F482485

General Info

Members Datasets Scaffolds Average Seq Length
826 363 1652 229

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0058528|Ga0495603_0058528_73_882
Length 269
Sequence VTRVLVVDDEPQILRALRINLRVRGYEVDTAATGGQALETAGHHPPDLVILDLGLPDLDGVEVIGGLRGWTSAPIIVLSGRADSTDKVQALDAGADDYVTKPFGMDELLARMRAAARRAAPAEETPQVRLGGLVVDLAAKRVIRPDGPDIRLTPTEWHLLEVLLRHPGKLMSQRQLLAEVWGPGYADATGNLRLYMTQLRRKLEPDPARPRWLLTEPGMGYRYQPDEDEHPDRAPLPASGEGQPPGEPARRVLAQRPGARSGNARPRKR

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
149 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
150 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
151 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
208 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
209 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
339 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
340 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
341 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
342 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
343 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
344 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
345 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
346 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
347 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
348 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
349 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
350 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
351 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
352 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
353 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
354 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
355 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
356 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
357 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
358 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
359 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
360 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
361 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
362 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
363 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0.73
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0.12
Rhizoplane 5.45
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0058528 3300046455 Bacteria 2278
2 JGI25406J46586_10031930 3300003203 Bacteria 1963
3 Ga0065714_10114558 3300005288 Bacteria 1427
4 Ga0070658_10000219 3300005327 Bacteria 50822
5 Ga0070658_10002124 3300005327 Bacteria 16641
6 Ga0070658_10037290 3300005327 Bacteria 3918
7 Ga0070683_100274637 3300005329 Bacteria 1603
8 Ga0070683_100599882 3300005329 Bacteria 1054
9 Ga0068869_100032036 3300005334 Bacteria 3702
10 Ga0070680_100000598 3300005336 Bacteria 24918
11 Ga0070680_100007320 3300005336 Bacteria 8417
12 Ga0070682_100004505 3300005337 Bacteria 7737
13 Ga0070682_100216611 3300005337 Bacteria 1360
14 Ga0070682_100347231 3300005337 Bacteria 1105
15 Ga0070660_100261879 3300005339 Bacteria 1412
16 Ga0070691_10045595 3300005341 Bacteria 2081
17 Ga0070687_100272721 3300005343 Unclassified 1061
18 Ga0070671_100023347 3300005355 Bacteria 5061
19 Ga0070674_100247803 3300005356 Bacteria 1398
20 Ga0070659_100020279 3300005366 Bacteria 5048
21 Ga0070667_100380145 3300005367 Bacteria 1283
22 Ga0070709_10000220 3300005434 Bacteria 37035
23 Ga0070709_10291902 3300005434 Bacteria 1188
24 Ga0070714_100002227 3300005435 Bacteria 14286
25 Ga0070714_100010578 3300005435 Bacteria 7297
26 Ga0070713_100001605 3300005436 Bacteria 14475
27 Ga0070713_100009389 3300005436 Bacteria 6999
28 Ga0070713_100018255 3300005436 Bacteria 5331
29 Ga0070713_100425008 3300005436 Bacteria 1244
30 Ga0070713_100438087 3300005436 Bacteria 1226
31 Ga0070710_10000042 3300005437 Bacteria 58499
32 Ga0070710_10000122 3300005437 Bacteria 36506
33 Ga0070710_10000939 3300005437 Bacteria 13853
34 Ga0070711_100003406 3300005439 Bacteria 9264
35 Ga0070711_100189566 3300005439 Bacteria 1579
36 Ga0070711_100243039 3300005439 Bacteria 1408
37 Ga0070705_100012329 3300005440 Bacteria 4343
38 Ga0070705_100138038 3300005440 Bacteria 1601
39 Ga0070700_100027103 3300005441 Bacteria 3394
40 Ga0070694_100131188 3300005444 Bacteria 1810
41 Ga0070708_100007036 3300005445 Bacteria 8972
42 Ga0070708_100092983 3300005445 Bacteria 2748
43 Ga0070708_100220048 3300005445 Bacteria 1780
44 Ga0070708_100377573 3300005445 Bacteria 1336
45 Ga0070678_100037865 3300005456 Bacteria 3391
46 Ga0070678_100208595 3300005456 Unclassified 1617
47 Ga0070681_10001670 3300005458 Bacteria 19802
48 Ga0070681_10046871 3300005458 Bacteria 4320
49 Ga0070681_10344148 3300005458 Bacteria 1401
50 Ga0068867_100147655 3300005459 Bacteria 1844
51 Ga0070706_100000817 3300005467 Bacteria 34479
52 Ga0070706_100001339 3300005467 Bacteria 26189
53 Ga0070706_100004736 3300005467 Bacteria 13044
54 Ga0070706_100025486 3300005467 Bacteria 5443
55 Ga0070706_100097621 3300005467 Bacteria 2729
56 Ga0070706_100289506 3300005467 Bacteria 1528
57 Ga0070706_100446853 3300005467 Bacteria 1203
58 Ga0070707_100002030 3300005468 Bacteria 19371
59 Ga0070707_100077511 3300005468 Bacteria 3207
60 Ga0070707_100107132 3300005468 Bacteria 2711
61 Ga0070707_100144166 3300005468 Bacteria 2318
62 Ga0070698_100000546 3300005471 Bacteria 40175
63 Ga0070698_100003558 3300005471 Bacteria 17114
64 Ga0070698_100007991 3300005471 Bacteria 11438
65 Ga0070698_100011156 3300005471 Bacteria 9547
66 Ga0070698_100028866 3300005471 Bacteria 5758
67 Ga0070698_100073875 3300005471 Bacteria 3415
68 Ga0070698_100347336 3300005471 Bacteria 1415
69 Ga0070699_100110625 3300005518 Bacteria 2412
70 Ga0070679_100012273 3300005530 Bacteria 8186
71 Ga0070679_100012308 3300005530 Bacteria 8172
72 Ga0070679_100437218 3300005530 Bacteria 1253
73 Ga0070684_100271854 3300005535 Bacteria 1551
74 Ga0070684_100283774 3300005535 Unclassified 1517
75 Ga0070697_100062917 3300005536 Bacteria 3030
76 Ga0070697_100065191 3300005536 Bacteria 2976
77 Ga0068853_100008671 3300005539 Bacteria 8176
78 Ga0070695_100033931 3300005545 Bacteria 3195
79 Ga0070696_100003133 3300005546 Bacteria 11012
80 Ga0070696_100664983 3300005546 Bacteria 846
81 Ga0070693_100002640 3300005547 Bacteria 8255
82 Ga0070693_100415291 3300005547 Bacteria 936
83 Ga0068855_100243003 3300005563 Bacteria 2011
84 Ga0070664_100218215 3300005564 Bacteria 1706
85 Ga0070664_100682504 3300005564 Bacteria 956
86 Ga0068857_100015977 3300005577 Bacteria 6576
87 Ga0068857_100065726 3300005577 Bacteria 3226
88 Ga0070702_100021040 3300005615 Bacteria 3427
89 Ga0070702_100169464 3300005615 Bacteria 1419
90 Ga0068864_100180433 3300005618 Bacteria 1930
91 Ga0068861_100235527 3300005719 Bacteria 1555
92 Ga0068861_100371229 3300005719 Bacteria 1261
93 Ga0068870_10339339 3300005840 Bacteria 960
94 Ga0068858_100059003 3300005842 Bacteria 3547
95 Ga0068860_100100242 3300005843 Bacteria 2763
96 Ga0081455_10000107 3300005937 Bacteria 93186
97 Ga0081455_10026019 3300005937 Bacteria 5390
98 Ga0081455_10029678 3300005937 Bacteria 4982
99 Ga0081455_10086575 3300005937 Bacteria 2552
100 Ga0081455_10139078 3300005937 Bacteria 1888
101 Ga0081455_10229864 3300005937 Bacteria 1369
102 Ga0081540_1000095 3300005983 Bacteria 92795
103 Ga0081540_1001613 3300005983 Bacteria 19226
104 Ga0081539_10000405 3300005985 Bacteria 92270
105 Ga0070717_10011462 3300006028 Bacteria 6734
106 Ga0070717_10093181 3300006028 Bacteria 2546
107 Ga0070717_10784646 3300006028 Bacteria 866
108 Ga0075365_10050673 3300006038 Bacteria 2739
109 Ga0075365_10560831 3300006038 Bacteria 808
110 Ga0075368_10026485 3300006042 Bacteria 2230
111 Ga0075363_100026463 3300006048 Bacteria 2968
112 Ga0075363_100059861 3300006048 Bacteria 2049
113 Ga0075363_100138956 3300006048 Bacteria 1367
