 Ga0207682_100065067 114
435 3300025893 Ga0207682_10009090 Ga0207682_100090902 114
436 3300025893 Ga0207682_10016549 Ga0207682_100165492 114
437 3300025893 Ga0207682_10123240 Ga0207682_101232402 114
438 3300025893 Ga0207682_10364121 Ga0207682_103641212 114
439 3300025901 Ga0207688_10033375 Ga0207688_100333752 114
440 3300025901 Ga0207688_10291234 Ga0207688_102912341 114
441 3300025901 Ga0207688_10385579 Ga0207688_103855792 114
442 3300025903 Ga0207680_10161244 Ga0207680_101612442 114
443 3300025903 Ga0207680_10545438 Ga0207680_105454383 114
444 3300025907 Ga0207645_10054247 Ga0207645_100542472 114
445 3300025907 Ga0207645_10085797 Ga0207645_100857972 114
446 3300025907 Ga0207645_10307518 Ga0207645_103075182 114
447 3300025908 Ga0207643_10010469 Ga0207643_100104692 114
448 3300025908 Ga0207643_10126588 Ga0207643_101265882 114
449 3300025908 Ga0207643_10208576 Ga0207643_102085762 114
450 3300025909 Ga0207705_10362683 Ga0207705_103626832 114
451 3300025909 Ga0207705_10424295 Ga0207705_104242952 114
452 3300025909 Ga0207705_10483172 Ga0207705_104831722 114
453 3300025911 Ga0207654_10050927 Ga0207654_100509272 114
454 3300025912 Ga0207707_10000287 Ga0207707_100002876 114
455 3300025912 Ga0207707_10011739 Ga0207707_100117397 114
456 3300025912 Ga0207707_10040426 Ga0207707_100404261 114
457 3300025912 Ga0207707_10145809 Ga0207707_101458092 114
458 3300025913 Ga0207695_10012750 Ga0207695_100127503 114
459 3300025913 Ga0207695_10044326 Ga0207695_100443266 114
460 3300025913 Ga0207695_11115976 Ga0207695_111159762 114
461 3300025914 Ga0207671_10480744 Ga0207671_104807442 114
462 3300025917 Ga0207660_10005852 Ga0207660_100058522 114
463 3300025917 Ga0207660_10041393 Ga0207660_100413932 114
464 3300025917 Ga0207660_10117727 Ga0207660_101177272 114
465 3300025919 Ga0207657_10023128 Ga0207657_100231287 114
466 3300025919 Ga0207657_10202480 Ga0207657_102024802 114
467 3300025919 Ga0207657_10932216 Ga0207657_109322162 114
468 3300025920 Ga0207649_10004693 Ga0207649_100046934 114
469 3300025920 Ga0207649_10095333 Ga0207649_100953332 114
470 3300025920 Ga0207649_10412082 Ga0207649_104120822 114
471 3300025920 Ga0207649_10413521 Ga0207649_104135211 114
472 3300025920 Ga0207649_10827497 Ga0207649_108274971 114
473 3300025921 Ga0207652_10005817 Ga0207652_100058175 114
474 3300025921 Ga0207652_10046539 Ga0207652_100465393 114
475 3300025921 Ga0207652_10059126 Ga0207652_100591262 114
476 3300025921 Ga0207652_10187214 Ga0207652_101872142 114
477 3300025921 Ga0207652_10736225 Ga0207652_107362252 114
478 3300025921 Ga0207652_11254293 Ga0207652_112542931 114
479 3300025921 Ga0207652_11263709 Ga0207652_112637092 114
480 3300025923 Ga0207681_10109314 Ga0207681_101093142 114
481 3300025923 Ga0207681_10121383 Ga0207681_101213832 114
482 3300025924 Ga0207694_10005307 Ga0207694_1000530712 114
483 3300025924 Ga0207694_10047004 Ga0207694_100470041 114
484 3300025924 Ga0207694_10306590 Ga0207694_103065902 114
485 3300025925 Ga0207650_10001487 Ga0207650_100014877 114
486 3300025925 Ga0207650_10022541 Ga0207650_100225412 114
487 3300025925 Ga0207650_10040917 Ga0207650_100409172 114
488 3300025925 Ga0207650_10049495 Ga0207650_100494952 114
