F482515

General Info

Members Datasets Scaffolds Average Seq Length
827 519 1654 276

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1002267|Ga0209758_10022677
Length 276
Sequence MKRLLVILSSVVLLAVAGYFGASKWAIRHQTLSLVDRARNRVIAVDLAVRWDDDMKARAGMKVLPVAIVSHGNTVKNTEYAFIANLLAARGYLVASIQHDLESDAPLVTKKGSLYVGRLPVYERGEQNILFTIGELKKIEPNADYDHLTLVGHSNGGDISMFFAQQNPGLVSKVVTLDNLRVPFVTSGLAKILSFRSKDWKPDPGVIPDANVAKQAGIDIIRTDAQHTQMSDRGPDSVKEAIQRTLDKFLNDDSNSQLRPVDTRIPNLGDPRAMGP

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
138 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
311 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
314 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
320 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
323 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
324 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
325 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
328 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
329 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
330 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
334 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
335 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
338 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
339 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
340 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
344 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
345 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
346 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
347 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
348 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
349 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
350 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
351 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
352 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
353 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
354 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
355 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
356 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
357 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
358 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
359 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
360 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
361 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
362 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
363 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
364 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
365 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
366 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
367 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
368 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
369 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
370 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
371 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
372 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
373 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
374 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
375 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
376 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
377 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
378 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
379 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
380 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
381 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
382 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
383 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
384 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
385 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
386 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
387 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
388 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
389 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
390 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
391 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
392 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
393 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
394 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
395 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
396 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
397 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
398 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
399 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
400 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
401 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
402 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
403 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
404 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
405 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
406 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
407 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
408 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
409 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
410 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
411 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
412 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
413 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
414 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
415 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
416 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
417 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
418 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
419 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
420 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
421 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
422 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
423 2922368715
424 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
425 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
426 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
427 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
428 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
429 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
430 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
431 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
432 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
433 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
434 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
435 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
436 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
437 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
438 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
439 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
440 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
441 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
442 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
443 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
444 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
445 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
446 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
447 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
448 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
449 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
450 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
451 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
452 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
453 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
454 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
455 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
456 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
457 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
458 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
459 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
460 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
461 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
462 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
463 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
464 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
465 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
466 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
467 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
468 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
469 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
470 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
