F482485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 826 | 363 | 1652 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0058528|Ga0495603_0058528_73_882 |
| Length | 269 |
| Sequence | VTRVLVVDDEPQILRALRINLRVRGYEVDTAATGGQALETAGHHPPDLVILDLGLPDLDGVEVIGGLRGWTSAPIIVLSGRADSTDKVQALDAGADDYVTKPFGMDELLARMRAAARRAAPAEETPQVRLGGLVVDLAAKRVIRPDGPDIRLTPTEWHLLEVLLRHPGKLMSQRQLLAEVWGPGYADATGNLRLYMTQLRRKLEPDPARPRWLLTEPGMGYRYQPDEDEHPDRAPLPASGEGQPPGEPARRVLAQRPGARSGNARPRKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 148 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 149 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 150 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 151 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 207 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 208 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 209 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 210 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 339 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 340 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 341 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 342 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 343 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 344 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 345 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 346 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 347 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 348 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 349 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 350 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 351 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 352 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 353 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 354 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 355 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 356 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 357 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 358 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 359 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 360 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 361 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 362 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 363 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.13 |
| Metatranscriptomes | 0.73 |
| Isolates | 3.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 0.12 |
| Rhizoplane | 5.45 |
| Rhizosphere | 86.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495603_0058528 | 3300046455 | Bacteria | 2278 |
| 2 | JGI25406J46586_10031930 | 3300003203 | Bacteria | 1963 |
| 3 | Ga0065714_10114558 | 3300005288 | Bacteria | 1427 |
| 4 | Ga0070658_10000219 | 3300005327 | Bacteria | 50822 |
| 5 | Ga0070658_10002124 | 3300005327 | Bacteria | 16641 |
| 6 | Ga0070658_10037290 | 3300005327 | Bacteria | 3918 |
| 7 | Ga0070683_100274637 | 3300005329 | Bacteria | 1603 |
| 8 | Ga0070683_100599882 | 3300005329 | Bacteria | 1054 |
| 9 | Ga0068869_100032036 | 3300005334 | Bacteria | 3702 |
| 10 | Ga0070680_100000598 | 3300005336 | Bacteria | 24918 |
| 11 | Ga0070680_100007320 | 3300005336 | Bacteria | 8417 |
| 12 | Ga0070682_100004505 | 3300005337 | Bacteria | 7737 |
| 13 | Ga0070682_100216611 | 3300005337 | Bacteria | 1360 |
| 14 | Ga0070682_100347231 | 3300005337 | Bacteria | 1105 |
| 15 | Ga0070660_100261879 | 3300005339 | Bacteria | 1412 |
| 16 | Ga0070691_10045595 | 3300005341 | Bacteria | 2081 |
| 17 | Ga0070687_100272721 | 3300005343 | Unclassified | 1061 |
| 18 | Ga0070671_100023347 | 3300005355 | Bacteria | 5061 |
| 19 | Ga0070674_100247803 | 3300005356 | Bacteria | 1398 |
| 20 | Ga0070659_100020279 | 3300005366 | Bacteria | 5048 |
| 21 | Ga0070667_100380145 | 3300005367 | Bacteria | 1283 |
| 22 | Ga0070709_10000220 | 3300005434 | Bacteria | 37035 |
| 23 | Ga0070709_10291902 | 3300005434 | Bacteria | 1188 |
| 24 | Ga0070714_100002227 | 3300005435 | Bacteria | 14286 |
| 25 | Ga0070714_100010578 | 3300005435 | Bacteria | 7297 |
| 26 | Ga0070713_100001605 | 3300005436 | Bacteria | 14475 |
| 27 | Ga0070713_100009389 | 3300005436 | Bacteria | 6999 |
| 28 | Ga0070713_100018255 | 3300005436 | Bacteria | 5331 |
| 29 | Ga0070713_100425008 | 3300005436 | Bacteria | 1244 |
| 30 | Ga0070713_100438087 | 3300005436 | Bacteria | 1226 |
| 31 | Ga0070710_10000042 | 3300005437 | Bacteria | 58499 |
| 32 | Ga0070710_10000122 | 3300005437 | Bacteria | 36506 |
| 33 | Ga0070710_10000939 | 3300005437 | Bacteria | 13853 |
| 34 | Ga0070711_100003406 | 3300005439 | Bacteria | 9264 |
| 35 | Ga0070711_100189566 | 3300005439 | Bacteria | 1579 |
| 36 | Ga0070711_100243039 | 3300005439 | Bacteria | 1408 |
| 37 | Ga0070705_100012329 | 3300005440 | Bacteria | 4343 |
| 38 | Ga0070705_100138038 | 3300005440 | Bacteria | 1601 |
| 39 | Ga0070700_100027103 | 3300005441 | Bacteria | 3394 |
| 40 | Ga0070694_100131188 | 3300005444 | Bacteria | 1810 |
| 41 | Ga0070708_100007036 | 3300005445 | Bacteria | 8972 |
| 42 | Ga0070708_100092983 | 3300005445 | Bacteria | 2748 |
| 43 | Ga0070708_100220048 | 3300005445 | Bacteria | 1780 |
| 44 | Ga0070708_100377573 | 3300005445 | Bacteria | 1336 |
| 45 | Ga0070678_100037865 | 3300005456 | Bacteria | 3391 |
| 46 | Ga0070678_100208595 | 3300005456 | Unclassified | 1617 |
| 47 | Ga0070681_10001670 | 3300005458 | Bacteria | 19802 |
| 48 | Ga0070681_10046871 | 3300005458 | Bacteria | 4320 |
| 49 | Ga0070681_10344148 | 3300005458 | Bacteria | 1401 |
| 50 | Ga0068867_100147655 | 3300005459 | Bacteria | 1844 |
| 51 | Ga0070706_100000817 | 3300005467 | Bacteria | 34479 |
| 52 | Ga0070706_100001339 | 3300005467 | Bacteria | 26189 |
| 53 | Ga0070706_100004736 | 3300005467 | Bacteria | 13044 |
| 54 | Ga0070706_100025486 | 3300005467 | Bacteria | 5443 |
| 55 | Ga0070706_100097621 | 3300005467 | Bacteria | 2729 |
| 56 | Ga0070706_100289506 | 3300005467 | Bacteria | 1528 |
| 57 | Ga0070706_100446853 | 3300005467 | Bacteria | 1203 |
| 58 | Ga0070707_100002030 | 3300005468 | Bacteria | 19371 |
| 59 | Ga0070707_100077511 | 3300005468 | Bacteria | 3207 |
| 60 | Ga0070707_100107132 | 3300005468 | Bacteria | 2711 |
| 61 | Ga0070707_100144166 | 3300005468 | Bacteria | 2318 |
| 62 | Ga0070698_100000546 | 3300005471 | Bacteria | 40175 |
| 63 | Ga0070698_100003558 | 3300005471 | Bacteria | 17114 |
| 64 | Ga0070698_100007991 | 3300005471 | Bacteria | 11438 |
| 65 | Ga0070698_100011156 | 3300005471 | Bacteria | 9547 |
| 66 | Ga0070698_100028866 | 3300005471 | Bacteria | 5758 |
| 67 | Ga0070698_100073875 | 3300005471 | Bacteria | 3415 |
| 68 | Ga0070698_100347336 | 3300005471 | Bacteria | 1415 |
| 69 | Ga0070699_100110625 | 3300005518 | Bacteria | 2412 |
| 70 | Ga0070679_100012273 | 3300005530 | Bacteria | 8186 |
| 71 | Ga0070679_100012308 | 3300005530 | Bacteria | 8172 |
| 72 | Ga0070679_100437218 | 3300005530 | Bacteria | 1253 |
| 73 | Ga0070684_100271854 | 3300005535 | Bacteria | 1551 |
| 74 | Ga0070684_100283774 | 3300005535 | Unclassified | 1517 |
| 75 | Ga0070697_100062917 | 3300005536 | Bacteria | 3030 |
| 76 | Ga0070697_100065191 | 3300005536 | Bacteria | 2976 |
| 77 | Ga0068853_100008671 | 3300005539 | Bacteria | 8176 |
| 78 | Ga0070695_100033931 | 3300005545 | Bacteria | 3195 |
| 79 | Ga0070696_100003133 | 3300005546 | Bacteria | 11012 |
| 80 | Ga0070696_100664983 | 3300005546 | Bacteria | 846 |
| 81 | Ga0070693_100002640 | 3300005547 | Bacteria | 8255 |
| 82 | Ga0070693_100415291 | 3300005547 | Bacteria | 936 |
| 83 | Ga0068855_100243003 | 3300005563 | Bacteria | 2011 |
| 84 | Ga0070664_100218215 | 3300005564 | Bacteria | 1706 |
| 85 | Ga0070664_100682504 | 3300005564 | Bacteria | 956 |
| 86 | Ga0068857_100015977 | 3300005577 | Bacteria | 6576 |
| 87 | Ga0068857_100065726 | 3300005577 | Bacteria | 3226 |
| 88 | Ga0070702_100021040 | 3300005615 | Bacteria | 3427 |
| 89 | Ga0070702_100169464 | 3300005615 | Bacteria | 1419 |
| 90 | Ga0068864_100180433 | 3300005618 | Bacteria | 1930 |
| 91 | Ga0068861_100235527 | 3300005719 | Bacteria | 1555 |
| 92 | Ga0068861_100371229 | 3300005719 | Bacteria | 1261 |
| 93 | Ga0068870_10339339 | 3300005840 | Bacteria | 960 |
| 94 | Ga0068858_100059003 | 3300005842 | Bacteria | 3547 |
| 95 | Ga0068860_100100242 | 3300005843 | Bacteria | 2763 |
| 96 | Ga0081455_10000107 | 3300005937 | Bacteria | 93186 |
| 97 | Ga0081455_10026019 | 3300005937 | Bacteria | 5390 |
| 98 | Ga0081455_10029678 | 3300005937 | Bacteria | 4982 |
| 99 | Ga0081455_10086575 | 3300005937 | Bacteria | 2552 |
| 100 | Ga0081455_10139078 | 3300005937 | Bacteria | 1888 |
| 101 | Ga0081455_10229864 | 3300005937 | Bacteria | 1369 |
| 102 | Ga0081540_1000095 | 3300005983 | Bacteria | 92795 |
| 103 | Ga0081540_1001613 | 3300005983 | Bacteria | 19226 |
| 104 | Ga0081539_10000405 | 3300005985 | Bacteria | 92270 |
| 105 | Ga0070717_10011462 | 3300006028 | Bacteria | 6734 |
| 106 | Ga0070717_10093181 | 3300006028 | Bacteria | 2546 |
| 107 | Ga0070717_10784646 | 3300006028 | Bacteria | 866 |
| 108 | Ga0075365_10050673 | 3300006038 | Bacteria | 2739 |
| 109 | Ga0075365_10560831 | 3300006038 | Bacteria | 808 |
| 110 | Ga0075368_10026485 | 3300006042 | Bacteria | 2230 |
| 111 | Ga0075363_100026463 | 3300006048 | Bacteria | 2968 |
| 112 | Ga0075363_100059861 | 3300006048 | Bacteria | 2049 |
| 113 | Ga0075363_100138956 | 3300006048 | Bacteria | 1367 |
| 114 | Ga0075364_10030085 | 3300006051 | Bacteria | 3484 |
| 115 | Ga0075364_10036174 | 3300006051 | Bacteria | 3192 |
| 116 | Ga0070715_10023800 | 3300006163 | Bacteria | 2404 |
| 117 | Ga0070715_10028333 | 3300006163 | Bacteria | 2245 |
| 118 | Ga0070715_10202908 | 3300006163 | Bacteria | 1008 |
| 119 | Ga0070716_100002596 | 3300006173 | Bacteria | 8344 |
| 120 | Ga0070716_100144009 | 3300006173 | Bacteria | 1524 |
| 121 | Ga0070712_100002114 | 3300006175 | Bacteria | 12210 |
| 122 | Ga0070712_100039382 | 3300006175 | Bacteria | 3234 |
| 123 | Ga0070712_100149391 | 3300006175 | Bacteria | 1792 |
| 124 | Ga0070712_100366355 | 3300006175 | Bacteria | 1183 |