489 3300025925 Ga0207650_10054873 Ga0207650_100548732 114
490 3300025925 Ga0207650_10243718 Ga0207650_102437182 114
491 3300025925 Ga0207650_10603214 Ga0207650_106032141 114
492 3300025925 Ga0207650_10750948 Ga0207650_107509481 114
493 3300025925 Ga0207650_11703724 Ga0207650_117037242 114
494 3300025926 Ga0207659_10000842 Ga0207659_1000084214 114
495 3300025926 Ga0207659_10009447 Ga0207659_100094473 114
496 3300025926 Ga0207659_10039817 Ga0207659_100398172 114
497 3300025926 Ga0207659_10050449 Ga0207659_100504495 114
498 3300025926 Ga0207659_10058256 Ga0207659_100582563 114
499 3300025926 Ga0207659_10159418 Ga0207659_101594182 114
500 3300025931 Ga0207644_10000239 Ga0207644_1000023922 114
501 3300025931 Ga0207644_10001162 Ga0207644_1000116210 114
502 3300025931 Ga0207644_10055205 Ga0207644_100552052 114
503 3300025931 Ga0207644_10081456 Ga0207644_100814562 114
504 3300025931 Ga0207644_10358012 Ga0207644_103580122 114
505 3300025932 Ga0207690_10004609 Ga0207690_100046098 114
506 3300025932 Ga0207690_10037289 Ga0207690_100372892 114
507 3300025932 Ga0207690_10265733 Ga0207690_102657331 114
508 3300025932 Ga0207690_10570877 Ga0207690_105708772 114
509 3300025933 Ga0207706_10001645 Ga0207706_1000164524 114
510 3300025933 Ga0207706_10018070 Ga0207706_100180707 114
511 3300025933 Ga0207706_10156228 Ga0207706_101562282 114
512 3300025934 Ga0207686_10958455 Ga0207686_109584552 114
513 3300025935 Ga0207709_10271086 Ga0207709_102710862 114
514 3300025936 Ga0207670_10008010 Ga0207670_100080106 114
515 3300025937 Ga0207669_10000691 Ga0207669_1000069110 114
516 3300025937 Ga0207669_10003216 Ga0207669_100032167 114
517 3300025937 Ga0207669_10165937 Ga0207669_101659372 114
518 3300025937 Ga0207669_11024990 Ga0207669_110249902 114
519 3300025937 Ga0207669_11208669 Ga0207669_112086692 114
520 3300025938 Ga0207704_10029915 Ga0207704_100299152 114
521 3300025940 Ga0207691_10004292 Ga0207691_1000429214 114
522 3300025940 Ga0207691_10016122 Ga0207691_100161222 114
523 3300025940 Ga0207691_10301632 Ga0207691_103016322 114
524 3300025940 Ga0207691_10325210 Ga0207691_103252102 114
525 3300025940 Ga0207691_10400419 Ga0207691_104004192 114
526 3300025940 Ga0207691_10457116 Ga0207691_104571162 114
527 3300025940 Ga0207691_11232899 Ga0207691_112328991 114
528 3300025941 Ga0207711_10001648 Ga0207711_100016489 114
529 3300025942 Ga0207689_10001354 Ga0207689_100013543 114
530 3300025944 Ga0207661_10045569 Ga0207661_100455692 114
531 3300025944 Ga0207661_10221684 Ga0207661_102216842 114
532 3300025945 Ga0207679_10002362 Ga0207679_1000236211 114
533 3300025945 Ga0207679_10003480 Ga0207679_100034806 114
534 3300025945 Ga0207679_10023601 Ga0207679_100236012 114
535 3300025945 Ga0207679_10052355 Ga0207679_100523553 114
536 3300025945 Ga0207679_10103188 Ga0207679_101031881 114
537 3300025945 Ga0207679_10481540 Ga0207679_104815402 114
538 3300025945 Ga0207679_11030432 Ga0207679_110304322 114
539 3300025945 Ga0207679_11787250 Ga0207679_117872501 114
540 3300025949 Ga0207667_10005072 Ga0207667_100050725 114
541 3300025949 Ga0207667_10053783 Ga0207667_100537833 114
542 3300025949 Ga0207667_10142742 Ga0207667_101427422 114
543 3300025960 Ga0207651_10001068 Ga0207651_1000106811 114