471 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
472 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
473 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
474 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
475 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
476 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
477 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
478 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
479 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
480 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
481 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
482 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
483 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
484 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
485 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
486 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
487 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
488 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
489 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
490 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
491 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
492 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
493 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
494 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
495 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
496 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
497 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
498 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
499 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
500 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
501 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
502 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
503 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
504 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
505 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
506 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
507 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
508 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
509 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
510 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
511 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
512 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
513 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
514 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
515 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
516 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
517 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
518 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
519 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.6
Metatranscriptomes 1.09
Isolates 21.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.99
Nodule 16.81
Rhizoplane 4.47
Rhizosphere 53.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1002267 3300025297 Bacteria 19939
2 JGI25165J46597_1014029 3300003214 Bacteria 1094
3 JGI25153J46596_10000161 3300003215 Bacteria 67388
4 JGI25153J46596_10000281 3300003215 Bacteria 38848
5 JGI25153J46596_10000977 3300003215 Bacteria 17336
6 JGI25153J46596_10028539 3300003215 Bacteria 1932
7 JGI25153J46596_10031775 3300003215 Bacteria 1771
8 rootH2_10037366 3300003320 Bacteria 3791
9 rootH1_10017149 3300003323 Bacteria 10527
10 rootH1_10227855 3300003323 Bacteria 1549
11 JGI25160J50197_1001545 3300003354 Bacteria 11394
12 JGI25160J50197_1014428 3300003354 Bacteria 2644
13 JGI25160J50197_1035300 3300003354 Bacteria 1228
14 JGI25161J50226_1009886 3300003374 Bacteria 1317
15 Ga0055531_10002042 3300003794 Bacteria 13930
16 Ga0065165_1000244 3300005262 Bacteria 93411
17 Ga0065165_1000368 3300005262 Bacteria 73904
18 Ga0065165_1002095 3300005262 Bacteria 18247
19 Ga0065165_1006546 3300005262 Bacteria 6072
20 Ga0070658_10181891 3300005327 Bacteria 1769
21 Ga0070683_100044265 3300005329 Bacteria 4104
22 Ga0070683_100090596 3300005329 Bacteria 2871
23 Ga0070680_100065456 3300005336 Bacteria 2979
24 Ga0070680_100182066 3300005336 Bacteria 1770
25 Ga0070691_10047553 3300005341 Bacteria 2040
26 Ga0070691_10057726 3300005341 Bacteria 1862
27 Ga0070668_100027400 3300005347 Bacteria 4326
28 Ga0070669_100009310 3300005353 Bacteria 6993
29 Ga0070671_100016245 3300005355 Bacteria 6020
30 Ga0070659_100274911 3300005366 Bacteria 1400
31 Ga0070709_10000876 3300005434 Bacteria 16851
32 Ga0070709_10016052 3300005434 Bacteria 4268
33 Ga0070709_10017442 3300005434 Bacteria 4118
34 Ga0070709_10024784 3300005434 Bacteria 3536
35 Ga0070709_10051571 3300005434 Bacteria 2582
36 Ga0070714_100003854 3300005435 Bacteria 11265
37 Ga0070714_100046908 3300005435 Bacteria 3667
38 Ga0070714_100521373 3300005435 Bacteria 1135
39 Ga0070713_100015180 3300005436 Bacteria 5744
40 Ga0070713_100032437 3300005436 Bacteria 4172
41 Ga0070713_100036433 3300005436 Bacteria 3970
42 Ga0070713_100078573 3300005436 Bacteria 2809
43 Ga0070713_100182842 3300005436 Bacteria 1885
44 Ga0070710_10001739 3300005437 Bacteria 10290
45 Ga0070710_10005371 3300005437 Bacteria 6080
46 Ga0070710_10061696 3300005437 Bacteria 2136
47 Ga0070711_100010949 3300005439 Bacteria 5621
48 Ga0070711_100018545 3300005439 Bacteria 4446
49 Ga0070711_100029254 3300005439 Bacteria 3634
50 Ga0070711_100076311 3300005439 Bacteria 2376
51 Ga0070711_100207290 3300005439 Bacteria 1516
52 Ga0070708_100060892 3300005445 Bacteria 3370
53 Ga0070663_100034153 3300005455 Bacteria 3520
54 Ga0070663_100036758 3300005455 Bacteria 3404
55 Ga0070663_100055860 3300005455 Bacteria 2827
56 Ga0070681_10004189 3300005458 Bacteria 13659
57 Ga0070681_10014364 3300005458 Bacteria 7880
58 Ga0070681_10040815 3300005458 Bacteria 4648
59 Ga0070681_10239647 3300005458 Bacteria 1727
60 Ga0070707_100038070 3300005468 Bacteria 4593
61 Ga0070707_100295512 3300005468 Bacteria 1574
62 Ga0070698_100089755 3300005471 Bacteria 3057
63 Ga0070679_100071108 3300005530 Bacteria 3470
64 Ga0070679_100077015 3300005530 Bacteria 3324
65 Ga0070684_100011228 3300005535 Bacteria 7131
66 Ga0070684_100037064 3300005535 Bacteria 4180
67 Ga0070697_100480559 3300005536 Bacteria 1085
68 Ga0068853_100156221 3300005539 Bacteria 2056
69 Ga0068853_100252498 3300005539 Bacteria 1619
70 Ga0070693_100067082 3300005547 Bacteria 2102
71 Ga0070665_100299989 3300005548 Bacteria 1609
72 Ga0068855_100035195 3300005563 Bacteria 5965
73 Ga0068855_100310229 3300005563 Bacteria 1746
74 Ga0068855_100456591 3300005563 Bacteria 1393
75 Ga0070664_100217240 3300005564 Bacteria 1710
76 Ga0070664_100500334 3300005564 Bacteria 1120
77 Ga0070664_100583482 3300005564 Bacteria 1036
78 Ga0068857_100048028 3300005577 Bacteria 3790
79 Ga0068857_100056565 3300005577 Bacteria 3481
80 Ga0068857_100226770 3300005577 Bacteria 1708
81 Ga0068857_100525056 3300005577 Bacteria 1113
82 Ga0068854_100170273 3300005578 Bacteria 1694
83 Ga0068852_100144309 3300005616 Bacteria 2206
84 Ga0068859_100760228 3300005617 Bacteria 1058
85 Ga0068864_100459209 3300005618 Bacteria 1219
86 Ga0068863_100208422 3300005841 Bacteria 1882
87 Ga0081455_10054923 3300005937 Bacteria 3390
88 Ga0081540_1040316 3300005983 Bacteria 2435
89 Ga0081540_1065844 3300005983 Bacteria 1701
90 Ga0070717_10000296 3300006028 Bacteria 33438
91 Ga0070717_10002073 3300006028 Bacteria 14037
92 Ga0070717_10054199 3300006028 Bacteria 3307
93 Ga0070717_10184553 3300006028 Bacteria 1820
94 Ga0075365_10007951 3300006038 Bacteria 5981
95 Ga0075365_10034785 3300006038 Bacteria 3256
96 Ga0075365_10151464 3300006038 Bacteria 1613
97 Ga0075365_10223806 3300006038 Bacteria 1320
98 Ga0075368_10003467 3300006042 Bacteria 5271
99 Ga0075363_100092369 3300006048 Bacteria 1667
100 Ga0075363_100101891 3300006048 Bacteria 1589
101 Ga0075364_10141115 3300006051 Bacteria 1621
102 Ga0070715_10002809 3300006163 Bacteria 5420
103 Ga0070715_10010420 3300006163 Bacteria 3313
104 Ga0070716_100024870 3300006173 Bacteria 3189
105 Ga0070716_100412975 3300006173 Bacteria 974
106 Ga0070712_100002413 3300006175 Bacteria 11516
107 Ga0070712_100084813 3300006175 Bacteria 2304
108 Ga0075362_10065010 3300006177 Bacteria 1656
109 Ga0075367_10011773 3300006178 Bacteria 4642
110 Ga0075369_10017586 3300006186 Bacteria 2901
111 Ga0075369_10044798 3300006186 Bacteria 1901
112 Ga0075369_10055394 3300006186 Bacteria 1723
113 Ga0097621_100077348 3300006237 Bacteria 2762
114 Ga0097621_100510446 3300006237 Bacteria 1090
115 Ga0068871_100486372 3300006358 Bacteria 1111
116 Ga0075434_100016276 3300006871 Bacteria 7148
117 Ga0068865_100342886 3300006881 Bacteria 1208
118 Ga0097620_100760267 3300006931 Bacteria 1058
119 Ga0099824_1009964 3300006942 Bacteria 11453
120 Ga0105240_10005680 3300009093 Bacteria 18518