114 Ga0075364_10030085 3300006051 Bacteria 3484
115 Ga0075364_10036174 3300006051 Bacteria 3192
116 Ga0070715_10023800 3300006163 Bacteria 2404
117 Ga0070715_10028333 3300006163 Bacteria 2245
118 Ga0070715_10202908 3300006163 Bacteria 1008
119 Ga0070716_100002596 3300006173 Bacteria 8344
120 Ga0070716_100144009 3300006173 Bacteria 1524
121 Ga0070712_100002114 3300006175 Bacteria 12210
122 Ga0070712_100039382 3300006175 Bacteria 3234
123 Ga0070712_100149391 3300006175 Bacteria 1792
124 Ga0070712_100366355 3300006175 Bacteria 1183
125 Ga0075362_10015049 3300006177 Bacteria 3138
126 Ga0075367_10007069 3300006178 Bacteria 5721
127 Ga0075367_10017056 3300006178 Bacteria 3978
128 Ga0097621_100075623 3300006237 Bacteria 2792
129 Ga0097621_100733539 3300006237 Bacteria 911
130 Ga0068871_100163066 3300006358 Bacteria 1907
131 Ga0075428_100003999 3300006844 Bacteria 16185
132 Ga0075428_100919129 3300006844 Bacteria 928
133 Ga0075430_100001640 3300006846 Bacteria 18293
134 Ga0075431_100034551 3300006847 Bacteria 5208
135 Ga0075431_100037160 3300006847 Bacteria 5019
136 Ga0075431_100644360 3300006847 Bacteria 1040
137 Ga0075433_10045253 3300006852 Bacteria 3826
138 Ga0075434_100007088 3300006871 Bacteria 10352
139 Ga0075434_100010616 3300006871 Bacteria 8641
140 Ga0075434_100013021 3300006871 Bacteria 7899
141 Ga0075429_100000660 3300006880 Bacteria 26633
142 Ga0075429_100004902 3300006880 Bacteria 11530
143 Ga0075429_100058247 3300006880 Bacteria 3364
144 Ga0068865_100008386 3300006881 Bacteria 6386
145 Ga0075436_100170075 3300006914 Bacteria 1539
146 Ga0075436_100296207 3300006914 Bacteria 1159
147 Ga0075435_100010863 3300007076 Bacteria 6669
148 Ga0105244_10141717 3300009036 Bacteria 1156
149 Ga0105240_10281576 3300009093 Bacteria 1910
150 Ga0111539_10003516 3300009094 Bacteria 20665
151 Ga0111539_10033353 3300009094 Bacteria 6250
152 Ga0111539_10403670 3300009094 Bacteria 1592
153 Ga0105245_10115987 3300009098 Bacteria 2497
154 Ga0105247_10036225 3300009101 Bacteria 3008
155 Ga0105247_10545877 3300009101 Unclassified 851
156 Ga0114129_10004780 3300009147 Bacteria 19142
157 Ga0114129_10006566 3300009147 Bacteria 16509
158 Ga0114129_10149868 3300009147 Bacteria 3192
159 Ga0114129_10186076 3300009147 Bacteria 2822
160 Ga0114129_10248108 3300009147 Bacteria 2391
161 Ga0114129_10578249 3300009147 Bacteria 1458
162 Ga0105243_10009365 3300009148 Bacteria 7464
163 Ga0105248_10361366 3300009177 Bacteria 1634
164 Ga0105248_10572037 3300009177 Bacteria 1275
165 Ga0105248_10836336 3300009177 Bacteria 1039
166 Ga0105237_10016176 3300009545 Bacteria 7759
167 Ga0105238_10042741 3300009551 Bacteria 4588
168 Ga0105249_10961047 3300009553 Bacteria 922
169 Ga0105239_10045939 3300010375 Bacteria 4786
170 Ga0105246_10021145 3300011119 Bacteria 4183
171 Ga0105246_10049942 3300011119 Bacteria 2867
172 Ga0105246_10089623 3300011119 Bacteria 2213
173 Ga0105246_10097333 3300011119 Bacteria 2135
174 Ga0157325_1000680 3300012485 Bacteria 1401
175 Ga0157373_10090102 3300013100 Bacteria 2160
176 Ga0157373_10224828 3300013100 Bacteria 1325
177 Ga0157371_10324112 3300013102 Bacteria 1118
178 Ga0157369_10048952 3300013105 Bacteria 4584
179 Ga0157369_10166016 3300013105 Bacteria 2328
180 Ga0157369_10796700 3300013105 Bacteria 971
181 Ga0163162_10945825 3300013306 Bacteria 973
182 Ga0157375_10011834 3300013308 Bacteria 7715
183 Ga0157375_10229033 3300013308 Bacteria 2017
184 Ga0157380_10081900 3300014326 Bacteria 2641
185 Ga0157380_10404547 3300014326 Unclassified 1296
186 Ga0157379_10039501 3300014968 Bacteria 4210
187 Ga0157376_10044467 3300014969 Bacteria 3651
188 Ga0157376_10227790 3300014969 Bacteria 1730
189 Ga0182005_1026945 3300015265 Bacteria 1568
190 Ga0197907_10955139 3300020069 Bacteria 2611
191 Ga0206356_11336389 3300020070 Bacteria 3044
192 Ga0206351_10371423 3300020077 Bacteria 1434
193 Ga0206353_10711485 3300020082 Bacteria 15955
194 Ga0206353_11700971 3300020082 Bacteria 2073
195 Ga0213873_10019275 3300021358 Bacteria 1581
196 Ga0213876_10001614 3300021384 Bacteria 13824
197 Ga0213876_10032465 3300021384 Bacteria 2754
198 Ga0213875_10000279 3300021388 Bacteria 50175
199 Ga0213875_10000363 3300021388 Bacteria 42235
200 Ga0213875_10007355 3300021388 Bacteria 5693
201 Ga0213875_10008272 3300021388 Bacteria 5336
202 Ga0213875_10013828 3300021388 Bacteria 3952
203 Ga0213875_10106593 3300021388 Bacteria 1308
204 Ga0224712_10030107 3300022467 Bacteria 1956
205 Ga0228598_1021335 3300024227 Bacteria 1275
206 Ga0207697_10049746 3300025315 Bacteria 1730
207 Ga0207655_1009968 3300025728 Bacteria 5829
208 Ga0207692_10000172 3300025898 Bacteria 20623
209 Ga0207692_10000192 3300025898 Bacteria 20115
210 Ga0207692_10098942 3300025898 Bacteria 1597
211 Ga0207647_10011318 3300025904 Bacteria 6262
212 Ga0207685_10008530 3300025905 Bacteria 2925
213 Ga0207685_10023176 3300025905 Bacteria 2110
214 Ga0207699_10001218 3300025906 Bacteria 12202
215 Ga0207699_10019655 3300025906 Bacteria 3607
216 Ga0207699_10040782 3300025906 Bacteria 2677
217 Ga0207699_10518036 3300025906 Bacteria 862
218 Ga0207705_10094807 3300025909 Bacteria 2189
219 Ga0207705_10122818 3300025909 Bacteria 1928
220 Ga0207684_10015452 3300025910 Bacteria 6568
221 Ga0207684_10043013 3300025910 Bacteria 3829
222 Ga0207684_10044698 3300025910 Bacteria 3756
223 Ga0207684_10053168 3300025910 Bacteria 3438
224 Ga0207684_10182786 3300025910 Bacteria 1808
225 Ga0207684_10244433 3300025910 Bacteria 1548
226 Ga0207654_10221898 3300025911 Unclassified 1254
227 Ga0207707_10000513 3300025912 Bacteria 39738
228 Ga0207707_10101159 3300025912 Bacteria 2519
229 Ga0207695_10054675 3300025913 Bacteria 4166
230 Ga0207671_10043373 3300025914 Bacteria 3326
231 Ga0207671_10132640 3300025914 Bacteria 1913
232 Ga0207693_10001433 3300025915 Bacteria 21142
233 Ga0207693_10058519 3300025915 Bacteria 3019
234 Ga0207693_10284367 3300025915 Bacteria 1296
235 Ga0207663_10002117 3300025916 Bacteria 9467
236 Ga0207663_10007354 3300025916 Bacteria 5706
237 Ga0207663_10024463 3300025916 Bacteria 3478
238 Ga0207660_10006015 3300025917 Bacteria 7876
239 Ga0207660_10157628 3300025917 Bacteria 1749
240 Ga0207657_10157574 3300025919 Bacteria 1846
241 Ga0207657_10248455 3300025919 Bacteria 1419
242 Ga0207649_10352789 3300025920 Bacteria 1089
243 Ga0207652_10003086 3300025921 Bacteria 13899
244 Ga0207652_10011409 3300025921 Bacteria 7164
245 Ga0207652_10696162 3300025921 Bacteria 907
246 Ga0207646_10000050 3300025922 Bacteria 171554
247 Ga0207646_10032395 3300025922 Bacteria 4731
248 Ga0207646_10044414 3300025922 Bacteria 3989
249 Ga0207646_10048483 3300025922 Bacteria 3808
250 Ga0207646_10220171 3300025922 Bacteria 1715
251 Ga0207687_10104558 3300025927 Bacteria 2090
252 Ga0207687_10160845 3300025927 Bacteria 1723
253 Ga0207700_10000619 3300025928 Bacteria 20729
254 Ga0207700_10075360 3300025928 Bacteria 2614
255 Ga0207700_10097320 3300025928 Bacteria 2339
256 Ga0207700_10197829 3300025928 Bacteria 1692
257 Ga0207664_10000543 3300025929 Bacteria 26710
258 Ga0207664_10001834 3300025929 Bacteria 14011
259 Ga0207664_10021017 3300025929 Bacteria 4844
260 Ga0207664_10032211 3300025929 Bacteria 4016
261 Ga0207664_10066193 3300025929 Bacteria 2896
262 Ga0207644_10020502 3300025931 Bacteria 4494
263 Ga0207709_10055536 3300025935 Bacteria 2447
264 Ga0207704_10028646 3300025938 Bacteria 3093
265 Ga0207665_10001519 3300025939 Bacteria 15611
266 Ga0207665_10002049 3300025939 Bacteria 13569
267 Ga0207665_10005449 3300025939 Bacteria 8494
268 Ga0207665_10154506 3300025939 Bacteria 1646
269 Ga0207665_10485797 3300025939 Bacteria 952
270 Ga0207691_10345790 3300025940 Bacteria 1273
271 Ga0207689_10577836 3300025942 Bacteria 945
272 Ga0207661_10052377 3300025944 Bacteria 3261
273 Ga0207661_10229802 3300025944 Bacteria 1642
274 Ga0207661_10902006 3300025944 Bacteria 814
275 Ga0207679_10142281 3300025945 Bacteria 1941