| 125 | Ga0075362_10015049 | 3300006177 | Bacteria | 3138 |
| 126 | Ga0075367_10007069 | 3300006178 | Bacteria | 5721 |
| 127 | Ga0075367_10017056 | 3300006178 | Bacteria | 3978 |
| 128 | Ga0097621_100075623 | 3300006237 | Bacteria | 2792 |
| 129 | Ga0097621_100733539 | 3300006237 | Bacteria | 911 |
| 130 | Ga0068871_100163066 | 3300006358 | Bacteria | 1907 |
| 131 | Ga0075428_100003999 | 3300006844 | Bacteria | 16185 |
| 132 | Ga0075428_100919129 | 3300006844 | Bacteria | 928 |
| 133 | Ga0075430_100001640 | 3300006846 | Bacteria | 18293 |
| 134 | Ga0075431_100034551 | 3300006847 | Bacteria | 5208 |
| 135 | Ga0075431_100037160 | 3300006847 | Bacteria | 5019 |
| 136 | Ga0075431_100644360 | 3300006847 | Bacteria | 1040 |
| 137 | Ga0075433_10045253 | 3300006852 | Bacteria | 3826 |
| 138 | Ga0075434_100007088 | 3300006871 | Bacteria | 10352 |
| 139 | Ga0075434_100010616 | 3300006871 | Bacteria | 8641 |
| 140 | Ga0075434_100013021 | 3300006871 | Bacteria | 7899 |
| 141 | Ga0075429_100000660 | 3300006880 | Bacteria | 26633 |
| 142 | Ga0075429_100004902 | 3300006880 | Bacteria | 11530 |
| 143 | Ga0075429_100058247 | 3300006880 | Bacteria | 3364 |
| 144 | Ga0068865_100008386 | 3300006881 | Bacteria | 6386 |
| 145 | Ga0075436_100170075 | 3300006914 | Bacteria | 1539 |
| 146 | Ga0075436_100296207 | 3300006914 | Bacteria | 1159 |
| 147 | Ga0075435_100010863 | 3300007076 | Bacteria | 6669 |
| 148 | Ga0105244_10141717 | 3300009036 | Bacteria | 1156 |
| 149 | Ga0105240_10281576 | 3300009093 | Bacteria | 1910 |
| 150 | Ga0111539_10003516 | 3300009094 | Bacteria | 20665 |
| 151 | Ga0111539_10033353 | 3300009094 | Bacteria | 6250 |
| 152 | Ga0111539_10403670 | 3300009094 | Bacteria | 1592 |
| 153 | Ga0105245_10115987 | 3300009098 | Bacteria | 2497 |
| 154 | Ga0105247_10036225 | 3300009101 | Bacteria | 3008 |
| 155 | Ga0105247_10545877 | 3300009101 | Unclassified | 851 |
| 156 | Ga0114129_10004780 | 3300009147 | Bacteria | 19142 |
| 157 | Ga0114129_10006566 | 3300009147 | Bacteria | 16509 |
| 158 | Ga0114129_10149868 | 3300009147 | Bacteria | 3192 |
| 159 | Ga0114129_10186076 | 3300009147 | Bacteria | 2822 |
| 160 | Ga0114129_10248108 | 3300009147 | Bacteria | 2391 |
| 161 | Ga0114129_10578249 | 3300009147 | Bacteria | 1458 |
| 162 | Ga0105243_10009365 | 3300009148 | Bacteria | 7464 |
| 163 | Ga0105248_10361366 | 3300009177 | Bacteria | 1634 |
| 164 | Ga0105248_10572037 | 3300009177 | Bacteria | 1275 |
| 165 | Ga0105248_10836336 | 3300009177 | Bacteria | 1039 |
| 166 | Ga0105237_10016176 | 3300009545 | Bacteria | 7759 |
| 167 | Ga0105238_10042741 | 3300009551 | Bacteria | 4588 |
| 168 | Ga0105249_10961047 | 3300009553 | Bacteria | 922 |
| 169 | Ga0105239_10045939 | 3300010375 | Bacteria | 4786 |
| 170 | Ga0105246_10021145 | 3300011119 | Bacteria | 4183 |
| 171 | Ga0105246_10049942 | 3300011119 | Bacteria | 2867 |
| 172 | Ga0105246_10089623 | 3300011119 | Bacteria | 2213 |
| 173 | Ga0105246_10097333 | 3300011119 | Bacteria | 2135 |
| 174 | Ga0157325_1000680 | 3300012485 | Bacteria | 1401 |
| 175 | Ga0157373_10090102 | 3300013100 | Bacteria | 2160 |
| 176 | Ga0157373_10224828 | 3300013100 | Bacteria | 1325 |
| 177 | Ga0157371_10324112 | 3300013102 | Bacteria | 1118 |
| 178 | Ga0157369_10048952 | 3300013105 | Bacteria | 4584 |
| 179 | Ga0157369_10166016 | 3300013105 | Bacteria | 2328 |
| 180 | Ga0157369_10796700 | 3300013105 | Bacteria | 971 |
| 181 | Ga0163162_10945825 | 3300013306 | Bacteria | 973 |
| 182 | Ga0157375_10011834 | 3300013308 | Bacteria | 7715 |
| 183 | Ga0157375_10229033 | 3300013308 | Bacteria | 2017 |
| 184 | Ga0157380_10081900 | 3300014326 | Bacteria | 2641 |
| 185 | Ga0157380_10404547 | 3300014326 | Unclassified | 1296 |
| 186 | Ga0157379_10039501 | 3300014968 | Bacteria | 4210 |
| 187 | Ga0157376_10044467 | 3300014969 | Bacteria | 3651 |
| 188 | Ga0157376_10227790 | 3300014969 | Bacteria | 1730 |
| 189 | Ga0182005_1026945 | 3300015265 | Bacteria | 1568 |
| 190 | Ga0197907_10955139 | 3300020069 | Bacteria | 2611 |
| 191 | Ga0206356_11336389 | 3300020070 | Bacteria | 3044 |
| 192 | Ga0206351_10371423 | 3300020077 | Bacteria | 1434 |
| 193 | Ga0206353_10711485 | 3300020082 | Bacteria | 15955 |
| 194 | Ga0206353_11700971 | 3300020082 | Bacteria | 2073 |
| 195 | Ga0213873_10019275 | 3300021358 | Bacteria | 1581 |
| 196 | Ga0213876_10001614 | 3300021384 | Bacteria | 13824 |
| 197 | Ga0213876_10032465 | 3300021384 | Bacteria | 2754 |
| 198 | Ga0213875_10000279 | 3300021388 | Bacteria | 50175 |
| 199 | Ga0213875_10000363 | 3300021388 | Bacteria | 42235 |
| 200 | Ga0213875_10007355 | 3300021388 | Bacteria | 5693 |
| 201 | Ga0213875_10008272 | 3300021388 | Bacteria | 5336 |
| 202 | Ga0213875_10013828 | 3300021388 | Bacteria | 3952 |
| 203 | Ga0213875_10106593 | 3300021388 | Bacteria | 1308 |
| 204 | Ga0224712_10030107 | 3300022467 | Bacteria | 1956 |
| 205 | Ga0228598_1021335 | 3300024227 | Bacteria | 1275 |
| 206 | Ga0207697_10049746 | 3300025315 | Bacteria | 1730 |
| 207 | Ga0207655_1009968 | 3300025728 | Bacteria | 5829 |
| 208 | Ga0207692_10000172 | 3300025898 | Bacteria | 20623 |
| 209 | Ga0207692_10000192 | 3300025898 | Bacteria | 20115 |
| 210 | Ga0207692_10098942 | 3300025898 | Bacteria | 1597 |
| 211 | Ga0207647_10011318 | 3300025904 | Bacteria | 6262 |
| 212 | Ga0207685_10008530 | 3300025905 | Bacteria | 2925 |
| 213 | Ga0207685_10023176 | 3300025905 | Bacteria | 2110 |
| 214 | Ga0207699_10001218 | 3300025906 | Bacteria | 12202 |
| 215 | Ga0207699_10019655 | 3300025906 | Bacteria | 3607 |
| 216 | Ga0207699_10040782 | 3300025906 | Bacteria | 2677 |
| 217 | Ga0207699_10518036 | 3300025906 | Bacteria | 862 |
| 218 | Ga0207705_10094807 | 3300025909 | Bacteria | 2189 |
| 219 | Ga0207705_10122818 | 3300025909 | Bacteria | 1928 |
| 220 | Ga0207684_10015452 | 3300025910 | Bacteria | 6568 |
| 221 | Ga0207684_10043013 | 3300025910 | Bacteria | 3829 |
| 222 | Ga0207684_10044698 | 3300025910 | Bacteria | 3756 |
| 223 | Ga0207684_10053168 | 3300025910 | Bacteria | 3438 |
| 224 | Ga0207684_10182786 | 3300025910 | Bacteria | 1808 |
| 225 | Ga0207684_10244433 | 3300025910 | Bacteria | 1548 |
| 226 | Ga0207654_10221898 | 3300025911 | Unclassified | 1254 |
| 227 | Ga0207707_10000513 | 3300025912 | Bacteria | 39738 |
| 228 | Ga0207707_10101159 | 3300025912 | Bacteria | 2519 |
| 229 | Ga0207695_10054675 | 3300025913 | Bacteria | 4166 |
| 230 | Ga0207671_10043373 | 3300025914 | Bacteria | 3326 |
| 231 | Ga0207671_10132640 | 3300025914 | Bacteria | 1913 |
| 232 | Ga0207693_10001433 | 3300025915 | Bacteria | 21142 |
| 233 | Ga0207693_10058519 | 3300025915 | Bacteria | 3019 |
| 234 | Ga0207693_10284367 | 3300025915 | Bacteria | 1296 |
| 235 | Ga0207663_10002117 | 3300025916 | Bacteria | 9467 |
| 236 | Ga0207663_10007354 | 3300025916 | Bacteria | 5706 |
| 237 | Ga0207663_10024463 | 3300025916 | Bacteria | 3478 |
| 238 | Ga0207660_10006015 | 3300025917 | Bacteria | 7876 |
| 239 | Ga0207660_10157628 | 3300025917 | Bacteria | 1749 |
| 240 | Ga0207657_10157574 | 3300025919 | Bacteria | 1846 |
| 241 | Ga0207657_10248455 | 3300025919 | Bacteria | 1419 |
| 242 | Ga0207649_10352789 | 3300025920 | Bacteria | 1089 |
| 243 | Ga0207652_10003086 | 3300025921 | Bacteria | 13899 |
| 244 | Ga0207652_10011409 | 3300025921 | Bacteria | 7164 |
| 245 | Ga0207652_10696162 | 3300025921 | Bacteria | 907 |
| 246 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 247 | Ga0207646_10032395 | 3300025922 | Bacteria | 4731 |
| 248 | Ga0207646_10044414 | 3300025922 | Bacteria | 3989 |
| 249 | Ga0207646_10048483 | 3300025922 | Bacteria | 3808 |
| 250 | Ga0207646_10220171 | 3300025922 | Bacteria | 1715 |
| 251 | Ga0207687_10104558 | 3300025927 | Bacteria | 2090 |
| 252 | Ga0207687_10160845 | 3300025927 | Bacteria | 1723 |
| 253 | Ga0207700_10000619 | 3300025928 | Bacteria | 20729 |
| 254 | Ga0207700_10075360 | 3300025928 | Bacteria | 2614 |
| 255 | Ga0207700_10097320 | 3300025928 | Bacteria | 2339 |
| 256 | Ga0207700_10197829 | 3300025928 | Bacteria | 1692 |
| 257 | Ga0207664_10000543 | 3300025929 | Bacteria | 26710 |
| 258 | Ga0207664_10001834 | 3300025929 | Bacteria | 14011 |
| 259 | Ga0207664_10021017 | 3300025929 | Bacteria | 4844 |
| 260 | Ga0207664_10032211 | 3300025929 | Bacteria | 4016 |
| 261 | Ga0207664_10066193 | 3300025929 | Bacteria | 2896 |
| 262 | Ga0207644_10020502 | 3300025931 | Bacteria | 4494 |
| 263 | Ga0207709_10055536 | 3300025935 | Bacteria | 2447 |
| 264 | Ga0207704_10028646 | 3300025938 | Bacteria | 3093 |
| 265 | Ga0207665_10001519 | 3300025939 | Bacteria | 15611 |
| 266 | Ga0207665_10002049 | 3300025939 | Bacteria | 13569 |
| 267 | Ga0207665_10005449 | 3300025939 | Bacteria | 8494 |
| 268 | Ga0207665_10154506 | 3300025939 | Bacteria | 1646 |
| 269 | Ga0207665_10485797 | 3300025939 | Bacteria | 952 |
| 270 | Ga0207691_10345790 | 3300025940 | Bacteria | 1273 |
| 271 | Ga0207689_10577836 | 3300025942 | Bacteria | 945 |
| 272 | Ga0207661_10052377 | 3300025944 | Bacteria | 3261 |
| 273 | Ga0207661_10229802 | 3300025944 | Bacteria | 1642 |
| 274 | Ga0207661_10902006 | 3300025944 | Bacteria | 814 |
| 275 | Ga0207679_10142281 | 3300025945 | Bacteria | 1941 |
| 276 | Ga0207679_10183118 | 3300025945 | Bacteria | 1735 |
| 277 | Ga0207667_10234374 | 3300025949 | Bacteria | 1879 |
| 278 | Ga0207712_10832937 | 3300025961 | Bacteria | 812 |
| 279 | Ga0207703_10122129 | 3300026035 | Bacteria | 2237 |
| 280 | Ga0207639_10008463 | 3300026041 | Bacteria | 7051 |
| 281 | Ga0207678_10000157 | 3300026067 | Bacteria | 56289 |
| 282 | Ga0207678_10016906 | 3300026067 | Bacteria | 6405 |
| 283 | Ga0207708_10179764 | 3300026075 | Unclassified | 1679 |
| 284 | Ga0207702_10026300 | 3300026078 | Bacteria | 4830 |
| 285 | Ga0207674_10019283 | 3300026116 | Bacteria | 7392 |
| 286 | Ga0207674_10130657 | 3300026116 | Bacteria | 2475 |
| 287 | Ga0207683_10036212 | 3300026121 | Bacteria | 4296 |
| 288 | Ga0207683_10081484 | 3300026121 | Bacteria | 2873 |
| 289 | Ga0207683_10264114 | 3300026121 | Bacteria | 1572 |
| 290 | Ga0207698_10116881 | 3300026142 | Bacteria | 2249 |
| 291 | Ga0268266_10081132 | 3300028379 | Bacteria | 2828 |
| 292 | Ga0268264_10026308 | 3300028381 | Bacteria | 4753 |