121 Ga0105240_10009106 3300009093 Bacteria 14095
122 Ga0105245_10300501 3300009098 Bacteria 1575
123 Ga0105247_10069894 3300009101 Bacteria 2192
124 Ga0105247_10076660 3300009101 Bacteria 2100
125 Ga0105243_10043445 3300009148 Bacteria 3522
126 Ga0105241_10029445 3300009174 Bacteria 4097
127 Ga0105241_10084127 3300009174 Bacteria 2497
128 Ga0105241_10425050 3300009174 Bacteria 1170
129 Ga0105248_10034075 3300009177 Bacteria 5691
130 Ga0105237_10001256 3300009545 Bacteria 33873
131 Ga0105237_10021725 3300009545 Bacteria 6594
132 Ga0105237_10108288 3300009545 Bacteria 2770
133 Ga0105237_10117219 3300009545 Bacteria 2657
134 Ga0105237_10309696 3300009545 Bacteria 1582
135 Ga0105238_10098194 3300009551 Bacteria 2913
136 Ga0105238_10321729 3300009551 Bacteria 1533
137 Ga0105238_10390320 3300009551 Bacteria 1384
138 Ga0105238_10617831 3300009551 Bacteria 1092
139 Ga0099796_10043577 3300010159 Bacteria 1529
140 Ga0105239_10003503 3300010375 Bacteria 19212
141 Ga0105239_10031910 3300010375 Bacteria 5788
142 Ga0105239_10408467 3300010375 Bacteria 1537
143 Ga0105239_10438011 3300010375 Bacteria 1482
144 Ga0105246_10011901 3300011119 Bacteria 5412
145 Ga0157370_10053791 3300013104 Bacteria 3838
146 Ga0157369_10002124 3300013105 Bacteria 23888
147 Ga0157369_10004766 3300013105 Bacteria 15947
148 Ga0157369_10199328 3300013105 Bacteria 2101
149 Ga0157374_10402186 3300013296 Bacteria 1366
150 Ga0163162_10066124 3300013306 Bacteria 3664
151 Ga0163162_10071272 3300013306 Bacteria 3528
152 Ga0163162_10160318 3300013306 Bacteria 2371
153 Ga0157372_10024319 3300013307 Bacteria 6578
154 Ga0157372_10140745 3300013307 Bacteria 2779
155 Ga0157372_10239559 3300013307 Bacteria 2105
156 Ga0157372_10521420 3300013307 Bacteria 1385
157 Ga0157375_10492878 3300013308 Bacteria 1390
158 Ga0157375_10772670 3300013308 Bacteria 1111
159 Ga0163163_10002879 3300014325 Bacteria 14556
160 Ga0163163_10011582 3300014325 Bacteria 8011
161 Ga0163163_10114500 3300014325 Bacteria 2728
162 Ga0157379_10054625 3300014968 Bacteria 3569
163 Ga0157376_10328082 3300014969 Bacteria 1457
164 Ga0182005_1045676 3300015265 Bacteria 1190
165 Ga0206350_10272083 3300020080 Bacteria 1285
166 Ga0206350_10659846 3300020080 Bacteria 1277
167 Ga0206350_10947626 3300020080 Bacteria 1355
168 Ga0213872_10020796 3300021361 Bacteria 3024
169 Ga0213871_10000551 3300021441 Bacteria 5238
170 Ga0224712_10020347 3300022467 Bacteria 2251
171 Ga0224712_10020470 3300022467 Bacteria 2247
172 Ga0224712_10034714 3300022467 Bacteria 1857
173 Ga0209563_101077 3300025230 Bacteria 7868
174 Ga0207425_1009962 3300025245 Bacteria 2335
175 Ga0209677_103802 3300025253 Bacteria 4681
176 Ga0209148_1000224 3300025254 Bacteria 92967
177 Ga0209233_1006766 3300025261 Bacteria 3670
178 Ga0209233_1010720 3300025261 Bacteria 2730
179 Ga0209455_1007407 3300025272 Bacteria 3101
180 Ga0209564_1003777 3300025295 Bacteria 9854
181 Ga0209758_1000075 3300025297 Bacteria 271585
182 Ga0209758_1000087 3300025297 Bacteria 254384
183 Ga0209758_1000423 3300025297 Bacteria 71797
184 Ga0209758_1002791 3300025297 Bacteria 17078
185 Ga0209758_1005214 3300025297 Bacteria 10205
186 Ga0209256_1006240 3300025299 Bacteria 6415
187 Ga0207426_1000289 3300025302 Bacteria 99963
188 Ga0207426_1000312 3300025302 Bacteria 95006
189 Ga0207426_1009071 3300025302 Bacteria 3957
190 Ga0207426_1009727 3300025302 Bacteria 3781
191 Ga0209051_1033899 3300025303 Bacteria 1922
192 Ga0209257_1000382 3300025304 Bacteria 88368
193 Ga0209257_1032517 3300025304 Bacteria 1653
194 Ga0207692_10001619 3300025898 Bacteria 8492
195 Ga0207692_10004379 3300025898 Bacteria 5589
196 Ga0207692_10033839 3300025898 Bacteria 2469
197 Ga0207647_10004670 3300025904 Bacteria 10146
198 Ga0207647_10056389 3300025904 Bacteria 2411
199 Ga0207699_10012332 3300025906 Bacteria 4346
200 Ga0207699_10014652 3300025906 Bacteria 4049
201 Ga0207699_10033469 3300025906 Bacteria 2905
202 Ga0207699_10084056 3300025906 Bacteria 1981
203 Ga0207684_10069846 3300025910 Bacteria 2985
204 Ga0207654_10077535 3300025911 Bacteria 1992
205 Ga0207707_10000173 3300025912 Bacteria 67122
206 Ga0207707_10001587 3300025912 Bacteria 20953
207 Ga0207707_10024621 3300025912 Bacteria 5269
208 Ga0207707_10031046 3300025912 Bacteria 4674
209 Ga0207695_10000240 3300025913 Bacteria 143196
210 Ga0207695_10118996 3300025913 Bacteria 2612
211 Ga0207695_10574706 3300025913 Bacteria 1008
212 Ga0207671_10003554 3300025914 Bacteria 15450
213 Ga0207671_10153012 3300025914 Bacteria 1783
214 Ga0207671_10167791 3300025914 Bacteria 1703
215 Ga0207671_10194069 3300025914 Bacteria 1584
216 Ga0207671_10249248 3300025914 Bacteria 1396
217 Ga0207671_10285629 3300025914 Bacteria 1302
218 Ga0207693_10000981 3300025915 Bacteria 25583
219 Ga0207693_10001050 3300025915 Bacteria 24700
220 Ga0207693_10083888 3300025915 Bacteria 2496
221 Ga0207693_10124897 3300025915 Bacteria 2022
222 Ga0207663_10000235 3300025916 Bacteria 24574
223 Ga0207663_10005271 3300025916 Bacteria 6508
224 Ga0207663_10052007 3300025916 Bacteria 2553
225 Ga0207663_10176762 3300025916 Bacteria 1521
226 Ga0207663_10218944 3300025916 Bacteria 1384
227 Ga0207660_10037654 3300025917 Bacteria 3372
228 Ga0207657_10040367 3300025919 Bacteria 4135
229 Ga0207649_10355431 3300025920 Bacteria 1085
230 Ga0207652_10117236 3300025921 Bacteria 2366
231 Ga0207652_10738285 3300025921 Bacteria 877
232 Ga0207694_10154404 3300025924 Bacteria 1850
233 Ga0207694_10190091 3300025924 Bacteria 1668
234 Ga0207694_10491929 3300025924 Bacteria 1027
235 Ga0207700_10012922 3300025928 Bacteria 5405
236 Ga0207700_10024511 3300025928 Bacteria 4176
237 Ga0207700_10027959 3300025928 Bacteria 3957
238 Ga0207700_10157973 3300025928 Bacteria 1880
239 Ga0207700_10208055 3300025928 Bacteria 1652
240 Ga0207700_10422241 3300025928 Bacteria 1172
241 Ga0207664_10023596 3300025929 Bacteria 4611
242 Ga0207664_10163931 3300025929 Bacteria 1897
243 Ga0207644_10199050 3300025931 Bacteria 1579
244 Ga0207709_10182259 3300025935 Bacteria 1484
245 Ga0207704_10193138 3300025938 Bacteria 1483
246 Ga0207665_10000311 3300025939 Bacteria 33740
247 Ga0207665_10012802 3300025939 Bacteria 5516
248 Ga0207665_10289502 3300025939 Bacteria 1221
249 Ga0207665_10321925 3300025939 Bacteria 1160
250 Ga0207691_10415708 3300025940 Bacteria 1146
251 Ga0207711_10038610 3300025941 Bacteria 4061
252 Ga0207689_10262064 3300025942 Bacteria 1430
253 Ga0207661_10002926 3300025944 Bacteria 11801
254 Ga0207679_10574584 3300025945 Bacteria 1013
255 Ga0207667_10036980 3300025949 Bacteria 5224
256 Ga0207667_10192345 3300025949 Bacteria 2093
257 Ga0207667_10320901 3300025949 Bacteria 1582
258 Ga0207712_10455556 3300025961 Bacteria 1086
259 Ga0207668_10103608 3300025972 Bacteria 2119
260 Ga0207668_10180054 3300025972 Bacteria 1666
261 Ga0207668_10259475 3300025972 Bacteria 1415
262 Ga0207640_10112152 3300025981 Bacteria 1935
263 Ga0207703_10135064 3300026035 Bacteria 2135
264 Ga0207639_10047084 3300026041 Bacteria 3257
265 Ga0207639_10282202 3300026041 Bacteria 1461
266 Ga0207639_10304788 3300026041 Bacteria 1409
267 Ga0207678_10008199 3300026067 Bacteria 9212
268 Ga0207678_10047119 3300026067 Bacteria 3728
269 Ga0207678_10063854 3300026067 Bacteria 3164
270 Ga0207702_10541045 3300026078 Bacteria 1138
271 Ga0207702_10674031 3300026078 Bacteria 1018
272 Ga0207702_10744353 3300026078 Bacteria 967
273 Ga0207641_10127434 3300026088 Bacteria 2281
274 Ga0207641_10252613 3300026088 Bacteria 1647
275 Ga0207676_10129282 3300026095 Bacteria 2145
276 Ga0207674_10015383 3300026116 Bacteria 8405
277 Ga0207674_10059055 3300026116 Bacteria 3883
278 Ga0207674_10231674 3300026116 Bacteria 1795
279 Ga0207674_10512620 3300026116 Bacteria 1158
280 Ga0207698_10012757 3300026142 Bacteria 5515
281 Ga0209389_1000210 3300027296 Bacteria 41871
282 Ga0209589_1001190 3300027357 Bacteria 41871
283 Ga0209489_100192 3300027361 Bacteria 98028
284 Ga0209489_113916 3300027361 Bacteria 6085
285 Ga0209489_113918 3300027361 Bacteria 6082
286 Ga0209700_100046 3300027363 Bacteria 159296
287 Ga0209813_10043902 3300027866 Bacteria 1372
288 Ga0268266_10025392 3300028379 Bacteria 5040
289 Ga0268266_10160575 3300028379 Bacteria 2033
290 Ga0265334_10009406 3300028573 Bacteria 4135
291 Ga0265340_10052996 3300031247 Bacteria 1960
292 Ga0265339_10006000 3300031249 Bacteria 8027
293 Ga0307509_10180953 3300031507 Bacteria 1973
294 Ga0307508_10029376 3300031616 Bacteria 4970
295 Ga0307508_10227967 3300031616 Bacteria 1462
296 Ga0307510_10033996 3300033180 Bacteria 5715
297 Ga0307510_10038603 3300033180 Bacteria 5277
298 Ga0373934_0010659 3300035086 Bacteria 3453
299 Ga0373923_0074291 3300035111 Bacteria 1465
300 Ga0373936_0010898 3300035113 Bacteria 3435
301 Ga0373936_0065883 3300035113 Bacteria 1486
302 Ga0373945_0050911 3300035116 Bacteria 1523