276 Ga0207679_10183118 3300025945 Bacteria 1735
277 Ga0207667_10234374 3300025949 Bacteria 1879
278 Ga0207712_10832937 3300025961 Bacteria 812
279 Ga0207703_10122129 3300026035 Bacteria 2237
280 Ga0207639_10008463 3300026041 Bacteria 7051
281 Ga0207678_10000157 3300026067 Bacteria 56289
282 Ga0207678_10016906 3300026067 Bacteria 6405
283 Ga0207708_10179764 3300026075 Unclassified 1679
284 Ga0207702_10026300 3300026078 Bacteria 4830
285 Ga0207674_10019283 3300026116 Bacteria 7392
286 Ga0207674_10130657 3300026116 Bacteria 2475
287 Ga0207683_10036212 3300026121 Bacteria 4296
288 Ga0207683_10081484 3300026121 Bacteria 2873
289 Ga0207683_10264114 3300026121 Bacteria 1572
290 Ga0207698_10116881 3300026142 Bacteria 2249
291 Ga0268266_10081132 3300028379 Bacteria 2828
292 Ga0268264_10026308 3300028381 Bacteria 4753
293 Ga0268264_10083263 3300028381 Bacteria 2740
294 Ga0265338_10013043 3300028800 Bacteria 9424
295 Ga0265338_10013073 3300028800 Bacteria 9407
296 Ga0265338_10217580 3300028800 Bacteria 1429
297 Ga0265338_10333654 3300028800 Bacteria 1094
298 Ga0265338_10404776 3300028800 Bacteria 972
299 Ga0307512_10009654 3300030522 Bacteria 9279
300 Ga0316177_1197193 3300030731 Bacteria 1548
301 Ga0316176_1113610 3300030732 Bacteria 2634
302 Ga0314311_1077865 3300030733 Bacteria 4310
303 Ga0316180_1150129 3300030736 Bacteria 1642
304 Ga0265330_10081617 3300031235 Bacteria 1393
305 Ga0265325_10001703 3300031241 Bacteria 15285
306 Ga0265325_10033132 3300031241 Bacteria 2754
307 Ga0265340_10007600 3300031247 Bacteria 5881
308 Ga0265340_10016457 3300031247 Bacteria 3829
309 Ga0265340_10038501 3300031247 Bacteria 2364
310 Ga0265339_10013459 3300031249 Bacteria 4955
311 Ga0265339_10044690 3300031249 Bacteria 2442
312 Ga0265339_10111098 3300031249 Bacteria 1418
313 Ga0265316_10227831 3300031344 Bacteria 1373
314 Ga0265316_10251289 3300031344 Bacteria 1298
315 Ga0265316_10289682 3300031344 Bacteria 1195
316 Ga0307408_100181954 3300031548 Bacteria 1686
317 Ga0307408_100531615 3300031548 Bacteria 1034
318 Ga0265314_10179683 3300031711 Bacteria 1269
319 Ga0265342_10062926 3300031712 Bacteria 2182
320 Ga0265342_10101868 3300031712 Bacteria 1634
321 Ga0307405_10016785 3300031731 Bacteria 4000
322 Ga0307405_10339438 3300031731 Bacteria 1154
323 Ga0307405_10414089 3300031731 Bacteria 1059
324 Ga0307410_10036917 3300031852 Bacteria 3187
325 Ga0307406_10038338 3300031901 Bacteria 2966
326 Ga0307412_10012455 3300031911 Bacteria 4959
327 Ga0307412_10442299 3300031911 Bacteria 1069
328 Ga0307409_100075539 3300031995 Bacteria 2698
329 Ga0307409_100329267 3300031995 Bacteria 1433
330 Ga0307409_100790549 3300031995 Bacteria 956
331 Ga0307416_100227319 3300032002 Bacteria 1795
332 Ga0307416_100306712 3300032002 Bacteria 1581
333 Ga0307416_100496471 3300032002 Bacteria 1284
334 Ga0307416_100662151 3300032002 Bacteria 1130
335 Ga0307414_10033206 3300032004 Bacteria 3408
336 Ga0307414_10224991 3300032004 Bacteria 1543
337 Ga0307411_10010825 3300032005 Bacteria 4885
338 Ga0307507_10010875 3300033179 Bacteria 11614
339 Ga0307507_10022266 3300033179 Bacteria 7011
340 Ga0373948_0004399 3300034817 Bacteria 2227
341 Ga0373959_0001394 3300034820 Bacteria 3866
342 Ga0373929_0011026 3300035085 Bacteria 1697
343 Ga0373934_0007632 3300035086 Bacteria 4017
344 Ga0373934_0074223 3300035086 Bacteria 1362
345 Ga0373940_0055874 3300035088 Bacteria 1119
346 Ga0373944_0001809 3300035089 Bacteria 5400
347 Ga0373944_0036087 3300035089 Bacteria 1509
348 Ga0373949_0084768 3300035090 Bacteria 849
349 Ga0373923_0069748 3300035111 Bacteria 1507
350 Ga0373923_0105881 3300035111 Bacteria 1244
351 Ga0373923_0136697 3300035111 Bacteria 1105
352 Ga0373923_0188861 3300035111 Bacteria 949
353 Ga0373936_0014217 3300035113 Bacteria 3041
354 Ga0373936_0015889 3300035113 Bacteria 2888
355 Ga0373936_0020596 3300035113 Bacteria 2562
356 Ga0373945_0000676 3300035116 Bacteria 9841
357 Ga0373953_0022219 3300035117 Bacteria 2389
358 Ga0373953_0092825 3300035117 Bacteria 1264
359 Ga0373954_0323420 3300035118 Bacteria 761
360 Ga0373956_0022142 3300035119 Bacteria 2716
361 Ga0373956_0030203 3300035119 Bacteria 2367
362 Ga0373957_0006783 3300035120 Bacteria 3626
363 Ga0373957_0012473 3300035120 Bacteria 2863
364 Ga0373957_0022067 3300035120 Bacteria 2265
365 Ga0373957_0137827 3300035120 Bacteria 996
366 Ga0373943_0000554 3300035170 Bacteria 16138
367 Ga0373943_0078246 3300035170 Bacteria 1690
368 Ga0373943_0113499 3300035170 Bacteria 1432
369 Ga0373946_0000088 3300035171 Bacteria 25288
370 Ga0373946_0165997 3300035171 Bacteria 1039
371 Ga0373946_0205385 3300035171 Bacteria 945
372 Ga0373955_0003886 3300035172 Bacteria 6589
373 Ga0373955_0016557 3300035172 Bacteria 3631
374 Ga0373955_0289422 3300035172 Bacteria 986
375 Ga0373962_0001724 3300035242 Bacteria 5200
376 Ga0373924_0000756 3300035410 Bacteria 10046
377 Ga0373924_0025436 3300035410 Bacteria 2341
378 Ga0373924_0038827 3300035410 Bacteria 1943
379 Ga0373931_0031859 3300035691 Bacteria 2724
380 Ga0373935_0004943 3300035692 Bacteria 7840
381 Ga0373935_0005239 3300035692 Bacteria 7637
382 Ga0373927_0003620 3300035695 Bacteria 11023
383 Ga0373933_0001897 3300035724 Bacteria 12059
384 Ga0373933_0004727 3300035724 Bacteria 7447
385 Ga0373933_0009789 3300035724 Bacteria 5245
386 Ga0373933_0110754 3300035724 Bacteria 1712
387 Ga0373947_0000815 3300035725 Bacteria 18801
388 Ga0373947_0139581 3300035725 Bacteria 1553
389 Ga0373947_0205357 3300035725 Bacteria 1290
390 Ga0373947_0338758 3300035725 Bacteria 1008
391 Ga0373937_0032735 3300036401 Bacteria 4716
392 Ga0373937_0089238 3300036401 Bacteria 2854
393 Ga0373937_0266723 3300036401 Bacteria 1615
394 Ga0373937_0336814 3300036401 Bacteria 1428
395 Ga0373925_0002262 3300037068 Bacteria 15582
396 Ga0373925_0103984 3300037068 Bacteria 2186
397 Ga0395899_0008829 3300037312 Bacteria 7758
398 Ga0395899_0076950 3300037312 Bacteria 2435
399 Ga0395899_0171502 3300037312 Bacteria 1528
400 Ga0395899_0325149 3300037312 Bacteria 1035
401 Ga0395900_0035842 3300037418 Bacteria 5112
402 Ga0395900_0038293 3300037418 Bacteria 4942
403 Ga0395900_0048798 3300037418 Bacteria 4360
404 Ga0395900_0063634 3300037418 Bacteria 3792
405 Ga0395900_0076186 3300037418 Bacteria 3448
406 Ga0395900_0108161 3300037418 Bacteria 2857
407 Ga0395900_0286653 3300037418 Bacteria 1637
408 Ga0395898_0002402 3300037466 Bacteria 22230
409 Ga0395898_0019032 3300037466 Bacteria 6992
410 Ga0395898_0043998 3300037466 Bacteria 4398
411 Ga0395898_0056245 3300037466 Bacteria 3835
412 Ga0395898_0109593 3300037466 Bacteria 2647
413 Ga0395905_0132127 3300037471 Bacteria 2348
414 Ga0395905_0227022 3300037471 Bacteria 1746
415 Ga0395905_0560328 3300037471 Bacteria 1044
416 Ga0436364_0028797 3300037853 Bacteria 5808
417 Ga0436364_0121732 3300037853 Bacteria 5869
418 Ga0436364_0426348 3300037853 Bacteria 32972
419 Ga0436364_0549328 3300037853 Bacteria 13439
420 Ga0436364_1427311 3300037853 Bacteria 97691
421 Ga0436364_1439262 3300037853 Bacteria 1081
422 Ga0436364_1529133 3300037853 Bacteria 6866
423 Ga0436364_1545210 3300037853 Bacteria 2129
424 Ga0395901_0082064 3300038443 Bacteria 3368
425 Ga0395901_0091986 3300038443 Bacteria 3175
426 Ga0395901_0094809 3300038443 Bacteria 3127
427 Ga0395901_0199365 3300038443 Bacteria 2098
428 Ga0395901_0220117 3300038443 Bacteria 1984
429 Ga0395901_0801951 3300038443 Bacteria 930
430 Ga0436365_0824727 3300039437 Bacteria 1295
431 Ga0436365_1131341 3300039437 Bacteria 1413
432 Ga0436365_1228920 3300039437 Bacteria 1024
433 Ga0436365_1473848 3300039437 Bacteria 56626
434 Ga0436365_1759695 3300039437 Bacteria 5636
435 Ga0436363_0439343 3300039450 Bacteria 2981
436 Ga0436363_0809494 3300039450 Bacteria 856
437 Ga0436363_1193301 3300039450 Bacteria 2137
438 Ga0436363_1305175 3300039450 Bacteria 918
439 Ga0436362_0353422 3300039453 Bacteria 5701