544 3300025960 Ga0207651_10009955 Ga0207651_100099557 114
545 3300025960 Ga0207651_10177425 Ga0207651_101774251 114
546 3300025960 Ga0207651_11720394 Ga0207651_117203942 114
547 3300025972 Ga0207668_10273271 Ga0207668_102732712 114
548 3300025972 Ga0207668_11724567 Ga0207668_117245672 114
549 3300025981 Ga0207640_10140847 Ga0207640_101408471 114
550 3300025981 Ga0207640_10300138 Ga0207640_103001382 114
551 3300025981 Ga0207640_10337025 Ga0207640_103370252 114
552 3300025981 Ga0207640_10366067 Ga0207640_103660672 114
553 3300025981 Ga0207640_10828043 Ga0207640_108280432 114
554 3300025981 Ga0207640_10922757 Ga0207640_109227572 114
555 3300025981 Ga0207640_11171199 Ga0207640_111711992 114
556 3300025981 Ga0207640_11738277 Ga0207640_117382772 114
557 3300025986 Ga0207658_10199097 Ga0207658_101990972 114
558 3300026023 Ga0207677_10002459 Ga0207677_1000245910 114
559 3300026023 Ga0207677_10090591 Ga0207677_100905912 114
560 3300026023 Ga0207677_10890784 Ga0207677_108907842 114
561 3300026023 Ga0207677_11116929 Ga0207677_111169292 114
562 3300026023 Ga0207677_11392180 Ga0207677_113921801 114
563 3300026035 Ga0207703_10033505 Ga0207703_100335054 114
564 3300026035 Ga0207703_10071135 Ga0207703_100711352 114
565 3300026041 Ga0207639_10035006 Ga0207639_100350062 114
566 3300026041 Ga0207639_10864969 Ga0207639_108649692 114
567 3300026041 Ga0207639_11111393 Ga0207639_111113932 114
568 3300026067 Ga0207678_10003424 Ga0207678_100034246 114
569 3300026067 Ga0207678_10296096 Ga0207678_102960962 114
570 3300026067 Ga0207678_10367488 Ga0207678_103674882 114
571 3300026067 Ga0207678_11339138 Ga0207678_113391381 114
572 3300026067 Ga0207678_11697997 Ga0207678_116979972 114
573 3300026075 Ga0207708_10407295 Ga0207708_104072952 114
574 3300026075 Ga0207708_10580508 Ga0207708_105805082 114
575 3300026075 Ga0207708_10580539 Ga0207708_105805392 114
576 3300026078 Ga0207702_10020021 Ga0207702_100200212 114
577 3300026078 Ga0207702_10024769 Ga0207702_100247694 114
578 3300026078 Ga0207702_10059200 Ga0207702_100592002 114
579 3300026078 Ga0207702_10063945 Ga0207702_100639453 114
580 3300026078 Ga0207702_10120098 Ga0207702_101200982 114
581 3300026078 Ga0207702_10759491 Ga0207702_107594912 114
582 3300026088 Ga0207641_10047192 Ga0207641_100471923 114
583 3300026088 Ga0207641_10442962 Ga0207641_104429622 114
584 3300026088 Ga0207641_10446518 Ga0207641_104465182 114
585 3300026089 Ga0207648_10009235 Ga0207648_100092352 114
586 3300026089 Ga0207648_10027124 Ga0207648_100271246 114
587 3300026089 Ga0207648_10028071 Ga0207648_100280712 114
588 3300026089 Ga0207648_10094182 Ga0207648_100941822 114
589 3300026089 Ga0207648_10148580 Ga0207648_101485802 114
590 3300026089 Ga0207648_10191278 Ga0207648_101912782 114
591 3300026089 Ga0207648_10321775 Ga0207648_103217752 114
592 3300026095 Ga0207676_10010197 Ga0207676_100101972 114
593 3300026095 Ga0207676_10151029 Ga0207676_101510292 114
594 3300026095 Ga0207676_10164453 Ga0207676_101644532 114
595 3300026095 Ga0207676_10961846 Ga0207676_109618462 114
596 3300026095 Ga0207676_11579721 Ga0207676_115797212 114
597 3300026116 Ga0207674_10006551 Ga0207674_100065517 114
598 3300026116 Ga0207674_10708956 Ga0207674_107089562 114