303 Ga0373953_0002954 3300035117 Bacteria 5197
304 Ga0373954_0030519 3300035118 Bacteria 2485
305 Ga0373954_0085255 3300035118 Bacteria 1512
306 Ga0373957_0045368 3300035120 Bacteria 1665
307 Ga0373957_0084417 3300035120 Bacteria 1256
308 Ga0373955_0013417 3300035172 Bacteria 3963
309 Ga0373924_0003042 3300035410 Bacteria 5720
310 Ga0373924_0010768 3300035410 Bacteria 3384
311 Ga0373935_0001649 3300035692 Bacteria 12480
312 Ga0373927_0000753 3300035695 Bacteria 24725
313 Ga0373927_0029808 3300035695 Bacteria 3558
314 Ga0373933_0000112 3300035724 Bacteria 52335
315 Ga0373933_0030793 3300035724 Bacteria 3108
316 Ga0373933_0097739 3300035724 Bacteria 1819
317 Ga0373947_0002383 3300035725 Bacteria 11353
318 Ga0373947_0063196 3300035725 Bacteria 2255
319 Ga0373947_0170089 3300035725 Bacteria 1413
320 Ga0373937_0118172 3300036401 Bacteria 2469
321 Ga0372808_008063 3300036459 Bacteria 1454
322 Ga0373925_0004124 3300037068 Bacteria 11022
323 Ga0373925_0051434 3300037068 Bacteria 3075
324 Ga0373925_0412226 3300037068 Bacteria 1103
325 Ga0373925_0440280 3300037068 Bacteria 1066
326 Ga0395899_0094378 3300037312 Bacteria 2165
327 Ga0395900_0002290 3300037418 Bacteria 21266
328 Ga0395900_0224423 3300037418 Bacteria 1892
329 Ga0395898_0010726 3300037466 Bacteria 9572
330 Ga0395898_0041055 3300037466 Bacteria 4572
331 Ga0395898_0052153 3300037466 Bacteria 3996
332 Ga0395898_0118304 3300037466 Bacteria 2538
333 Ga0395905_0306784 3300037471 Bacteria 1475
334 Ga0436364_0808523 3300037853 Bacteria 1903
335 Ga0395901_0108706 3300038443 Bacteria 2911
336 Ga0395901_0649751 3300038443 Bacteria 1058
337 Ga0395901_0737722 3300038443 Bacteria 979
338 Ga0436365_0090965 3300039437 Bacteria 3522
339 Ga0436365_0261949 3300039437 Bacteria 1222
340 Ga0436365_1005930 3300039437 Bacteria 2225
341 Ga0436360_0150999 3300039438 Bacteria 931
342 Ga0436360_0685625 3300039438 Bacteria 7008
343 Ga0436361_0170114 3300039447 Bacteria 2048
344 Ga0436361_0620447 3300039447 Bacteria 7815
345 Ga0436362_0483804 3300039453 Bacteria 3407
346 Ga0451793_1635304 3300041452 Bacteria 1769
347 Ga0451795_1671663 3300041456 Bacteria 1511
348 Ga0451804_1161461 3300041463 Bacteria 1436
349 Ga0451853_3948067 3300041512 Bacteria 2104
350 Ga0466972_0006609 3300044658 Bacteria 5823
351 Ga0466965_0079953 3300044683 Bacteria 1652
352 Ga0466966_0001893 3300044684 Bacteria 13588
353 Ga0466961_0000016 3300044693 Bacteria 111421
354 Ga0466961_0133952 3300044693 Bacteria 1553
355 Ga0466961_0160547 3300044693 Bacteria 1401
356 Ga0466963_0004088 3300044694 Bacteria 8442
357 Ga0466968_0024605 3300044735 Bacteria 2461
358 Ga0466970_0088053 3300044765 Bacteria 1684
359 Ga0466960_0093792 3300044901 Bacteria 1535
360 Ga0466959_0011853 3300045049 Bacteria 6277
361 Ga0466967_0053030 3300045976 Bacteria 3563
362 Ga0466967_0197098 3300045976 Bacteria 1906
363 Ga0466967_0198739 3300045976 Bacteria 1898
364 Ga0495592_0039590 3300046454 Bacteria 3540
365 Ga0495592_0057241 3300046454 Bacteria 2878
366 Ga0495603_0003032 3300046455 Bacteria 9952
367 Ga0495603_0011547 3300046455 Bacteria 5342
368 Ga0495603_0116389 3300046455 Bacteria 1559
369 Ga0495629_0000550 3300046459 Bacteria 30714
370 Ga0495629_0038165 3300046459 Bacteria 3384
371 Ga0495629_0152487 3300046459 Bacteria 1606
372 Ga0495638_0002916 3300046460 Bacteria 13658
373 Ga0495641_0014999 3300046461 Bacteria 4168
374 Ga0495651_0001898 3300046462 Bacteria 16168
375 Ga0495580_0036549 3300046472 Bacteria 3525
376 Ga0495580_0077330 3300046472 Bacteria 2321
377 Ga0495582_0000181 3300046473 Bacteria 34140
378 Ga0495639_0000191 3300046475 Bacteria 32236
379 Ga0495639_0051992 3300046475 Bacteria 1864
380 Ga0495662_0004915 3300046476 Bacteria 6695
381 Ga0495662_0032494 3300046476 Bacteria 2521
382 Ga0495664_0002406 3300046477 Bacteria 10045
383 Ga0495664_0011680 3300046477 Bacteria 4956
384 Ga0495664_0148165 3300046477 Bacteria 1423
385 Ga0495594_0001141 3300046499 Bacteria 13855
386 Ga0495607_0191699 3300046501 Bacteria 1018
387 Ga0495583_0106802 3300046506 Bacteria 1190
388 Ga0495606_0010980 3300046507 Bacteria 7440
389 Ga0495606_0119608 3300046507 Bacteria 1578
390 Ga0495608_0016858 3300046511 Bacteria 5056
391 Ga0495608_0023421 3300046511 Bacteria 4232
392 Ga0495608_0189936 3300046511 Bacteria 1297
393 Ga0495616_0074762 3300046513 Bacteria 1632
394 Ga0495618_0017157 3300046514 Bacteria 4437
395 Ga0495628_0036605 3300046516 Bacteria 3937
396 Ga0495628_0043212 3300046516 Bacteria 3591
397 Ga0495628_0340028 3300046516 Bacteria 1105
398 Ga0495630_0158533 3300046517 Bacteria 1723
399 Ga0495631_0061756 3300046518 Bacteria 1625
400 Ga0495643_0004498 3300046522 Bacteria 9717
401 Ga0495648_0020446 3300046524 Bacteria 4616
402 Ga0495648_0029504 3300046524 Bacteria 3640
403 Ga0495648_0074868 3300046524 Bacteria 1949
404 Ga0495648_0086424 3300046524 Bacteria 1769
405 Ga0495666_0153953 3300046526 Bacteria 1068
406 Ga0495666_0155945 3300046526 Bacteria 1060
407 Ga0495652_0005031 3300046529 Bacteria 12513
408 Ga0495652_0040701 3300046529 Bacteria 4016
409 Ga0495652_0162194 3300046529 Bacteria 1734
410 Ga0495665_0111446 3300046531 Bacteria 1435
411 Ga0495640_0005950 3300046533 Bacteria 9674
412 Ga0495640_0012054 3300046533 Bacteria 6622
413 Ga0495586_0095043 3300046535 Bacteria 1649
414 Ga0495587_0028830 3300046536 Bacteria 3373
415 Ga0495587_0033109 3300046536 Bacteria 3122
416 Ga0495587_0063873 3300046536 Bacteria 2152
417 Ga0495609_0076405 3300046538 Bacteria 1468
418 Ga0495597_0024074 3300046542 Bacteria 2812
419 Ga0495645_0004606 3300046543 Bacteria 9412
420 Ga0495645_0043303 3300046543 Bacteria 3283
421 Ga0495645_0175585 3300046543 Bacteria 1471
422 Ga0495622_0028860 3300046557 Bacteria 2592
423 Ga0495622_0061202 3300046557 Bacteria 1743
424 Ga0495667_0068046 3300046559 Bacteria 2326
425 Ga0495667_0088014 3300046559 Bacteria 2013
426 Ga0495668_0041526 3300046616 Bacteria 2562
427 Ga0495634_0002572 3300046642 Bacteria 14976
428 Ga0495634_0026215 3300046642 Bacteria 4069
429 Ga0495611_0093773 3300046648 Bacteria 1389
430 Ga0495625_0136176 3300046660 Bacteria 1660
431 Ga0495635_0002368 3300046663 Bacteria 12833
432 Ga0495635_0098845 3300046663 Bacteria 1994
433 Ga0495635_0101515 3300046663 Bacteria 1966
434 Ga0495635_0143465 3300046663 Bacteria 1626
435 Ga0495661_0047580 3300046665 Bacteria 2611
436 Ga0495661_0251891 3300046665 Bacteria 901
437 Ga0495588_0015203 3300046674 Bacteria 3699
438 Ga0495588_0018636 3300046674 Bacteria 3388
439 Ga0495588_0100774 3300046674 Bacteria 1517
440 Ga0495657_0012055 3300046675 Bacteria 6432
441 Ga0495657_0012763 3300046675 Bacteria 6230
442 Ga0495657_0016514 3300046675 Bacteria 5378
443 Ga0495599_0021739 3300046678 Bacteria 4004
444 Ga0495599_0035948 3300046678 Bacteria 3109
445 Ga0495623_0010395 3300046679 Bacteria 6023
446 Ga0495623_0073046 3300046679 Bacteria 2132
447 Ga0495646_0020307 3300046680 Bacteria 4203
448 Ga0495646_0040216 3300046680 Bacteria 2881
449 Ga0495646_0041538 3300046680 Bacteria 2825
450 Ga0495647_0001489 3300046681 Bacteria 7270
451 Ga0495658_0004478 3300046683 Bacteria 6874
452 Ga0495658_0005644 3300046683 Bacteria 6148
453 Ga0495658_0327918 3300046683 Bacteria 971
454 Ga0495613_0033214 3300046689 Bacteria 3834
455 Ga0495624_0008267 3300046690 Bacteria 7273
456 Ga0495624_0016611 3300046690 Bacteria 4953
457 Ga0495624_0095851 3300046690 Bacteria 1828
458 Ga0495649_0039286 3300046694 Bacteria 2595
459 Ga0495649_0105353 3300046694 Bacteria 1497
460 Ga0495649_0231267 3300046694 Bacteria 954
461 Ga0495600_0001909 3300046809 Bacteria 11706
462 Ga0495600_0016056 3300046809 Bacteria 4746
463 Ga0495600_0026187 3300046809 Bacteria 3762
464 Ga0495581_0006884 3300047315 Bacteria 6592
465 Ga0495604_0001045 3300047317 Bacteria 23003
466 Ga0495604_0041580 3300047317 Bacteria 3605
467 Ga0495674_0009655 3300047319 Bacteria 9164
468 Ga0495674_0020915 3300047319 Bacteria 6057
469 Ga0495674_0023288 3300047319 Bacteria 5710
470 Ga0495672_0020577 3300047320 Bacteria 4318
471 Ga0495672_0027534 3300047320 Bacteria 3610
472 Ga0495672_0213828 3300047320 Bacteria 956
473 Ga0495676_0091859 3300047321 Bacteria 2267
474 Ga0495680_0001894 3300047322 Bacteria 21963
475 Ga0495680_0090412 3300047322 Bacteria 2296
476 Ga0495687_002613 3300047443 Bacteria 14144
477 Ga0495675_0002556 3300047444 Bacteria 10891
478 Ga0495675_0005940 3300047444 Bacteria 7462
479 Ga0495673_0016740 3300047469 Bacteria 3741
480 Ga0495673_0124494 3300047469 Bacteria 1018
481 Ga0495684_0013759 3300047471 Bacteria 6227
482 Ga0495684_0036959 3300047471 Bacteria 3744
483 Ga0495684_0053511 3300047471 Bacteria 3080
484 Ga0495684_0315994 3300047471 Bacteria 1118
485 Ga0495686_0084011 3300047472 Bacteria 1941
486 Ga0495686_0129118 3300047472 Bacteria 1500
487 Ga0495593_0003024 3300047673 Bacteria 10130
488 Ga0495593_0058056 3300047673 Bacteria 2031