440 Ga0439436_0019587 3300041404 Bacteria 2019
441 Ga0451797_0119597 3300041453 Bacteria 5049
442 Ga0451837_0443190 3300041494 Bacteria 1545
443 Ga0439442_000037 3300042002 Bacteria 29843
444 Ga0439442_000671 3300042002 Bacteria 7263
445 Ga0439457_000224 3300042014 Bacteria 15165
446 Ga0439463_038687 3300042016 Bacteria 1211
447 Ga0439440_0083101 3300042993 Bacteria 850
448 Ga0466969_0093538 3300044656 Bacteria 1422
449 Ga0466972_0020758 3300044658 Bacteria 3281
450 Ga0466965_0009750 3300044683 Bacteria 4468
451 Ga0466965_0053636 3300044683 Bacteria 2004
452 Ga0466965_0130787 3300044683 Bacteria 1302
453 Ga0466965_0160862 3300044683 Bacteria 1177
454 Ga0466966_0046573 3300044684 Bacteria 2768
455 Ga0466966_0069037 3300044684 Bacteria 2217
456 Ga0466961_0131005 3300044693 Bacteria 1572
457 Ga0466961_0141696 3300044693 Bacteria 1505
458 Ga0466961_0387631 3300044693 Bacteria 848
459 Ga0466963_0001620 3300044694 Bacteria 12244
460 Ga0466963_0016067 3300044694 Bacteria 4648
461 Ga0466963_0222812 3300044694 Bacteria 1321
462 Ga0466963_0588407 3300044694 Bacteria 786
463 Ga0466971_0008840 3300044719 Bacteria 4398
464 Ga0466971_0051690 3300044719 Bacteria 1850
465 Ga0466970_0006565 3300044765 Bacteria 5814
466 Ga0466970_0028964 3300044765 Bacteria 2913
467 Ga0466970_0261785 3300044765 Bacteria 970
468 Ga0466957_0010347 3300044842 Bacteria 5350
469 Ga0466957_0175644 3300044842 Bacteria 1397
470 Ga0466960_0002868 3300044901 Bacteria 6538
471 Ga0466960_0292851 3300044901 Bacteria 915
472 Ga0466960_0295601 3300044901 Bacteria 911
473 Ga0466959_0063230 3300045049 Bacteria 2688
474 Ga0466959_0320485 3300045049 Bacteria 1060
475 Ga0466958_0000994 3300045836 Bacteria 12823
476 Ga0466967_0017821 3300045976 Bacteria 5654
477 Ga0466967_0042911 3300045976 Bacteria 3913
478 Ga0466967_0108621 3300045976 Bacteria 2546
479 Ga0466967_0112602 3300045976 Bacteria 2502
480 Ga0466967_0119804 3300045976 Bacteria 2430
481 Ga0466967_0295511 3300045976 Bacteria 1557
482 Ga0466967_0596829 3300045976 Bacteria 1090
483 Ga0495592_0005858 3300046454 Bacteria 9120
484 Ga0495592_0104531 3300046454 Bacteria 2013
485 Ga0495603_0051703 3300046455 Bacteria 2441
486 Ga0495603_0250502 3300046455 Bacteria 1020
487 Ga0495629_0002998 3300046459 Bacteria 12846
488 Ga0495629_0051130 3300046459 Bacteria 2892
489 Ga0495629_0081566 3300046459 Bacteria 2257
490 Ga0495629_0090675 3300046459 Bacteria 2133
491 Ga0495629_0112288 3300046459 Bacteria 1899
492 Ga0495629_0253729 3300046459 Bacteria 1210
493 Ga0495641_0026622 3300046461 Bacteria 2819
494 Ga0495641_0035703 3300046461 Bacteria 2340
495 Ga0495641_0046978 3300046461 Bacteria 1983
496 Ga0495651_0014823 3300046462 Bacteria 6028
497 Ga0495651_0016773 3300046462 Bacteria 5673
498 Ga0495651_0157995 3300046462 Bacteria 1627
499 Ga0495651_0250588 3300046462 Bacteria 1209
500 Ga0495651_0322429 3300046462 Bacteria 1029
501 Ga0495653_0002903 3300046463 Bacteria 13704
502 Ga0495653_0022289 3300046463 Bacteria 5126
503 Ga0495653_0031632 3300046463 Bacteria 4204
504 Ga0495653_0097763 3300046463 Bacteria 2132
505 Ga0495653_0131365 3300046463 Bacteria 1772
506 Ga0495653_0140712 3300046463 Bacteria 1697
507 Ga0495582_0007038 3300046473 Bacteria 6254
508 Ga0495582_0013945 3300046473 Bacteria 4427
509 Ga0495582_0061641 3300046473 Bacteria 2071
510 Ga0495639_0000532 3300046475 Bacteria 17867
511 Ga0495639_0038543 3300046475 Bacteria 2146
512 Ga0495639_0053152 3300046475 Bacteria 1845
513 Ga0495639_0065181 3300046475 Bacteria 1675
514 Ga0495662_0009293 3300046476 Bacteria 4823
515 Ga0495664_0011303 3300046477 Bacteria 5031
516 Ga0495664_0036995 3300046477 Bacteria 2879
517 Ga0495664_0055076 3300046477 Bacteria 2366
518 Ga0495664_0166705 3300046477 Bacteria 1336
519 Ga0495594_0076675 3300046499 Bacteria 1864
520 Ga0495594_0253819 3300046499 Bacteria 1002
521 Ga0495608_0009357 3300046511 Bacteria 6850
522 Ga0495608_0023867 3300046511 Bacteria 4184
523 Ga0495608_0239789 3300046511 Bacteria 1133
524 Ga0495608_0266034 3300046511 Bacteria 1066
525 Ga0495608_0380770 3300046511 Bacteria 865
526 Ga0495618_0025596 3300046514 Bacteria 3662
527 Ga0495618_0058897 3300046514 Bacteria 2433
528 Ga0495618_0189286 3300046514 Bacteria 1305
529 Ga0495628_0009366 3300046516 Bacteria 8362
530 Ga0495628_0065292 3300046516 Bacteria 2847
531 Ga0495628_0126871 3300046516 Bacteria 1954
532 Ga0495628_0208502 3300046516 Bacteria 1470
533 Ga0495630_0008061 3300046517 Bacteria 7573
534 Ga0495630_0019030 3300046517 Bacteria 5047
535 Ga0495630_0047208 3300046517 Bacteria 3221
536 Ga0495630_0141044 3300046517 Bacteria 1832
537 Ga0495666_0055655 3300046526 Bacteria 1895
538 Ga0495652_0005483 3300046529 Bacteria 11951
539 Ga0495652_0043128 3300046529 Bacteria 3887
540 Ga0495652_0050725 3300046529 Bacteria 3547
541 Ga0495665_0007538 3300046531 Bacteria 5890
542 Ga0495665_0018575 3300046531 Bacteria 3736
543 Ga0495665_0021026 3300046531 Bacteria 3506
544 Ga0495665_0057936 3300046531 Bacteria 2045
545 Ga0495665_0115215 3300046531 Bacteria 1408
546 Ga0495640_0003176 3300046533 Bacteria 13238
547 Ga0495640_0086670 3300046533 Bacteria 2073
548 Ga0495640_0157249 3300046533 Bacteria 1458
549 Ga0495640_0169756 3300046533 Bacteria 1394
550 Ga0495640_0260645 3300046533 Bacteria 1083
551 Ga0495586_0000632 3300046535 Bacteria 20286
552 Ga0495587_0004127 3300046536 Bacteria 9604
553 Ga0495587_0031177 3300046536 Bacteria 3230
554 Ga0495587_0064665 3300046536 Bacteria 2137
555 Ga0495587_0168296 3300046536 Bacteria 1245
556 Ga0495645_0018671 3300046543 Bacteria 4984
557 Ga0495645_0055890 3300046543 Bacteria 2865
558 Ga0495645_0204158 3300046543 Bacteria 1338
559 Ga0495645_0248081 3300046543 Bacteria 1184
560 Ga0495667_0028601 3300046559 Bacteria 3754
561 Ga0495667_0029607 3300046559 Bacteria 3685
562 Ga0495667_0030175 3300046559 Bacteria 3646
563 Ga0495667_0053905 3300046559 Bacteria 2647
564 Ga0495667_0346623 3300046559 Bacteria 938
565 Ga0495656_0124346 3300046615 Bacteria 1221
566 Ga0495656_0249745 3300046615 Bacteria 896
567 Ga0495668_0136367 3300046616 Bacteria 1343
568 Ga0495634_0019891 3300046642 Bacteria 4765
569 Ga0495634_0024993 3300046642 Bacteria 4187
570 Ga0495634_0047224 3300046642 Bacteria 2902
571 Ga0495634_0066340 3300046642 Bacteria 2390
572 Ga0495635_0001151 3300046663 Bacteria 17639
573 Ga0495635_0004086 3300046663 Bacteria 10129
574 Ga0495635_0021859 3300046663 Bacteria 4459
575 Ga0495635_0216452 3300046663 Bacteria 1296
576 Ga0495588_0000765 3300046674 Bacteria 14594
577 Ga0495588_0126867 3300046674 Bacteria 1346
578 Ga0495588_0132378 3300046674 Bacteria 1316
579 Ga0495657_0043253 3300046675 Bacteria 3072
580 Ga0495657_0046910 3300046675 Bacteria 2923
581 Ga0495657_0055790 3300046675 Bacteria 2634
582 Ga0495657_0072408 3300046675 Bacteria 2248
583 Ga0495657_0073703 3300046675 Bacteria 2223
584 Ga0495599_0070639 3300046678 Bacteria 2179
585 Ga0495599_0080677 3300046678 Bacteria 2031
586 Ga0495599_0148356 3300046678 Bacteria 1453
587 Ga0495623_0070324 3300046679 Bacteria 2180
588 Ga0495623_0275698 3300046679 Bacteria 937
589 Ga0495646_0002600 3300046680 Bacteria 11130
590 Ga0495646_0018691 3300046680 Bacteria 4389
591 Ga0495646_0075625 3300046680 Bacteria 1974
592 Ga0495646_0126454 3300046680 Bacteria 1442
593 Ga0495647_0245264 3300046681 Bacteria 796
594 Ga0495658_0006826 3300046683 Bacteria 5621
595 Ga0495658_0248423 3300046683 Bacteria 1118
596 Ga0495613_0018649 3300046689 Bacteria 5174
597 Ga0495613_0034019 3300046689 Bacteria 3785
598 Ga0495613_0071074 3300046689 Bacteria 2537
599 Ga0495613_0089590 3300046689 Bacteria 2229
600 Ga0495613_0159765 3300046689 Bacteria 1604
601 Ga0495613_0190694 3300046689 Bacteria 1448
602 Ga0495613_0215672 3300046689 Bacteria 1348
603 Ga0495624_0003920 3300046690 Bacteria 10962
604 Ga0495624_0008780 3300046690 Bacteria 7028
605 Ga0495624_0064030 3300046690 Bacteria 2298