| 293 | Ga0268264_10083263 | 3300028381 | Bacteria | 2740 |
| 294 | Ga0265338_10013043 | 3300028800 | Bacteria | 9424 |
| 295 | Ga0265338_10013073 | 3300028800 | Bacteria | 9407 |
| 296 | Ga0265338_10217580 | 3300028800 | Bacteria | 1429 |
| 297 | Ga0265338_10333654 | 3300028800 | Bacteria | 1094 |
| 298 | Ga0265338_10404776 | 3300028800 | Bacteria | 972 |
| 299 | Ga0307512_10009654 | 3300030522 | Bacteria | 9279 |
| 300 | Ga0316177_1197193 | 3300030731 | Bacteria | 1548 |
| 301 | Ga0316176_1113610 | 3300030732 | Bacteria | 2634 |
| 302 | Ga0314311_1077865 | 3300030733 | Bacteria | 4310 |
| 303 | Ga0316180_1150129 | 3300030736 | Bacteria | 1642 |
| 304 | Ga0265330_10081617 | 3300031235 | Bacteria | 1393 |
| 305 | Ga0265325_10001703 | 3300031241 | Bacteria | 15285 |
| 306 | Ga0265325_10033132 | 3300031241 | Bacteria | 2754 |
| 307 | Ga0265340_10007600 | 3300031247 | Bacteria | 5881 |
| 308 | Ga0265340_10016457 | 3300031247 | Bacteria | 3829 |
| 309 | Ga0265340_10038501 | 3300031247 | Bacteria | 2364 |
| 310 | Ga0265339_10013459 | 3300031249 | Bacteria | 4955 |
| 311 | Ga0265339_10044690 | 3300031249 | Bacteria | 2442 |
| 312 | Ga0265339_10111098 | 3300031249 | Bacteria | 1418 |
| 313 | Ga0265316_10227831 | 3300031344 | Bacteria | 1373 |
| 314 | Ga0265316_10251289 | 3300031344 | Bacteria | 1298 |
| 315 | Ga0265316_10289682 | 3300031344 | Bacteria | 1195 |
| 316 | Ga0307408_100181954 | 3300031548 | Bacteria | 1686 |
| 317 | Ga0307408_100531615 | 3300031548 | Bacteria | 1034 |
| 318 | Ga0265314_10179683 | 3300031711 | Bacteria | 1269 |
| 319 | Ga0265342_10062926 | 3300031712 | Bacteria | 2182 |
| 320 | Ga0265342_10101868 | 3300031712 | Bacteria | 1634 |
| 321 | Ga0307405_10016785 | 3300031731 | Bacteria | 4000 |
| 322 | Ga0307405_10339438 | 3300031731 | Bacteria | 1154 |
| 323 | Ga0307405_10414089 | 3300031731 | Bacteria | 1059 |
| 324 | Ga0307410_10036917 | 3300031852 | Bacteria | 3187 |
| 325 | Ga0307406_10038338 | 3300031901 | Bacteria | 2966 |
| 326 | Ga0307412_10012455 | 3300031911 | Bacteria | 4959 |
| 327 | Ga0307412_10442299 | 3300031911 | Bacteria | 1069 |
| 328 | Ga0307409_100075539 | 3300031995 | Bacteria | 2698 |
| 329 | Ga0307409_100329267 | 3300031995 | Bacteria | 1433 |
| 330 | Ga0307409_100790549 | 3300031995 | Bacteria | 956 |
| 331 | Ga0307416_100227319 | 3300032002 | Bacteria | 1795 |
| 332 | Ga0307416_100306712 | 3300032002 | Bacteria | 1581 |
| 333 | Ga0307416_100496471 | 3300032002 | Bacteria | 1284 |
| 334 | Ga0307416_100662151 | 3300032002 | Bacteria | 1130 |
| 335 | Ga0307414_10033206 | 3300032004 | Bacteria | 3408 |
| 336 | Ga0307414_10224991 | 3300032004 | Bacteria | 1543 |
| 337 | Ga0307411_10010825 | 3300032005 | Bacteria | 4885 |
| 338 | Ga0307507_10010875 | 3300033179 | Bacteria | 11614 |
| 339 | Ga0307507_10022266 | 3300033179 | Bacteria | 7011 |
| 340 | Ga0373948_0004399 | 3300034817 | Bacteria | 2227 |
| 341 | Ga0373959_0001394 | 3300034820 | Bacteria | 3866 |
| 342 | Ga0373929_0011026 | 3300035085 | Bacteria | 1697 |
| 343 | Ga0373934_0007632 | 3300035086 | Bacteria | 4017 |
| 344 | Ga0373934_0074223 | 3300035086 | Bacteria | 1362 |
| 345 | Ga0373940_0055874 | 3300035088 | Bacteria | 1119 |
| 346 | Ga0373944_0001809 | 3300035089 | Bacteria | 5400 |
| 347 | Ga0373944_0036087 | 3300035089 | Bacteria | 1509 |
| 348 | Ga0373949_0084768 | 3300035090 | Bacteria | 849 |
| 349 | Ga0373923_0069748 | 3300035111 | Bacteria | 1507 |
| 350 | Ga0373923_0105881 | 3300035111 | Bacteria | 1244 |
| 351 | Ga0373923_0136697 | 3300035111 | Bacteria | 1105 |
| 352 | Ga0373923_0188861 | 3300035111 | Bacteria | 949 |
| 353 | Ga0373936_0014217 | 3300035113 | Bacteria | 3041 |
| 354 | Ga0373936_0015889 | 3300035113 | Bacteria | 2888 |
| 355 | Ga0373936_0020596 | 3300035113 | Bacteria | 2562 |
| 356 | Ga0373945_0000676 | 3300035116 | Bacteria | 9841 |
| 357 | Ga0373953_0022219 | 3300035117 | Bacteria | 2389 |
| 358 | Ga0373953_0092825 | 3300035117 | Bacteria | 1264 |
| 359 | Ga0373954_0323420 | 3300035118 | Bacteria | 761 |
| 360 | Ga0373956_0022142 | 3300035119 | Bacteria | 2716 |
| 361 | Ga0373956_0030203 | 3300035119 | Bacteria | 2367 |
| 362 | Ga0373957_0006783 | 3300035120 | Bacteria | 3626 |
| 363 | Ga0373957_0012473 | 3300035120 | Bacteria | 2863 |
| 364 | Ga0373957_0022067 | 3300035120 | Bacteria | 2265 |
| 365 | Ga0373957_0137827 | 3300035120 | Bacteria | 996 |
| 366 | Ga0373943_0000554 | 3300035170 | Bacteria | 16138 |
| 367 | Ga0373943_0078246 | 3300035170 | Bacteria | 1690 |
| 368 | Ga0373943_0113499 | 3300035170 | Bacteria | 1432 |
| 369 | Ga0373946_0000088 | 3300035171 | Bacteria | 25288 |
| 370 | Ga0373946_0165997 | 3300035171 | Bacteria | 1039 |
| 371 | Ga0373946_0205385 | 3300035171 | Bacteria | 945 |
| 372 | Ga0373955_0003886 | 3300035172 | Bacteria | 6589 |
| 373 | Ga0373955_0016557 | 3300035172 | Bacteria | 3631 |
| 374 | Ga0373955_0289422 | 3300035172 | Bacteria | 986 |
| 375 | Ga0373962_0001724 | 3300035242 | Bacteria | 5200 |
| 376 | Ga0373924_0000756 | 3300035410 | Bacteria | 10046 |
| 377 | Ga0373924_0025436 | 3300035410 | Bacteria | 2341 |
| 378 | Ga0373924_0038827 | 3300035410 | Bacteria | 1943 |
| 379 | Ga0373931_0031859 | 3300035691 | Bacteria | 2724 |
| 380 | Ga0373935_0004943 | 3300035692 | Bacteria | 7840 |
| 381 | Ga0373935_0005239 | 3300035692 | Bacteria | 7637 |
| 382 | Ga0373927_0003620 | 3300035695 | Bacteria | 11023 |
| 383 | Ga0373933_0001897 | 3300035724 | Bacteria | 12059 |
| 384 | Ga0373933_0004727 | 3300035724 | Bacteria | 7447 |
| 385 | Ga0373933_0009789 | 3300035724 | Bacteria | 5245 |
| 386 | Ga0373933_0110754 | 3300035724 | Bacteria | 1712 |
| 387 | Ga0373947_0000815 | 3300035725 | Bacteria | 18801 |
| 388 | Ga0373947_0139581 | 3300035725 | Bacteria | 1553 |
| 389 | Ga0373947_0205357 | 3300035725 | Bacteria | 1290 |
| 390 | Ga0373947_0338758 | 3300035725 | Bacteria | 1008 |
| 391 | Ga0373937_0032735 | 3300036401 | Bacteria | 4716 |
| 392 | Ga0373937_0089238 | 3300036401 | Bacteria | 2854 |
| 393 | Ga0373937_0266723 | 3300036401 | Bacteria | 1615 |
| 394 | Ga0373937_0336814 | 3300036401 | Bacteria | 1428 |
| 395 | Ga0373925_0002262 | 3300037068 | Bacteria | 15582 |
| 396 | Ga0373925_0103984 | 3300037068 | Bacteria | 2186 |
| 397 | Ga0395899_0008829 | 3300037312 | Bacteria | 7758 |
| 398 | Ga0395899_0076950 | 3300037312 | Bacteria | 2435 |
| 399 | Ga0395899_0171502 | 3300037312 | Bacteria | 1528 |
| 400 | Ga0395899_0325149 | 3300037312 | Bacteria | 1035 |
| 401 | Ga0395900_0035842 | 3300037418 | Bacteria | 5112 |
| 402 | Ga0395900_0038293 | 3300037418 | Bacteria | 4942 |
| 403 | Ga0395900_0048798 | 3300037418 | Bacteria | 4360 |
| 404 | Ga0395900_0063634 | 3300037418 | Bacteria | 3792 |
| 405 | Ga0395900_0076186 | 3300037418 | Bacteria | 3448 |
| 406 | Ga0395900_0108161 | 3300037418 | Bacteria | 2857 |
| 407 | Ga0395900_0286653 | 3300037418 | Bacteria | 1637 |
| 408 | Ga0395898_0002402 | 3300037466 | Bacteria | 22230 |
| 409 | Ga0395898_0019032 | 3300037466 | Bacteria | 6992 |
| 410 | Ga0395898_0043998 | 3300037466 | Bacteria | 4398 |
| 411 | Ga0395898_0056245 | 3300037466 | Bacteria | 3835 |
| 412 | Ga0395898_0109593 | 3300037466 | Bacteria | 2647 |
| 413 | Ga0395905_0132127 | 3300037471 | Bacteria | 2348 |
| 414 | Ga0395905_0227022 | 3300037471 | Bacteria | 1746 |
| 415 | Ga0395905_0560328 | 3300037471 | Bacteria | 1044 |
| 416 | Ga0436364_0028797 | 3300037853 | Bacteria | 5808 |
| 417 | Ga0436364_0121732 | 3300037853 | Bacteria | 5869 |
| 418 | Ga0436364_0426348 | 3300037853 | Bacteria | 32972 |
| 419 | Ga0436364_0549328 | 3300037853 | Bacteria | 13439 |
| 420 | Ga0436364_1427311 | 3300037853 | Bacteria | 97691 |
| 421 | Ga0436364_1439262 | 3300037853 | Bacteria | 1081 |
| 422 | Ga0436364_1529133 | 3300037853 | Bacteria | 6866 |
| 423 | Ga0436364_1545210 | 3300037853 | Bacteria | 2129 |
| 424 | Ga0395901_0082064 | 3300038443 | Bacteria | 3368 |
| 425 | Ga0395901_0091986 | 3300038443 | Bacteria | 3175 |
| 426 | Ga0395901_0094809 | 3300038443 | Bacteria | 3127 |
| 427 | Ga0395901_0199365 | 3300038443 | Bacteria | 2098 |
| 428 | Ga0395901_0220117 | 3300038443 | Bacteria | 1984 |
| 429 | Ga0395901_0801951 | 3300038443 | Bacteria | 930 |
| 430 | Ga0436365_0824727 | 3300039437 | Bacteria | 1295 |
| 431 | Ga0436365_1131341 | 3300039437 | Bacteria | 1413 |
| 432 | Ga0436365_1228920 | 3300039437 | Bacteria | 1024 |
| 433 | Ga0436365_1473848 | 3300039437 | Bacteria | 56626 |
| 434 | Ga0436365_1759695 | 3300039437 | Bacteria | 5636 |
| 435 | Ga0436363_0439343 | 3300039450 | Bacteria | 2981 |
| 436 | Ga0436363_0809494 | 3300039450 | Bacteria | 856 |
| 437 | Ga0436363_1193301 | 3300039450 | Bacteria | 2137 |
| 438 | Ga0436363_1305175 | 3300039450 | Bacteria | 918 |
| 439 | Ga0436362_0353422 | 3300039453 | Bacteria | 5701 |
| 440 | Ga0439436_0019587 | 3300041404 | Bacteria | 2019 |
| 441 | Ga0451797_0119597 | 3300041453 | Bacteria | 5049 |
| 442 | Ga0451837_0443190 | 3300041494 | Bacteria | 1545 |
| 443 | Ga0439442_000037 | 3300042002 | Bacteria | 29843 |
| 444 | Ga0439442_000671 | 3300042002 | Bacteria | 7263 |
| 445 | Ga0439457_000224 | 3300042014 | Bacteria | 15165 |
| 446 | Ga0439463_038687 | 3300042016 | Bacteria | 1211 |
| 447 | Ga0439440_0083101 | 3300042993 | Bacteria | 850 |
| 448 | Ga0466969_0093538 | 3300044656 | Bacteria | 1422 |
| 449 | Ga0466972_0020758 | 3300044658 | Bacteria | 3281 |
| 450 | Ga0466965_0009750 | 3300044683 | Bacteria | 4468 |
| 451 | Ga0466965_0053636 | 3300044683 | Bacteria | 2004 |
| 452 | Ga0466965_0130787 | 3300044683 | Bacteria | 1302 |
| 453 | Ga0466965_0160862 | 3300044683 | Bacteria | 1177 |
| 454 | Ga0466966_0046573 | 3300044684 | Bacteria | 2768 |
| 455 | Ga0466966_0069037 | 3300044684 | Bacteria | 2217 |
| 456 | Ga0466961_0131005 | 3300044693 | Bacteria | 1572 |
| 457 | Ga0466961_0141696 | 3300044693 | Bacteria | 1505 |
| 458 | Ga0466961_0387631 | 3300044693 | Bacteria | 848 |
| 459 | Ga0466963_0001620 | 3300044694 | Bacteria | 12244 |
| 460 | Ga0466963_0016067 | 3300044694 | Bacteria | 4648 |
| 461 | Ga0466963_0222812 | 3300044694 | Bacteria | 1321 |
| 462 | Ga0466963_0588407 | 3300044694 | Bacteria | 786 |
| 463 | Ga0466971_0008840 | 3300044719 | Bacteria | 4398 |