489 Ga0495602_0011822 3300048088 Bacteria 9014
490 Ga0495602_0073702 3300048088 Bacteria 2904
491 Ga0495602_0196465 3300048088 Bacteria 1542
492 Ga0495614_0168258 3300048089 Bacteria 983
493 Ga0496100_0188900 3300048903 Bacteria 1494
494 Ga0496101_0125488 3300048904 Bacteria 1945
495 Ga0496101_0162412 3300048904 Bacteria 1714
496 Ga0496101_0250572 3300048904 Bacteria 1380
497 Ga0496102_0009673 3300048905 Bacteria 8292
498 Ga0496102_0022705 3300048905 Bacteria 5561
499 Ga0496102_0593052 3300048905 Bacteria 1031
500 Ga0496103_0103458 3300048906 Bacteria 1804
501 Ga0496103_0139231 3300048906 Bacteria 1551
502 Ga0496104_0004880 3300048907 Bacteria 11690
503 Ga0496104_0034830 3300048907 Bacteria 4697
504 Ga0496104_0062970 3300048907 Bacteria 3517
505 Ga0496105_0016620 3300048908 Bacteria 5876
506 Ga0496105_0176786 3300048908 Bacteria 1748
507 Ga0496105_0304391 3300048908 Bacteria 1281
508 Ga0496106_0007337 3300048909 Bacteria 8148
509 Ga0496106_0144944 3300048909 Bacteria 1870
510 Ga0496106_0149704 3300048909 Bacteria 1840
511 Ga0496106_0531855 3300048909 Bacteria 944
512 Ga0496107_0054859 3300048910 Bacteria 2877
513 Ga0496107_0233993 3300048910 Bacteria 1367
514 Ga0496108_0004880 3300048911 Bacteria 10828
515 Ga0496108_0009704 3300048911 Bacteria 7801
516 Ga0496109_0024526 3300048912 Bacteria 5363
517 Ga0496110_0011659 3300048913 Bacteria 7207
518 Ga0496110_0058380 3300048913 Bacteria 3399
519 Ga0496110_0214557 3300048913 Bacteria 1750
520 Ga0496111_0016574 3300048914 Bacteria 5080
521 Ga0496111_0028793 3300048914 Bacteria 3939
522 Ga0496113_0115616 3300048916 Bacteria 2093
523 Ga0496113_0229706 3300048916 Bacteria 1479
524 Ga0496114_0084338 3300048917 Bacteria 2690
525 Ga0496115_0020385 3300048918 Bacteria 5115
526 Ga0496115_0165852 3300048918 Bacteria 1826
527 Ga0496116_0037121 3300048919 Bacteria 3401
528 Ga0496117_0147040 3300048920 Bacteria 1401
529 Ga0496117_0195055 3300048920 Bacteria 1149
530 Ga0496118_0005327 3300048921 Bacteria 14652
531 Ga0496118_0035956 3300048921 Bacteria 4013
532 Ga0496118_0081283 3300048921 Bacteria 2276
533 Ga0496118_0140577 3300048921 Bacteria 1531
534 Ga0496119_0012747 3300048922 Bacteria 6789
535 Ga0496119_0042621 3300048922 Bacteria 2876
536 Ga0496119_0136864 3300048922 Bacteria 1327
537 Ga0496120_0004629 3300048923 Bacteria 11398
538 Ga0496120_0193895 3300048923 Bacteria 988
539 Ga0496121_0003676 3300048924 Bacteria 21548
540 Ga0496121_0006831 3300048924 Bacteria 13960
541 Ga0496121_0035195 3300048924 Bacteria 4492
542 Ga0496121_0040406 3300048924 Bacteria 4093
543 Ga0496122_0200906 3300048925 Bacteria 1166
544 Ga0496124_0001147 3300048927 Bacteria 41534
545 Ga0496124_0059591 3300048927 Bacteria 3206
546 Ga0496125_0084480 3300048928 Bacteria 2410
547 Ga0496126_0012042 3300048929 Bacteria 8887
548 Ga0496126_0032797 3300048929 Bacteria 4889
549 Ga0496126_0036049 3300048929 Bacteria 4630
550 Ga0496126_0049899 3300048929 Bacteria 3818
551 Ga0496126_0095838 3300048929 Bacteria 2602
552 Ga0496126_0099158 3300048929 Bacteria 2552
553 Ga0496126_0214026 3300048929 Bacteria 1621
554 Ga0496126_0366934 3300048929 Bacteria 1175
555 Ga0495682_0045658 3300049460 Bacteria 1600
556 Ga0501036_0037033 3300049572 Bacteria 4127
557 Ga0501038_0073801 3300049574 Bacteria 2888
558 Ga0501043_0043670 3300049579 Bacteria 3523
559 Ga0501046_0046826 3300049580 Bacteria 3431
560 Ga0501047_0036800 3300049581 Bacteria 4731
561 Ga0501047_0056285 3300049581 Bacteria 3803
562 Ga0501070_0050051 3300049586 Bacteria 3469
563 Ga0501080_0025198 3300049742 Bacteria 5520
564 Ga0501044_0033833 3300049823 Bacteria 5367
565 Ga0501044_0050907 3300049823 Bacteria 4272
566 nmdc:mga03683_81113_c1 3300050489 Bacteria 1401
567 nmdc:mga03n38_15339_c1 3300050490 Bacteria 2957
568 nmdc:mga03n38_64638_c1 3300050490 Bacteria 1675
569 nmdc:mga0yw44_1895_c1 3300050492 Bacteria 8619
570 nmdc:mga0k408_128276_c1 3300050493 Bacteria 1505
571 nmdc:mga0k408_35058_c1 3300050493 Bacteria 2876
572 nmdc:mga04h51_46276_c1 3300050495 Bacteria 1442
573 nmdc:mga07m45_47461_c1 3300050496 Bacteria 2415
574 nmdc:mga0n895_3623_c1 3300050512 Bacteria 12481
575 nmdc:mga0sz30_89304_c1 3300050516 Bacteria 1340
576 nmdc:mga0sz30_93453_c1 3300050516 Bacteria 1310
577 Ga0495601_0023417 3300053077 Bacteria 3793
578 Ga0495601_0056257 3300053077 Bacteria 2491
579 Ga0500610_0016251 3300053079 Bacteria 3543
580 Ga0495595_0031845 3300053084 Bacteria 2371
581 Ga0495595_0066412 3300053084 Bacteria 1698
582 Ga0495619_0029281 3300053085 Bacteria 3557
583 Ga0495619_0055647 3300053085 Bacteria 2621
584 Ga0495619_0091409 3300053085 Bacteria 2060
585 Ga0500578_0057229 3300053086 Bacteria 2493
586 Ga0500578_0093542 3300053086 Bacteria 1907
587 Ga0500578_0159211 3300053086 Bacteria 1402
588 Ga0500578_0219293 3300053086 Bacteria 1157
589 Ga0500643_000037 3300053087 Bacteria 180821
590 Ga0500647_0005929 3300053091 Bacteria 5127
591 Ga0500647_0126273 3300053091 Bacteria 1208
592 Ga0500583_0098271 3300053092 Bacteria 1431
593 Ga0500651_0000608 3300053093 Bacteria 17858
594 Ga0500651_0009054 3300053093 Bacteria 5893
595 Ga0500651_0134759 3300053093 Bacteria 1492
596 Ga0500566_0000077 3300053094 Bacteria 48099
597 Ga0500640_000014 3300053095 Bacteria 26024
598 Ga0500641_0006114 3300053096 Bacteria 4265
599 Ga0500641_0159187 3300053096 Bacteria 974
600 Ga0500555_002445 3300053103 Bacteria 5383
601 Ga0500556_0003377 3300053104 Bacteria 4709
602 Ga0500557_000014 3300053105 Bacteria 107928
603 Ga0500562_004561 3300053108 Bacteria 3498
604 Ga0500569_000568 3300053109 Bacteria 6227
605 Ga0500572_000824 3300053111 Bacteria 9766
606 Ga0500572_003621 3300053111 Bacteria 3515
607 Ga0500595_000146 3300053119 Bacteria 46362
608 Ga0500595_000902 3300053119 Bacteria 16940
609 Ga0500595_005728 3300053119 Bacteria 5380
610 Ga0500595_011412 3300053119 Bacteria 3481
611 Ga0500607_020601 3300053121 Bacteria 3721
612 Ga0500608_006842 3300053122 Bacteria 4673
613 Ga0500608_026102 3300053122 Bacteria 2740
614 Ga0500608_152843 3300053122 Bacteria 1010
615 Ga0500614_000797 3300053123 Bacteria 7978
616 Ga0500642_0000182 3300053130 Bacteria 25923
617 Ga0500642_0006294 3300053130 Bacteria 3895
618 Ga0500642_0011461 3300053130 Bacteria 3172
619 Ga0500658_0154010 3300053134 Bacteria 1037
620 Ga0500559_0002082 3300053136 Bacteria 10697
621 Ga0500559_0012957 3300053136 Bacteria 3537
622 Ga0500559_0074411 3300053136 Bacteria 1534
623 Ga0500564_037166 3300053138 Bacteria 2245
624 Ga0500573_0028490 3300053140 Bacteria 3216
625 Ga0500577_0086670 3300053142 Bacteria 1258
626 Ga0500588_0000943 3300053146 Bacteria 5161
627 Ga0500603_000150 3300053150 Bacteria 17014
628 Ga0500620_004388 3300053155 Bacteria 3147
629 Ga0500622_0011609 3300053156 Bacteria 4791
630 Ga0500627_0076655 3300053158 Bacteria 1487
631 Ga0500630_000158 3300053159 Bacteria 24806
632 Ga0500633_0031148 3300053160 Bacteria 1722
633 Ga0500638_064285 3300053162 Bacteria 1760
634 Ga0500638_185360 3300053162 Bacteria 894
635 Ga0500639_000171 3300053163 Bacteria 31550
636 Ga0500639_163764 3300053163 Bacteria 1007
637 Ga0500636_0000200 3300053177 Bacteria 32385
638 Ga0500637_0009526 3300053178 Bacteria 4949
639 Ga0500637_0127802 3300053178 Bacteria 1474
640 Ga0500570_107762 3300053724 Bacteria 1143
641 Ga0500611_024954 3300053727 Bacteria 1180
642 Ga0500625_024404 3300053729 Bacteria 2857
643 Ga0500645_030770 3300053730 Bacteria 1614
644 Ga0500609_001917 3300053731 Bacteria 3009
645 Ga0500599_000245 3300053736 Bacteria 5153
646 Ga0500601_001294 3300053737 Bacteria 2774
647 Ga0587073_0004612 3300059492 Bacteria 1993
648 Ga0587072_005414 3300059643 Bacteria 1905
649 Ga0466962_0033072 3300061719 Bacteria 2474
650 Ga0466962_0093706 3300061719 Bacteria 1440
651 2507510649 2507262055 Bacteria 8048963
652 2508544452 2508501009 Bacteria 7784016
653 2508697403 2508501042 Bacteria 8719808
654 2509152107 2508501128 Bacteria 8613869
655 2511393672 2511231028 Bacteria 8046582
656 2513627845 2513237092 Bacteria 8341956
657 2513640172 2513237094 Bacteria 8789602
658 2513650706 2513237095 Bacteria 8976980
659 2513702153 2513237102 Bacteria 7703324
660 2513715829 2513237104 Bacteria 10034502
661 2513877807 2513237139 Bacteria 8737671
662 2513888291 2513237141 Bacteria 8496279
663 2514014990 2513237161 Bacteria 8871253
664 2515628711 2515154112 Bacteria 8294334
665 2517106849 2517093001 Bacteria 9002274
666 2524437038 2524023205 Bacteria 8918781
667 2528856341 2528768022 Bacteria 10457665
668 2617352631 2617270735 Bacteria 9163226
669 2745076250 2744054633 Bacteria 8678936
670 2793063412 2791355196 Bacteria 7323613
671 2805917064 2802429603 Bacteria 8777136
672 2818242525 2816332527 Bacteria 8933356
673 2824601975 2824600985 Bacteria 8488197
674 2824615790 2824609381 Bacteria 8672835
675 2824620907 2824617872 Bacteria 8814715