606 Ga0495624_0094526 3300046690 Bacteria 1843
607 Ga0495600_0003586 3300046809 Bacteria 9140
608 Ga0495600_0026915 3300046809 Bacteria 3715
609 Ga0495600_0054646 3300046809 Bacteria 2608
610 Ga0495581_0034269 3300047315 Bacteria 2937
611 Ga0495581_0213747 3300047315 Bacteria 1127
612 Ga0495604_0029667 3300047317 Bacteria 4351
613 Ga0495604_0036076 3300047317 Bacteria 3900
614 Ga0495604_0037215 3300047317 Bacteria 3833
615 Ga0495604_0148313 3300047317 Bacteria 1669
616 Ga0495604_0229642 3300047317 Bacteria 1273
617 Ga0495604_0260188 3300047317 Bacteria 1180
618 Ga0495674_0003395 3300047319 Bacteria 15469
619 Ga0495674_0069694 3300047319 Bacteria 3040
620 Ga0495674_0080318 3300047319 Bacteria 2799
621 Ga0495674_0100660 3300047319 Bacteria 2459
622 Ga0495674_0240061 3300047319 Bacteria 1493
623 Ga0495676_0029713 3300047321 Bacteria 4651
624 Ga0495676_0111551 3300047321 Bacteria 2005
625 Ga0495676_0342028 3300047321 Bacteria 1001
626 Ga0495676_0405856 3300047321 Bacteria 903
627 Ga0495680_0003725 3300047322 Bacteria 14867
628 Ga0495680_0006511 3300047322 Bacteria 10839
629 Ga0495680_0015991 3300047322 Bacteria 6455
630 Ga0495680_0034757 3300047322 Bacteria 4066
631 Ga0495680_0073690 3300047322 Bacteria 2594
632 Ga0495680_0123284 3300047322 Bacteria 1911
633 Ga0495675_0003832 3300047444 Bacteria 9106
634 Ga0495675_0027687 3300047444 Bacteria 3612
635 Ga0495675_0054938 3300047444 Bacteria 2526
636 Ga0495675_0083834 3300047444 Bacteria 2006
637 Ga0495675_0222360 3300047444 Bacteria 1142
638 Ga0495684_0001405 3300047471 Bacteria 19281
639 Ga0495684_0018126 3300047471 Bacteria 5426
640 Ga0495684_0068266 3300047471 Bacteria 2703
641 Ga0495684_0243113 3300047471 Bacteria 1312
642 Ga0495684_0246378 3300047471 Bacteria 1301
643 Ga0495593_0005742 3300047673 Bacteria 7325
644 Ga0495593_0016271 3300047673 Bacteria 4198
645 Ga0495593_0040446 3300047673 Bacteria 2510
646 Ga0495593_0078437 3300047673 Bacteria 1710
647 Ga0495602_0081964 3300048088 Bacteria 2709
648 Ga0495602_0089498 3300048088 Bacteria 2559
649 Ga0495602_0167355 3300048088 Bacteria 1709
650 Ga0495614_0046931 3300048089 Bacteria 1852
651 Ga0495614_0059558 3300048089 Bacteria 1640
652 Ga0496100_0033888 3300048903 Bacteria 3199
653 Ga0496100_0049759 3300048903 Bacteria 2712
654 Ga0496101_0007369 3300048904 Bacteria 7126
655 Ga0496101_0043696 3300048904 Bacteria 3203
656 Ga0496101_0258127 3300048904 Bacteria 1359
657 Ga0496101_0770034 3300048904 Bacteria 759
658 Ga0496102_0014892 3300048905 Bacteria 6765
659 Ga0496102_0077427 3300048905 Bacteria 3061
660 Ga0496102_0422077 3300048905 Unclassified 1253
661 Ga0496103_0000898 3300048906 Bacteria 21446
662 Ga0496104_0018338 3300048907 Bacteria 6386
663 Ga0496104_0040418 3300048907 Bacteria 4371
664 Ga0496105_0133367 3300048908 Bacteria 2046
665 Ga0496105_0145354 3300048908 Bacteria 1950
666 Ga0496105_0175632 3300048908 Bacteria 1755
667 Ga0496105_0332690 3300048908 Bacteria 1215
668 Ga0496106_0006772 3300048909 Bacteria 8482
669 Ga0496106_0065172 3300048909 Bacteria 2773
670 Ga0496106_0718278 3300048909 Unclassified 796
671 Ga0496107_0006344 3300048910 Bacteria 8129
672 Ga0496107_0189978 3300048910 Bacteria 1526
673 Ga0496107_0239570 3300048910 Bacteria 1350
674 Ga0496107_0336434 3300048910 Bacteria 1123
675 Ga0496108_0083258 3300048911 Bacteria 2713
676 Ga0496108_0352393 3300048911 Bacteria 1284
677 Ga0496108_0456367 3300048911 Bacteria 1116
678 Ga0496108_0566374 3300048911 Bacteria 991
679 Ga0496109_0011430 3300048912 Bacteria 7632
680 Ga0496109_0120685 3300048912 Bacteria 2442
681 Ga0496110_0030486 3300048913 Bacteria 4650
682 Ga0496111_0034956 3300048914 Bacteria 3590
683 Ga0496112_0044319 3300048915 Bacteria 4359
684 Ga0496112_0334281 3300048915 Bacteria 1459
685 Ga0496112_0359854 3300048915 Bacteria 1397
686 Ga0496112_0518048 3300048915 Bacteria 1127
687 Ga0496113_0060560 3300048916 Bacteria 2854
688 Ga0496114_0027387 3300048917 Bacteria 4668
689 Ga0496114_0053121 3300048917 Bacteria 3377
690 Ga0496114_0181776 3300048917 Bacteria 1837
691 Ga0496114_0254182 3300048917 Bacteria 1546
692 Ga0496114_0476399 3300048917 Bacteria 1104
693 Ga0496115_0015138 3300048918 Bacteria 5846
694 Ga0496115_0029459 3300048918 Bacteria 4311
695 Ga0496115_0079414 3300048918 Bacteria 2670
696 Ga0496126_0000048 3300048929 Bacteria 317977
697 Ga0501031_0005992 3300049568 Bacteria 7935
698 Ga0501032_0000831 3300049569 Bacteria 25090
699 Ga0501032_0021761 3300049569 Bacteria 4455
700 Ga0501034_0000669 3300049571 Bacteria 52088
701 Ga0501034_0075948 3300049571 Bacteria 3367
702 Ga0501036_0224115 3300049572 Bacteria 1578
703 Ga0501037_0075983 3300049573 Bacteria 2439
704 Ga0501038_0043793 3300049574 Bacteria 3891
705 Ga0501038_0315640 3300049574 Bacteria 1223
706 Ga0501039_0123258 3300049575 Bacteria 2032
707 Ga0501039_0212363 3300049575 Bacteria 1522
708 Ga0501040_0002929 3300049576 Bacteria 11042
709 Ga0501041_0234681 3300049577 Bacteria 1152
710 Ga0501042_0000567 3300049578 Bacteria 19534
711 Ga0501043_0004750 3300049579 Bacteria 11019
712 Ga0501043_0043761 3300049579 Bacteria 3520
713 Ga0501046_0094491 3300049580 Bacteria 2298
714 Ga0501047_0000660 3300049581 Bacteria 36046
715 Ga0501047_0289894 3300049581 Bacteria 1480
716 Ga0501048_0018382 3300049582 Bacteria 5141
717 Ga0501048_0095709 3300049582 Bacteria 2094
718 Ga0501067_0004614 3300049583 Bacteria 7627
719 Ga0501067_0186602 3300049583 Bacteria 1155
720 Ga0501069_0029739 3300049585 Bacteria 2999
721 Ga0501069_0270930 3300049585 Bacteria 992
722 Ga0501070_0037439 3300049586 Bacteria 4050
723 Ga0501070_0068682 3300049586 Bacteria 2934
724 Ga0501070_0314213 3300049586 Bacteria 1275
725 Ga0501070_0615048 3300049586 Bacteria 865
726 Ga0501071_0040853 3300049587 Bacteria 3321
727 Ga0501071_0181938 3300049587 Bacteria 1575
728 Ga0501072_0182905 3300049588 Bacteria 1672
729 Ga0501075_0131552 3300049591 Bacteria 1906
730 Ga0501076_0165756 3300049592 Bacteria 1801
731 Ga0501079_0192640 3300049741 Bacteria 1591
732 Ga0501079_0205287 3300049741 Bacteria 1539
733 Ga0501081_0308830 3300049743 Bacteria 1161
734 Ga0501083_0344857 3300049744 Bacteria 968
735 Ga0501035_0072092 3300049822 Bacteria 3058
736 Ga0501035_0121303 3300049822 Bacteria 2285
737 Ga0501044_0041692 3300049823 Bacteria 4779
738 Ga0501045_0002992 3300049824 Bacteria 11565
739 Ga0501045_0166226 3300049824 Bacteria 1643
740 nmdc:mga03683_78679_c1 3300050489 Bacteria 1420
741 nmdc:mga00v17_46376_c1 3300050491 Bacteria 2629
742 nmdc:mga0yw44_126493_c1 3300050492 Bacteria 1651
743 nmdc:mga0yw44_56449_c1 3300050492 Bacteria 2392
744 nmdc:mga06z11_208210_c1 3300050494 Bacteria 1138
745 nmdc:mga06z11_242655_c1 3300050494 Bacteria 1059
746 nmdc:mga06z11_29740_c1 3300050494 Bacteria 2635
747 nmdc:mga05p37_155734_c1 3300050507 Bacteria 2793
748 nmdc:mga05p37_261389_c1 3300050507 Bacteria 2071
749 nmdc:mga05p37_815466_c1 3300050507 Bacteria 1019
750 nmdc:mga09592_2829_c1 3300050508 Bacteria 14063
751 nmdc:mga09592_329566_c1 3300050508 Bacteria 1322
752 nmdc:mga09592_8866_c1 3300050508 Bacteria 8180
753 nmdc:mga0qj67_140821_c1 3300050509 Bacteria 1956
754 nmdc:mga0qj67_150568_c1 3300050509 Bacteria 1888
755 nmdc:mga0qj67_168378_c1 3300050509 Bacteria 1779
756 nmdc:mga0qj67_270961_c1 3300050509 Bacteria 1377
757 nmdc:mga0qj67_84154_c1 3300050509 Bacteria 2550
758 nmdc:mga06r32_148857_c1 3300050510 Bacteria 2319
759 nmdc:mga06r32_1610_c1 3300050510 Bacteria 20351
760 nmdc:mga06r32_524701_c1 3300050510 Bacteria 1160
761 nmdc:mga08y16_44235_c1 3300050511 Bacteria 4665
762 nmdc:mga0n895_100740_c1 3300050512 Bacteria 2898
763 nmdc:mga0n895_3284_c1 3300050512 Bacteria 12986
764 nmdc:mga0n895_35984_c1 3300050512 Bacteria 4778
765 nmdc:mga0n895_43045_c1 3300050512 Bacteria 4398
766 nmdc:mga0rr50_23575_c1 3300050513 Bacteria 4246
767 nmdc:mga0rr50_5486_c1 3300050513 Bacteria 7575