| 464 | Ga0466971_0051690 | 3300044719 | Bacteria | 1850 |
| 465 | Ga0466970_0006565 | 3300044765 | Bacteria | 5814 |
| 466 | Ga0466970_0028964 | 3300044765 | Bacteria | 2913 |
| 467 | Ga0466970_0261785 | 3300044765 | Bacteria | 970 |
| 468 | Ga0466957_0010347 | 3300044842 | Bacteria | 5350 |
| 469 | Ga0466957_0175644 | 3300044842 | Bacteria | 1397 |
| 470 | Ga0466960_0002868 | 3300044901 | Bacteria | 6538 |
| 471 | Ga0466960_0292851 | 3300044901 | Bacteria | 915 |
| 472 | Ga0466960_0295601 | 3300044901 | Bacteria | 911 |
| 473 | Ga0466959_0063230 | 3300045049 | Bacteria | 2688 |
| 474 | Ga0466959_0320485 | 3300045049 | Bacteria | 1060 |
| 475 | Ga0466958_0000994 | 3300045836 | Bacteria | 12823 |
| 476 | Ga0466967_0017821 | 3300045976 | Bacteria | 5654 |
| 477 | Ga0466967_0042911 | 3300045976 | Bacteria | 3913 |
| 478 | Ga0466967_0108621 | 3300045976 | Bacteria | 2546 |
| 479 | Ga0466967_0112602 | 3300045976 | Bacteria | 2502 |
| 480 | Ga0466967_0119804 | 3300045976 | Bacteria | 2430 |
| 481 | Ga0466967_0295511 | 3300045976 | Bacteria | 1557 |
| 482 | Ga0466967_0596829 | 3300045976 | Bacteria | 1090 |
| 483 | Ga0495592_0005858 | 3300046454 | Bacteria | 9120 |
| 484 | Ga0495592_0104531 | 3300046454 | Bacteria | 2013 |
| 485 | Ga0495603_0051703 | 3300046455 | Bacteria | 2441 |
| 486 | Ga0495603_0250502 | 3300046455 | Bacteria | 1020 |
| 487 | Ga0495629_0002998 | 3300046459 | Bacteria | 12846 |
| 488 | Ga0495629_0051130 | 3300046459 | Bacteria | 2892 |
| 489 | Ga0495629_0081566 | 3300046459 | Bacteria | 2257 |
| 490 | Ga0495629_0090675 | 3300046459 | Bacteria | 2133 |
| 491 | Ga0495629_0112288 | 3300046459 | Bacteria | 1899 |
| 492 | Ga0495629_0253729 | 3300046459 | Bacteria | 1210 |
| 493 | Ga0495641_0026622 | 3300046461 | Bacteria | 2819 |
| 494 | Ga0495641_0035703 | 3300046461 | Bacteria | 2340 |
| 495 | Ga0495641_0046978 | 3300046461 | Bacteria | 1983 |
| 496 | Ga0495651_0014823 | 3300046462 | Bacteria | 6028 |
| 497 | Ga0495651_0016773 | 3300046462 | Bacteria | 5673 |
| 498 | Ga0495651_0157995 | 3300046462 | Bacteria | 1627 |
| 499 | Ga0495651_0250588 | 3300046462 | Bacteria | 1209 |
| 500 | Ga0495651_0322429 | 3300046462 | Bacteria | 1029 |
| 501 | Ga0495653_0002903 | 3300046463 | Bacteria | 13704 |
| 502 | Ga0495653_0022289 | 3300046463 | Bacteria | 5126 |
| 503 | Ga0495653_0031632 | 3300046463 | Bacteria | 4204 |
| 504 | Ga0495653_0097763 | 3300046463 | Bacteria | 2132 |
| 505 | Ga0495653_0131365 | 3300046463 | Bacteria | 1772 |
| 506 | Ga0495653_0140712 | 3300046463 | Bacteria | 1697 |
| 507 | Ga0495582_0007038 | 3300046473 | Bacteria | 6254 |
| 508 | Ga0495582_0013945 | 3300046473 | Bacteria | 4427 |
| 509 | Ga0495582_0061641 | 3300046473 | Bacteria | 2071 |
| 510 | Ga0495639_0000532 | 3300046475 | Bacteria | 17867 |
| 511 | Ga0495639_0038543 | 3300046475 | Bacteria | 2146 |
| 512 | Ga0495639_0053152 | 3300046475 | Bacteria | 1845 |
| 513 | Ga0495639_0065181 | 3300046475 | Bacteria | 1675 |
| 514 | Ga0495662_0009293 | 3300046476 | Bacteria | 4823 |
| 515 | Ga0495664_0011303 | 3300046477 | Bacteria | 5031 |
| 516 | Ga0495664_0036995 | 3300046477 | Bacteria | 2879 |
| 517 | Ga0495664_0055076 | 3300046477 | Bacteria | 2366 |
| 518 | Ga0495664_0166705 | 3300046477 | Bacteria | 1336 |
| 519 | Ga0495594_0076675 | 3300046499 | Bacteria | 1864 |
| 520 | Ga0495594_0253819 | 3300046499 | Bacteria | 1002 |
| 521 | Ga0495608_0009357 | 3300046511 | Bacteria | 6850 |
| 522 | Ga0495608_0023867 | 3300046511 | Bacteria | 4184 |
| 523 | Ga0495608_0239789 | 3300046511 | Bacteria | 1133 |
| 524 | Ga0495608_0266034 | 3300046511 | Bacteria | 1066 |
| 525 | Ga0495608_0380770 | 3300046511 | Bacteria | 865 |
| 526 | Ga0495618_0025596 | 3300046514 | Bacteria | 3662 |
| 527 | Ga0495618_0058897 | 3300046514 | Bacteria | 2433 |
| 528 | Ga0495618_0189286 | 3300046514 | Bacteria | 1305 |
| 529 | Ga0495628_0009366 | 3300046516 | Bacteria | 8362 |
| 530 | Ga0495628_0065292 | 3300046516 | Bacteria | 2847 |
| 531 | Ga0495628_0126871 | 3300046516 | Bacteria | 1954 |
| 532 | Ga0495628_0208502 | 3300046516 | Bacteria | 1470 |
| 533 | Ga0495630_0008061 | 3300046517 | Bacteria | 7573 |
| 534 | Ga0495630_0019030 | 3300046517 | Bacteria | 5047 |
| 535 | Ga0495630_0047208 | 3300046517 | Bacteria | 3221 |
| 536 | Ga0495630_0141044 | 3300046517 | Bacteria | 1832 |
| 537 | Ga0495666_0055655 | 3300046526 | Bacteria | 1895 |
| 538 | Ga0495652_0005483 | 3300046529 | Bacteria | 11951 |
| 539 | Ga0495652_0043128 | 3300046529 | Bacteria | 3887 |
| 540 | Ga0495652_0050725 | 3300046529 | Bacteria | 3547 |
| 541 | Ga0495665_0007538 | 3300046531 | Bacteria | 5890 |
| 542 | Ga0495665_0018575 | 3300046531 | Bacteria | 3736 |
| 543 | Ga0495665_0021026 | 3300046531 | Bacteria | 3506 |
| 544 | Ga0495665_0057936 | 3300046531 | Bacteria | 2045 |
| 545 | Ga0495665_0115215 | 3300046531 | Bacteria | 1408 |
| 546 | Ga0495640_0003176 | 3300046533 | Bacteria | 13238 |
| 547 | Ga0495640_0086670 | 3300046533 | Bacteria | 2073 |
| 548 | Ga0495640_0157249 | 3300046533 | Bacteria | 1458 |
| 549 | Ga0495640_0169756 | 3300046533 | Bacteria | 1394 |
| 550 | Ga0495640_0260645 | 3300046533 | Bacteria | 1083 |
| 551 | Ga0495586_0000632 | 3300046535 | Bacteria | 20286 |
| 552 | Ga0495587_0004127 | 3300046536 | Bacteria | 9604 |
| 553 | Ga0495587_0031177 | 3300046536 | Bacteria | 3230 |
| 554 | Ga0495587_0064665 | 3300046536 | Bacteria | 2137 |
| 555 | Ga0495587_0168296 | 3300046536 | Bacteria | 1245 |
| 556 | Ga0495645_0018671 | 3300046543 | Bacteria | 4984 |
| 557 | Ga0495645_0055890 | 3300046543 | Bacteria | 2865 |
| 558 | Ga0495645_0204158 | 3300046543 | Bacteria | 1338 |
| 559 | Ga0495645_0248081 | 3300046543 | Bacteria | 1184 |
| 560 | Ga0495667_0028601 | 3300046559 | Bacteria | 3754 |
| 561 | Ga0495667_0029607 | 3300046559 | Bacteria | 3685 |
| 562 | Ga0495667_0030175 | 3300046559 | Bacteria | 3646 |
| 563 | Ga0495667_0053905 | 3300046559 | Bacteria | 2647 |
| 564 | Ga0495667_0346623 | 3300046559 | Bacteria | 938 |
| 565 | Ga0495656_0124346 | 3300046615 | Bacteria | 1221 |
| 566 | Ga0495656_0249745 | 3300046615 | Bacteria | 896 |
| 567 | Ga0495668_0136367 | 3300046616 | Bacteria | 1343 |
| 568 | Ga0495634_0019891 | 3300046642 | Bacteria | 4765 |
| 569 | Ga0495634_0024993 | 3300046642 | Bacteria | 4187 |
| 570 | Ga0495634_0047224 | 3300046642 | Bacteria | 2902 |
| 571 | Ga0495634_0066340 | 3300046642 | Bacteria | 2390 |
| 572 | Ga0495635_0001151 | 3300046663 | Bacteria | 17639 |
| 573 | Ga0495635_0004086 | 3300046663 | Bacteria | 10129 |
| 574 | Ga0495635_0021859 | 3300046663 | Bacteria | 4459 |
| 575 | Ga0495635_0216452 | 3300046663 | Bacteria | 1296 |
| 576 | Ga0495588_0000765 | 3300046674 | Bacteria | 14594 |
| 577 | Ga0495588_0126867 | 3300046674 | Bacteria | 1346 |
| 578 | Ga0495588_0132378 | 3300046674 | Bacteria | 1316 |
| 579 | Ga0495657_0043253 | 3300046675 | Bacteria | 3072 |
| 580 | Ga0495657_0046910 | 3300046675 | Bacteria | 2923 |
| 581 | Ga0495657_0055790 | 3300046675 | Bacteria | 2634 |
| 582 | Ga0495657_0072408 | 3300046675 | Bacteria | 2248 |
| 583 | Ga0495657_0073703 | 3300046675 | Bacteria | 2223 |
| 584 | Ga0495599_0070639 | 3300046678 | Bacteria | 2179 |
| 585 | Ga0495599_0080677 | 3300046678 | Bacteria | 2031 |
| 586 | Ga0495599_0148356 | 3300046678 | Bacteria | 1453 |
| 587 | Ga0495623_0070324 | 3300046679 | Bacteria | 2180 |
| 588 | Ga0495623_0275698 | 3300046679 | Bacteria | 937 |
| 589 | Ga0495646_0002600 | 3300046680 | Bacteria | 11130 |
| 590 | Ga0495646_0018691 | 3300046680 | Bacteria | 4389 |
| 591 | Ga0495646_0075625 | 3300046680 | Bacteria | 1974 |
| 592 | Ga0495646_0126454 | 3300046680 | Bacteria | 1442 |
| 593 | Ga0495647_0245264 | 3300046681 | Bacteria | 796 |
| 594 | Ga0495658_0006826 | 3300046683 | Bacteria | 5621 |
| 595 | Ga0495658_0248423 | 3300046683 | Bacteria | 1118 |
| 596 | Ga0495613_0018649 | 3300046689 | Bacteria | 5174 |
| 597 | Ga0495613_0034019 | 3300046689 | Bacteria | 3785 |
| 598 | Ga0495613_0071074 | 3300046689 | Bacteria | 2537 |
| 599 | Ga0495613_0089590 | 3300046689 | Bacteria | 2229 |
| 600 | Ga0495613_0159765 | 3300046689 | Bacteria | 1604 |
| 601 | Ga0495613_0190694 | 3300046689 | Bacteria | 1448 |
| 602 | Ga0495613_0215672 | 3300046689 | Bacteria | 1348 |
| 603 | Ga0495624_0003920 | 3300046690 | Bacteria | 10962 |
| 604 | Ga0495624_0008780 | 3300046690 | Bacteria | 7028 |
| 605 | Ga0495624_0064030 | 3300046690 | Bacteria | 2298 |
| 606 | Ga0495624_0094526 | 3300046690 | Bacteria | 1843 |
| 607 | Ga0495600_0003586 | 3300046809 | Bacteria | 9140 |
| 608 | Ga0495600_0026915 | 3300046809 | Bacteria | 3715 |
| 609 | Ga0495600_0054646 | 3300046809 | Bacteria | 2608 |
| 610 | Ga0495581_0034269 | 3300047315 | Bacteria | 2937 |
| 611 | Ga0495581_0213747 | 3300047315 | Bacteria | 1127 |
| 612 | Ga0495604_0029667 | 3300047317 | Bacteria | 4351 |
| 613 | Ga0495604_0036076 | 3300047317 | Bacteria | 3900 |
| 614 | Ga0495604_0037215 | 3300047317 | Bacteria | 3833 |
| 615 | Ga0495604_0148313 | 3300047317 | Bacteria | 1669 |
| 616 | Ga0495604_0229642 | 3300047317 | Bacteria | 1273 |
| 617 | Ga0495604_0260188 | 3300047317 | Bacteria | 1180 |
| 618 | Ga0495674_0003395 | 3300047319 | Bacteria | 15469 |
| 619 | Ga0495674_0069694 | 3300047319 | Bacteria | 3040 |
| 620 | Ga0495674_0080318 | 3300047319 | Bacteria | 2799 |
| 621 | Ga0495674_0100660 | 3300047319 | Bacteria | 2459 |
| 622 | Ga0495674_0240061 | 3300047319 | Bacteria | 1493 |
| 623 | Ga0495676_0029713 | 3300047321 | Bacteria | 4651 |
| 624 | Ga0495676_0111551 | 3300047321 | Bacteria | 2005 |
| 625 | Ga0495676_0342028 | 3300047321 | Bacteria | 1001 |
| 626 | Ga0495676_0405856 | 3300047321 | Bacteria | 903 |
| 627 | Ga0495680_0003725 | 3300047322 | Bacteria | 14867 |
| 628 | Ga0495680_0006511 | 3300047322 | Bacteria | 10839 |
| 629 | Ga0495680_0015991 | 3300047322 | Bacteria | 6455 |
| 630 | Ga0495680_0034757 | 3300047322 | Bacteria | 4066 |
| 631 | Ga0495680_0073690 | 3300047322 | Bacteria | 2594 |
| 632 | Ga0495680_0123284 | 3300047322 | Bacteria | 1911 |
| 633 | Ga0495675_0003832 | 3300047444 | Bacteria | 9106 |
| 634 | Ga0495675_0027687 | 3300047444 | Bacteria | 3612 |