599 3300026118 Ga0207675_100000395 Ga0207675_10000039524 114
600 3300026118 Ga0207675_100052624 Ga0207675_1000526242 114
601 3300026118 Ga0207675_100135429 Ga0207675_1001354292 114
602 3300026118 Ga0207675_100706597 Ga0207675_1007065972 114
603 3300026118 Ga0207675_101424275 Ga0207675_1014242752 114
604 3300026121 Ga0207683_10011601 Ga0207683_100116013 114
605 3300026121 Ga0207683_10037943 Ga0207683_100379432 114
606 3300026121 Ga0207683_10073610 Ga0207683_100736102 114
607 3300026121 Ga0207683_10087860 Ga0207683_100878603 114
608 3300026121 Ga0207683_10129492 Ga0207683_101294922 114
609 3300026121 Ga0207683_10348112 Ga0207683_103481122 114
610 3300026121 Ga0207683_11546316 Ga0207683_115463162 114
611 3300026142 Ga0207698_10006452 Ga0207698_100064525 114
612 3300026142 Ga0207698_10033642 Ga0207698_100336422 114
613 3300026142 Ga0207698_10303445 Ga0207698_103034451 114
614 3300026142 Ga0207698_10429117 Ga0207698_104291172 114
615 3300026142 Ga0207698_10431509 Ga0207698_104315092 114
616 3300026142 Ga0207698_10496969 Ga0207698_104969692 114
617 3300027111 Ga0209281_1000195 Ga0209281_100019587 114
618 3300027378 Ga0209981_1034852 Ga0209981_10348522 114
619 3300027543 Ga0209999_1013149 Ga0209999_10131492 114
620 3300027543 Ga0209999_1076242 Ga0209999_10762422 114
621 3300027614 Ga0209970_1000073 Ga0209970_100007317 114
622 3300027665 Ga0209983_1110297 Ga0209983_11102972 114
623 3300027876 Ga0209974_10064116 Ga0209974_100641162 114
624 3300028379 Ga0268266_10199398 Ga0268266_101993982 114
625 3300028379 Ga0268266_10453066 Ga0268266_104530662 114
626 3300028380 Ga0268265_10348012 Ga0268265_103480122 114
627 3300028380 Ga0268265_10350606 Ga0268265_103506062 114
628 3300028380 Ga0268265_10552585 Ga0268265_105525852 114
629 3300028380 Ga0268265_11256575 Ga0268265_112565752 114
630 3300028381 Ga0268264_10420655 Ga0268264_104206551 114
631 3300028786 Ga0307517_10125093 Ga0307517_101250932 114
632 3300028794 Ga0307515_10242171 Ga0307515_102421712 114
633 3300031548 Ga0307408_100150198 Ga0307408_1001501982 114
634 3300031548 Ga0307408_100222787 Ga0307408_1002227872 114
635 3300031548 Ga0307408_100489674 Ga0307408_1004896742 114
636 3300031548 Ga0307408_101102231 Ga0307408_1011022312 114
637 3300031548 Ga0307408_101230812 Ga0307408_1012308122 114
638 3300031730 Ga0307516_10002337 Ga0307516_1000233719 114
639 3300031730 Ga0307516_10002395 Ga0307516_1000239511 114
640 3300031730 Ga0307516_10937801 Ga0307516_109378012 114
641 3300031731 Ga0307405_10139165 Ga0307405_101391652 114
642 3300031731 Ga0307405_10172313 Ga0307405_101723132 114
643 3300031731 Ga0307405_10562760 Ga0307405_105627602 114
644 3300031731 Ga0307405_10611725 Ga0307405_106117252 114
645 3300031824 Ga0307413_10042250 Ga0307413_100422502 114
646 3300031824 Ga0307413_10614009 Ga0307413_106140092 114
647 3300031852 Ga0307410_11334483 Ga0307410_113344832 114
648 3300031852 Ga0307410_11636441 Ga0307410_116364411 114
649 3300031901 Ga0307406_10004461 Ga0307406_100044619 114
650 3300031901 Ga0307406_10640917 Ga0307406_106409172 114
651 3300031901 Ga0307406_11337169 Ga0307406_113371691 114
652 3300031903 Ga0307407_10072833 Ga0307407_100728332 114