768 nmdc:mga08x19_131872_c1 3300050514 Bacteria 1681
769 nmdc:mga0a205_177579_c1 3300050515 Bacteria 2024
770 nmdc:mga0a205_23375_c1 3300050515 Bacteria 5863
771 Ga0495601_0012510 3300053077 Bacteria 5090
772 Ga0495601_0059676 3300053077 Bacteria 2419
773 Ga0495601_0135706 3300053077 Bacteria 1604
774 Ga0495601_0193951 3300053077 Bacteria 1327
775 Ga0495601_0218242 3300053077 Bacteria 1245
776 Ga0495612_0010706 3300053078 Bacteria 3705
777 Ga0495612_0010871 3300053078 Bacteria 3676
778 Ga0495612_0014473 3300053078 Bacteria 3173
779 Ga0495612_0016037 3300053078 Bacteria 3002
780 Ga0495612_0096434 3300053078 Bacteria 1256
781 Ga0495655_0003848 3300053083 Bacteria 2515
782 Ga0495595_0001229 3300053084 Bacteria 9974
783 Ga0495595_0014179 3300053084 Bacteria 3376
784 Ga0495619_0018782 3300053085 Bacteria 4388
785 Ga0495619_0105131 3300053085 Bacteria 1925
786 Ga0495619_0171892 3300053085 Bacteria 1498
787 Ga0495619_0278937 3300053085 Bacteria 1158
788 Ga0495619_0359706 3300053085 Bacteria 1006
789 Ga0500577_0004096 3300053142 Bacteria 3824
790 Ga0500616_0005288 3300053153 Bacteria 8821
791 Ga0500616_0027645 3300053153 Bacteria 3130
792 Ga0500616_0102144 3300053153 Bacteria 1400
793 Ga0500616_0105909 3300053153 Bacteria 1367
794 Ga0501084_0006259 3300054114 Bacteria 9784
795 Ga0501084_0284316 3300054114 Bacteria 1397
796 Ga0501082_0046612 3300060353 Bacteria 3736
797 Ga0501082_0067836 3300060353 Bacteria 3072
798 Ga0501082_0453653 3300060353 Bacteria 1120
799 Ga0466962_0010848 3300061719 Bacteria 4381
800 Ga0530510_0169030 3300061734 Bacteria 1619
801 2775655555 2775506735 Bacteria 4556596
802 2785339459 2784746763 Bacteria 9783172
803 2808828265 2808606357 Bacteria 4466944
804 2808849508 2808606360 Bacteria 4404006
805 2808891105 2808606370 Bacteria 4942454
806 2808895396 2808606371 Bacteria 4251511
807 2810364554 2808606700 Bacteria 3482157
808 2812319991 2811994871 Bacteria 4497550
809 2812374470 2811994882 Bacteria 4688362
810 2819689458 2818991462 Bacteria 4320267
811 2862510640 2862507626 Bacteria 9425308
812 2870726730 2870721527 Bacteria 9689237
813 2883825346 2883821847 Bacteria 5121194
814 2885313006 2885312484 Bacteria 6415165
815 2905928106 2905926851 Bacteria 4423176
816 2915364970 2915358134 Bacteria 6050864
817 2919060688 2919059106 Bacteria 4991624
818 2945917756 2945916053 Bacteria 4555517
819 2945943426 2945941187 Bacteria 4682474
820 2946061558 2946059875 Bacteria 4386623
821 2954000486 2953998280 Bacteria 4812144
822 2956939880 2956939328 Bacteria 3474458
823 3001121301 3001119090 Bacteria 3449530
824 8004024923 8004021418 Bacteria 4313954
825 8048411351 8048406513 Bacteria 8936924
826 8054108861 8054107350 Bacteria 5022511
827 Ga0495603_0058528
828 JGI25406J46586_10031930
829 Ga0065714_10114558
830 Ga0070658_10000219
831 Ga0070658_10002124
832 Ga0070658_10037290
833 Ga0070683_100274637
834 Ga0070683_100599882
835 Ga0068869_100032036
836 Ga0070680_100000598
837 Ga0070680_100007320
838 Ga0070682_100004505
839 Ga0070682_100216611
840 Ga0070682_100347231
841 Ga0070660_100261879
842 Ga0070691_10045595
843 Ga0070687_100272721
844 Ga0070671_100023347
845 Ga0070674_100247803
846 Ga0070659_100020279
847 Ga0070667_100380145
848 Ga0070709_10000220
849 Ga0070709_10291902
850 Ga0070714_100002227
851 Ga0070714_100010578
852 Ga0070713_100001605
853 Ga0070713_100009389
854 Ga0070713_100018255
855 Ga0070713_100425008
856 Ga0070713_100438087
857 Ga0070710_10000042
858 Ga0070710_10000122
859 Ga0070710_10000939
860 Ga0070711_100003406
861 Ga0070711_100189566
862 Ga0070711_100243039
863 Ga0070705_100012329
864 Ga0070705_100138038
865 Ga0070700_100027103
866 Ga0070694_100131188
867 Ga0070708_100007036
868 Ga0070708_100092983
869 Ga0070708_100220048
870 Ga0070708_100377573
871 Ga0070678_100037865
872 Ga0070678_100208595
873 Ga0070681_10001670
874 Ga0070681_10046871
875 Ga0070681_10344148
876 Ga0068867_100147655
877 Ga0070706_100000817
878 Ga0070706_100001339
879 Ga0070706_100004736
880 Ga0070706_100025486
881 Ga0070706_100097621
882 Ga0070706_100289506
883 Ga0070706_100446853
884 Ga0070707_100002030
885 Ga0070707_100077511
886 Ga0070707_100107132
887 Ga0070707_100144166
888 Ga0070698_100000546
889 Ga0070698_100003558
890 Ga0070698_100007991
891 Ga0070698_100011156
892 Ga0070698_100028866
893 Ga0070698_100073875
894 Ga0070698_100347336
895 Ga0070699_100110625
896 Ga0070679_100012273
897 Ga0070679_100012308
898 Ga0070679_100437218
899 Ga0070684_100271854
900 Ga0070684_100283774
901 Ga0070697_100062917
902 Ga0070697_100065191
903 Ga0068853_100008671
904 Ga0070695_100033931
905 Ga0070696_100003133
906 Ga0070696_100664983
907 Ga0070693_100002640
908 Ga0070693_100415291
909 Ga0068855_100243003
910 Ga0070664_100218215
911 Ga0070664_100682504
912 Ga0068857_100015977
913 Ga0068857_100065726
914 Ga0070702_100021040
915 Ga0070702_100169464
916 Ga0068864_100180433
917 Ga0068861_100235527
918 Ga0068861_100371229
919 Ga0068870_10339339
920 Ga0068858_100059003
921 Ga0068860_100100242
922 Ga0081455_10000107
923 Ga0081455_10026019
924 Ga0081455_10029678
925 Ga0081455_10086575
926 Ga0081455_10139078
927 Ga0081455_10229864
928 Ga0081540_1000095
929 Ga0081540_1001613
930 Ga0081539_10000405
931 Ga0070717_10011462
932 Ga0070717_10093181
933 Ga0070717_10784646
934 Ga0075365_10050673
935 Ga0075365_10560831
936 Ga0075368_10026485
937 Ga0075363_100026463
938 Ga0075363_100059861
939 Ga0075363_100138956
940 Ga0075364_10030085
941 Ga0075364_10036174
942 Ga0070715_10023800
943 Ga0070715_10028333
944 Ga0070715_10202908
945 Ga0070716_100002596
946 Ga0070716_100144009
947 Ga0070712_100002114
948 Ga0070712_100039382
949 Ga0070712_100149391
950 Ga0070712_100366355
951 Ga0075362_10015049
952 Ga0075367_10007069
953 Ga0075367_10017056
954 Ga0097621_100075623
955 Ga0097621_100733539
956 Ga0068871_100163066
957 Ga0075428_100003999
958 Ga0075428_100919129
959 Ga0075430_100001640
960 Ga0075431_100034551
961 Ga0075431_100037160
962 Ga0075431_100644360
963 Ga0075433_10045253
964 Ga0075434_100007088
965 Ga0075434_100010616
966 Ga0075434_100013021
967 Ga0075429_100000660
968 Ga0075429_100004902
969 Ga0075429_100058247
970 Ga0068865_100008386
971 Ga0075436_100170075
972 Ga0075436_100296207
973 Ga0075435_100010863
974 Ga0105244_10141717
975 Ga0105240_10281576
976 Ga0111539_10003516
977 Ga0111539_10033353
978 Ga0111539_10403670
979 Ga0105245_10115987
980 Ga0105247_10036225
981 Ga0105247_10545877
982 Ga0114129_10004780
983 Ga0114129_10006566
984 Ga0114129_10149868
985 Ga0114129_10186076
986 Ga0114129_10248108
987 Ga0114129_10578249
988 Ga0105243_10009365
989 Ga0105248_10361366
990 Ga0105248_10572037
991 Ga0105248_10836336
992 Ga0105237_10016176
993 Ga0105238_10042741
994 Ga0105249_10961047
995 Ga0105239_10045939
996 Ga0105246_10021145
997 Ga0105246_10049942
998 Ga0105246_10089623
999 Ga0105246_10097333
1000 Ga0157325_1000680
1001 Ga0157373_10090102
1002 Ga0157373_10224828
1003 Ga0157371_10324112
1004 Ga0157369_10048952
1005 Ga0157369_10166016
1006 Ga0157369_10796700
1007 Ga0163162_10945825
1008 Ga0157375_10011834
1009 Ga0157375_10229033
1010 Ga0157380_10081900
1011 Ga0157380_10404547
1012 Ga0157379_10039501
1013 Ga0157376_10044467
1014 Ga0157376_10227790
1015 Ga0182005_1026945
1016 Ga0197907_10955139
1017 Ga0206356_11336389
1018 Ga0206351_10371423
1019 Ga0206353_10711485
1020 Ga0206353_11700971
1021 Ga0213873_10019275
1022 Ga0213876_10001614
1023 Ga0213876_10032465
1024 Ga0213875_10000279
1025 Ga0213875_10000363
1026 Ga0213875_10007355
1027 Ga0213875_10008272
1028 Ga0213875_10013828
1029 Ga0213875_10106593
1030 Ga0224712_10030107
1031 Ga0228598_1021335
1032 Ga0207697_10049746
1033 Ga0207655_1009968
1034 Ga0207692_10000172
1035 Ga0207692_10000192
1036 Ga0207692_10098942
1037 Ga0207647_10011318
1038 Ga0207685_10008530
1039 Ga0207685_10023176
1040 Ga0207699_10001218
1041 Ga0207699_10019655
1042 Ga0207699_10040782
1043 Ga0207699_10518036