676 2824628231 2824626560 Bacteria 8813858
677 2824636220 2824635225 Bacteria 8785348
678 2824649051 2824644064 Bacteria 8743947
679 2824653131 2824653114 Bacteria 8493680
680 2824662478 2824661429 Bacteria 9877870
681 2824675312 2824671348 Bacteria 8369588
682 2824681151 2824679649 Bacteria 8248951
683 2824691513 2824687955 Bacteria 8360029
684 2824702209 2824696289 Bacteria 8335049
685 2824705603 2824704595 Bacteria 9667483
686 2824718095 2824714736 Bacteria 8717648
687 2824728346 2824723954 Bacteria 8758240
688 2824756332 2824753945 Bacteria 9787441
689 2824764016 2824763712 Bacteria 9792355
690 2824780271 2824773399 Bacteria 8360218
691 2838125338 2838122688 Bacteria 8803140
692 2841942009 2841941048 Bacteria 8688029
693 2841951421 2841949485 Bacteria 8680857
694 2841958904 2841957949 Bacteria 8652217
695 2841968564 2841966195 Bacteria 8673214
696 2841976235 2841974524 Bacteria 8931498
697 2841987599 2841983080 Bacteria 8395090
698 2842043221 2842038055 Bacteria 8002051
699 2842051262 2842045827 Bacteria 8006841
700 2844317267 2844315083 Bacteria 8138177
701 2847933989 2847930680 Bacteria 9342022
702 2847944634 2847939898 Bacteria 8606328
703 2849081131 2849076700 Bacteria 7039503
704 2857516088 2857509624 Bacteria 7472071
705 2874595884 2874590934 Bacteria 8299676
706 2874612976 2874612657 Bacteria 8252029
707 2874625324 2874620515 Bacteria 8290088
708 2874634681 2874628541 Bacteria 8630250
709 2874649965 2874645413 Bacteria 8214782
710 2876761301 2876761206 Bacteria 10111113
711 2876775509 2876771140 Bacteria 8287509
712 2876826139 2876818435 Bacteria 8274608
713 2879079404 2879074833 Bacteria 8279565
714 2879089783 2879083081 Bacteria 8587928
715 2879109712 2879099564 Bacteria 10442239
716 2879132353 2879127579 Bacteria 8294491
717 2879144438 2879142872 Bacteria 8267021
718 2881365056 2881364244 Bacteria 7710352
719 2881667658 2881665667 Bacteria 8175609
720 2885367360 2885366525 Bacteria 8326213
721 2885417618 2885409591 Bacteria 9235467
722 2888381959 2888378607 Bacteria 9652610
723 2888388690 2888388044 Bacteria 7304136
724 2888422578 2888419890 Bacteria 7857137
725 2903733346 2903727486 Bacteria 8281579
726 2904668878 2904666416 Bacteria 8226587
727 2904720400 2904711408 Bacteria 9771557
728 2906607658 2906602504 Bacteria 8295279
729 2906630539 2906626472 Bacteria 8826946
730 2906648317 2906643746 Bacteria 8722424
731 2922371904
732 2922399375 2922393267 Bacteria 8285685
733 2929616746 2929615660 Bacteria 9193770
734 2929625490 2929624759 Bacteria 9339455
735 2932791231 2932784394 Bacteria 9704911
736 2932799280 2932794094 Bacteria 7915132
737 2932803725 2932801729 Bacteria 7987968
738 2932811586 2932809354 Bacteria 9135765
739 2932826497 2932818245 Bacteria 9955613
740 2932834157 2932828146 Bacteria 9745859
741 2933577971 2933577622 Bacteria 9116884
742 2935610616 2935608549 Bacteria 8203142
743 2935624019 2935616580 Bacteria 9032984
744 2935647065 2935638405 Bacteria 10015038
745 2935652388 2935648319 Bacteria 8801166
746 2935660970 2935656913 Bacteria 8965014
747 2935674243 2935665750 Bacteria 9571747
748 2935682447 2935675223 Bacteria 9928132
749 2935691662 2935684952 Bacteria 9590419
750 2935699536 2935694250 Bacteria 9291695
751 2935707765 2935703347 Bacteria 10242284
752 2935719496 2935713505 Bacteria 9608509
753 2935728904 2935722832 Bacteria 9608746
754 2935737855 2935732158 Bacteria 9706831
755 2935747231 2935741537 Bacteria 9707219
756 2935757969 2935750917 Bacteria 9590372
757 2935761758 2935760218 Bacteria 9817913
758 2935770597 2935769743 Bacteria 7878163
759 2935782832 2935777560 Bacteria 8077691
760 2935787118 2935785616 Bacteria 7962367
761 2935795166 2935793552 Bacteria 8012592
762 2935809512 2935801545 Bacteria 9301974
763 2935819066 2935810662 Bacteria 9401221
764 2935820113 2935819856 Bacteria 8261050
765 2935836332 2935827899 Bacteria 10038562
766 2935845243 2935837841 Bacteria 9454360
767 2935849876 2935847175 Bacteria 8228321
768 2935862131 2935855204 Bacteria 9035059
769 2935870942 2935864058 Bacteria 9784707
770 2935881335 2935873716 Bacteria 9632195
771 2935884397 2935883170 Bacteria 7964738
772 2935914436 2935908558 Bacteria 8568796
773 2935918986 2935916978 Bacteria 9113783
774 2935932183 2935926038 Bacteria 8601059
775 2935940781 2935934488 Bacteria 8602579
776 2935948632 2935942939 Bacteria 8599779
777 2935957261 2935951376 Bacteria 8602333
778 2935963689 2935959822 Bacteria 7869783
779 2935973767 2935967501 Bacteria 8603075
780 2935979631 2935975950 Bacteria 8347125
781 2935988994 2935984226 Bacteria 8302647
782 2936001050 2935992306 Bacteria 9802711
783 2936005491 2936002035 Bacteria 9362176
784 2936015026 2936011229 Bacteria 8801034
785 2936023172 2936019824 Bacteria 8804134
786 2936032375 2936028420 Bacteria 8965941
787 2936042022 2936037263 Bacteria 9446081
788 2936050236 2936046547 Bacteria 8903709
789 2936061056 2936055302 Bacteria 8785755
790 2940564120 2940556831 Bacteria 9590747
791 2941535103 2941531003 Bacteria 7653939
792 2941545570 2941538514 Bacteria 9402094
793 3005486274 3005483717 Bacteria 7877331
794 3005512053 3005506211 Bacteria 6943378
795 3005596970 3005594810 Bacteria 8716512
796 3005713004 3005710791 Bacteria 7622528
797 3005720417 3005718088 Bacteria 8283608
798 8006932321 8006926726 Bacteria 6749210
799 8016523330 8016522445 Bacteria 8156687
800 8016536825 8016530956 Bacteria 8155261
801 8016541099 8016539877 Bacteria 8155419
802 8016552156 8016548790 Bacteria 8155074
803 8016560532 8016557553 Bacteria 8154380
804 8016566484 8016566248 Bacteria 8158151
805 8016579234 8016575299 Bacteria 8154085
806 8016598431 8016595262 Bacteria 8149947
807 8016612700 8016603502 Bacteria 8731218
808 8016621124 8016613128 Bacteria 8794220
809 8016628887 8016622563 Bacteria 7999408
810 8016633426 8016630954 Bacteria 9217207
811 8017060726 8017057580 Bacteria 10023680
812 8019536524 8019530166 Bacteria 8155624
813 8019542933 8019538911 Bacteria 7872763
814 8019547810 8019547302 Bacteria 7996444
815 8019580246 8019576017 Bacteria 10049540
816 8019587962 8019586578 Bacteria 10212056
817 8019603370 8019597564 Bacteria 10041141
818 8019615165 8019608314 Bacteria 10042931
819 8019625966 8019619141 Bacteria 9218857
820 8019643112 8019638758 Bacteria 9062356
821 8019655937 8019648815 Bacteria 10014479
822 8019664299 8019659431 Bacteria 8577854
823 8019673884 8019668869 Bacteria 8791617
824 8019682228 8019678201 Bacteria 8863603
825 8019687930 8019687851 Bacteria 8712826
826 8055748392 8055742211 Bacteria 9226248
827 8056976180 8056967851 Bacteria 9038162
828 Ga0209758_1002267
829 JGI25165J46597_1014029
830 JGI25153J46596_10000161
831 JGI25153J46596_10000281
832 JGI25153J46596_10000977
833 JGI25153J46596_10028539
834 JGI25153J46596_10031775
835 rootH2_10037366
836 rootH1_10017149
837 rootH1_10227855
838 JGI25160J50197_1001545
839 JGI25160J50197_1014428
840 JGI25160J50197_1035300
841 JGI25161J50226_1009886
842 Ga0055531_10002042
843 Ga0065165_1000244
844 Ga0065165_1000368
845 Ga0065165_1002095
846 Ga0065165_1006546
847 Ga0070658_10181891
848 Ga0070683_100044265
849 Ga0070683_100090596
850 Ga0070680_100065456
851 Ga0070680_100182066
852 Ga0070691_10047553
853 Ga0070691_10057726
854 Ga0070668_100027400
855 Ga0070669_100009310
856 Ga0070671_100016245
857 Ga0070659_100274911
858 Ga0070709_10000876
859 Ga0070709_10016052
860 Ga0070709_10017442
861 Ga0070709_10024784
862 Ga0070709_10051571
863 Ga0070714_100003854
864 Ga0070714_100046908
865 Ga0070714_100521373
866 Ga0070713_100015180
867 Ga0070713_100032437
868 Ga0070713_100036433
869 Ga0070713_100078573
870 Ga0070713_100182842
871 Ga0070710_10001739
872 Ga0070710_10005371
873 Ga0070710_10061696
874 Ga0070711_100010949
875 Ga0070711_100018545
876 Ga0070711_100029254
877 Ga0070711_100076311
878 Ga0070711_100207290
879 Ga0070708_100060892
880 Ga0070663_100034153
881 Ga0070663_100036758
882 Ga0070663_100055860
883 Ga0070681_10004189
884 Ga0070681_10014364
885 Ga0070681_10040815
886 Ga0070681_10239647
887 Ga0070707_100038070
888 Ga0070707_100295512
889 Ga0070698_100089755
890 Ga0070679_100071108
891 Ga0070679_100077015
892 Ga0070684_100011228
893 Ga0070684_100037064
894 Ga0070697_100480559
895 Ga0068853_100156221
896 Ga0068853_100252498
897 Ga0070693_100067082
898 Ga0070665_100299989
899 Ga0068855_100035195
900 Ga0068855_100310229
901 Ga0068855_100456591
902 Ga0070664_100217240
903 Ga0070664_100500334
904 Ga0070664_100583482
905 Ga0068857_100048028
906 Ga0068857_100056565
907 Ga0068857_100226770
908 Ga0068857_100525056
909 Ga0068854_100170273
910 Ga0068852_100144309
911 Ga0068859_100760228
912 Ga0068864_100459209
913 Ga0068863_100208422
914 Ga0081455_10054923
915 Ga0081540_1040316
916 Ga0081540_1065844
917 Ga0070717_10000296
918 Ga0070717_10002073
919 Ga0070717_10054199
920 Ga0070717_10184553
921 Ga0075365_10007951
922 Ga0075365_10034785
923 Ga0075365_10151464
924 Ga0075365_10223806
925 Ga0075368_10003467
926 Ga0075363_100092369
927 Ga0075363_100101891
928 Ga0075364_10141115
929 Ga0070715_10002809
930 Ga0070715_10010420
931 Ga0070716_100024870
932 Ga0070716_100412975
933 Ga0070712_100002413
934 Ga0070712_100084813
935 Ga0075362_10065010
936 Ga0075367_10011773
937 Ga0075369_10017586
938 Ga0075369_10044798
939 Ga0075369_10055394
940 Ga0097621_100077348
941 Ga0097621_100510446
942 Ga0068871_100486372
943 Ga0075434_100016276
944 Ga0068865_100342886
945 Ga0097620_100760267
946 Ga0099824_1009964
947 Ga0105240_10005680
948 Ga0105240_10009106
949 Ga0105245_10300501
950 Ga0105247_10069894
951 Ga0105247_10076660
952 Ga0105243_10043445
953 Ga0105241_10029445
954 Ga0105241_10084127
955 Ga0105241_10425050
956 Ga0105248_10034075
957 Ga0105237_10001256
958 Ga0105237_10021725
959 Ga0105237_10108288
960 Ga0105237_10117219
961 Ga0105237_10309696
962 Ga0105238_10098194
963 Ga0105238_10321729
964 Ga0105238_10390320
965 Ga0105238_10617831
966 Ga0099796_10043577
967 Ga0105239_10003503
968 Ga0105239_10031910
969 Ga0105239_10408467
970 Ga0105239_10438011
971 Ga0105246_10011901
972 Ga0157370_10053791
973 Ga0157369_10002124
974 Ga0157369_10004766
975 Ga0157369_10199328
976 Ga0157374_10402186
977 Ga0163162_10066124
978 Ga0163162_10071272
979 Ga0163162_10160318
980 Ga0157372_10024319
981 Ga0157372_10140745
982 Ga0157372_10239559
983 Ga0157372_10521420
984 Ga0157375_10492878
985 Ga0157375_10772670
986 Ga0163163_10002879
987 Ga0163163_10011582
988 Ga0163163_10114500
989 Ga0157379_10054625
990 Ga0157376_10328082
991 Ga0182005_1045676
992 Ga0206350_10272083
993 Ga0206350_10659846
994 Ga0206350_10947626
995 Ga0213872_10020796
996 Ga0213871_10000551
997 Ga0224712_10020347
998 Ga0224712_10020470
999 Ga0224712_10034714
1000 Ga0209563_101077
1001 Ga0207425_1009962
1002 Ga0209677_103802
1003 Ga0209148_1000224
1004 Ga0209233_1006766
1005 Ga0209233_1010720
1006 Ga0209455_1007407
1007 Ga0209564_1003777
1008 Ga0209758_1000075
1009 Ga0209758_1000087
1010 Ga0209758_1000423
1011 Ga0209758_1002791
1012 Ga0209758_1005214
1013 Ga0209256_1006240
1014 Ga0207426_1000289
1015 Ga0207426_1000312
1016 Ga0207426_1009071
1017 Ga0207426_1009727
1018 Ga0209051_1033899
1019 Ga0209257_1000382
1020 Ga0209257_1032517
1021 Ga0207692_10001619
1022 Ga0207692_10004379
1023 Ga0207692_10033839
1024 Ga0207647_10004670
1025 Ga0207647_10056389
1026 Ga0207699_10012332
1027 Ga0207699_10014652
1028 Ga0207699_10033469
1029 Ga0207699_10084056
1030 Ga0207684_10069846
1031 Ga0207654_10077535
1032 Ga0207707_10000173
1033 Ga0207707_10001587
1034 Ga0207707_10024621
1035 Ga0207707_10031046
1036 Ga0207695_10000240
1037 Ga0207695_10118996
1038 Ga0207695_10574706
1039 Ga0207671_10003554
1040 Ga0207671_10153012
1041 Ga0207671_10167791
1042 Ga0207671_10194069
1043 Ga0207671_10249248
1044 Ga0207671_10285629
1045 Ga0207693_10000981
1046 Ga0207693_10001050
1047 Ga0207693_10083888
1048 Ga0207693_10124897
1049 Ga0207663_10000235
1050 Ga0207663_10005271
1051 Ga0207663_10052007
1052 Ga0207663_10176762
1053 Ga0207663_10218944
1054 Ga0207660_10037654
1055 Ga0207657_10040367
1056 Ga0207649_10355431
1057 Ga0207652_10117236
1058 Ga0207652_10738285
1059 Ga0207694_10154404
1060 Ga0207694_10190091
1061 Ga0207694_10491929
1062 Ga0207700_10012922
1063 Ga0207700_10024511
1064 Ga0207700_10027959
1065 Ga0207700_10157973
1066 Ga0207700_10208055
1067 Ga0207700_10422241
1068 Ga0207664_10023596
1069 Ga0207664_10163931
1070 Ga0207644_10199050
1071 Ga0207709_10182259
1072 Ga0207704_10193138
1073 Ga0207665_10000311
1074 Ga0207665_10012802
1075 Ga0207665_10289502
1076 Ga0207665_10321925
1077 Ga0207691_10415708
1078 Ga0207711_10038610
1079 Ga0207689_10262064
1080 Ga0207661_10002926
1081 Ga0207679_10574584
1082 Ga0207667_10036980
1083 Ga0207667_10192345
1084 Ga0207667_10320901
1085 Ga0207712_10455556
1086 Ga0207668_10103608
1087 Ga0207668_10180054
1088 Ga0207668_10259475
1089 Ga0207640_10112152
1090 Ga0207703_10135064
1091 Ga0207639_10047084
1092 Ga0207639_10282202
1093 Ga0207639_10304788
1094 Ga0207678_10008199
1095 Ga0207678_10047119
1096 Ga0207678_10063854
1097 Ga0207702_10541045
1098 Ga0207702_10674031
1099 Ga0207702_10744353
1100 Ga0207641_10127434
1101 Ga0207641_10252613
1102 Ga0207676_10129282
1103 Ga0207674_10015383
1104 Ga0207674_10059055
1105 Ga0207674_10231674
1106 Ga0207674_10512620
1107 Ga0207698_10012757
1108 Ga0209389_1000210
1109 Ga0209589_1001190
1110 Ga0209489_100192
1111 Ga0209489_113916
1112 Ga0209489_113918
1113 Ga0209700_100046
1114 Ga0209813_10043902
1115 Ga0268266_10025392
1116 Ga0268266_10160575
1117 Ga0265334_10009406
1118 Ga0265340_10052996
1119 Ga0265339_10006000
1120 Ga0307509_10180953
1121 Ga0307508_10029376
1122 Ga0307508_10227967
1123 Ga0307510_10033996
1124 Ga0307510_10038603
1125 Ga0373934_0010659
1126 Ga0373923_0074291
1127 Ga0373936_0010898
1128 Ga0373936_0065883
1129 Ga0373945_0050911
1130 Ga0373953_0002954
1131 Ga0373954_0030519
1132 Ga0373954_0085255
1133 Ga0373957_0045368
1134 Ga0373957_0084417
1135 Ga0373955_0013417
1136 Ga0373924_0003042
1137 Ga0373924_0010768
1138 Ga0373935_0001649
1139 Ga0373927_0000753
1140 Ga0373927_0029808
1141 Ga0373933_0000112
1142 Ga0373933_0030793
1143 Ga0373933_0097739
1144 Ga0373947_0002383
1145 Ga0373947_0063196
1146 Ga0373947_0170089
1147 Ga0373937_0118172
1148 Ga0372808_008063
1149 Ga0373925_0004124
1150 Ga0373925_0051434
1151 Ga0373925_0412226
1152 Ga0373925_0440280
1153 Ga0395899_0094378
1154 Ga0395900_0002290
1155 Ga0395900_0224423
1156 Ga0395898_0010726
1157 Ga0395898_0041055
1158 Ga0395898_0052153
1159 Ga0395898_0118304
1160 Ga0395905_0306784
1161 Ga0436364_0808523
1162 Ga0395901_0108706
1163 Ga0395901_0649751
1164 Ga0395901_0737722
1165 Ga0436365_0090965
1166 Ga0436365_0261949
1167 Ga0436365_1005930
1168 Ga0436360_0150999
1169 Ga0436360_0685625
1170 Ga0436361_0170114
1171 Ga0436361_0620447
1172 Ga0436362_0483804
1173 Ga0451793_1635304
1174 Ga0451795_1671663
1175 Ga0451804_1161461
1176 Ga0451853_3948067
1177 Ga0466972_0006609
1178 Ga0466965_0079953
1179 Ga0466966_0001893
1180 Ga0466961_0000016
1181 Ga0466961_0133952
1182 Ga0466961_0160547
1183 Ga0466963_0004088
1184 Ga0466968_0024605
1185 Ga0466970_0088053
1186 Ga0466960_0093792
1187 Ga0466959_0011853
1188 Ga0466967_0053030
1189 Ga0466967_0197098
1190 Ga0466967_0198739
1191 Ga0495592_0039590
1192 Ga0495592_0057241
1193 Ga0495603_0003032
1194 Ga0495603_0011547
1195 Ga0495603_0116389
1196 Ga0495629_0000550
1197 Ga0495629_0038165
1198 Ga0495629_0152487
1199 Ga0495638_0002916
1200 Ga0495641_0014999
1201 Ga0495651_0001898
1202 Ga0495580_0036549
1203 Ga0495580_0077330
1204 Ga0495582_0000181
1205 Ga0495639_0000191
1206 Ga0495639_0051992
1207 Ga0495662_0004915
1208 Ga0495662_0032494
1209 Ga0495664_0002406
1210 Ga0495664_0011680
1211 Ga0495664_0148165
1212 Ga0495594_0001141
1213 Ga0495607_0191699
1214 Ga0495583_0106802
1215 Ga0495606_0010980
1216 Ga0495606_0119608
1217 Ga0495608_0016858
1218 Ga0495608_0023421
1219 Ga0495608_0189936
1220 Ga0495616_0074762
1221 Ga0495618_0017157
1222 Ga0495628_0036605
1223 Ga0495628_0043212
1224 Ga0495628_0340028
1225 Ga0495630_0158533
1226 Ga0495631_0061756
1227 Ga0495643_0004498
1228 Ga0495648_0020446
1229 Ga0495648_0029504
1230 Ga0495648_0074868
1231 Ga0495648_0086424
1232 Ga0495666_0153953
1233 Ga0495666_0155945
1234 Ga0495652_0005031
1235 Ga0495652_0040701
1236 Ga0495652_0162194
1237 Ga0495665_0111446
1238 Ga0495640_0005950
1239 Ga0495640_0012054
1240 Ga0495586_0095043
1241 Ga0495587_0028830
1242 Ga0495587_0033109
1243 Ga0495587_0063873
1244 Ga0495609_0076405
1245 Ga0495597_0024074
1246 Ga0495645_0004606
1247 Ga0495645_0043303
1248 Ga0495645_0175585
1249 Ga0495622_0028860
1250 Ga0495622_0061202
1251 Ga0495667_0068046
1252 Ga0495667_0088014
1253 Ga0495668_0041526
1254 Ga0495634_0002572
1255 Ga0495634_0026215
1256 Ga0495611_0093773
1257 Ga0495625_0136176
1258 Ga0495635_0002368
1259 Ga0495635_0098845
1260 Ga0495635_0101515
1261 Ga0495635_0143465
1262 Ga0495661_0047580
1263 Ga0495661_0251891
1264 Ga0495588_0015203
1265 Ga0495588_0018636
1266 Ga0495588_0100774
1267 Ga0495657_0012055
1268 Ga0495657_0012763
1269 Ga0495657_0016514
1270 Ga0495599_0021739
1271 Ga0495599_0035948
1272 Ga0495623_0010395
1273 Ga0495623_0073046
1274 Ga0495646_0020307
1275 Ga0495646_0040216
1276 Ga0495646_0041538
1277 Ga0495647_0001489
1278 Ga0495658_0004478
1279 Ga0495658_0005644
1280 Ga0495658_0327918
1281 Ga0495613_0033214
1282 Ga0495624_0008267
1283 Ga0495624_0016611
1284 Ga0495624_0095851
1285 Ga0495649_0039286
1286 Ga0495649_0105353
1287 Ga0495649_0231267
1288 Ga0495600_0001909
1289 Ga0495600_0016056
1290 Ga0495600_0026187
1291 Ga0495581_0006884
1292 Ga0495604_0001045
1293 Ga0495604_0041580
1294 Ga0495674_0009655
1295 Ga0495674_0020915
1296 Ga0495674_0023288
1297 Ga0495672_0020577
1298 Ga0495672_0027534
1299 Ga0495672_0213828
1300 Ga0495676_0091859
1301 Ga0495680_0001894
1302 Ga0495680_0090412
1303 Ga0495687_002613
1304 Ga0495675_0002556
1305 Ga0495675_0005940
1306 Ga0495673_0016740
1307 Ga0495673_0124494
1308 Ga0495684_0013759
1309 Ga0495684_0036959
1310 Ga0495684_0053511
1311 Ga0495684_0315994
1312 Ga0495686_0084011
1313 Ga0495686_0129118
1314 Ga0495593_0003024
1315 Ga0495593_0058056
1316 Ga0495602_0011822
1317 Ga0495602_0073702
1318 Ga0495602_0196465
1319 Ga0495614_0168258
1320 Ga0496100_0188900
1321 Ga0496101_0125488
1322 Ga0496101_0162412
1323 Ga0496101_0250572
1324 Ga0496102_0009673
1325 Ga0496102_0022705
1326 Ga0496102_0593052
1327 Ga0496103_0103458
1328 Ga0496103_0139231
1329 Ga0496104_0004880
1330 Ga0496104_0034830
1331 Ga0496104_0062970
1332 Ga0496105_0016620
1333 Ga0496105_0176786
1334 Ga0496105_0304391
1335 Ga0496106_0007337
1336 Ga0496106_0144944
1337 Ga0496106_0149704
1338 Ga0496106_0531855
1339 Ga0496107_0054859
1340 Ga0496107_0233993
1341 Ga0496108_0004880
1342 Ga0496108_0009704
1343 Ga0496109_0024526
1344 Ga0496110_0011659
1345 Ga0496110_0058380
1346 Ga0496110_0214557
1347 Ga0496111_0016574
1348 Ga0496111_0028793
1349 Ga0496113_0115616
1350 Ga0496113_0229706
1351 Ga0496114_0084338
1352 Ga0496115_0020385
1353 Ga0496115_0165852
1354 Ga0496116_0037121
1355 Ga0496117_0147040
1356 Ga0496117_0195055
1357 Ga0496118_0005327
1358 Ga0496118_0035956
1359 Ga0496118_0081283
1360 Ga0496118_0140577
1361 Ga0496119_0012747
1362 Ga0496119_0042621
1363 Ga0496119_0136864
1364 Ga0496120_0004629
1365 Ga0496120_0193895
1366 Ga0496121_0003676
1367 Ga0496121_0006831
1368 Ga0496121_0035195
1369 Ga0496121_0040406
1370 Ga0496122_0200906
1371 Ga0496124_0001147
1372 Ga0496124_0059591
1373 Ga0496125_0084480
1374 Ga0496126_0012042
1375 Ga0496126_0032797
1376 Ga0496126_0036049
1377 Ga0496126_0049899
1378 Ga0496126_0095838
1379 Ga0496126_0099158
1380 Ga0496126_0214026
1381 Ga0496126_0366934
1382 Ga0495682_0045658
1383 Ga0501036_0037033
1384 Ga0501038_0073801
1385 Ga0501043_0043670
1386 Ga0501046_0046826
1387 Ga0501047_0036800
1388 Ga0501047_0056285
1389 Ga0501070_0050051
1390 Ga0501080_0025198
1391 Ga0501044_0033833
1392 Ga0501044_0050907
1393 nmdc:mga03683_81113_c1
1394 nmdc:mga03n38_15339_c1
1395 nmdc:mga03n38_64638_c1
1396 nmdc:mga0yw44_1895_c1
1397 nmdc:mga0k408_128276_c1
1398 nmdc:mga0k408_35058_c1
1399 nmdc:mga04h51_46276_c1
1400 nmdc:mga07m45_47461_c1
1401 nmdc:mga0n895_3623_c1
1402 nmdc:mga0sz30_89304_c1
1403 nmdc:mga0sz30_93453_c1
1404 Ga0495601_0023417
1405 Ga0495601_0056257
1406 Ga0500610_0016251
1407 Ga0495595_0031845
1408 Ga0495595_0066412
1409 Ga0495619_0029281
1410 Ga0495619_0055647
1411 Ga0495619_0091409
1412 Ga0500578_0057229
1413 Ga0500578_0093542
1414 Ga0500578_0159211
1415 Ga0500578_0219293
1416 Ga0500643_000037
1417 Ga0500647_0005929
1418 Ga0500647_0126273
1419 Ga0500583_0098271
1420 Ga0500651_0000608
1421 Ga0500651_0009054
1422 Ga0500651_0134759
1423 Ga0500566_0000077
1424 Ga0500640_000014
1425 Ga0500641_0006114
1426 Ga0500641_0159187
1427 Ga0500555_002445
1428 Ga0500556_0003377
1429 Ga0500557_000014
1430 Ga0500562_004561
1431 Ga0500569_000568
1432 Ga0500572_000824
1433 Ga0500572_003621
1434 Ga0500595_000146
1435 Ga0500595_000902
1436 Ga0500595_005728
1437 Ga0500595_011412
1438 Ga0500607_020601
1439 Ga0500608_006842
1440 Ga0500608_026102
1441 Ga0500608_152843
1442 Ga0500614_000797
1443 Ga0500642_0000182
1444 Ga0500642_0006294
1445 Ga0500642_0011461
1446 Ga0500658_0154010
1447 Ga0500559_0002082
1448 Ga0500559_0012957
1449 Ga0500559_0074411
1450 Ga0500564_037166
1451 Ga0500573_0028490
1452 Ga0500577_0086670
1453 Ga0500588_0000943
1454 Ga0500603_000150
1455 Ga0500620_004388
1456 Ga0500622_0011609
1457 Ga0500627_0076655
1458 Ga0500630_000158
1459 Ga0500633_0031148
1460 Ga0500638_064285
1461 Ga0500638_185360
1462 Ga0500639_000171
1463 Ga0500639_163764
1464 Ga0500636_0000200
1465 Ga0500637_0009526
1466 Ga0500637_0127802
1467 Ga0500570_107762
1468 Ga0500611_024954
1469 Ga0500625_024404
1470 Ga0500645_030770
1471 Ga0500609_001917
1472 Ga0500599_000245
1473 Ga0500601_001294
1474 Ga0587073_0004612
1475 Ga0587072_005414
1476 Ga0466962_0033072
1477 Ga0466962_0093706
1478 2507510649
1479 2508544452
1480 2508697403
1481 2509152107
1482 2511393672
1483 2513627845
1484 2513640172
1485 2513650706
1486 2513702153
1487 2513715829
1488 2513877807
1489 2513888291
1490 2514014990
1491 2515628711
1492 2517106849
1493 2524437038
1494 2528856341
1495 2617352631
1496 2745076250
1497 2793063412
1498 2805917064
1499 2818242525
1500 2824601975
1501 2824615790
1502 2824620907
1503 2824628231
1504 2824636220
1505 2824649051
1506 2824653131
1507 2824662478
1508 2824675312
1509 2824681151
1510 2824691513
1511 2824702209
1512 2824705603
1513 2824718095
1514 2824728346
1515 2824756332
1516 2824764016
1517 2824780271
1518 2838125338
1519 2841942009
1520 2841951421
1521 2841958904
1522 2841968564
1523 2841976235
1524 2841987599
1525 2842043221
1526 2842051262
1527 2844317267
1528 2847933989
1529 2847944634
1530 2849081131
1531 2857516088
1532 2874595884
1533 2874612976
1534 2874625324
1535 2874634681
1536 2874649965
1537 2876761301
1538 2876775509
1539 2876826139
1540 2879079404
1541 2879089783
1542 2879109712
1543 2879132353
1544 2879144438
1545 2881365056
1546 2881667658
1547 2885367360
1548 2885417618
1549 2888381959
1550 2888388690
1551 2888422578
1552 2903733346
1553 2904668878
1554 2904720400
1555 2906607658
1556 2906630539
1557 2906648317
1558 2922371904
1559 2922399375
1560 2929616746
1561 2929625490
1562 2932791231
1563 2932799280
1564 2932803725
1565 2932811586
1566 2932826497
1567 2932834157
1568 2933577971
1569 2935610616
1570 2935624019
1571 2935647065
1572 2935652388
1573 2935660970
1574 2935674243
1575 2935682447
1576 2935691662
1577 2935699536
1578 2935707765
1579 2935719496
1580 2935728904
1581 2935737855
1582 2935747231
1583 2935757969
1584 2935761758
1585 2935770597
1586 2935782832
1587 2935787118
1588 2935795166
1589 2935809512
1590 2935819066
1591 2935820113
1592 2935836332
1593 2935845243
1594 2935849876
1595 2935862131
1596 2935870942
1597 2935881335
1598 2935884397
1599 2935914436
1600 2935918986
1601 2935932183
1602 2935940781
1603 2935948632
1604 2935957261
1605 2935963689
1606 2935973767
1607 2935979631
1608 2935988994
1609 2936001050
1610 2936005491
1611 2936015026
1612 2936023172
1613 2936032375
1614 2936042022
1615 2936050236
1616 2936061056
1617 2940564120
1618 2941535103
1619 2941545570
1620 3005486274
1621 3005512053
1622 3005596970
1623 3005713004
1624 3005720417
1625 8006932321
1626 8016523330
1627 8016536825
1628 8016541099
1629 8016552156
1630 8016560532
1631 8016566484
1632 8016579234
1633 8016598431
1634 8016612700
1635 8016621124
1636 8016628887
1637 8016633426
1638 8017060726
1639 8019536524
1640 8019542933
1641 8019547810
1642 8019580246
1643 8019587962
1644 8019603370
1645 8019615165
1646 8019625966
1647 8019643112
1648 8019655937
1649 8019664299
1650 8019673884
1651 8019682228
1652 8019687930
1653 8055748392
1654 8056976180

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03403

PAF-AH_p_II

Platelet-activating factor acetylhydrolase, isoform II

19

112

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o2g-assembly1.cif.gz_B crystal structure determination from picosecond infrared laser ablated protein crystals by serial synchrotron crystallography 0.7804 29 181
6qi1-assembly1.cif.gz_B time resolved structural analysis of the full turnover of an enzyme - 12312 ms 0.7777 29 178
5k3b-assembly1.cif.gz_B crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/chloroacetate - cocrystallized 0.7756 29 179
5k3e-assembly1.cif.gz_B crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/glycolate - cocrystallized 0.7755 29 179
3afi-assembly2.cif.gz_B crystal structure of dbja (his-dbja) 0.7755 30 183
ID Description Score Start End Superfamily
3oc4B03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.7873 27 54 3.30.390.30
af_O53622_2_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7797 32 183 3.40.50.1820
af_Q2FY80_39_164_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7778 27 50 3.30.450.20
af_Q8NFV4_60_314_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7767 64 179 3.40.50.1820
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7647 28 188 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A354V041-F1-model_v4 Alpha/beta hydrolase 0.9732 1 225 GO:0016787
AF-A0A0W1AKH5-F1-model_v4 Polysaccharide deacetylase 0.9656 26 254 GO:0005975
GO:0016020
GO:0016810
AF-A0A354V041-F1-model_v4 Alpha/beta hydrolase 0.9648 1 225 GO:0016787
AF-A0A7K1T9F3-F1-model_v4 Alpha/beta hydrolase 0.9619 27 253 GO:0003847
GO:0016042
AF-A0A4Z0QIA5-F1-model_v4 Alpha/beta hydrolase 0.9605 26 253 GO:0016787

Map