| 635 | Ga0495675_0054938 | 3300047444 | Bacteria | 2526 |
| 636 | Ga0495675_0083834 | 3300047444 | Bacteria | 2006 |
| 637 | Ga0495675_0222360 | 3300047444 | Bacteria | 1142 |
| 638 | Ga0495684_0001405 | 3300047471 | Bacteria | 19281 |
| 639 | Ga0495684_0018126 | 3300047471 | Bacteria | 5426 |
| 640 | Ga0495684_0068266 | 3300047471 | Bacteria | 2703 |
| 641 | Ga0495684_0243113 | 3300047471 | Bacteria | 1312 |
| 642 | Ga0495684_0246378 | 3300047471 | Bacteria | 1301 |
| 643 | Ga0495593_0005742 | 3300047673 | Bacteria | 7325 |
| 644 | Ga0495593_0016271 | 3300047673 | Bacteria | 4198 |
| 645 | Ga0495593_0040446 | 3300047673 | Bacteria | 2510 |
| 646 | Ga0495593_0078437 | 3300047673 | Bacteria | 1710 |
| 647 | Ga0495602_0081964 | 3300048088 | Bacteria | 2709 |
| 648 | Ga0495602_0089498 | 3300048088 | Bacteria | 2559 |
| 649 | Ga0495602_0167355 | 3300048088 | Bacteria | 1709 |
| 650 | Ga0495614_0046931 | 3300048089 | Bacteria | 1852 |
| 651 | Ga0495614_0059558 | 3300048089 | Bacteria | 1640 |
| 652 | Ga0496100_0033888 | 3300048903 | Bacteria | 3199 |
| 653 | Ga0496100_0049759 | 3300048903 | Bacteria | 2712 |
| 654 | Ga0496101_0007369 | 3300048904 | Bacteria | 7126 |
| 655 | Ga0496101_0043696 | 3300048904 | Bacteria | 3203 |
| 656 | Ga0496101_0258127 | 3300048904 | Bacteria | 1359 |
| 657 | Ga0496101_0770034 | 3300048904 | Bacteria | 759 |
| 658 | Ga0496102_0014892 | 3300048905 | Bacteria | 6765 |
| 659 | Ga0496102_0077427 | 3300048905 | Bacteria | 3061 |
| 660 | Ga0496102_0422077 | 3300048905 | Unclassified | 1253 |
| 661 | Ga0496103_0000898 | 3300048906 | Bacteria | 21446 |
| 662 | Ga0496104_0018338 | 3300048907 | Bacteria | 6386 |
| 663 | Ga0496104_0040418 | 3300048907 | Bacteria | 4371 |
| 664 | Ga0496105_0133367 | 3300048908 | Bacteria | 2046 |
| 665 | Ga0496105_0145354 | 3300048908 | Bacteria | 1950 |
| 666 | Ga0496105_0175632 | 3300048908 | Bacteria | 1755 |
| 667 | Ga0496105_0332690 | 3300048908 | Bacteria | 1215 |
| 668 | Ga0496106_0006772 | 3300048909 | Bacteria | 8482 |
| 669 | Ga0496106_0065172 | 3300048909 | Bacteria | 2773 |
| 670 | Ga0496106_0718278 | 3300048909 | Unclassified | 796 |
| 671 | Ga0496107_0006344 | 3300048910 | Bacteria | 8129 |
| 672 | Ga0496107_0189978 | 3300048910 | Bacteria | 1526 |
| 673 | Ga0496107_0239570 | 3300048910 | Bacteria | 1350 |
| 674 | Ga0496107_0336434 | 3300048910 | Bacteria | 1123 |
| 675 | Ga0496108_0083258 | 3300048911 | Bacteria | 2713 |
| 676 | Ga0496108_0352393 | 3300048911 | Bacteria | 1284 |
| 677 | Ga0496108_0456367 | 3300048911 | Bacteria | 1116 |
| 678 | Ga0496108_0566374 | 3300048911 | Bacteria | 991 |
| 679 | Ga0496109_0011430 | 3300048912 | Bacteria | 7632 |
| 680 | Ga0496109_0120685 | 3300048912 | Bacteria | 2442 |
| 681 | Ga0496110_0030486 | 3300048913 | Bacteria | 4650 |
| 682 | Ga0496111_0034956 | 3300048914 | Bacteria | 3590 |
| 683 | Ga0496112_0044319 | 3300048915 | Bacteria | 4359 |
| 684 | Ga0496112_0334281 | 3300048915 | Bacteria | 1459 |
| 685 | Ga0496112_0359854 | 3300048915 | Bacteria | 1397 |
| 686 | Ga0496112_0518048 | 3300048915 | Bacteria | 1127 |
| 687 | Ga0496113_0060560 | 3300048916 | Bacteria | 2854 |
| 688 | Ga0496114_0027387 | 3300048917 | Bacteria | 4668 |
| 689 | Ga0496114_0053121 | 3300048917 | Bacteria | 3377 |
| 690 | Ga0496114_0181776 | 3300048917 | Bacteria | 1837 |
| 691 | Ga0496114_0254182 | 3300048917 | Bacteria | 1546 |
| 692 | Ga0496114_0476399 | 3300048917 | Bacteria | 1104 |
| 693 | Ga0496115_0015138 | 3300048918 | Bacteria | 5846 |
| 694 | Ga0496115_0029459 | 3300048918 | Bacteria | 4311 |
| 695 | Ga0496115_0079414 | 3300048918 | Bacteria | 2670 |
| 696 | Ga0496126_0000048 | 3300048929 | Bacteria | 317977 |
| 697 | Ga0501031_0005992 | 3300049568 | Bacteria | 7935 |
| 698 | Ga0501032_0000831 | 3300049569 | Bacteria | 25090 |
| 699 | Ga0501032_0021761 | 3300049569 | Bacteria | 4455 |
| 700 | Ga0501034_0000669 | 3300049571 | Bacteria | 52088 |
| 701 | Ga0501034_0075948 | 3300049571 | Bacteria | 3367 |
| 702 | Ga0501036_0224115 | 3300049572 | Bacteria | 1578 |
| 703 | Ga0501037_0075983 | 3300049573 | Bacteria | 2439 |
| 704 | Ga0501038_0043793 | 3300049574 | Bacteria | 3891 |
| 705 | Ga0501038_0315640 | 3300049574 | Bacteria | 1223 |
| 706 | Ga0501039_0123258 | 3300049575 | Bacteria | 2032 |
| 707 | Ga0501039_0212363 | 3300049575 | Bacteria | 1522 |
| 708 | Ga0501040_0002929 | 3300049576 | Bacteria | 11042 |
| 709 | Ga0501041_0234681 | 3300049577 | Bacteria | 1152 |
| 710 | Ga0501042_0000567 | 3300049578 | Bacteria | 19534 |
| 711 | Ga0501043_0004750 | 3300049579 | Bacteria | 11019 |
| 712 | Ga0501043_0043761 | 3300049579 | Bacteria | 3520 |
| 713 | Ga0501046_0094491 | 3300049580 | Bacteria | 2298 |
| 714 | Ga0501047_0000660 | 3300049581 | Bacteria | 36046 |
| 715 | Ga0501047_0289894 | 3300049581 | Bacteria | 1480 |
| 716 | Ga0501048_0018382 | 3300049582 | Bacteria | 5141 |
| 717 | Ga0501048_0095709 | 3300049582 | Bacteria | 2094 |
| 718 | Ga0501067_0004614 | 3300049583 | Bacteria | 7627 |
| 719 | Ga0501067_0186602 | 3300049583 | Bacteria | 1155 |
| 720 | Ga0501069_0029739 | 3300049585 | Bacteria | 2999 |
| 721 | Ga0501069_0270930 | 3300049585 | Bacteria | 992 |
| 722 | Ga0501070_0037439 | 3300049586 | Bacteria | 4050 |
| 723 | Ga0501070_0068682 | 3300049586 | Bacteria | 2934 |
| 724 | Ga0501070_0314213 | 3300049586 | Bacteria | 1275 |
| 725 | Ga0501070_0615048 | 3300049586 | Bacteria | 865 |
| 726 | Ga0501071_0040853 | 3300049587 | Bacteria | 3321 |
| 727 | Ga0501071_0181938 | 3300049587 | Bacteria | 1575 |
| 728 | Ga0501072_0182905 | 3300049588 | Bacteria | 1672 |
| 729 | Ga0501075_0131552 | 3300049591 | Bacteria | 1906 |
| 730 | Ga0501076_0165756 | 3300049592 | Bacteria | 1801 |
| 731 | Ga0501079_0192640 | 3300049741 | Bacteria | 1591 |
| 732 | Ga0501079_0205287 | 3300049741 | Bacteria | 1539 |
| 733 | Ga0501081_0308830 | 3300049743 | Bacteria | 1161 |
| 734 | Ga0501083_0344857 | 3300049744 | Bacteria | 968 |
| 735 | Ga0501035_0072092 | 3300049822 | Bacteria | 3058 |
| 736 | Ga0501035_0121303 | 3300049822 | Bacteria | 2285 |
| 737 | Ga0501044_0041692 | 3300049823 | Bacteria | 4779 |
| 738 | Ga0501045_0002992 | 3300049824 | Bacteria | 11565 |
| 739 | Ga0501045_0166226 | 3300049824 | Bacteria | 1643 |
| 740 | nmdc:mga03683_78679_c1 | 3300050489 | Bacteria | 1420 |
| 741 | nmdc:mga00v17_46376_c1 | 3300050491 | Bacteria | 2629 |
| 742 | nmdc:mga0yw44_126493_c1 | 3300050492 | Bacteria | 1651 |
| 743 | nmdc:mga0yw44_56449_c1 | 3300050492 | Bacteria | 2392 |
| 744 | nmdc:mga06z11_208210_c1 | 3300050494 | Bacteria | 1138 |
| 745 | nmdc:mga06z11_242655_c1 | 3300050494 | Bacteria | 1059 |
| 746 | nmdc:mga06z11_29740_c1 | 3300050494 | Bacteria | 2635 |
| 747 | nmdc:mga05p37_155734_c1 | 3300050507 | Bacteria | 2793 |
| 748 | nmdc:mga05p37_261389_c1 | 3300050507 | Bacteria | 2071 |
| 749 | nmdc:mga05p37_815466_c1 | 3300050507 | Bacteria | 1019 |
| 750 | nmdc:mga09592_2829_c1 | 3300050508 | Bacteria | 14063 |
| 751 | nmdc:mga09592_329566_c1 | 3300050508 | Bacteria | 1322 |
| 752 | nmdc:mga09592_8866_c1 | 3300050508 | Bacteria | 8180 |
| 753 | nmdc:mga0qj67_140821_c1 | 3300050509 | Bacteria | 1956 |
| 754 | nmdc:mga0qj67_150568_c1 | 3300050509 | Bacteria | 1888 |
| 755 | nmdc:mga0qj67_168378_c1 | 3300050509 | Bacteria | 1779 |
| 756 | nmdc:mga0qj67_270961_c1 | 3300050509 | Bacteria | 1377 |
| 757 | nmdc:mga0qj67_84154_c1 | 3300050509 | Bacteria | 2550 |
| 758 | nmdc:mga06r32_148857_c1 | 3300050510 | Bacteria | 2319 |
| 759 | nmdc:mga06r32_1610_c1 | 3300050510 | Bacteria | 20351 |
| 760 | nmdc:mga06r32_524701_c1 | 3300050510 | Bacteria | 1160 |
| 761 | nmdc:mga08y16_44235_c1 | 3300050511 | Bacteria | 4665 |
| 762 | nmdc:mga0n895_100740_c1 | 3300050512 | Bacteria | 2898 |
| 763 | nmdc:mga0n895_3284_c1 | 3300050512 | Bacteria | 12986 |
| 764 | nmdc:mga0n895_35984_c1 | 3300050512 | Bacteria | 4778 |
| 765 | nmdc:mga0n895_43045_c1 | 3300050512 | Bacteria | 4398 |
| 766 | nmdc:mga0rr50_23575_c1 | 3300050513 | Bacteria | 4246 |
| 767 | nmdc:mga0rr50_5486_c1 | 3300050513 | Bacteria | 7575 |
| 768 | nmdc:mga08x19_131872_c1 | 3300050514 | Bacteria | 1681 |
| 769 | nmdc:mga0a205_177579_c1 | 3300050515 | Bacteria | 2024 |
| 770 | nmdc:mga0a205_23375_c1 | 3300050515 | Bacteria | 5863 |
| 771 | Ga0495601_0012510 | 3300053077 | Bacteria | 5090 |
| 772 | Ga0495601_0059676 | 3300053077 | Bacteria | 2419 |
| 773 | Ga0495601_0135706 | 3300053077 | Bacteria | 1604 |
| 774 | Ga0495601_0193951 | 3300053077 | Bacteria | 1327 |
| 775 | Ga0495601_0218242 | 3300053077 | Bacteria | 1245 |
| 776 | Ga0495612_0010706 | 3300053078 | Bacteria | 3705 |
| 777 | Ga0495612_0010871 | 3300053078 | Bacteria | 3676 |
| 778 | Ga0495612_0014473 | 3300053078 | Bacteria | 3173 |
| 779 | Ga0495612_0016037 | 3300053078 | Bacteria | 3002 |
| 780 | Ga0495612_0096434 | 3300053078 | Bacteria | 1256 |
| 781 | Ga0495655_0003848 | 3300053083 | Bacteria | 2515 |
| 782 | Ga0495595_0001229 | 3300053084 | Bacteria | 9974 |
| 783 | Ga0495595_0014179 | 3300053084 | Bacteria | 3376 |
| 784 | Ga0495619_0018782 | 3300053085 | Bacteria | 4388 |
| 785 | Ga0495619_0105131 | 3300053085 | Bacteria | 1925 |
| 786 | Ga0495619_0171892 | 3300053085 | Bacteria | 1498 |
| 787 | Ga0495619_0278937 | 3300053085 | Bacteria | 1158 |
| 788 | Ga0495619_0359706 | 3300053085 | Bacteria | 1006 |
| 789 | Ga0500577_0004096 | 3300053142 | Bacteria | 3824 |
| 790 | Ga0500616_0005288 | 3300053153 | Bacteria | 8821 |
| 791 | Ga0500616_0027645 | 3300053153 | Bacteria | 3130 |
| 792 | Ga0500616_0102144 | 3300053153 | Bacteria | 1400 |
| 793 | Ga0500616_0105909 | 3300053153 | Bacteria | 1367 |
| 794 | Ga0501084_0006259 | 3300054114 | Bacteria | 9784 |
| 795 | Ga0501084_0284316 | 3300054114 | Bacteria | 1397 |
| 796 | Ga0501082_0046612 | 3300060353 | Bacteria | 3736 |
| 797 | Ga0501082_0067836 | 3300060353 | Bacteria | 3072 |
| 798 | Ga0501082_0453653 | 3300060353 | Bacteria | 1120 |
| 799 | Ga0466962_0010848 | 3300061719 | Bacteria | 4381 |
| 800 | Ga0530510_0169030 | 3300061734 | Bacteria | 1619 |
| 801 | 2775655555 | 2775506735 | Bacteria | 4556596 |
| 802 | 2785339459 | 2784746763 | Bacteria | 9783172 |