1044 Ga0207705_10094807
1045 Ga0207705_10122818
1046 Ga0207684_10015452
1047 Ga0207684_10043013
1048 Ga0207684_10044698
1049 Ga0207684_10053168
1050 Ga0207684_10182786
1051 Ga0207684_10244433
1052 Ga0207654_10221898
1053 Ga0207707_10000513
1054 Ga0207707_10101159
1055 Ga0207695_10054675
1056 Ga0207671_10043373
1057 Ga0207671_10132640
1058 Ga0207693_10001433
1059 Ga0207693_10058519
1060 Ga0207693_10284367
1061 Ga0207663_10002117
1062 Ga0207663_10007354
1063 Ga0207663_10024463
1064 Ga0207660_10006015
1065 Ga0207660_10157628
1066 Ga0207657_10157574
1067 Ga0207657_10248455
1068 Ga0207649_10352789
1069 Ga0207652_10003086
1070 Ga0207652_10011409
1071 Ga0207652_10696162
1072 Ga0207646_10000050
1073 Ga0207646_10032395
1074 Ga0207646_10044414
1075 Ga0207646_10048483
1076 Ga0207646_10220171
1077 Ga0207687_10104558
1078 Ga0207687_10160845
1079 Ga0207700_10000619
1080 Ga0207700_10075360
1081 Ga0207700_10097320
1082 Ga0207700_10197829
1083 Ga0207664_10000543
1084 Ga0207664_10001834
1085 Ga0207664_10021017
1086 Ga0207664_10032211
1087 Ga0207664_10066193
1088 Ga0207644_10020502
1089 Ga0207709_10055536
1090 Ga0207704_10028646
1091 Ga0207665_10001519
1092 Ga0207665_10002049
1093 Ga0207665_10005449
1094 Ga0207665_10154506
1095 Ga0207665_10485797
1096 Ga0207691_10345790
1097 Ga0207689_10577836
1098 Ga0207661_10052377
1099 Ga0207661_10229802
1100 Ga0207661_10902006
1101 Ga0207679_10142281
1102 Ga0207679_10183118
1103 Ga0207667_10234374
1104 Ga0207712_10832937
1105 Ga0207703_10122129
1106 Ga0207639_10008463
1107 Ga0207678_10000157
1108 Ga0207678_10016906
1109 Ga0207708_10179764
1110 Ga0207702_10026300
1111 Ga0207674_10019283
1112 Ga0207674_10130657
1113 Ga0207683_10036212
1114 Ga0207683_10081484
1115 Ga0207683_10264114
1116 Ga0207698_10116881
1117 Ga0268266_10081132
1118 Ga0268264_10026308
1119 Ga0268264_10083263
1120 Ga0265338_10013043
1121 Ga0265338_10013073
1122 Ga0265338_10217580
1123 Ga0265338_10333654
1124 Ga0265338_10404776
1125 Ga0307512_10009654
1126 Ga0316177_1197193
1127 Ga0316176_1113610
1128 Ga0314311_1077865
1129 Ga0316180_1150129
1130 Ga0265330_10081617
1131 Ga0265325_10001703
1132 Ga0265325_10033132
1133 Ga0265340_10007600
1134 Ga0265340_10016457
1135 Ga0265340_10038501
1136 Ga0265339_10013459
1137 Ga0265339_10044690
1138 Ga0265339_10111098
1139 Ga0265316_10227831
1140 Ga0265316_10251289
1141 Ga0265316_10289682
1142 Ga0307408_100181954
1143 Ga0307408_100531615
1144 Ga0265314_10179683
1145 Ga0265342_10062926
1146 Ga0265342_10101868
1147 Ga0307405_10016785
1148 Ga0307405_10339438
1149 Ga0307405_10414089
1150 Ga0307410_10036917
1151 Ga0307406_10038338
1152 Ga0307412_10012455
1153 Ga0307412_10442299
1154 Ga0307409_100075539
1155 Ga0307409_100329267
1156 Ga0307409_100790549
1157 Ga0307416_100227319
1158 Ga0307416_100306712
1159 Ga0307416_100496471
1160 Ga0307416_100662151
1161 Ga0307414_10033206
1162 Ga0307414_10224991
1163 Ga0307411_10010825
1164 Ga0307507_10010875
1165 Ga0307507_10022266
1166 Ga0373948_0004399
1167 Ga0373959_0001394
1168 Ga0373929_0011026
1169 Ga0373934_0007632
1170 Ga0373934_0074223
1171 Ga0373940_0055874
1172 Ga0373944_0001809
1173 Ga0373944_0036087
1174 Ga0373949_0084768
1175 Ga0373923_0069748
1176 Ga0373923_0105881
1177 Ga0373923_0136697
1178 Ga0373923_0188861
1179 Ga0373936_0014217
1180 Ga0373936_0015889
1181 Ga0373936_0020596
1182 Ga0373945_0000676
1183 Ga0373953_0022219
1184 Ga0373953_0092825
1185 Ga0373954_0323420
1186 Ga0373956_0022142
1187 Ga0373956_0030203
1188 Ga0373957_0006783
1189 Ga0373957_0012473
1190 Ga0373957_0022067
1191 Ga0373957_0137827
1192 Ga0373943_0000554
1193 Ga0373943_0078246
1194 Ga0373943_0113499
1195 Ga0373946_0000088
1196 Ga0373946_0165997
1197 Ga0373946_0205385
1198 Ga0373955_0003886
1199 Ga0373955_0016557
1200 Ga0373955_0289422
1201 Ga0373962_0001724
1202 Ga0373924_0000756
1203 Ga0373924_0025436
1204 Ga0373924_0038827
1205 Ga0373931_0031859
1206 Ga0373935_0004943
1207 Ga0373935_0005239
1208 Ga0373927_0003620
1209 Ga0373933_0001897
1210 Ga0373933_0004727
1211 Ga0373933_0009789
1212 Ga0373933_0110754
1213 Ga0373947_0000815
1214 Ga0373947_0139581
1215 Ga0373947_0205357
1216 Ga0373947_0338758
1217 Ga0373937_0032735
1218 Ga0373937_0089238
1219 Ga0373937_0266723
1220 Ga0373937_0336814
1221 Ga0373925_0002262
1222 Ga0373925_0103984
1223 Ga0395899_0008829
1224 Ga0395899_0076950
1225 Ga0395899_0171502
1226 Ga0395899_0325149
1227 Ga0395900_0035842
1228 Ga0395900_0038293
1229 Ga0395900_0048798
1230 Ga0395900_0063634
1231 Ga0395900_0076186
1232 Ga0395900_0108161
1233 Ga0395900_0286653
1234 Ga0395898_0002402
1235 Ga0395898_0019032
1236 Ga0395898_0043998
1237 Ga0395898_0056245
1238 Ga0395898_0109593
1239 Ga0395905_0132127
1240 Ga0395905_0227022
1241 Ga0395905_0560328
1242 Ga0436364_0028797
1243 Ga0436364_0121732
1244 Ga0436364_0426348
1245 Ga0436364_0549328
1246 Ga0436364_1427311
1247 Ga0436364_1439262
1248 Ga0436364_1529133
1249 Ga0436364_1545210
1250 Ga0395901_0082064
1251 Ga0395901_0091986
1252 Ga0395901_0094809
1253 Ga0395901_0199365
1254 Ga0395901_0220117
1255 Ga0395901_0801951
1256 Ga0436365_0824727
1257 Ga0436365_1131341
1258 Ga0436365_1228920
1259 Ga0436365_1473848
1260 Ga0436365_1759695
1261 Ga0436363_0439343
1262 Ga0436363_0809494
1263 Ga0436363_1193301
1264 Ga0436363_1305175
1265 Ga0436362_0353422
1266 Ga0439436_0019587
1267 Ga0451797_0119597
1268 Ga0451837_0443190
1269 Ga0439442_000037
1270 Ga0439442_000671
1271 Ga0439457_000224
1272 Ga0439463_038687
1273 Ga0439440_0083101
1274 Ga0466969_0093538
1275 Ga0466972_0020758
1276 Ga0466965_0009750
1277 Ga0466965_0053636
1278 Ga0466965_0130787
1279 Ga0466965_0160862
1280 Ga0466966_0046573
1281 Ga0466966_0069037
1282 Ga0466961_0131005
1283 Ga0466961_0141696
1284 Ga0466961_0387631
1285 Ga0466963_0001620
1286 Ga0466963_0016067
1287 Ga0466963_0222812
1288 Ga0466963_0588407
1289 Ga0466971_0008840
1290 Ga0466971_0051690
1291 Ga0466970_0006565
1292 Ga0466970_0028964
1293 Ga0466970_0261785
1294 Ga0466957_0010347
1295 Ga0466957_0175644
1296 Ga0466960_0002868
1297 Ga0466960_0292851
1298 Ga0466960_0295601
1299 Ga0466959_0063230
1300 Ga0466959_0320485
1301 Ga0466958_0000994
1302 Ga0466967_0017821
1303 Ga0466967_0042911
1304 Ga0466967_0108621
1305 Ga0466967_0112602
1306 Ga0466967_0119804
1307 Ga0466967_0295511
1308 Ga0466967_0596829
1309 Ga0495592_0005858
1310 Ga0495592_0104531
1311 Ga0495603_0051703
1312 Ga0495603_0250502
1313 Ga0495629_0002998
1314 Ga0495629_0051130
1315 Ga0495629_0081566
1316 Ga0495629_0090675
1317 Ga0495629_0112288
1318 Ga0495629_0253729
1319 Ga0495641_0026622
1320 Ga0495641_0035703
1321 Ga0495641_0046978
1322 Ga0495651_0014823
1323 Ga0495651_0016773
1324 Ga0495651_0157995
1325 Ga0495651_0250588
1326 Ga0495651_0322429
1327 Ga0495653_0002903
1328 Ga0495653_0022289
1329 Ga0495653_0031632
1330 Ga0495653_0097763
1331 Ga0495653_0131365
1332 Ga0495653_0140712
1333 Ga0495582_0007038
1334 Ga0495582_0013945
1335 Ga0495582_0061641
1336 Ga0495639_0000532
1337 Ga0495639_0038543
1338 Ga0495639_0053152
1339 Ga0495639_0065181
1340 Ga0495662_0009293
1341 Ga0495664_0011303
1342 Ga0495664_0036995
1343 Ga0495664_0055076
1344 Ga0495664_0166705
1345 Ga0495594_0076675
1346 Ga0495594_0253819
1347 Ga0495608_0009357
1348 Ga0495608_0023867
1349 Ga0495608_0239789
1350 Ga0495608_0266034
1351 Ga0495608_0380770
1352 Ga0495618_0025596
1353 Ga0495618_0058897
1354 Ga0495618_0189286
1355 Ga0495628_0009366
1356 Ga0495628_0065292
1357 Ga0495628_0126871
1358 Ga0495628_0208502
1359 Ga0495630_0008061
1360 Ga0495630_0019030
1361 Ga0495630_0047208
1362 Ga0495630_0141044
1363 Ga0495666_0055655
1364 Ga0495652_0005483
1365 Ga0495652_0043128
1366 Ga0495652_0050725
1367 Ga0495665_0007538
1368 Ga0495665_0018575
1369 Ga0495665_0021026
1370 Ga0495665_0057936
1371 Ga0495665_0115215
1372 Ga0495640_0003176
1373 Ga0495640_0086670
1374 Ga0495640_0157249
1375 Ga0495640_0169756
1376 Ga0495640_0260645
1377 Ga0495586_0000632
1378 Ga0495587_0004127
1379 Ga0495587_0031177
1380 Ga0495587_0064665
1381 Ga0495587_0168296
1382 Ga0495645_0018671
1383 Ga0495645_0055890
1384 Ga0495645_0204158
1385 Ga0495645_0248081
1386 Ga0495667_0028601
1387 Ga0495667_0029607
1388 Ga0495667_0030175
1389 Ga0495667_0053905
1390 Ga0495667_0346623
1391 Ga0495656_0124346
1392 Ga0495656_0249745
1393 Ga0495668_0136367
1394 Ga0495634_0019891
1395 Ga0495634_0024993
1396 Ga0495634_0047224
1397 Ga0495634_0066340
1398 Ga0495635_0001151
1399 Ga0495635_0004086
1400 Ga0495635_0021859
1401 Ga0495635_0216452
1402 Ga0495588_0000765
1403 Ga0495588_0126867
1404 Ga0495588_0132378
1405 Ga0495657_0043253
1406 Ga0495657_0046910
1407 Ga0495657_0055790
1408 Ga0495657_0072408
1409 Ga0495657_0073703
1410 Ga0495599_0070639
1411 Ga0495599_0080677
1412 Ga0495599_0148356
1413 Ga0495623_0070324
1414 Ga0495623_0275698
1415 Ga0495646_0002600
1416 Ga0495646_0018691
1417 Ga0495646_0075625
1418 Ga0495646_0126454
1419 Ga0495647_0245264
1420 Ga0495658_0006826
1421 Ga0495658_0248423
1422 Ga0495613_0018649
1423 Ga0495613_0034019
1424 Ga0495613_0071074
1425 Ga0495613_0089590
1426 Ga0495613_0159765
1427 Ga0495613_0190694
1428 Ga0495613_0215672
1429 Ga0495624_0003920
1430 Ga0495624_0008780
1431 Ga0495624_0064030
1432 Ga0495624_0094526
1433 Ga0495600_0003586
1434 Ga0495600_0026915
1435 Ga0495600_0054646
1436 Ga0495581_0034269
1437 Ga0495581_0213747
1438 Ga0495604_0029667
1439 Ga0495604_0036076
1440 Ga0495604_0037215
1441 Ga0495604_0148313
1442 Ga0495604_0229642
1443 Ga0495604_0260188
1444 Ga0495674_0003395
1445 Ga0495674_0069694
1446 Ga0495674_0080318
1447 Ga0495674_0100660
1448 Ga0495674_0240061
1449 Ga0495676_0029713
1450 Ga0495676_0111551
1451 Ga0495676_0342028
1452 Ga0495676_0405856
1453 Ga0495680_0003725
1454 Ga0495680_0006511
1455 Ga0495680_0015991
1456 Ga0495680_0034757
1457 Ga0495680_0073690
1458 Ga0495680_0123284
1459 Ga0495675_0003832
1460 Ga0495675_0027687
1461 Ga0495675_0054938
1462 Ga0495675_0083834
1463 Ga0495675_0222360
1464 Ga0495684_0001405
1465 Ga0495684_0018126
1466 Ga0495684_0068266
1467 Ga0495684_0243113
1468 Ga0495684_0246378
1469 Ga0495593_0005742
1470 Ga0495593_0016271
1471 Ga0495593_0040446
1472 Ga0495593_0078437
1473 Ga0495602_0081964
1474 Ga0495602_0089498
1475 Ga0495602_0167355
1476 Ga0495614_0046931
1477 Ga0495614_0059558
1478 Ga0496100_0033888
1479 Ga0496100_0049759
1480 Ga0496101_0007369
1481 Ga0496101_0043696
1482 Ga0496101_0258127
1483 Ga0496101_0770034
1484 Ga0496102_0014892
1485 Ga0496102_0077427
1486 Ga0496102_0422077
1487 Ga0496103_0000898
1488 Ga0496104_0018338
1489 Ga0496104_0040418
1490 Ga0496105_0133367
1491 Ga0496105_0145354
1492 Ga0496105_0175632
1493 Ga0496105_0332690
1494 Ga0496106_0006772
1495 Ga0496106_0065172
1496 Ga0496106_0718278
1497 Ga0496107_0006344
1498 Ga0496107_0189978
1499 Ga0496107_0239570
1500 Ga0496107_0336434
1501 Ga0496108_0083258
1502 Ga0496108_0352393
1503 Ga0496108_0456367
1504 Ga0496108_0566374
1505 Ga0496109_0011430
1506 Ga0496109_0120685
1507 Ga0496110_0030486
1508 Ga0496111_0034956
1509 Ga0496112_0044319
1510 Ga0496112_0334281
1511 Ga0496112_0359854
1512 Ga0496112_0518048
1513 Ga0496113_0060560
1514 Ga0496114_0027387
1515 Ga0496114_0053121
1516 Ga0496114_0181776
1517 Ga0496114_0254182
1518 Ga0496114_0476399
1519 Ga0496115_0015138
1520 Ga0496115_0029459
1521 Ga0496115_0079414
1522 Ga0496126_0000048
1523 Ga0501031_0005992
1524 Ga0501032_0000831
1525 Ga0501032_0021761
1526 Ga0501034_0000669
1527 Ga0501034_0075948
1528 Ga0501036_0224115
1529 Ga0501037_0075983
1530 Ga0501038_0043793
1531 Ga0501038_0315640
1532 Ga0501039_0123258
1533 Ga0501039_0212363
1534 Ga0501040_0002929
1535 Ga0501041_0234681
1536 Ga0501042_0000567
1537 Ga0501043_0004750
1538 Ga0501043_0043761
1539 Ga0501046_0094491
1540 Ga0501047_0000660
1541 Ga0501047_0289894
1542 Ga0501048_0018382
1543 Ga0501048_0095709
1544 Ga0501067_0004614
1545 Ga0501067_0186602
1546 Ga0501069_0029739
1547 Ga0501069_0270930
1548 Ga0501070_0037439
1549 Ga0501070_0068682
1550 Ga0501070_0314213
1551 Ga0501070_0615048
1552 Ga0501071_0040853
1553 Ga0501071_0181938
1554 Ga0501072_0182905
1555 Ga0501075_0131552
1556 Ga0501076_0165756
1557 Ga0501079_0192640
1558 Ga0501079_0205287
1559 Ga0501081_0308830
1560 Ga0501083_0344857
1561 Ga0501035_0072092
1562 Ga0501035_0121303
1563 Ga0501044_0041692
1564 Ga0501045_0002992
1565 Ga0501045_0166226
1566 nmdc:mga03683_78679_c1
1567 nmdc:mga00v17_46376_c1
1568 nmdc:mga0yw44_126493_c1
1569 nmdc:mga0yw44_56449_c1
1570 nmdc:mga06z11_208210_c1
1571 nmdc:mga06z11_242655_c1
1572 nmdc:mga06z11_29740_c1
1573 nmdc:mga05p37_155734_c1
1574 nmdc:mga05p37_261389_c1
1575 nmdc:mga05p37_815466_c1
1576 nmdc:mga09592_2829_c1
1577 nmdc:mga09592_329566_c1
1578 nmdc:mga09592_8866_c1
1579 nmdc:mga0qj67_140821_c1
1580 nmdc:mga0qj67_150568_c1
1581 nmdc:mga0qj67_168378_c1
1582 nmdc:mga0qj67_270961_c1
1583 nmdc:mga0qj67_84154_c1
1584 nmdc:mga06r32_148857_c1
1585 nmdc:mga06r32_1610_c1
1586 nmdc:mga06r32_524701_c1
1587 nmdc:mga08y16_44235_c1
1588 nmdc:mga0n895_100740_c1
1589 nmdc:mga0n895_3284_c1
1590 nmdc:mga0n895_35984_c1
1591 nmdc:mga0n895_43045_c1
1592 nmdc:mga0rr50_23575_c1
1593 nmdc:mga0rr50_5486_c1
1594 nmdc:mga08x19_131872_c1
1595 nmdc:mga0a205_177579_c1
1596 nmdc:mga0a205_23375_c1
1597 Ga0495601_0012510
1598 Ga0495601_0059676
1599 Ga0495601_0135706
1600 Ga0495601_0193951
1601 Ga0495601_0218242
1602 Ga0495612_0010706
1603 Ga0495612_0010871
1604 Ga0495612_0014473
1605 Ga0495612_0016037
1606 Ga0495612_0096434
1607 Ga0495655_0003848
1608 Ga0495595_0001229
1609 Ga0495595_0014179
1610 Ga0495619_0018782
1611 Ga0495619_0105131
1612 Ga0495619_0171892
1613 Ga0495619_0278937
1614 Ga0495619_0359706
1615 Ga0500577_0004096
1616 Ga0500616_0005288
1617 Ga0500616_0027645
1618 Ga0500616_0102144
1619 Ga0500616_0105909
1620 Ga0501084_0006259
1621 Ga0501084_0284316
1622 Ga0501082_0046612
1623 Ga0501082_0067836
1624 Ga0501082_0453653
1625 Ga0466962_0010848
1626 Ga0530510_0169030
1627 2775655555
1628 2785339459
1629 2808828265
1630 2808849508
1631 2808891105
1632 2808895396
1633 2810364554
1634 2812319991
1635 2812374470
1636 2819689458
1637 2862510640
1638 2870726730
1639 2883825346
1640 2885313006
1641 2905928106
1642 2915364970
1643 2919060688
1644 2945917756
1645 2945943426
1646 2946061558
1647 2954000486
1648 2956939880
1649 3001121301
1650 8004024923
1651 8048411351
1652 8054108861

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

113

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

147

223

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9635 1 118
3zq7-assembly1.cif.gz_A the structure of dna-binding domain of response regulator from escherichia coli k-12 0.9617 128 224
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9556 1 115
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9554 1 117
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9547 2 118
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9964 2 79 3.40.50.2300
af_P9WGN1_116_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9932 128 223 1.10.10.10
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9865 1 77 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9841 3 84 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9755 1 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A258FSP1-F1-model_v4 DNA-binding response regulator 0.9027 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A258FSP1-F1-model_v4 DNA-binding response regulator 0.8951 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A366WR70-F1-model_v4 DNA-binding response regulator 0.8793 2 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Y9RGY6-F1-model_v4 Response regulator transcription factor 0.8752 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1G9V7M6-F1-model_v4 Sensory transduction protein RegX3 0.872 1 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map