653 3300031903 Ga0307407_11127042 Ga0307407_111270422 114
654 3300031911 Ga0307412_10020707 Ga0307412_100207072 114
655 3300031911 Ga0307412_10179849 Ga0307412_101798492 114
656 3300031911 Ga0307412_10355907 Ga0307412_103559072 114
657 3300031911 Ga0307412_10681519 Ga0307412_106815192 114
658 3300031911 Ga0307412_11465726 Ga0307412_114657262 114
659 3300031995 Ga0307409_100106596 Ga0307409_1001065962 114
660 3300031995 Ga0307409_102310032 Ga0307409_1023100322 114
661 3300031995 Ga0307409_102761737 Ga0307409_1027617371 114
662 3300032002 Ga0307416_100064527 Ga0307416_1000645272 114
663 3300032002 Ga0307416_100147090 Ga0307416_1001470902 114
664 3300032002 Ga0307416_100205141 Ga0307416_1002051412 114
665 3300032002 Ga0307416_100782445 Ga0307416_1007824452 114
666 3300032002 Ga0307416_100964547 Ga0307416_1009645472 114
667 3300032002 Ga0307416_101653800 Ga0307416_1016538001 114
668 3300032002 Ga0307416_101676497 Ga0307416_1016764972 114
669 3300032004 Ga0307414_10057499 Ga0307414_100574992 114
670 3300032004 Ga0307414_10451059 Ga0307414_104510592 114
671 3300032004 Ga0307414_10893411 Ga0307414_108934112 114
672 3300032005 Ga0307411_10001621 Ga0307411_100016213 114
673 3300032005 Ga0307411_10055286 Ga0307411_100552862 114
674 3300032005 Ga0307411_10202507 Ga0307411_102025071 114
675 3300032005 Ga0307411_10360430 Ga0307411_103604302 114
676 3300032005 Ga0307411_10836729 Ga0307411_108367292 114
677 3300032005 Ga0307411_11578435 Ga0307411_115784352 114
678 3300032126 Ga0307415_100827488 Ga0307415_1008274882 114
679 3300033180 Ga0307510_10486625 Ga0307510_104866252 114
680 3300035112 Ga0373932_0051412 Ga0373932_0051412_63_407 114
681 3300035691 Ga0373931_0011887 Ga0373931_0011887_35_379 114
682 3300037312 Ga0395899_0862013 Ga0395899_0862013_12_356 114
683 3300037418 Ga0395900_0297437 Ga0395900_0297437_106_450 114
684 3300037466 Ga0395898_0809902 Ga0395898_0809902_231_575 114
685 3300037471 Ga0395905_0008484 Ga0395905_0008484_9337_9735 114
686 3300037471 Ga0395905_0353557 Ga0395905_0353557_33_377 114
687 3300041406 Ga0439439_0040025 Ga0439439_0040025_837_1190 114
688 3300041410 Ga0439461_0090850 Ga0439461_0090850_304_648 114
689 3300041441 Ga0451787_826069 Ga0451787_826069_59_403 114
690 3300041443 Ga0451789_0082674 Ga0451789_0082674_40_384 114
691 3300041443 Ga0451789_0190724 Ga0451789_0190724_105_449 114
692 3300041443 Ga0451789_1092815 Ga0451789_1092815_76_420 114
693 3300041451 Ga0451791_0052799 Ga0451791_0052799_313_657 114
694 3300041451 Ga0451791_1403387 Ga0451791_1403387_443_787 114
695 3300041451 Ga0451791_1836382 Ga0451791_1836382_132_476 114
696 3300041452 Ga0451793_0719068 Ga0451793_0719068_54_398 114
697 3300041452 Ga0451793_1085354 Ga0451793_1085354_305_649 114
698 3300041453 Ga0451797_0735469 Ga0451797_0735469_71_415 114
699 3300041453 Ga0451797_0986766 Ga0451797_0986766_265_609 114
700 3300041453 Ga0451797_1293458 Ga0451797_1293458_902_1246 114
701 3300041453 Ga0451797_1536375 Ga0451797_1536375_91_435 114
702 3300041456 Ga0451795_0117693 Ga0451795_0117693_47_391 114
703 3300041456 Ga0451795_0517502 Ga0451795_0517502_242_586 114
704 3300041459 Ga0451800_0337247 Ga0451800_0337247_83_427 114
705 3300041459 Ga0451800_1579281 Ga0451800_1579281_435_779 114
706 3300041460 Ga0451802_0035716 Ga0451802_0035716_656_1000 114
707 3300041460 Ga0451802_0549967 Ga0451802_0549967_240_584 114
708 3300041460 Ga0451802_0897781 Ga0451802_0897781_223_567 114
709 3300041460 Ga0451802_1073611 Ga0451802_1073611_387_731 114
710 3300041463 Ga0451804_0232158 Ga0451804_0232158_76_420 114
711 3300041463 Ga0451804_1035732 Ga0451804_1035732_96_440 114
712 3300041486 Ga0451807_0166802 Ga0451807_0166802_125_469 114
713 3300041486 Ga0451807_0510672 Ga0451807_0510672_73_417 114
714 3300041486 Ga0451807_0680237 Ga0451807_0680237_119_463 114
715 3300041486 Ga0451807_0753404 Ga0451807_0753404_4317_4661 114
716 3300041486 Ga0451807_1086543 Ga0451807_1086543_99_443 114
717 3300041486 Ga0451807_1229690 Ga0451807_1229690_125_469 114
718 3300041486 Ga0451807_1374150 Ga0451807_1374150_487_831 114
719 3300041486 Ga0451807_1717545 Ga0451807_1717545_65_409 114
720 3300041491 Ga0451833_0846255 Ga0451833_0846255_10_354 114
721 3300041492 Ga0451835_1258364 Ga0451835_1258364_564_908 114
722 3300041494 Ga0451837_0131608 Ga0451837_0131608_491_835 114
723 3300041494 Ga0451837_1622431 Ga0451837_1622431_131_475 114
724 3300041496 Ga0451839_1532241 Ga0451839_1532241_290_634 114
725 3300041496 Ga0451839_1622057 Ga0451839_1622057_44_388 114
726 3300041498 Ga0451841_0547980 Ga0451841_0547980_65_409 114
727 3300041505 Ga0451849_0481405 Ga0451849_0481405_401_745 114
728 3300041505 Ga0451849_1015217 Ga0451849_1015217_298_642 114
729 3300041507 Ga0451851_0957127 Ga0451851_0957127_53_397 114
730 3300041509 Ga0451843_0875201 Ga0451843_0875201_217_561 114
731 3300041509 Ga0451843_1115108 Ga0451843_1115108_550_894 114
732 3300041509 Ga0451843_1770695 Ga0451843_1770695_116_463 114
733 3300041512 Ga0451853_0998724 Ga0451853_0998724_233_577 114
734 3300041512 Ga0451853_1694975 Ga0451853_1694975_54_398 114
735 3300041512 Ga0451853_1820425 Ga0451853_1820425_622_969 114
736 3300041512 Ga0451853_1823316 Ga0451853_1823316_51_395 114
737 3300041512 Ga0451853_1973013 Ga0451853_1973013_105_449 114
738 3300041512 Ga0451853_2455328 Ga0451853_2455328_11_355 114
739 3300041512 Ga0451853_3284776 Ga0451853_3284776_95_439 114
740 3300041512 Ga0451853_3568330 Ga0451853_3568330_133_480 114
741 3300041512 Ga0451853_3576675 Ga0451853_3576675_292_636 114
742 3300041512 Ga0451853_3746272 Ga0451853_3746272_146_490 114
743 3300041512 Ga0451853_3981066 Ga0451853_3981066_24_368 114
744 3300042122 Ga0450920_031078 Ga0450920_031078_445_789 114
745 3300042531 Ga0450918_000311 Ga0450918_000311_969_1313 114
746 3300042876 Ga0451577_0001649 Ga0451577_0001649_26541_26885 114
747 3300044658 Ga0466972_0037411 Ga0466972_0037411_1997_2341 114
748 3300044658 Ga0466972_0155017 Ga0466972_0155017_687_1031 114
749 3300044712 Ga0453684_1554695 Ga0453684_1554695_318_662 114
750 3300044901 Ga0466960_0032293 Ga0466960_0032293_80_424 114
751 3300045051 Ga0451576_0256771 Ga0451576_0256771_1228_1572 114
752 3300046472 Ga0495580_0939561 Ga0495580_0939561_92_436 114
753 3300046519 Ga0495632_0053249 Ga0495632_0053249_218_562 114
754 3300046539 Ga0495621_0101175 Ga0495621_0101175_307_651 114
755 3300046616 Ga0495668_0383848 Ga0495668_0383848_39_383 114
756 3300046660 Ga0495625_0002783 Ga0495625_0002783_10024_10368 114
757 3300046674 Ga0495588_0589968 Ga0495588_0589968_44_388 114
758 3300046683 Ga0495658_0384566 Ga0495658_0384566_232_576 114
759 3300047472 Ga0495686_0005461 Ga0495686_0005461_2826_3170 114
760 3300047472 Ga0495686_0051627 Ga0495686_0051627_1565_1909 114
761 3300048903 Ga0496100_1434732 Ga0496100_1434732_158_502 114
762 3300048904 Ga0496101_0008877 Ga0496101_0008877_4329_4673 114
763 3300048905 Ga0496102_0012845 Ga0496102_0012845_551_895 114
764 3300048906 Ga0496103_0038510 Ga0496103_0038510_813_1157 114
765 3300048907 Ga0496104_0161291 Ga0496104_0161291_925_1269 114
766 3300048908 Ga0496105_0276837 Ga0496105_0276837_157_501 114
767 3300048910 Ga0496107_0006067 Ga0496107_0006067_3417_3761 114
768 3300048911 Ga0496108_0026763 Ga0496108_0026763_255_599 114
769 3300048911 Ga0496108_0547105 Ga0496108_0547105_94_441 114
770 3300048912 Ga0496109_0007706 Ga0496109_0007706_3592_3936 114
771 3300048913 Ga0496110_0003217 Ga0496110_0003217_6207_6551 114
772 3300048915 Ga0496112_0087318 Ga0496112_0087318_858_1202 114
773 3300048916 Ga0496113_0324923 Ga0496113_0324923_639_983 114
774 3300048917 Ga0496114_0078800 Ga0496114_0078800_168_512 114
775 3300048917 Ga0496114_0125863 Ga0496114_0125863_1539_1883 114
776 3300048918 Ga0496115_0069982 Ga0496115_0069982_1873_2217 114
777 3300049571 Ga0501034_0114078 Ga0501034_0114078_121_465 114
778 3300049571 Ga0501034_0452323 Ga0501034_0452323_639_983 114
779 3300049571 Ga0501034_1063569 Ga0501034_1063569_165_509 114
780 3300049574 Ga0501038_0988119 Ga0501038_0988119_193_537 114
781 3300049575 Ga0501039_1540318 Ga0501039_1540318_101_445 114
782 3300049578 Ga0501042_0421701 Ga0501042_0421701_40_384 114
783 3300049578 Ga0501042_0648077 Ga0501042_0648077_286_633 114
784 3300049578 Ga0501042_0959787 Ga0501042_0959787_123_470 114
785 3300049579 Ga0501043_0000573 Ga0501043_0000573_21181_21525 114
786 3300049580 Ga0501046_0000752 Ga0501046_0000752_21229_21573 114
787 3300049581 Ga0501047_0000298 Ga0501047_0000298_21128_21472 114
788 3300049581 Ga0501047_0069572 Ga0501047_0069572_758_1102 114
789 3300049581 Ga0501047_0569797 Ga0501047_0569797_478_822 114
790 3300049582 Ga0501048_0008752 Ga0501048_0008752_3412_3756 114
791 3300049586 Ga0501070_0006860 Ga0501070_0006860_6104_6448 114
792 3300049586 Ga0501070_0336070 Ga0501070_0336070_605_949 114
793 3300049587 Ga0501071_0748600 Ga0501071_0748600_276_620 114
794 3300049588 Ga0501072_0010730 Ga0501072_0010730_5603_5947 114
795 3300049588 Ga0501072_0373838 Ga0501072_0373838_331_675 114
796 3300049589 Ga0501073_0004070 Ga0501073_0004070_9579_9923 114
797 3300049589 Ga0501073_0181721 Ga0501073_0181721_813_1157 114
798 3300049590 Ga0501074_0329609 Ga0501074_0329609_636_980 114
799 3300049590 Ga0501074_0765263 Ga0501074_0765263_305_652 114
800 3300049649 Ga0501198_000049 Ga0501198_000049_2906_3250 114
801 3300049662 Ga0501222_000057 Ga0501222_000057_2906_3250 114
802 3300049741 Ga0501079_0031863 Ga0501079_0031863_713_1057 114
803 3300049742 Ga0501080_0026620 Ga0501080_0026620_1520_1864 114
804 3300049744 Ga0501083_0051574 Ga0501083_0051574_303_647 114
805 3300049822 Ga0501035_0406615 Ga0501035_0406615_537_881 114
806 3300049823 Ga0501044_0515763 Ga0501044_0515763_469_813 114
807 3300049824 Ga0501045_0001157 Ga0501045_0001157_10264_10608 114
808 3300049824 Ga0501045_0986218 Ga0501045_0986218_206_550 114
809 3300050492 nmdc:mga0yw44_279045_c1 nmdc:mga0yw44_279045_c1_597_941 114
810 3300050492 nmdc:mga0yw44_733674_c1 nmdc:mga0yw44_733674_c1_57_401 114
811 3300050493 nmdc:mga0k408_23129_c1 nmdc:mga0k408_23129_c1_1141_1485 114
812 3300050493 nmdc:mga0k408_41987_c1 nmdc:mga0k408_41987_c1_992_1336 114
813 3300050493 nmdc:mga0k408_760854_c1 nmdc:mga0k408_760854_c1_155_499 114
814 3300050494 nmdc:mga06z11_168128_c1 nmdc:mga06z11_168128_c1_322_666 114
815 3300050494 nmdc:mga06z11_934928_c1 nmdc:mga06z11_934928_c1_66_410 114
816 3300050496 nmdc:mga07m45_205813_c1 nmdc:mga07m45_205813_c1_269_613 114
817 3300050496 nmdc:mga07m45_550076_c1 nmdc:mga07m45_550076_c1_157_501 114
818 3300050496 nmdc:mga07m45_75493_c1 nmdc:mga07m45_75493_c1_450_794 114
819 3300050508 nmdc:mga09592_787246_c1 nmdc:mga09592_787246_c1_30_374 114
820 3300050511 nmdc:mga08y16_1329778_c1 nmdc:mga08y16_1329778_c1_70_414 114
821 3300050513 nmdc:mga0rr50_315903_c1 nmdc:mga0rr50_315903_c1_953_1297 114
822 3300050516 nmdc:mga0sz30_28160_c1 nmdc:mga0sz30_28160_c1_477_821 114
823 3300053117 Ga0500593_000325 Ga0500593_000325_12940_13284 114
824 3300053130 Ga0500642_0011345 Ga0500642_0011345_2583_2927 114
825 3300053131 Ga0500652_000110 Ga0500652_000110_3895_4239 114
826 3300053156 Ga0500622_0065330 Ga0500622_0065330_444_788 114
827 3300060353 Ga0501082_1129798 Ga0501082_1129798_205_549 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

27

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ec2-assembly1.cif.gz_C kcsa with v76ester+g77da mutations 0.4884 24 106
7qru-assembly1.cif.gz_C structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.4692 1 114
7qru-assembly1.cif.gz_C structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.4593 1 114
5d57-assembly2.cif.gz_F in meso x-ray crystallography structure of diacylglycerol kinase, dgka, at 100 k 0.4267 24 99
5ec2-assembly1.cif.gz_C kcsa with v76ester+g77da mutations 0.4246 24 106
ID Description Score Start End Superfamily
5d56E00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6287 2 99 1.10.287.3610
5d56E00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6016 2 99 1.10.287.3610
4uyoF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5848 6 99 1.10.287.3610
4uyoF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5332 6 99 1.10.287.3610
af_Q2FZV3_3_109_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4998 7 108 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A4R6SJT5-F1-model_v4 Uncharacterized protein 0.5661 2 99 GO:0016020
AF-A0A1F2T9X3-F1-model_v4 Cation:proton antiporter 0.5607 25 114 GO:0005886
AF-D0WYG6-F1-model_v4 deleted 0.5584 25 114
AF-A0A841BMK6-F1-model_v4 Mannose/fructose/N-acetylgalactosamine-specific phosphotransferase system component IIC 0.5487 1 106 GO:0016020
GO:0016740
AF-A0A1F2T9X3-F1-model_v4 Cation:proton antiporter 0.5246 25 114 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.89 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map