| 803 | 2808828265 | 2808606357 | Bacteria | 4466944 |
| 804 | 2808849508 | 2808606360 | Bacteria | 4404006 |
| 805 | 2808891105 | 2808606370 | Bacteria | 4942454 |
| 806 | 2808895396 | 2808606371 | Bacteria | 4251511 |
| 807 | 2810364554 | 2808606700 | Bacteria | 3482157 |
| 808 | 2812319991 | 2811994871 | Bacteria | 4497550 |
| 809 | 2812374470 | 2811994882 | Bacteria | 4688362 |
| 810 | 2819689458 | 2818991462 | Bacteria | 4320267 |
| 811 | 2862510640 | 2862507626 | Bacteria | 9425308 |
| 812 | 2870726730 | 2870721527 | Bacteria | 9689237 |
| 813 | 2883825346 | 2883821847 | Bacteria | 5121194 |
| 814 | 2885313006 | 2885312484 | Bacteria | 6415165 |
| 815 | 2905928106 | 2905926851 | Bacteria | 4423176 |
| 816 | 2915364970 | 2915358134 | Bacteria | 6050864 |
| 817 | 2919060688 | 2919059106 | Bacteria | 4991624 |
| 818 | 2945917756 | 2945916053 | Bacteria | 4555517 |
| 819 | 2945943426 | 2945941187 | Bacteria | 4682474 |
| 820 | 2946061558 | 2946059875 | Bacteria | 4386623 |
| 821 | 2954000486 | 2953998280 | Bacteria | 4812144 |
| 822 | 2956939880 | 2956939328 | Bacteria | 3474458 |
| 823 | 3001121301 | 3001119090 | Bacteria | 3449530 |
| 824 | 8004024923 | 8004021418 | Bacteria | 4313954 |
| 825 | 8048411351 | 8048406513 | Bacteria | 8936924 |
| 826 | 8054108861 | 8054107350 | Bacteria | 5022511 |
| 827 | Ga0495603_0058528 | |||
| 828 | JGI25406J46586_10031930 | |||
| 829 | Ga0065714_10114558 | |||
| 830 | Ga0070658_10000219 | |||
| 831 | Ga0070658_10002124 | |||
| 832 | Ga0070658_10037290 | |||
| 833 | Ga0070683_100274637 | |||
| 834 | Ga0070683_100599882 | |||
| 835 | Ga0068869_100032036 | |||
| 836 | Ga0070680_100000598 | |||
| 837 | Ga0070680_100007320 | |||
| 838 | Ga0070682_100004505 | |||
| 839 | Ga0070682_100216611 | |||
| 840 | Ga0070682_100347231 | |||
| 841 | Ga0070660_100261879 | |||
| 842 | Ga0070691_10045595 | |||
| 843 | Ga0070687_100272721 | |||
| 844 | Ga0070671_100023347 | |||
| 845 | Ga0070674_100247803 | |||
| 846 | Ga0070659_100020279 | |||
| 847 | Ga0070667_100380145 | |||
| 848 | Ga0070709_10000220 | |||
| 849 | Ga0070709_10291902 | |||
| 850 | Ga0070714_100002227 | |||
| 851 | Ga0070714_100010578 | |||
| 852 | Ga0070713_100001605 | |||
| 853 | Ga0070713_100009389 | |||
| 854 | Ga0070713_100018255 | |||
| 855 | Ga0070713_100425008 | |||
| 856 | Ga0070713_100438087 | |||
| 857 | Ga0070710_10000042 | |||
| 858 | Ga0070710_10000122 | |||
| 859 | Ga0070710_10000939 | |||
| 860 | Ga0070711_100003406 | |||
| 861 | Ga0070711_100189566 | |||
| 862 | Ga0070711_100243039 | |||
| 863 | Ga0070705_100012329 | |||
| 864 | Ga0070705_100138038 | |||
| 865 | Ga0070700_100027103 | |||
| 866 | Ga0070694_100131188 | |||
| 867 | Ga0070708_100007036 | |||
| 868 | Ga0070708_100092983 | |||
| 869 | Ga0070708_100220048 | |||
| 870 | Ga0070708_100377573 | |||
| 871 | Ga0070678_100037865 | |||
| 872 | Ga0070678_100208595 | |||
| 873 | Ga0070681_10001670 | |||
| 874 | Ga0070681_10046871 | |||
| 875 | Ga0070681_10344148 | |||
| 876 | Ga0068867_100147655 | |||
| 877 | Ga0070706_100000817 | |||
| 878 | Ga0070706_100001339 | |||
| 879 | Ga0070706_100004736 | |||
| 880 | Ga0070706_100025486 | |||
| 881 | Ga0070706_100097621 | |||
| 882 | Ga0070706_100289506 | |||
| 883 | Ga0070706_100446853 | |||
| 884 | Ga0070707_100002030 | |||
| 885 | Ga0070707_100077511 | |||
| 886 | Ga0070707_100107132 | |||
| 887 | Ga0070707_100144166 | |||
| 888 | Ga0070698_100000546 | |||
| 889 | Ga0070698_100003558 | |||
| 890 | Ga0070698_100007991 | |||
| 891 | Ga0070698_100011156 | |||
| 892 | Ga0070698_100028866 | |||
| 893 | Ga0070698_100073875 | |||
| 894 | Ga0070698_100347336 | |||
| 895 | Ga0070699_100110625 | |||
| 896 | Ga0070679_100012273 | |||
| 897 | Ga0070679_100012308 | |||
| 898 | Ga0070679_100437218 | |||
| 899 | Ga0070684_100271854 | |||
| 900 | Ga0070684_100283774 | |||
| 901 | Ga0070697_100062917 | |||
| 902 | Ga0070697_100065191 | |||
| 903 | Ga0068853_100008671 | |||
| 904 | Ga0070695_100033931 | |||
| 905 | Ga0070696_100003133 | |||
| 906 | Ga0070696_100664983 | |||
| 907 | Ga0070693_100002640 | |||
| 908 | Ga0070693_100415291 | |||
| 909 | Ga0068855_100243003 | |||
| 910 | Ga0070664_100218215 | |||
| 911 | Ga0070664_100682504 | |||
| 912 | Ga0068857_100015977 | |||
| 913 | Ga0068857_100065726 | |||
| 914 | Ga0070702_100021040 | |||
| 915 | Ga0070702_100169464 | |||
| 916 | Ga0068864_100180433 | |||
| 917 | Ga0068861_100235527 | |||
| 918 | Ga0068861_100371229 | |||
| 919 | Ga0068870_10339339 | |||
| 920 | Ga0068858_100059003 | |||
| 921 | Ga0068860_100100242 | |||
| 922 | Ga0081455_10000107 | |||
| 923 | Ga0081455_10026019 | |||
| 924 | Ga0081455_10029678 | |||
| 925 | Ga0081455_10086575 | |||
| 926 | Ga0081455_10139078 | |||
| 927 | Ga0081455_10229864 | |||
| 928 | Ga0081540_1000095 | |||
| 929 | Ga0081540_1001613 | |||
| 930 | Ga0081539_10000405 | |||
| 931 | Ga0070717_10011462 | |||
| 932 | Ga0070717_10093181 | |||
| 933 | Ga0070717_10784646 | |||
| 934 | Ga0075365_10050673 | |||
| 935 | Ga0075365_10560831 | |||
| 936 | Ga0075368_10026485 | |||
| 937 | Ga0075363_100026463 | |||
| 938 | Ga0075363_100059861 | |||
| 939 | Ga0075363_100138956 | |||
| 940 | Ga0075364_10030085 | |||
| 941 | Ga0075364_10036174 | |||
| 942 | Ga0070715_10023800 | |||
| 943 | Ga0070715_10028333 | |||
| 944 | Ga0070715_10202908 | |||
| 945 | Ga0070716_100002596 | |||
| 946 | Ga0070716_100144009 | |||
| 947 | Ga0070712_100002114 | |||
| 948 | Ga0070712_100039382 | |||
| 949 | Ga0070712_100149391 | |||
| 950 | Ga0070712_100366355 | |||
| 951 | Ga0075362_10015049 | |||
| 952 | Ga0075367_10007069 | |||
| 953 | Ga0075367_10017056 | |||
| 954 | Ga0097621_100075623 | |||
| 955 | Ga0097621_100733539 | |||
| 956 | Ga0068871_100163066 | |||
| 957 | Ga0075428_100003999 | |||
| 958 | Ga0075428_100919129 | |||
| 959 | Ga0075430_100001640 | |||
| 960 | Ga0075431_100034551 | |||
| 961 | Ga0075431_100037160 | |||
| 962 | Ga0075431_100644360 | |||
| 963 | Ga0075433_10045253 | |||
| 964 | Ga0075434_100007088 | |||
| 965 | Ga0075434_100010616 | |||
| 966 | Ga0075434_100013021 | |||
| 967 | Ga0075429_100000660 | |||
| 968 | Ga0075429_100004902 | |||
| 969 | Ga0075429_100058247 | |||
| 970 | Ga0068865_100008386 | |||
| 971 | Ga0075436_100170075 | |||
| 972 | Ga0075436_100296207 | |||
| 973 | Ga0075435_100010863 | |||
| 974 | Ga0105244_10141717 | |||
| 975 | Ga0105240_10281576 | |||
| 976 | Ga0111539_10003516 | |||
| 977 | Ga0111539_10033353 | |||
| 978 | Ga0111539_10403670 | |||
| 979 | Ga0105245_10115987 | |||
| 980 | Ga0105247_10036225 | |||
| 981 | Ga0105247_10545877 | |||
| 982 | Ga0114129_10004780 | |||
| 983 | Ga0114129_10006566 | |||
| 984 | Ga0114129_10149868 | |||
| 985 | Ga0114129_10186076 | |||
| 986 | Ga0114129_10248108 | |||
| 987 | Ga0114129_10578249 | |||
| 988 | Ga0105243_10009365 | |||
| 989 | Ga0105248_10361366 | |||
| 990 | Ga0105248_10572037 | |||
| 991 | Ga0105248_10836336 | |||
| 992 | Ga0105237_10016176 | |||
| 993 | Ga0105238_10042741 | |||
| 994 | Ga0105249_10961047 | |||
| 995 | Ga0105239_10045939 | |||
| 996 | Ga0105246_10021145 | |||
| 997 | Ga0105246_10049942 | |||
| 998 | Ga0105246_10089623 | |||
| 999 | Ga0105246_10097333 | |||
| 1000 | Ga0157325_1000680 | |||
| 1001 | Ga0157373_10090102 | |||
| 1002 | Ga0157373_10224828 | |||
| 1003 | Ga0157371_10324112 | |||
| 1004 | Ga0157369_10048952 | |||
| 1005 | Ga0157369_10166016 | |||
| 1006 | Ga0157369_10796700 | |||
| 1007 | Ga0163162_10945825 | |||
| 1008 | Ga0157375_10011834 | |||
| 1009 | Ga0157375_10229033 | |||
| 1010 | Ga0157380_10081900 | |||
| 1011 | Ga0157380_10404547 | |||
| 1012 | Ga0157379_10039501 | |||
| 1013 | Ga0157376_10044467 | |||
| 1014 | Ga0157376_10227790 | |||
| 1015 | Ga0182005_1026945 | |||
| 1016 | Ga0197907_10955139 | |||
| 1017 | Ga0206356_11336389 | |||
| 1018 | Ga0206351_10371423 | |||
| 1019 | Ga0206353_10711485 | |||
| 1020 | Ga0206353_11700971 | |||
| 1021 | Ga0213873_10019275 | |||
| 1022 | Ga0213876_10001614 | |||
| 1023 | Ga0213876_10032465 | |||
| 1024 | Ga0213875_10000279 | |||
| 1025 | Ga0213875_10000363 | |||
| 1026 | Ga0213875_10007355 | |||
| 1027 | Ga0213875_10008272 | |||
| 1028 | Ga0213875_10013828 | |||
| 1029 | Ga0213875_10106593 | |||
| 1030 | Ga0224712_10030107 | |||
| 1031 | Ga0228598_1021335 | |||
| 1032 | Ga0207697_10049746 | |||
| 1033 | Ga0207655_1009968 | |||
| 1034 | Ga0207692_10000172 | |||
| 1035 | Ga0207692_10000192 | |||
| 1036 | Ga0207692_10098942 | |||
| 1037 | Ga0207647_10011318 | |||
| 1038 | Ga0207685_10008530 | |||
| 1039 | Ga0207685_10023176 | |||
| 1040 | Ga0207699_10001218 | |||
| 1041 | Ga0207699_10019655 | |||
| 1042 | Ga0207699_10040782 | |||
| 1043 | Ga0207699_10518036 | |||
| 1044 | Ga0207705_10094807 | |||
| 1045 | Ga0207705_10122818 | |||
| 1046 | Ga0207684_10015452 | |||
| 1047 | Ga0207684_10043013 | |||
| 1048 | Ga0207684_10044698 | |||
| 1049 | Ga0207684_10053168 | |||
| 1050 | Ga0207684_10182786 | |||
| 1051 | Ga0207684_10244433 | |||
| 1052 | Ga0207654_10221898 | |||
| 1053 | Ga0207707_10000513 | |||
| 1054 | Ga0207707_10101159 | |||
| 1055 | Ga0207695_10054675 | |||
| 1056 | Ga0207671_10043373 | |||
| 1057 | Ga0207671_10132640 | |||
| 1058 | Ga0207693_10001433 | |||
| 1059 | Ga0207693_10058519 | |||
| 1060 | Ga0207693_10284367 | |||
| 1061 | Ga0207663_10002117 | |||
| 1062 | Ga0207663_10007354 | |||
| 1063 | Ga0207663_10024463 | |||
| 1064 | Ga0207660_10006015 | |||
| 1065 | Ga0207660_10157628 | |||
| 1066 | Ga0207657_10157574 | |||
| 1067 | Ga0207657_10248455 | |||
| 1068 | Ga0207649_10352789 | |||
| 1069 | Ga0207652_10003086 | |||
| 1070 | Ga0207652_10011409 | |||
| 1071 | Ga0207652_10696162 | |||
| 1072 | Ga0207646_10000050 | |||
| 1073 | Ga0207646_10032395 | |||
| 1074 | Ga0207646_10044414 | |||
| 1075 | Ga0207646_10048483 | |||
| 1076 | Ga0207646_10220171 | |||
| 1077 | Ga0207687_10104558 | |||
| 1078 | Ga0207687_10160845 | |||
| 1079 | Ga0207700_10000619 | |||
| 1080 | Ga0207700_10075360 | |||
| 1081 | Ga0207700_10097320 | |||
| 1082 | Ga0207700_10197829 | |||
| 1083 | Ga0207664_10000543 | |||
| 1084 | Ga0207664_10001834 | |||
| 1085 | Ga0207664_10021017 | |||
| 1086 | Ga0207664_10032211 | |||
| 1087 | Ga0207664_10066193 | |||
| 1088 | Ga0207644_10020502 | |||
| 1089 | Ga0207709_10055536 | |||
| 1090 | Ga0207704_10028646 | |||
| 1091 | Ga0207665_10001519 | |||
| 1092 | Ga0207665_10002049 | |||
| 1093 | Ga0207665_10005449 | |||
| 1094 | Ga0207665_10154506 | |||
| 1095 | Ga0207665_10485797 | |||
| 1096 | Ga0207691_10345790 | |||
| 1097 | Ga0207689_10577836 | |||
| 1098 | Ga0207661_10052377 | |||
| 1099 | Ga0207661_10229802 | |||
| 1100 | Ga0207661_10902006 | |||
| 1101 | Ga0207679_10142281 | |||
| 1102 | Ga0207679_10183118 | |||
| 1103 | Ga0207667_10234374 | |||
| 1104 | Ga0207712_10832937 | |||
| 1105 | Ga0207703_10122129 | |||
| 1106 | Ga0207639_10008463 | |||
| 1107 | Ga0207678_10000157 | |||
| 1108 | Ga0207678_10016906 | |||
| 1109 | Ga0207708_10179764 | |||
| 1110 | Ga0207702_10026300 | |||
| 1111 | Ga0207674_10019283 | |||
| 1112 | Ga0207674_10130657 | |||
| 1113 | Ga0207683_10036212 | |||
| 1114 | Ga0207683_10081484 | |||
| 1115 | Ga0207683_10264114 | |||
| 1116 | Ga0207698_10116881 | |||
| 1117 | Ga0268266_10081132 | |||
| 1118 | Ga0268264_10026308 | |||
| 1119 | Ga0268264_10083263 | |||
| 1120 | Ga0265338_10013043 | |||
| 1121 | Ga0265338_10013073 | |||
| 1122 | Ga0265338_10217580 | |||
| 1123 | Ga0265338_10333654 | |||
| 1124 | Ga0265338_10404776 | |||
| 1125 | Ga0307512_10009654 | |||
| 1126 | Ga0316177_1197193 | |||
| 1127 | Ga0316176_1113610 | |||
| 1128 | Ga0314311_1077865 | |||
| 1129 | Ga0316180_1150129 | |||
| 1130 | Ga0265330_10081617 | |||
| 1131 | Ga0265325_10001703 | |||
| 1132 | Ga0265325_10033132 | |||
| 1133 | Ga0265340_10007600 | |||
| 1134 | Ga0265340_10016457 | |||
| 1135 | Ga0265340_10038501 | |||
| 1136 | Ga0265339_10013459 | |||
| 1137 | Ga0265339_10044690 | |||
| 1138 | Ga0265339_10111098 | |||
| 1139 | Ga0265316_10227831 | |||
| 1140 | Ga0265316_10251289 | |||
| 1141 | Ga0265316_10289682 | |||
| 1142 | Ga0307408_100181954 | |||
| 1143 | Ga0307408_100531615 | |||
| 1144 | Ga0265314_10179683 | |||
| 1145 | Ga0265342_10062926 | |||
| 1146 | Ga0265342_10101868 | |||
| 1147 | Ga0307405_10016785 | |||
| 1148 | Ga0307405_10339438 | |||
| 1149 | Ga0307405_10414089 | |||
| 1150 | Ga0307410_10036917 | |||
| 1151 | Ga0307406_10038338 | |||
| 1152 | Ga0307412_10012455 | |||
| 1153 | Ga0307412_10442299 | |||
| 1154 | Ga0307409_100075539 | |||
| 1155 | Ga0307409_100329267 | |||
| 1156 | Ga0307409_100790549 | |||
| 1157 | Ga0307416_100227319 | |||
| 1158 | Ga0307416_100306712 | |||
| 1159 | Ga0307416_100496471 | |||
| 1160 | Ga0307416_100662151 | |||
| 1161 | Ga0307414_10033206 | |||
| 1162 | Ga0307414_10224991 | |||
| 1163 | Ga0307411_10010825 | |||
| 1164 | Ga0307507_10010875 | |||
| 1165 | Ga0307507_10022266 | |||
| 1166 | Ga0373948_0004399 | |||
| 1167 | Ga0373959_0001394 | |||
| 1168 | Ga0373929_0011026 | |||
| 1169 | Ga0373934_0007632 | |||
| 1170 | Ga0373934_0074223 | |||
| 1171 | Ga0373940_0055874 | |||
| 1172 | Ga0373944_0001809 | |||
| 1173 | Ga0373944_0036087 | |||
| 1174 | Ga0373949_0084768 | |||
| 1175 | Ga0373923_0069748 | |||
| 1176 | Ga0373923_0105881 | |||
| 1177 | Ga0373923_0136697 | |||
| 1178 | Ga0373923_0188861 | |||
| 1179 | Ga0373936_0014217 | |||
| 1180 | Ga0373936_0015889 | |||
| 1181 | Ga0373936_0020596 | |||
| 1182 | Ga0373945_0000676 | |||
| 1183 | Ga0373953_0022219 | |||
| 1184 | Ga0373953_0092825 | |||
| 1185 | Ga0373954_0323420 | |||
| 1186 | Ga0373956_0022142 | |||
| 1187 | Ga0373956_0030203 | |||
| 1188 | Ga0373957_0006783 | |||
| 1189 | Ga0373957_0012473 | |||
| 1190 | Ga0373957_0022067 | |||
| 1191 | Ga0373957_0137827 | |||
| 1192 | Ga0373943_0000554 | |||
| 1193 | Ga0373943_0078246 | |||
| 1194 | Ga0373943_0113499 | |||
| 1195 | Ga0373946_0000088 | |||
| 1196 | Ga0373946_0165997 | |||
| 1197 | Ga0373946_0205385 | |||
| 1198 | Ga0373955_0003886 | |||
| 1199 | Ga0373955_0016557 | |||
| 1200 | Ga0373955_0289422 | |||
| 1201 | Ga0373962_0001724 | |||
| 1202 | Ga0373924_0000756 | |||
| 1203 | Ga0373924_0025436 | |||
| 1204 | Ga0373924_0038827 | |||
| 1205 | Ga0373931_0031859 | |||
| 1206 | Ga0373935_0004943 | |||
| 1207 | Ga0373935_0005239 | |||
| 1208 | Ga0373927_0003620 | |||
| 1209 | Ga0373933_0001897 | |||
| 1210 | Ga0373933_0004727 | |||
| 1211 | Ga0373933_0009789 | |||
| 1212 | Ga0373933_0110754 | |||
| 1213 | Ga0373947_0000815 | |||
| 1214 | Ga0373947_0139581 | |||
| 1215 | Ga0373947_0205357 | |||
| 1216 | Ga0373947_0338758 | |||
| 1217 | Ga0373937_0032735 | |||
| 1218 | Ga0373937_0089238 | |||
| 1219 | Ga0373937_0266723 | |||
| 1220 | Ga0373937_0336814 | |||
| 1221 | Ga0373925_0002262 | |||
| 1222 | Ga0373925_0103984 | |||
| 1223 | Ga0395899_0008829 | |||
| 1224 | Ga0395899_0076950 | |||
| 1225 | Ga0395899_0171502 | |||
| 1226 | Ga0395899_0325149 | |||
| 1227 | Ga0395900_0035842 | |||
| 1228 | Ga0395900_0038293 | |||
| 1229 | Ga0395900_0048798 | |||
| 1230 | Ga0395900_0063634 | |||
| 1231 | Ga0395900_0076186 | |||
| 1232 | Ga0395900_0108161 | |||
| 1233 | Ga0395900_0286653 | |||
| 1234 | Ga0395898_0002402 | |||
| 1235 | Ga0395898_0019032 | |||
| 1236 | Ga0395898_0043998 | |||
| 1237 | Ga0395898_0056245 | |||
| 1238 | Ga0395898_0109593 | |||
| 1239 | Ga0395905_0132127 | |||
| 1240 | Ga0395905_0227022 | |||
| 1241 | Ga0395905_0560328 | |||
| 1242 | Ga0436364_0028797 | |||
| 1243 | Ga0436364_0121732 | |||
| 1244 | Ga0436364_0426348 | |||
| 1245 | Ga0436364_0549328 | |||
| 1246 | Ga0436364_1427311 | |||
| 1247 | Ga0436364_1439262 | |||
| 1248 | Ga0436364_1529133 | |||
| 1249 | Ga0436364_1545210 | |||
| 1250 | Ga0395901_0082064 | |||
| 1251 | Ga0395901_0091986 | |||
| 1252 | Ga0395901_0094809 | |||
| 1253 | Ga0395901_0199365 | |||
| 1254 | Ga0395901_0220117 | |||
| 1255 | Ga0395901_0801951 | |||
| 1256 | Ga0436365_0824727 | |||
| 1257 | Ga0436365_1131341 | |||
| 1258 | Ga0436365_1228920 | |||
| 1259 | Ga0436365_1473848 | |||
| 1260 | Ga0436365_1759695 | |||
| 1261 | Ga0436363_0439343 | |||
| 1262 | Ga0436363_0809494 | |||
| 1263 | Ga0436363_1193301 | |||
| 1264 | Ga0436363_1305175 | |||
| 1265 | Ga0436362_0353422 | |||
| 1266 | Ga0439436_0019587 | |||
| 1267 | Ga0451797_0119597 | |||
| 1268 | Ga0451837_0443190 | |||
| 1269 | Ga0439442_000037 | |||
| 1270 | Ga0439442_000671 | |||
| 1271 | Ga0439457_000224 | |||
| 1272 | Ga0439463_038687 | |||
| 1273 | Ga0439440_0083101 | |||
| 1274 | Ga0466969_0093538 | |||
| 1275 | Ga0466972_0020758 | |||
| 1276 | Ga0466965_0009750 | |||
| 1277 | Ga0466965_0053636 | |||
| 1278 | Ga0466965_0130787 | |||
| 1279 | Ga0466965_0160862 | |||
| 1280 | Ga0466966_0046573 | |||
| 1281 | Ga0466966_0069037 | |||
| 1282 | Ga0466961_0131005 | |||
| 1283 | Ga0466961_0141696 | |||
| 1284 | Ga0466961_0387631 | |||
| 1285 | Ga0466963_0001620 | |||
| 1286 | Ga0466963_0016067 | |||
| 1287 | Ga0466963_0222812 | |||
| 1288 | Ga0466963_0588407 | |||
| 1289 | Ga0466971_0008840 | |||
| 1290 | Ga0466971_0051690 | |||
| 1291 | Ga0466970_0006565 | |||
| 1292 | Ga0466970_0028964 | |||
| 1293 | Ga0466970_0261785 | |||
| 1294 | Ga0466957_0010347 | |||
| 1295 | Ga0466957_0175644 | |||
| 1296 | Ga0466960_0002868 | |||
| 1297 | Ga0466960_0292851 | |||
| 1298 | Ga0466960_0295601 | |||
| 1299 | Ga0466959_0063230 | |||
| 1300 | Ga0466959_0320485 | |||
| 1301 | Ga0466958_0000994 | |||
| 1302 | Ga0466967_0017821 | |||
| 1303 | Ga0466967_0042911 | |||
| 1304 | Ga0466967_0108621 | |||
| 1305 | Ga0466967_0112602 | |||
| 1306 | Ga0466967_0119804 | |||
| 1307 | Ga0466967_0295511 | |||
| 1308 | Ga0466967_0596829 | |||
| 1309 | Ga0495592_0005858 | |||
| 1310 | Ga0495592_0104531 | |||
| 1311 | Ga0495603_0051703 | |||
| 1312 | Ga0495603_0250502 | |||
| 1313 | Ga0495629_0002998 | |||
| 1314 | Ga0495629_0051130 | |||
| 1315 | Ga0495629_0081566 | |||
| 1316 | Ga0495629_0090675 | |||
| 1317 | Ga0495629_0112288 | |||
| 1318 | Ga0495629_0253729 | |||
| 1319 | Ga0495641_0026622 | |||
| 1320 | Ga0495641_0035703 | |||
| 1321 | Ga0495641_0046978 | |||
| 1322 | Ga0495651_0014823 | |||
| 1323 | Ga0495651_0016773 | |||
| 1324 | Ga0495651_0157995 | |||
| 1325 | Ga0495651_0250588 | |||
| 1326 | Ga0495651_0322429 | |||
| 1327 | Ga0495653_0002903 | |||
| 1328 | Ga0495653_0022289 | |||
| 1329 | Ga0495653_0031632 | |||
| 1330 | Ga0495653_0097763 | |||
| 1331 | Ga0495653_0131365 | |||
| 1332 | Ga0495653_0140712 | |||
| 1333 | Ga0495582_0007038 | |||
| 1334 | Ga0495582_0013945 | |||
| 1335 | Ga0495582_0061641 | |||
| 1336 | Ga0495639_0000532 | |||
| 1337 | Ga0495639_0038543 | |||
| 1338 | Ga0495639_0053152 | |||
| 1339 | Ga0495639_0065181 | |||
| 1340 | Ga0495662_0009293 | |||
| 1341 | Ga0495664_0011303 | |||
| 1342 | Ga0495664_0036995 | |||
| 1343 | Ga0495664_0055076 | |||
| 1344 | Ga0495664_0166705 | |||
| 1345 | Ga0495594_0076675 | |||
| 1346 | Ga0495594_0253819 | |||
| 1347 | Ga0495608_0009357 | |||
| 1348 | Ga0495608_0023867 | |||
| 1349 | Ga0495608_0239789 | |||
| 1350 | Ga0495608_0266034 | |||
| 1351 | Ga0495608_0380770 | |||
| 1352 | Ga0495618_0025596 | |||
| 1353 | Ga0495618_0058897 | |||
| 1354 | Ga0495618_0189286 | |||
| 1355 | Ga0495628_0009366 | |||
| 1356 | Ga0495628_0065292 | |||
| 1357 | Ga0495628_0126871 | |||
| 1358 | Ga0495628_0208502 | |||
| 1359 | Ga0495630_0008061 | |||
| 1360 | Ga0495630_0019030 | |||
| 1361 | Ga0495630_0047208 | |||
| 1362 | Ga0495630_0141044 | |||
| 1363 | Ga0495666_0055655 | |||
| 1364 | Ga0495652_0005483 | |||
| 1365 | Ga0495652_0043128 | |||
| 1366 | Ga0495652_0050725 | |||
| 1367 | Ga0495665_0007538 | |||
| 1368 | Ga0495665_0018575 | |||
| 1369 | Ga0495665_0021026 | |||
| 1370 | Ga0495665_0057936 | |||
| 1371 | Ga0495665_0115215 | |||
| 1372 | Ga0495640_0003176 | |||
| 1373 | Ga0495640_0086670 | |||
| 1374 | Ga0495640_0157249 | |||
| 1375 | Ga0495640_0169756 | |||
| 1376 | Ga0495640_0260645 | |||
| 1377 | Ga0495586_0000632 | |||
| 1378 | Ga0495587_0004127 | |||
| 1379 | Ga0495587_0031177 | |||
| 1380 | Ga0495587_0064665 | |||
| 1381 | Ga0495587_0168296 | |||
| 1382 | Ga0495645_0018671 | |||
| 1383 | Ga0495645_0055890 | |||
| 1384 | Ga0495645_0204158 | |||
| 1385 | Ga0495645_0248081 | |||
| 1386 | Ga0495667_0028601 | |||
| 1387 | Ga0495667_0029607 | |||
| 1388 | Ga0495667_0030175 | |||
| 1389 | Ga0495667_0053905 | |||
| 1390 | Ga0495667_0346623 | |||
| 1391 | Ga0495656_0124346 | |||
| 1392 | Ga0495656_0249745 | |||
| 1393 | Ga0495668_0136367 | |||
| 1394 | Ga0495634_0019891 | |||
| 1395 | Ga0495634_0024993 | |||
| 1396 | Ga0495634_0047224 | |||
| 1397 | Ga0495634_0066340 | |||
| 1398 | Ga0495635_0001151 | |||
| 1399 | Ga0495635_0004086 | |||
| 1400 | Ga0495635_0021859 | |||
| 1401 | Ga0495635_0216452 | |||
| 1402 | Ga0495588_0000765 | |||
| 1403 | Ga0495588_0126867 | |||
| 1404 | Ga0495588_0132378 | |||
| 1405 | Ga0495657_0043253 | |||
| 1406 | Ga0495657_0046910 | |||
| 1407 | Ga0495657_0055790 | |||
| 1408 | Ga0495657_0072408 | |||
| 1409 | Ga0495657_0073703 | |||
| 1410 | Ga0495599_0070639 | |||
| 1411 | Ga0495599_0080677 | |||
| 1412 | Ga0495599_0148356 | |||
| 1413 | Ga0495623_0070324 | |||
| 1414 | Ga0495623_0275698 | |||
| 1415 | Ga0495646_0002600 | |||
| 1416 | Ga0495646_0018691 | |||
| 1417 | Ga0495646_0075625 | |||
| 1418 | Ga0495646_0126454 | |||
| 1419 | Ga0495647_0245264 | |||
| 1420 | Ga0495658_0006826 | |||
| 1421 | Ga0495658_0248423 | |||
| 1422 | Ga0495613_0018649 | |||
| 1423 | Ga0495613_0034019 | |||
| 1424 | Ga0495613_0071074 | |||
| 1425 | Ga0495613_0089590 | |||
| 1426 | Ga0495613_0159765 | |||
| 1427 | Ga0495613_0190694 | |||
| 1428 | Ga0495613_0215672 | |||
| 1429 | Ga0495624_0003920 | |||
| 1430 | Ga0495624_0008780 | |||
| 1431 | Ga0495624_0064030 | |||
| 1432 | Ga0495624_0094526 | |||
| 1433 | Ga0495600_0003586 | |||
| 1434 | Ga0495600_0026915 | |||
| 1435 | Ga0495600_0054646 | |||
| 1436 | Ga0495581_0034269 | |||
| 1437 | Ga0495581_0213747 | |||
| 1438 | Ga0495604_0029667 | |||
| 1439 | Ga0495604_0036076 | |||
| 1440 | Ga0495604_0037215 | |||
| 1441 | Ga0495604_0148313 | |||
| 1442 | Ga0495604_0229642 | |||
| 1443 | Ga0495604_0260188 | |||
| 1444 | Ga0495674_0003395 | |||
| 1445 | Ga0495674_0069694 | |||
| 1446 | Ga0495674_0080318 | |||
| 1447 | Ga0495674_0100660 | |||
| 1448 | Ga0495674_0240061 | |||
| 1449 | Ga0495676_0029713 | |||
| 1450 | Ga0495676_0111551 | |||
| 1451 | Ga0495676_0342028 | |||
| 1452 | Ga0495676_0405856 | |||
| 1453 | Ga0495680_0003725 | |||
| 1454 | Ga0495680_0006511 | |||
| 1455 | Ga0495680_0015991 | |||
| 1456 | Ga0495680_0034757 | |||
| 1457 | Ga0495680_0073690 | |||
| 1458 | Ga0495680_0123284 | |||
| 1459 | Ga0495675_0003832 | |||
| 1460 | Ga0495675_0027687 | |||
| 1461 | Ga0495675_0054938 | |||
| 1462 | Ga0495675_0083834 | |||
| 1463 | Ga0495675_0222360 | |||
| 1464 | Ga0495684_0001405 | |||
| 1465 | Ga0495684_0018126 | |||
| 1466 | Ga0495684_0068266 | |||
| 1467 | Ga0495684_0243113 | |||
| 1468 | Ga0495684_0246378 | |||
| 1469 | Ga0495593_0005742 | |||
| 1470 | Ga0495593_0016271 | |||
| 1471 | Ga0495593_0040446 | |||
| 1472 | Ga0495593_0078437 | |||
| 1473 | Ga0495602_0081964 | |||
| 1474 | Ga0495602_0089498 | |||
| 1475 | Ga0495602_0167355 | |||
| 1476 | Ga0495614_0046931 | |||
| 1477 | Ga0495614_0059558 | |||
| 1478 | Ga0496100_0033888 | |||
| 1479 | Ga0496100_0049759 | |||
| 1480 | Ga0496101_0007369 | |||
| 1481 | Ga0496101_0043696 | |||
| 1482 | Ga0496101_0258127 | |||
| 1483 | Ga0496101_0770034 | |||
| 1484 | Ga0496102_0014892 | |||
| 1485 | Ga0496102_0077427 | |||
| 1486 | Ga0496102_0422077 | |||
| 1487 | Ga0496103_0000898 | |||
| 1488 | Ga0496104_0018338 | |||
| 1489 | Ga0496104_0040418 | |||
| 1490 | Ga0496105_0133367 | |||
| 1491 | Ga0496105_0145354 | |||
| 1492 | Ga0496105_0175632 | |||
| 1493 | Ga0496105_0332690 | |||
| 1494 | Ga0496106_0006772 | |||
| 1495 | Ga0496106_0065172 | |||
| 1496 | Ga0496106_0718278 | |||
| 1497 | Ga0496107_0006344 | |||
| 1498 | Ga0496107_0189978 | |||
| 1499 | Ga0496107_0239570 | |||
| 1500 | Ga0496107_0336434 | |||
| 1501 | Ga0496108_0083258 | |||
| 1502 | Ga0496108_0352393 | |||
| 1503 | Ga0496108_0456367 | |||
| 1504 | Ga0496108_0566374 | |||
| 1505 | Ga0496109_0011430 | |||
| 1506 | Ga0496109_0120685 | |||
| 1507 | Ga0496110_0030486 | |||
| 1508 | Ga0496111_0034956 | |||
| 1509 | Ga0496112_0044319 | |||
| 1510 | Ga0496112_0334281 | |||
| 1511 | Ga0496112_0359854 | |||
| 1512 | Ga0496112_0518048 | |||
| 1513 | Ga0496113_0060560 | |||
| 1514 | Ga0496114_0027387 | |||
| 1515 | Ga0496114_0053121 | |||
| 1516 | Ga0496114_0181776 | |||
| 1517 | Ga0496114_0254182 | |||
| 1518 | Ga0496114_0476399 | |||
| 1519 | Ga0496115_0015138 | |||
| 1520 | Ga0496115_0029459 | |||
| 1521 | Ga0496115_0079414 | |||
| 1522 | Ga0496126_0000048 | |||
| 1523 | Ga0501031_0005992 | |||
| 1524 | Ga0501032_0000831 | |||
| 1525 | Ga0501032_0021761 | |||
| 1526 | Ga0501034_0000669 | |||
| 1527 | Ga0501034_0075948 | |||
| 1528 | Ga0501036_0224115 | |||
| 1529 | Ga0501037_0075983 | |||
| 1530 | Ga0501038_0043793 | |||
| 1531 | Ga0501038_0315640 | |||
| 1532 | Ga0501039_0123258 | |||
| 1533 | Ga0501039_0212363 | |||
| 1534 | Ga0501040_0002929 | |||
| 1535 | Ga0501041_0234681 | |||
| 1536 | Ga0501042_0000567 | |||
| 1537 | Ga0501043_0004750 | |||
| 1538 | Ga0501043_0043761 | |||
| 1539 | Ga0501046_0094491 | |||
| 1540 | Ga0501047_0000660 | |||
| 1541 | Ga0501047_0289894 | |||
| 1542 | Ga0501048_0018382 | |||
| 1543 | Ga0501048_0095709 | |||
| 1544 | Ga0501067_0004614 | |||
| 1545 | Ga0501067_0186602 | |||
| 1546 | Ga0501069_0029739 | |||
| 1547 | Ga0501069_0270930 | |||
| 1548 | Ga0501070_0037439 | |||
| 1549 | Ga0501070_0068682 | |||
| 1550 | Ga0501070_0314213 | |||
| 1551 | Ga0501070_0615048 | |||
| 1552 | Ga0501071_0040853 | |||
| 1553 | Ga0501071_0181938 | |||
| 1554 | Ga0501072_0182905 | |||
| 1555 | Ga0501075_0131552 | |||
| 1556 | Ga0501076_0165756 | |||
| 1557 | Ga0501079_0192640 | |||
| 1558 | Ga0501079_0205287 | |||
| 1559 | Ga0501081_0308830 | |||
| 1560 | Ga0501083_0344857 | |||
| 1561 | Ga0501035_0072092 | |||
| 1562 | Ga0501035_0121303 | |||
| 1563 | Ga0501044_0041692 | |||
| 1564 | Ga0501045_0002992 | |||
| 1565 | Ga0501045_0166226 | |||
| 1566 | nmdc:mga03683_78679_c1 | |||
| 1567 | nmdc:mga00v17_46376_c1 | |||
| 1568 | nmdc:mga0yw44_126493_c1 | |||
| 1569 | nmdc:mga0yw44_56449_c1 | |||
| 1570 | nmdc:mga06z11_208210_c1 | |||
| 1571 | nmdc:mga06z11_242655_c1 | |||
| 1572 | nmdc:mga06z11_29740_c1 | |||
| 1573 | nmdc:mga05p37_155734_c1 | |||
| 1574 | nmdc:mga05p37_261389_c1 | |||
| 1575 | nmdc:mga05p37_815466_c1 | |||
| 1576 | nmdc:mga09592_2829_c1 | |||
| 1577 | nmdc:mga09592_329566_c1 | |||
| 1578 | nmdc:mga09592_8866_c1 | |||
| 1579 | nmdc:mga0qj67_140821_c1 | |||
| 1580 | nmdc:mga0qj67_150568_c1 | |||
| 1581 | nmdc:mga0qj67_168378_c1 | |||
| 1582 | nmdc:mga0qj67_270961_c1 | |||
| 1583 | nmdc:mga0qj67_84154_c1 | |||
| 1584 | nmdc:mga06r32_148857_c1 | |||
| 1585 | nmdc:mga06r32_1610_c1 | |||
| 1586 | nmdc:mga06r32_524701_c1 | |||
| 1587 | nmdc:mga08y16_44235_c1 | |||
| 1588 | nmdc:mga0n895_100740_c1 | |||
| 1589 | nmdc:mga0n895_3284_c1 | |||
| 1590 | nmdc:mga0n895_35984_c1 | |||
| 1591 | nmdc:mga0n895_43045_c1 | |||
| 1592 | nmdc:mga0rr50_23575_c1 | |||
| 1593 | nmdc:mga0rr50_5486_c1 | |||
| 1594 | nmdc:mga08x19_131872_c1 | |||
| 1595 | nmdc:mga0a205_177579_c1 | |||
| 1596 | nmdc:mga0a205_23375_c1 | |||
| 1597 | Ga0495601_0012510 | |||
| 1598 | Ga0495601_0059676 | |||
| 1599 | Ga0495601_0135706 | |||
| 1600 | Ga0495601_0193951 | |||
| 1601 | Ga0495601_0218242 | |||
| 1602 | Ga0495612_0010706 | |||
| 1603 | Ga0495612_0010871 | |||
| 1604 | Ga0495612_0014473 | |||
| 1605 | Ga0495612_0016037 | |||
| 1606 | Ga0495612_0096434 | |||
| 1607 | Ga0495655_0003848 | |||
| 1608 | Ga0495595_0001229 | |||
| 1609 | Ga0495595_0014179 | |||
| 1610 | Ga0495619_0018782 | |||
| 1611 | Ga0495619_0105131 | |||
| 1612 | Ga0495619_0171892 | |||
| 1613 | Ga0495619_0278937 | |||
| 1614 | Ga0495619_0359706 | |||
| 1615 | Ga0500577_0004096 | |||
| 1616 | Ga0500616_0005288 | |||
| 1617 | Ga0500616_0027645 | |||
| 1618 | Ga0500616_0102144 | |||
| 1619 | Ga0500616_0105909 | |||
| 1620 | Ga0501084_0006259 | |||
| 1621 | Ga0501084_0284316 | |||
| 1622 | Ga0501082_0046612 | |||
| 1623 | Ga0501082_0067836 | |||
| 1624 | Ga0501082_0453653 | |||
| 1625 | Ga0466962_0010848 | |||
| 1626 | Ga0530510_0169030 | |||
| 1627 | 2775655555 | |||
| 1628 | 2785339459 | |||
| 1629 | 2808828265 | |||
| 1630 | 2808849508 | |||
| 1631 | 2808891105 | |||
| 1632 | 2808895396 | |||
| 1633 | 2810364554 | |||
| 1634 | 2812319991 | |||
| 1635 | 2812374470 | |||
| 1636 | 2819689458 | |||
| 1637 | 2862510640 | |||
| 1638 | 2870726730 | |||
| 1639 | 2883825346 | |||
| 1640 | 2885313006 | |||
| 1641 | 2905928106 | |||
| 1642 | 2915364970 | |||
| 1643 | 2919060688 | |||
| 1644 | 2945917756 | |||
| 1645 | 2945943426 | |||
| 1646 | 2946061558 | |||
| 1647 | 2954000486 | |||
| 1648 | 2956939880 | |||
| 1649 | 3001121301 | |||
| 1650 | 8004024923 | |||
| 1651 | 8048411351 | |||
| 1652 | 8054108861 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9635 | 1 | 118 |
| 3zq7-assembly1.cif.gz_A | the structure of dna-binding domain of response regulator from escherichia coli k-12 | 0.9617 | 128 | 224 |
| 3nhz-assembly2.cif.gz_B | structure of n-terminal domain of mtra | 0.9556 | 1 | 115 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9554 | 1 | 117 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9547 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9964 | 2 | 79 | 3.40.50.2300 |
| af_P9WGN1_116_225_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9932 | 128 | 223 | 1.10.10.10 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9865 | 1 | 77 | 3.40.50.2300 |
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9841 | 3 | 84 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9755 | 1 | 79 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258FSP1-F1-model_v4 | DNA-binding response regulator | 0.9027 | 2 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A258FSP1-F1-model_v4 | DNA-binding response regulator | 0.8951 | 2 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A366WR70-F1-model_v4 | DNA-binding response regulator | 0.8793 | 2 | 226 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4Y9RGY6-F1-model_v4 | Response regulator transcription factor | 0.8752 | 2 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1G9V7M6-F1-model_v4 | Sensory transduction protein RegX3 | 0.872 | 1 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |