F482392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 227 | 824 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0032217|Ga0395899_0032217_1816_2325 |
| Length | 169 |
| Sequence | MKIRRSIKADQQGAAVIEAAIALPVLVVMIYGIFSIGQLFEANAGMQHALGEGARYATLCSSMSVSADGTTKTCAVHTGTEIKAMVANKLFGANNGNGTWDDPNLDTSTASSGYVTLTVTYHPLMKFAFYSLPSFTITRSKRIYLADVPGTSADCASGSSTVGSCSIYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 188 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 189 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 210 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 221 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 227 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 1.58 |
| Rhizosphere | 97.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2738738 | 2162886011 | Unclassified | 803 |
| 2 | MRS1b_contig_816425 | 2162886011 | Bacteria | 858 |
| 3 | MBSR1b_contig_6582152 | 2162886012 | Unclassified | 805 |
| 4 | MBSR1b_contig_7487180 | 2162886012 | Unclassified | 1309 |
| 5 | CNBas_1009180 | 3300000531 | Unclassified | 592 |
| 6 | JGI24736J21556_1047311 | 3300001904 | Unclassified | 661 |
| 7 | JGI24740J21852_10007956 | 3300001979 | Bacteria | 4272 |
| 8 | JGI24740J21852_10096425 | 3300001979 | Bacteria | 757 |
| 9 | JGI24739J22299_10001510 | 3300001989 | Bacteria | 8784 |
| 10 | JGI24739J22299_10033107 | 3300001989 | Bacteria | 1772 |
| 11 | JGI24739J22299_10077882 | 3300001989 | Bacteria | 1022 |
| 12 | JGI24737J22298_10000293 | 3300001990 | Bacteria | 16594 |
| 13 | JGI24737J22298_10001879 | 3300001990 | Bacteria | 7505 |
| 14 | JGI24737J22298_10015945 | 3300001990 | Bacteria | 2426 |
| 15 | JGI24737J22298_10021011 | 3300001990 | Bacteria | 2082 |
| 16 | JGI24737J22298_10139634 | 3300001990 | Unclassified | 716 |
| 17 | JGI24735J21928_10171374 | 3300002067 | Unclassified | 627 |
| 18 | JGI24738J21930_10000671 | 3300002075 | Bacteria | 9929 |
| 19 | rootH2_10273668 | 3300003320 | Bacteria | 1285 |
| 20 | rootL2_10280324 | 3300003322 | Bacteria | 2984 |
| 21 | rootH1_10348281 | 3300003323 | Bacteria | 1282 |
| 22 | Ga0065712_10223242 | 3300005290 | Unclassified | 1026 |
| 23 | Ga0065712_10305407 | 3300005290 | Unclassified | 853 |
| 24 | Ga0065715_10130129 | 3300005293 | Bacteria | 2032 |
| 25 | Ga0065715_10303161 | 3300005293 | Bacteria | 1036 |
| 26 | Ga0065715_10310536 | 3300005293 | Unclassified | 1021 |
| 27 | Ga0065715_10393119 | 3300005293 | Unclassified | 872 |
| 28 | Ga0065715_10625605 | 3300005293 | Bacteria | 693 |
| 29 | Ga0070658_10092523 | 3300005327 | Bacteria | 2493 |
| 30 | Ga0070658_10187097 | 3300005327 | Bacteria | 1744 |
| 31 | Ga0070658_10371799 | 3300005327 | Bacteria | 1225 |
| 32 | Ga0070676_10001496 | 3300005328 | Bacteria | 11830 |
| 33 | Ga0070676_10011918 | 3300005328 | Bacteria | 4737 |
| 34 | Ga0070676_10075467 | 3300005328 | Bacteria | 2033 |
| 35 | Ga0070676_10294066 | 3300005328 | Unclassified | 1099 |
| 36 | Ga0070676_10703819 | 3300005328 | Unclassified | 738 |
| 37 | Ga0070676_11484340 | 3300005328 | Bacteria | 522 |
| 38 | Ga0070683_100006547 | 3300005329 | Bacteria | 9782 |
| 39 | Ga0070683_100122723 | 3300005329 | Bacteria | 2454 |
| 40 | Ga0070670_100002488 | 3300005331 | Bacteria | 15189 |
| 41 | Ga0070670_100067267 | 3300005331 | Bacteria | 3075 |
| 42 | Ga0070670_100146444 | 3300005331 | Bacteria | 2043 |
| 43 | Ga0070670_100165214 | 3300005331 | Bacteria | 1919 |
| 44 | Ga0070670_100518913 | 3300005331 | Bacteria | 1061 |
| 45 | Ga0070670_101072826 | 3300005331 | Unclassified | 734 |
| 46 | Ga0070677_10089575 | 3300005333 | Unclassified | 1335 |
| 47 | Ga0070677_10096835 | 3300005333 | Unclassified | 1293 |
| 48 | Ga0070677_10226910 | 3300005333 | Bacteria | 915 |
| 49 | Ga0068869_100000094 | 3300005334 | Bacteria | 41359 |
| 50 | Ga0068869_100038011 | 3300005334 | Bacteria | 3426 |
| 51 | Ga0068869_100051534 | 3300005334 | Bacteria | 2986 |
| 52 | Ga0068869_100129425 | 3300005334 | Bacteria | 1939 |
| 53 | Ga0068869_100176989 | 3300005334 | Bacteria | 1670 |
| 54 | Ga0068869_101180378 | 3300005334 | Unclassified | 672 |
| 55 | Ga0070666_10020219 | 3300005335 | Bacteria | 4302 |
| 56 | Ga0070666_10042190 | 3300005335 | Bacteria | 3051 |
| 57 | Ga0070666_10118000 | 3300005335 | Bacteria | 1839 |
| 58 | Ga0070666_10207699 | 3300005335 | Bacteria | 1378 |
| 59 | Ga0070680_101245445 | 3300005336 | Bacteria | 644 |
| 60 | Ga0070682_100098294 | 3300005337 | Unclassified | 1928 |
| 61 | Ga0070682_100123675 | 3300005337 | Bacteria | 1740 |
| 62 | Ga0068868_100001948 | 3300005338 | Bacteria | 14153 |
| 63 | Ga0068868_100072159 | 3300005338 | Bacteria | 2754 |
| 64 | Ga0070660_100004239 | 3300005339 | Bacteria | 9900 |
| 65 | Ga0070660_100022428 | 3300005339 | Bacteria | 4669 |
| 66 | Ga0070660_100056503 | 3300005339 | Bacteria | 3037 |
| 67 | Ga0070660_100086216 | 3300005339 | Bacteria | 2470 |
| 68 | Ga0070660_100184424 | 3300005339 | Bacteria | 1689 |
| 69 | Ga0070660_100603999 | 3300005339 | Unclassified | 917 |
| 70 | Ga0070660_100662954 | 3300005339 | Unclassified | 874 |
| 71 | Ga0070689_100289735 | 3300005340 | Bacteria | 1360 |
| 72 | Ga0070687_100689678 | 3300005343 | Bacteria | 712 |
| 73 | Ga0070661_100003747 | 3300005344 | Bacteria | 10478 |
| 74 | Ga0070661_100014559 | 3300005344 | Bacteria | 5544 |
| 75 | Ga0070661_100073098 | 3300005344 | Bacteria | 2524 |
| 76 | Ga0070661_100078415 | 3300005344 | Bacteria | 2436 |
| 77 | Ga0070661_100080649 | 3300005344 | Bacteria | 2402 |
| 78 | Ga0070661_100103784 | 3300005344 | Bacteria | 2117 |
| 79 | Ga0070661_100459923 | 3300005344 | Bacteria | 1013 |
| 80 | Ga0070661_100812430 | 3300005344 | Bacteria | 768 |
| 81 | Ga0070661_101025563 | 3300005344 | Bacteria | 685 |
| 82 | Ga0070692_10024487 | 3300005345 | Bacteria | 2967 |
| 83 | Ga0070668_100000311 | 3300005347 | Bacteria | 32092 |
| 84 | Ga0070668_100014598 | 3300005347 | Bacteria | 5871 |
| 85 | Ga0070668_100036377 | 3300005347 | Bacteria | 3758 |
| 86 | Ga0070668_100056574 | 3300005347 | Bacteria | 3030 |
| 87 | Ga0070668_100228957 | 3300005347 | Bacteria | 1536 |
| 88 | Ga0070668_100468558 | 3300005347 | Bacteria | 1086 |
| 89 | Ga0070668_100659750 | 3300005347 | Unclassified | 920 |
| 90 | Ga0070668_101321078 | 3300005347 | Bacteria | 656 |
| 91 | Ga0070669_100000155 | 3300005353 | Bacteria | 61710 |
| 92 | Ga0070669_100003672 | 3300005353 | Bacteria | 11068 |
| 93 | Ga0070669_100069766 | 3300005353 | Bacteria | 2596 |
| 94 | Ga0070669_100214262 | 3300005353 | Bacteria | 1521 |
| 95 | Ga0070669_100576056 | 3300005353 | Unclassified | 941 |
| 96 | Ga0070669_100626945 | 3300005353 | Unclassified | 903 |
| 97 | Ga0070675_100031778 | 3300005354 | Bacteria | 4269 |
| 98 | Ga0070675_100091624 | 3300005354 | Bacteria | 2547 |
| 99 | Ga0070675_100343655 | 3300005354 | Bacteria | 1322 |
| 100 | Ga0070675_100510002 | 3300005354 | Bacteria | 1084 |
| 101 | Ga0070671_100099159 | 3300005355 | Bacteria | 2443 |
| 102 | Ga0070671_100149229 | 3300005355 | Unclassified | 1974 |
| 103 | Ga0070671_100250091 | 3300005355 | Bacteria | 1506 |
| 104 | Ga0070671_101088384 | 3300005355 | Bacteria | 702 |
| 105 | Ga0070674_100049256 | 3300005356 | Bacteria | 2896 |
| 106 | Ga0070674_100506382 | 3300005356 | Unclassified | 1006 |
| 107 | Ga0070674_101309058 | 3300005356 | Unclassified | 646 |
| 108 | Ga0070673_100019549 | 3300005364 | Bacteria | 4864 |
| 109 | Ga0070673_100075382 | 3300005364 | Unclassified | 2720 |
| 110 | Ga0070673_100097307 | 3300005364 | Bacteria | 2417 |
| 111 | Ga0070673_100108904 | 3300005364 | Bacteria | 2294 |
| 112 | Ga0070673_100295256 | 3300005364 | Bacteria | 1425 |
| 113 | Ga0070673_100420219 | 3300005364 | Unclassified | 1198 |
| 114 | Ga0070673_101163073 | 3300005364 | Unclassified | 722 |
| 115 | Ga0070688_100174444 | 3300005365 | Bacteria | 1486 |
| 116 | Ga0070659_100000305 | 3300005366 | Bacteria | 38108 |
| 117 | Ga0070659_100021439 | 3300005366 | Bacteria | 4921 |
| 118 | Ga0070659_100022758 | 3300005366 | Bacteria | 4787 |
| 119 | Ga0070659_100220033 | 3300005366 | Unclassified | 1567 |
| 120 | Ga0070659_100370126 | 3300005366 | Bacteria | 1205 |
| 121 | Ga0070659_100415178 | 3300005366 | Bacteria | 1138 |
| 122 | Ga0070659_100533830 | 3300005366 | Bacteria | 1003 |
| 123 | Ga0070659_102034089 | 3300005366 | Bacteria | 516 |
| 124 | Ga0070667_100022892 | 3300005367 | Bacteria | 5180 |
| 125 | Ga0070667_100029038 | 3300005367 | Bacteria | 4606 |
| 126 | Ga0070667_100030696 | 3300005367 | Bacteria | 4482 |
| 127 | Ga0070667_100043068 | 3300005367 | Bacteria | 3788 |
| 128 | Ga0070667_100070149 | 3300005367 | Bacteria | 2983 |
| 129 | Ga0070667_100072334 | 3300005367 | Bacteria | 2938 |
| 130 | Ga0070667_100082262 | 3300005367 | Bacteria | 2756 |
| 131 | Ga0070667_100382451 | 3300005367 | Bacteria | 1279 |
| 132 | Ga0070667_100694772 | 3300005367 | Bacteria | 941 |
| 133 | Ga0070714_100070117 | 3300005435 | Bacteria | 3030 |
| 134 | Ga0070714_100282223 | 3300005435 | Bacteria | 1543 |
| 135 | Ga0070713_100027237 | 3300005436 | Bacteria | 4498 |
| 136 | Ga0070694_100205024 | 3300005444 | Unclassified | 1472 |
| 137 | Ga0070694_100371702 | 3300005444 | Bacteria | 1113 |
| 138 | Ga0070663_100007015 | 3300005455 | Bacteria | 6825 |
| 139 | Ga0070663_100023038 | 3300005455 | Bacteria | 4169 |
| 140 | Ga0070663_100057821 | 3300005455 | Bacteria | 2783 |
| 141 | Ga0070663_100061273 | 3300005455 | Bacteria | 2709 |
| 142 | Ga0070663_100067584 | 3300005455 | Bacteria | 2593 |
| 143 | Ga0070663_100068550 | 3300005455 | Bacteria | 2575 |
| 144 | Ga0070663_100189068 | 3300005455 | Bacteria | 1602 |
| 145 | Ga0070663_100262966 | 3300005455 | Bacteria | 1369 |
| 146 | Ga0070678_100072630 | 3300005456 | Bacteria | 2580 |
| 147 | Ga0070678_101409446 | 3300005456 | Unclassified | 651 |
| 148 | Ga0070662_100006089 | 3300005457 | Bacteria | 7749 |
| 149 | Ga0070662_100017060 | 3300005457 | Bacteria | 4886 |
| 150 | Ga0070662_100020874 | 3300005457 | Bacteria | 4467 |
| 151 | Ga0070662_100046756 | 3300005457 | Bacteria | 3110 |
| 152 | Ga0070662_100050613 | 3300005457 | Bacteria | 2997 |
| 153 | Ga0070662_100078528 | 3300005457 | Bacteria | 2452 |
| 154 | Ga0070662_100219559 | 3300005457 | Bacteria | 1516 |
| 155 | Ga0070662_100282597 | 3300005457 | Unclassified | 1343 |
| 156 | Ga0070662_100478933 | 3300005457 | Unclassified | 1036 |
| 157 | Ga0070662_100657234 | 3300005457 | Unclassified | 885 |
| 158 | Ga0070662_100736264 | 3300005457 | Bacteria | 835 |
| 159 | Ga0070662_101174267 | 3300005457 | Bacteria | 659 |
| 160 | Ga0070662_101769701 | 3300005457 | Bacteria | 534 |
| 161 | Ga0070681_10044764 | 3300005458 | Bacteria | 4431 |
| 162 | Ga0068867_100008791 | 3300005459 | Bacteria | 7132 |
| 163 | Ga0068867_100039753 | 3300005459 | Bacteria | 3430 |
| 164 | Ga0068867_100092554 | 3300005459 | Bacteria | 2296 |
| 165 | Ga0068867_100122862 | 3300005459 | Bacteria | 2008 |
| 166 | Ga0068867_100669214 | 3300005459 | Unclassified | 913 |
| 167 | Ga0068867_100697801 | 3300005459 | Bacteria | 895 |
| 168 | Ga0070685_10061622 | 3300005466 | Bacteria | 2197 |
| 169 | Ga0070706_100327274 | 3300005467 | Bacteria | 1429 |
| 170 | Ga0070679_100124128 | 3300005530 | Unclassified | 2565 |
| 171 | Ga0070679_100635682 | 3300005530 | Bacteria | 1010 |
| 172 | Ga0070679_100637483 | 3300005530 | Bacteria | 1008 |
| 173 | Ga0070684_100005972 | 3300005535 | Bacteria | 9381 |
| 174 | Ga0070684_100185799 | 3300005535 | Bacteria | 1890 |
| 175 | Ga0070684_100642215 | 3300005535 | Bacteria | 988 |
| 176 | Ga0068853_100014045 | 3300005539 | Bacteria | 6554 |
| 177 | Ga0068853_100079638 | 3300005539 | Bacteria | 2865 |
| 178 | Ga0068853_100140799 | 3300005539 | Bacteria | 2165 |
| 179 | Ga0068853_100369814 | 3300005539 | Unclassified | 1337 |
| 180 | Ga0068853_100472984 | 3300005539 | Unclassified | 1181 |
| 181 | Ga0070672_100000797 | 3300005543 | Bacteria | 18794 |
| 182 | Ga0070672_100014427 | 3300005543 | Bacteria | 5599 |
| 183 | Ga0070672_100040507 | 3300005543 | Bacteria | 3575 |
| 184 | Ga0070672_100143410 | 3300005543 | Bacteria | 1972 |
| 185 | Ga0070672_100674817 | 3300005543 | Bacteria | 904 |
| 186 | Ga0070686_100523873 | 3300005544 | Bacteria | 923 |
| 187 | Ga0070695_100792069 | 3300005545 | Bacteria | 759 |
| 188 | Ga0070695_100880612 | 3300005545 | Unclassified | 722 |
| 189 | Ga0070696_100215828 | 3300005546 | Bacteria | 1438 |
| 190 | Ga0070693_100058644 | 3300005547 | Bacteria | 2229 |
| 191 | Ga0070693_100114799 | 3300005547 | Unclassified | 1662 |
| 192 | Ga0070693_100189091 | 3300005547 | Unclassified | 1331 |
| 193 | Ga0070693_100189123 | 3300005547 | Bacteria | 1330 |
| 194 | Ga0070693_100746562 | 3300005547 | Unclassified | 721 |
| 195 | Ga0070665_100000995 | 3300005548 | Bacteria | 35932 |
| 196 | Ga0070665_100018705 | 3300005548 | Bacteria | 6945 |
| 197 | Ga0070665_100093331 | 3300005548 | Bacteria | 3014 |
| 198 | Ga0070665_100147062 | 3300005548 | Bacteria | 2359 |
| 199 | Ga0070665_100266582 | 3300005548 | Bacteria | 1714 |
| 200 | Ga0070665_100434400 | 3300005548 | Bacteria | 1322 |
| 201 | Ga0070665_100508781 | 3300005548 | Bacteria | 1216 |
| 202 | Ga0068855_100006968 | 3300005563 | Bacteria | 13718 |
| 203 | Ga0068855_100017657 | 3300005563 | Bacteria | 8580 |
| 204 | Ga0068855_100029523 | 3300005563 | Bacteria | 6553 |
| 205 | Ga0068855_100188129 | 3300005563 | Bacteria | 2330 |
| 206 | Ga0068855_100236653 | 3300005563 | Bacteria | 2042 |
| 207 | Ga0068855_100626955 | 3300005563 | Unclassified | 1157 |
| 208 | Ga0068855_100917273 | 3300005563 | Bacteria | 924 |
| 209 | Ga0068855_101023067 | 3300005563 | Bacteria | 867 |
| 210 | Ga0068855_101464336 | 3300005563 | Bacteria | 702 |
| 211 | Ga0070664_100014224 | 3300005564 | Bacteria | 6490 |
| 212 | Ga0070664_100015483 | 3300005564 | Bacteria | 6238 |
| 213 | Ga0070664_100017113 | 3300005564 | Bacteria | 5951 |
| 214 | Ga0070664_100037089 | 3300005564 | Bacteria | 4096 |
| 215 | Ga0070664_100217343 | 3300005564 | Bacteria | 1709 |
| 216 | Ga0070664_100993571 | 3300005564 | Unclassified | 789 |
| 217 | Ga0068857_100007925 | 3300005577 | Bacteria | 9167 |
| 218 | Ga0068857_100011070 | 3300005577 | Bacteria | 7848 |
| 219 | Ga0068857_100013097 | 3300005577 | Bacteria | 7227 |
| 220 | Ga0068857_100073362 | 3300005577 | Unclassified | 3049 |
| 221 | Ga0068857_100687339 | 3300005577 | Bacteria | 971 |
| 222 | Ga0068857_101867594 | 3300005577 | Unclassified | 588 |
| 223 | Ga0068854_100015999 | 3300005578 | Bacteria | 4987 |
| 224 | Ga0068854_100021442 | 3300005578 | Bacteria | 4385 |
| 225 | Ga0068854_100024641 | 3300005578 | Bacteria | 4122 |
| 226 | Ga0068854_100031846 | 3300005578 | Bacteria | 3666 |
| 227 | Ga0068854_100098367 | 3300005578 | Bacteria | 2189 |
| 228 | Ga0068854_100139016 | 3300005578 | Bacteria | 1862 |
| 229 | Ga0068854_100333935 | 3300005578 | Bacteria | 1236 |
| 230 | Ga0068854_100562479 | 3300005578 | Bacteria | 969 |
| 231 | Ga0068854_101611710 | 3300005578 | Bacteria | 592 |
| 232 | Ga0068856_100037364 | 3300005614 | Bacteria | 4766 |
| 233 | Ga0068856_100069594 | 3300005614 | Bacteria | 3480 |
| 234 | Ga0068856_100208614 | 3300005614 | Bacteria | 1968 |
| 235 | Ga0068856_100275782 | 3300005614 | Bacteria | 1698 |
| 236 | Ga0068856_100330248 | 3300005614 | Bacteria | 1542 |
| 237 | Ga0068856_101296759 | 3300005614 | Unclassified | 744 |
| 238 | Ga0068856_101592948 | 3300005614 | Bacteria | 666 |
| 239 | Ga0068852_100011189 | 3300005616 | Bacteria | 6741 |
| 240 | Ga0068852_100021745 | 3300005616 | Bacteria | 5131 |
| 241 | Ga0068852_100056352 | 3300005616 | Bacteria | 3396 |
| 242 | Ga0068852_100061331 | 3300005616 | Bacteria | 3268 |
| 243 | Ga0068852_100086277 | 3300005616 | Bacteria | 2798 |
| 244 | Ga0068852_100126757 | 3300005616 | Bacteria | 2346 |
| 245 | Ga0068852_100170088 | 3300005616 | Bacteria | 2042 |
| 246 | Ga0068852_100290295 | 3300005616 | Bacteria | 1580 |
| 247 | Ga0068852_100369894 | 3300005616 | Bacteria | 1404 |
| 248 | Ga0068852_100432382 | 3300005616 | Unclassified | 1300 |
| 249 | Ga0068852_100478960 | 3300005616 | Bacteria | 1236 |
| 250 | Ga0068859_100013299 | 3300005617 | Bacteria | 8258 |
| 251 | Ga0068859_100032867 | 3300005617 | Bacteria | 5211 |
| 252 | Ga0068859_100091183 | 3300005617 | Bacteria | 3098 |
| 253 | Ga0068859_100105910 | 3300005617 | Bacteria | 2871 |
| 254 | Ga0068859_100379146 | 3300005617 | Unclassified | 1510 |
| 255 | Ga0068859_100913047 | 3300005617 | Bacteria | 962 |
| 256 | Ga0068859_102035184 | 3300005617 | Bacteria | 634 |
| 257 | Ga0068864_100000328 | 3300005618 | Bacteria | 41844 |
| 258 | Ga0068864_100020388 | 3300005618 | Bacteria | 5545 |
| 259 | Ga0068864_100032621 | 3300005618 | Bacteria | 4426 |
| 260 | Ga0068864_101910336 | 3300005618 | Unclassified | 599 |
| 261 | Ga0068866_10036527 | 3300005718 | Bacteria | 2408 |
| 262 | Ga0068866_10251874 | 3300005718 | Bacteria | 1081 |
| 263 | Ga0068861_100022847 | 3300005719 | Bacteria | 4509 |
| 264 | Ga0068861_100484201 | 3300005719 | Bacteria | 1115 |
| 265 | Ga0068861_102056389 | 3300005719 | Unclassified | 570 |
| 266 | Ga0068851_10001318 | 3300005834 | Bacteria | 10811 |
| 267 | Ga0068851_10010278 | 3300005834 | Bacteria | 4364 |
| 268 | Ga0068851_10022059 | 3300005834 | Bacteria | 3098 |
| 269 | Ga0068851_10106250 | 3300005834 | Bacteria | 1494 |
| 270 | Ga0068851_10134324 | 3300005834 | Bacteria | 1340 |
| 271 | Ga0068870_10882229 | 3300005840 | Unclassified | 631 |
| 272 | Ga0068870_10937890 | 3300005840 | Unclassified | 614 |
| 273 | Ga0068863_100000634 | 3300005841 | Bacteria | 35566 |
| 274 | Ga0068863_100003869 | 3300005841 | Bacteria | 14810 |
| 275 | Ga0068863_100172606 | 3300005841 | Bacteria | 2074 |
| 276 | Ga0068863_100488539 | 3300005841 | Bacteria | 1211 |
| 277 | Ga0068858_100004807 | 3300005842 | Bacteria | 13235 |
| 278 | Ga0068858_100009244 | 3300005842 | Bacteria | 9411 |
| 279 | Ga0068858_100014386 | 3300005842 | Bacteria | 7459 |
| 280 | Ga0068858_100485958 | 3300005842 | Bacteria | 1192 |
| 281 | Ga0068860_100006212 | 3300005843 | Bacteria | 12010 |
| 282 | Ga0068860_100009697 | 3300005843 | Bacteria | 9564 |
| 283 | Ga0068860_100021934 | 3300005843 | Bacteria | 6179 |
| 284 | Ga0068860_100058772 | 3300005843 | Bacteria | 3656 |
| 285 | Ga0068860_100072263 | 3300005843 | Bacteria | 3278 |
| 286 | Ga0068860_100089367 | 3300005843 | Bacteria | 2933 |
| 287 | Ga0068860_100258611 | 3300005843 | Bacteria | 1696 |
| 288 | Ga0068860_100607621 | 3300005843 | Archaea | 1099 |
| 289 | Ga0068860_100734478 | 3300005843 | Bacteria | 998 |
| 290 | Ga0068862_100004541 | 3300005844 | Bacteria | 11701 |
| 291 | Ga0068862_100005881 | 3300005844 | Bacteria | 10217 |
| 292 | Ga0068862_100007340 | 3300005844 | Bacteria | 9155 |
| 293 | Ga0068862_100035359 | 3300005844 | Bacteria | 4230 |
| 294 | Ga0068862_100097434 | 3300005844 | Unclassified | 2568 |
| 295 | Ga0068862_100166394 | 3300005844 | Bacteria | 1971 |
| 296 | Ga0068862_100510985 | 3300005844 | Unclassified | 1142 |
| 297 | Ga0068862_100572507 | 3300005844 | Bacteria | 1081 |
| 298 | Ga0068862_100850991 | 3300005844 | Bacteria | 894 |
| 299 | Ga0075364_10425388 | 3300006051 | Bacteria | 907 |
| 300 | Ga0075362_10047063 | 3300006177 | Bacteria | 1920 |
| 301 | Ga0075366_10326305 | 3300006195 | Bacteria | 941 |
| 302 | Ga0068871_100022855 | 3300006358 | Bacteria | 4827 |
| 303 | Ga0068871_100039675 | 3300006358 | Bacteria | 3769 |
| 304 | Ga0075428_100625075 | 3300006844 | Bacteria | 1149 |
| 305 | Ga0075434_100101616 | 3300006871 | Bacteria | 2882 |
| 306 | Ga0075429_101932462 | 3300006880 | Bacteria | 511 |
| 307 | Ga0068865_100012978 | 3300006881 | Bacteria | 5253 |
| 308 | Ga0068865_100122966 | 3300006881 | Unclassified | 1933 |
| 309 | Ga0097620_100013298 | 3300006931 | Bacteria | 8258 |
| 310 | Ga0097620_100032867 | 3300006931 | Bacteria | 5211 |
| 311 | Ga0097620_100091178 | 3300006931 | Bacteria | 3098 |
| 312 | Ga0097620_100105916 | 3300006931 | Bacteria | 2871 |
| 313 | Ga0097620_100379165 | 3300006931 | Unclassified | 1510 |
| 314 | Ga0097620_100913064 | 3300006931 | Bacteria | 962 |
| 315 | Ga0097620_102034893 | 3300006931 | Bacteria | 634 |
| 316 | Ga0097620_102363650 | 3300006931 | Unclassified | 586 |
| 317 | Ga0075435_100131542 | 3300007076 | Bacteria | 2094 |
| 318 | Ga0105240_10086764 | 3300009093 | Bacteria | 3833 |
| 319 | Ga0105240_10109890 | 3300009093 | Bacteria | 3338 |
| 320 | Ga0105245_10000352 | 3300009098 | Bacteria | 42872 |
| 321 | Ga0105245_10118397 | 3300009098 | Bacteria | 2471 |
| 322 | Ga0114129_10892755 | 3300009147 | Bacteria | 1127 |
| 323 | Ga0105243_10027980 | 3300009148 | Bacteria | 4325 |
| 324 | Ga0105243_10499645 | 3300009148 | Unclassified | 1152 |
| 325 | Ga0105243_10676307 | 3300009148 | Bacteria | 1003 |
| 326 | Ga0105241_10041940 | 3300009174 | Bacteria | 3460 |
| 327 | Ga0105241_10262565 | 3300009174 | Bacteria | 1468 |
| 328 | Ga0105241_10952038 | 3300009174 | Unclassified | 800 |
| 329 | Ga0105241_12022105 | 3300009174 | Unclassified | 568 |
| 330 | Ga0105248_10020591 | 3300009177 | Bacteria | 7310 |
| 331 | Ga0105248_10065081 | 3300009177 | Bacteria | 4092 |
| 332 | Ga0105248_10113019 | 3300009177 | Bacteria | 3063 |
| 333 | Ga0105248_10158843 | 3300009177 | Bacteria | 2550 |
| 334 | Ga0105248_10234891 | 3300009177 | Bacteria | 2064 |
| 335 | Ga0105248_10434350 | 3300009177 | Bacteria | 1479 |
| 336 | Ga0105238_10526818 | 3300009551 | Unclassified | 1185 |
| 337 | Ga0105238_10771481 | 3300009551 | Bacteria | 976 |
| 338 | Ga0105238_11574156 | 3300009551 | Bacteria | 687 |
| 339 | Ga0105249_10008677 | 3300009553 | Bacteria | 8855 |
| 340 | Ga0105249_10021535 | 3300009553 | Bacteria | 5772 |
| 341 | Ga0105249_10160529 | 3300009553 | Bacteria | 2172 |
| 342 | Ga0105249_10161072 | 3300009553 | Bacteria | 2168 |
| 343 | Ga0105249_11176046 | 3300009553 | Unclassified | 838 |
| 344 | Ga0105249_11538183 | 3300009553 | Bacteria | 738 |
| 345 | Ga0105249_12018237 | 3300009553 | Bacteria | 649 |
| 346 | Ga0105249_13180518 | 3300009553 | Unclassified | 528 |
| 347 | Ga0105239_10040842 | 3300010375 | Bacteria | 5083 |
| 348 | Ga0105239_10063252 | 3300010375 | Bacteria | 4063 |
| 349 | Ga0105239_11370718 | 3300010375 | Unclassified | 816 |
| 350 | Ga0105239_12319576 | 3300010375 | Bacteria | 625 |
| 351 | Ga0105246_10664287 | 3300011119 | Unclassified | 909 |
| 352 | Ga0105246_11154647 | 3300011119 | Unclassified | 710 |
| 353 | Ga0157316_1017401 | 3300012510 | Bacteria | 749 |
| 354 | Ga0157373_10007015 | 3300013100 | Bacteria | 8395 |
| 355 | Ga0157373_10029098 | 3300013100 | Bacteria | 3982 |
| 356 | Ga0157373_10081989 | 3300013100 | Bacteria | 2273 |
| 357 | Ga0157373_10148086 | 3300013100 | Bacteria | 1651 |
| 358 | Ga0157373_10155299 | 3300013100 | Unclassified | 1610 |
| 359 | Ga0157373_10335593 | 3300013100 | Bacteria | 1077 |
| 360 | Ga0157373_10386291 | 3300013100 | Bacteria | 1002 |
| 361 | Ga0157373_11015385 | 3300013100 | Unclassified | 619 |
| 362 | Ga0157373_11285624 | 3300013100 | Bacteria | 553 |
| 363 | Ga0157371_10001647 | 3300013102 | Bacteria | 22783 |
| 364 | Ga0157371_10010308 | 3300013102 | Bacteria | 7293 |
| 365 | Ga0157371_10028803 | 3300013102 | Bacteria | 4020 |
| 366 | Ga0157371_10042483 | 3300013102 | Bacteria | 3240 |
| 367 | Ga0157371_10072679 | 3300013102 | Bacteria | 2435 |
| 368 | Ga0157371_10457035 | 3300013102 | Unclassified | 939 |
| 369 | Ga0157371_10519396 | 3300013102 | Unclassified | 881 |
| 370 | Ga0157371_10979654 | 3300013102 | Unclassified | 644 |
| 371 | Ga0157370_10022825 | 3300013104 | Bacteria | 6222 |
| 372 | Ga0157370_10071369 | 3300013104 | Bacteria | 3276 |
| 373 | Ga0157370_10177811 | 3300013104 | Bacteria | 1978 |
| 374 | Ga0157370_10497784 | 3300013104 | Bacteria | 1119 |
| 375 | Ga0157370_11491513 | 3300013104 | Bacteria | 608 |
| 376 | Ga0157369_10001177 | 3300013105 | Bacteria | 32602 |
| 377 | Ga0157369_10012443 | 3300013105 | Bacteria | 9659 |
| 378 | Ga0157369_10012489 | 3300013105 | Bacteria | 9636 |
| 379 | Ga0157369_10059027 | 3300013105 | Bacteria | 4138 |
| 380 | Ga0157369_10146686 | 3300013105 | Bacteria | 2495 |
| 381 | Ga0157369_10261787 | 3300013105 | Bacteria | 1804 |
| 382 | Ga0157369_10391297 | 3300013105 | Bacteria | 1442 |
| 383 | Ga0157369_11684232 | 3300013105 | Bacteria | 644 |
| 384 | Ga0157369_12673543 | 3300013105 | Unclassified | 503 |
| 385 | Ga0157374_10029857 | 3300013296 | Bacteria | 4945 |
| 386 | Ga0157374_10151117 | 3300013296 | Bacteria | 2258 |
| 387 | Ga0157374_10452386 | 3300013296 | Bacteria | 1286 |
| 388 | Ga0157378_10001977 | 3300013297 | Bacteria | 18333 |
| 389 | Ga0157378_10295979 | 3300013297 | Bacteria | 1565 |
| 390 | Ga0163162_10013433 | 3300013306 | Bacteria | 7993 |
| 391 | Ga0163162_10046045 | 3300013306 | Bacteria | 4372 |
| 392 | Ga0163162_10264258 | 3300013306 | Bacteria | 1852 |
| 393 | Ga0163162_10651938 | 3300013306 | Unclassified | 1176 |
| 394 | Ga0163162_10960173 | 3300013306 | Unclassified | 965 |
| 395 | Ga0157372_10070897 | 3300013307 | Bacteria | 3922 |
| 396 | Ga0157372_10081328 | 3300013307 | Bacteria | 3667 |
| 397 | Ga0157372_10152605 | 3300013307 | Bacteria | 2667 |
| 398 | Ga0157372_10265239 | 3300013307 | Bacteria | 1994 |
| 399 | Ga0157375_10006981 | 3300013308 | Bacteria | 9863 |
| 400 | Ga0157375_10075228 | 3300013308 | Bacteria | 3401 |
| 401 | Ga0157375_10098321 | 3300013308 | Bacteria | 3003 |
| 402 | Ga0157375_10232043 | 3300013308 | Unclassified | 2004 |
| 403 | Ga0163163_10026163 | 3300014325 | Bacteria | 5573 |
| 404 | Ga0163163_10500046 | 3300014325 | Bacteria | 1277 |
| 405 | Ga0157380_10067716 | 3300014326 | Plasmid | 2876 |
| 406 | Ga0157380_10070822 | 3300014326 | Bacteria | 2819 |
| 407 | Ga0182008_10118950 | 3300014497 | Bacteria | 1312 |
| 408 | Ga0157377_10053958 | 3300014745 | Bacteria | 2274 |
| 409 | Ga0157379_10034679 | 3300014968 | Bacteria | 4500 |
| 410 | Ga0157379_10054030 | 3300014968 | Bacteria | 3589 |
| 411 | Ga0163161_10720808 | 3300017792 | Bacteria | 832 |
| 412 | Ga0224712_10018528 | 3300022467 | Bacteria | 2329 |
| 413 | Ga0207697_10000751 | 3300025315 | Bacteria | 18378 |
| 414 | Ga0207656_10003025 | 3300025321 | Bacteria | 5751 |
| 415 | Ga0207656_10007718 | 3300025321 | Bacteria | 3934 |
| 416 | Ga0207656_10013094 | 3300025321 | Bacteria | 3163 |
| 417 | Ga0207656_10030371 | 3300025321 | Bacteria | 2232 |
| 418 | Ga0207656_10380321 | 3300025321 | Unclassified | 708 |
| 419 | Ga0207682_10003496 | 3300025893 | Bacteria | 6810 |
| 420 | Ga0207682_10098147 | 3300025893 | Unclassified | 1278 |
| 421 | Ga0207688_10003129 | 3300025901 | Bacteria | 9035 |
| 422 | Ga0207688_10011823 | 3300025901 | Bacteria | 4750 |
| 423 | Ga0207688_10123940 | 3300025901 | Bacteria | 1510 |
| 424 | Ga0207688_10236290 | 3300025901 | Bacteria | 1104 |
| 425 | Ga0207680_10087320 | 3300025903 | Bacteria | 1974 |
| 426 | Ga0207680_10089025 | 3300025903 | Bacteria | 1958 |
| 427 | Ga0207680_10190700 | 3300025903 | Bacteria | 1391 |
| 428 | Ga0207647_10000439 | 3300025904 | Bacteria | 34042 |
| 429 | Ga0207647_10000446 | 3300025904 | Bacteria | 33539 |
| 430 | Ga0207647_10026897 | 3300025904 | Bacteria | 3757 |
| 431 | Ga0207647_10246991 | 3300025904 | Bacteria | 1024 |
| 432 | Ga0207647_10273823 | 3300025904 | Bacteria | 964 |
| 433 | Ga0207645_10002747 | 3300025907 | Bacteria | 13707 |
| 434 | Ga0207645_10018707 | 3300025907 | Bacteria | 4549 |
| 435 | Ga0207645_10019033 | 3300025907 | Bacteria | 4509 |
| 436 | Ga0207645_10069759 | 3300025907 | Bacteria | 2248 |
| 437 | Ga0207645_10321727 | 3300025907 | Unclassified | 1032 |
| 438 | Ga0207643_10017186 | 3300025908 | Bacteria | 3951 |
| 439 | Ga0207643_10081713 | 3300025908 | Bacteria | 1873 |
| 440 | Ga0207705_10004596 | 3300025909 | Bacteria | 10419 |
| 441 | Ga0207705_10038318 | 3300025909 | Bacteria | 3432 |
| 442 | Ga0207705_10042629 | 3300025909 | Bacteria | 3258 |
| 443 | Ga0207705_10071092 | 3300025909 | Bacteria | 2522 |
| 444 | Ga0207705_10111594 | 3300025909 | Bacteria | 2021 |
| 445 | Ga0207705_10119522 | 3300025909 | Bacteria | 1954 |
| 446 | Ga0207684_10264557 | 3300025910 | Bacteria | 1484 |
| 447 | Ga0207654_10215782 | 3300025911 | Bacteria | 1270 |
| 448 | Ga0207654_10219261 | 3300025911 | Bacteria | 1261 |
| 449 | Ga0207707_10141594 | 3300025912 | Unclassified | 2103 |
| 450 | Ga0207695_10221443 | 3300025913 | Unclassified | 1799 |
| 451 | Ga0207695_10286907 | 3300025913 | Bacteria | 1539 |
| 452 | Ga0207660_10812034 | 3300025917 | Bacteria | 763 |
| 453 | Ga0207662_10167404 | 3300025918 | Bacteria | 1408 |
| 454 | Ga0207657_10002328 | 3300025919 | Bacteria | 20592 |
| 455 | Ga0207657_10007110 | 3300025919 | Bacteria | 11497 |
| 456 | Ga0207657_10014979 | 3300025919 | Bacteria | 7533 |
| 457 | Ga0207657_10037709 | 3300025919 | Bacteria | 4312 |
| 458 | Ga0207657_10040158 | 3300025919 | Bacteria | 4149 |
| 459 | Ga0207657_10047906 | 3300025919 | Bacteria | 3733 |
| 460 | Ga0207657_10050141 | 3300025919 | Bacteria | 3634 |
| 461 | Ga0207657_10145350 | 3300025919 | Bacteria | 1935 |
| 462 | Ga0207657_10218292 | 3300025919 | Bacteria | 1528 |
| 463 | Ga0207657_10238570 | 3300025919 | Bacteria | 1452 |
| 464 | Ga0207657_10267892 | 3300025919 | Bacteria | 1358 |
| 465 | Ga0207657_10477087 | 3300025919 | Bacteria | 978 |
| 466 | Ga0207649_10004861 | 3300025920 | Bacteria | 7267 |
| 467 | Ga0207649_11369456 | 3300025920 | Unclassified | 560 |
| 468 | Ga0207652_10076724 | 3300025921 | Bacteria | 2915 |
| 469 | Ga0207652_10196500 | 3300025921 | Unclassified | 1815 |
| 470 | Ga0207652_10488507 | 3300025921 | Unclassified | 1109 |
| 471 | Ga0207681_10001284 | 3300025923 | Bacteria | 16212 |
| 472 | Ga0207681_10007770 | 3300025923 | Bacteria | 6567 |
| 473 | Ga0207681_10028732 | 3300025923 | Bacteria | 3605 |
| 474 | Ga0207681_10039200 | 3300025923 | Bacteria | 3144 |
| 475 | Ga0207681_10439902 | 3300025923 | Unclassified | 1059 |
| 476 | Ga0207681_10474352 | 3300025923 | Bacteria | 1021 |
| 477 | Ga0207694_11118144 | 3300025924 | Bacteria | 667 |
| 478 | Ga0207650_10004951 | 3300025925 | Bacteria | 9102 |
| 479 | Ga0207650_10018723 | 3300025925 | Bacteria | 4863 |
| 480 | Ga0207650_10204572 | 3300025925 | Unclassified | 1583 |
| 481 | Ga0207659_10028832 | 3300025926 | Bacteria | 3776 |
| 482 | Ga0207659_10104748 | 3300025926 | Bacteria | 2139 |
| 483 | Ga0207687_10025332 | 3300025927 | Bacteria | 3970 |
| 484 | Ga0207687_10106282 | 3300025927 | Bacteria | 2075 |
| 485 | Ga0207664_10143163 | 3300025929 | Bacteria | 2025 |
| 486 | Ga0207644_10198958 | 3300025931 | Bacteria | 1580 |
| 487 | Ga0207644_10326450 | 3300025931 | Bacteria | 1242 |
| 488 | Ga0207690_10012741 | 3300025932 | Bacteria | 5039 |
| 489 | Ga0207690_10014735 | 3300025932 | Bacteria | 4728 |
| 490 | Ga0207690_10027796 | 3300025932 | Bacteria | 3578 |
| 491 | Ga0207690_10032900 | 3300025932 | Bacteria | 3330 |
| 492 | Ga0207690_10099441 | 3300025932 | Bacteria | 2074 |
| 493 | Ga0207690_10129487 | 3300025932 | Bacteria | 1845 |
| 494 | Ga0207690_10205050 | 3300025932 | Bacteria | 1500 |
| 495 | Ga0207690_10317065 | 3300025932 | Unclassified | 1224 |
| 496 | Ga0207690_10407053 | 3300025932 | Bacteria | 1086 |
| 497 | Ga0207690_10622975 | 3300025932 | Bacteria | 882 |
| 498 | Ga0207690_11168442 | 3300025932 | Unclassified | 642 |
| 499 | Ga0207706_10000446 | 3300025933 | Bacteria | 44110 |
| 500 | Ga0207706_10009416 | 3300025933 | Bacteria | 8966 |
| 501 | Ga0207706_10013576 | 3300025933 | Bacteria | 7400 |
| 502 | Ga0207706_10055491 | 3300025933 | Bacteria | 3493 |
| 503 | Ga0207706_10062782 | 3300025933 | Bacteria | 3271 |
| 504 | Ga0207706_10068347 | 3300025933 | Bacteria | 3126 |
| 505 | Ga0207706_10079578 | 3300025933 | Bacteria | 2882 |
| 506 | Ga0207706_10098659 | 3300025933 | Bacteria | 2570 |
| 507 | Ga0207706_10185844 | 3300025933 | Bacteria | 1825 |
| 508 | Ga0207706_10737392 | 3300025933 | Unclassified | 840 |
| 509 | Ga0207709_10214557 | 3300025935 | Bacteria | 1384 |
| 510 | Ga0207709_10348109 | 3300025935 | Bacteria | 1118 |
| 511 | Ga0207669_10022197 | 3300025937 | Bacteria | 3367 |
| 512 | Ga0207669_10249551 | 3300025937 | Bacteria | 1321 |
| 513 | Ga0207669_10541031 | 3300025937 | Unclassified | 938 |
| 514 | Ga0207704_10016682 | 3300025938 | Bacteria | 3782 |
| 515 | Ga0207704_10133568 | 3300025938 | Unclassified | 1723 |
| 516 | Ga0207704_10821357 | 3300025938 | Bacteria | 777 |
| 517 | Ga0207691_10008977 | 3300025940 | Bacteria | 9589 |
| 518 | Ga0207691_10021285 | 3300025940 | Bacteria | 6124 |
| 519 | Ga0207691_10064947 | 3300025940 | Bacteria | 3305 |
| 520 | Ga0207691_10117178 | 3300025940 | Unclassified | 2363 |
| 521 | Ga0207691_10183214 | 3300025940 | Bacteria | 1829 |
| 522 | Ga0207691_10512778 | 3300025940 | Bacteria | 1018 |
| 523 | Ga0207711_10000218 | 3300025941 | Bacteria | 61467 |
| 524 | Ga0207711_10035386 | 3300025941 | Bacteria | 4232 |
| 525 | Ga0207711_10081823 | 3300025941 | Bacteria | 2822 |
| 526 | Ga0207711_10178764 | 3300025941 | Bacteria | 1928 |
| 527 | Ga0207711_10755981 | 3300025941 | Bacteria | 906 |
| 528 | Ga0207689_10000064 | 3300025942 | Bacteria | 84222 |
| 529 | Ga0207689_10008314 | 3300025942 | Bacteria | 9039 |
| 530 | Ga0207689_10142528 | 3300025942 | Bacteria | 1974 |
| 531 | Ga0207689_10752775 | 3300025942 | Bacteria | 822 |
| 532 | Ga0207661_10051319 | 3300025944 | Bacteria | 3290 |
| 533 | Ga0207661_10145090 | 3300025944 | Bacteria | 2047 |
| 534 | Ga0207679_10007564 | 3300025945 | Bacteria | 6895 |
| 535 | Ga0207679_10012810 | 3300025945 | Bacteria | 5481 |
| 536 | Ga0207679_10033120 | 3300025945 | Bacteria | 3634 |
| 537 | Ga0207679_10091597 | 3300025945 | Bacteria | 2353 |
| 538 | Ga0207679_10099466 | 3300025945 | Bacteria | 2271 |
| 539 | Ga0207679_11027062 | 3300025945 | Bacteria | 756 |
| 540 | Ga0207679_11507049 | 3300025945 | Unclassified | 617 |
| 541 | Ga0207667_10016908 | 3300025949 | Bacteria | 8229 |
| 542 | Ga0207667_10027440 | 3300025949 | Bacteria | 6198 |
| 543 | Ga0207667_10082526 | 3300025949 | Bacteria | 3329 |
| 544 | Ga0207667_10386053 | 3300025949 | Unclassified | 1427 |
| 545 | Ga0207667_10871696 | 3300025949 | Bacteria | 893 |
| 546 | Ga0207667_10906072 | 3300025949 | Bacteria | 873 |
| 547 | Ga0207651_10004881 | 3300025960 | Bacteria | 6836 |
| 548 | Ga0207651_10190948 | 3300025960 | Bacteria | 1634 |
| 549 | Ga0207651_10478877 | 3300025960 | Bacteria | 1072 |
| 550 | Ga0207651_10494275 | 3300025960 | Bacteria | 1056 |
| 551 | Ga0207651_10717469 | 3300025960 | Unclassified | 882 |
| 552 | Ga0207651_10806962 | 3300025960 | Bacteria | 832 |
| 553 | Ga0207651_10865043 | 3300025960 | Bacteria | 804 |
| 554 | Ga0207651_11267245 | 3300025960 | Unclassified | 662 |
| 555 | Ga0207712_10000474 | 3300025961 | Bacteria | 33783 |
| 556 | Ga0207712_10030817 | 3300025961 | Bacteria | 3608 |
| 557 | Ga0207712_10116724 | 3300025961 | Bacteria | 2012 |
| 558 | Ga0207712_10828596 | 3300025961 | Bacteria | 814 |
| 559 | Ga0207712_11537416 | 3300025961 | Unclassified | 596 |
| 560 | Ga0207668_10000021 | 3300025972 | Bacteria | 137592 |
| 561 | Ga0207668_10022745 | 3300025972 | Bacteria | 4018 |
| 562 | Ga0207668_10112668 | 3300025972 | Bacteria | 2044 |
| 563 | Ga0207668_10674807 | 3300025972 | Bacteria | 906 |
| 564 | Ga0207668_10862919 | 3300025972 | Bacteria | 804 |
| 565 | Ga0207668_10991685 | 3300025972 | Unclassified | 750 |
| 566 | Ga0207668_11204573 | 3300025972 | Bacteria | 681 |
| 567 | Ga0207640_10038139 | 3300025981 | Bacteria | 3030 |
| 568 | Ga0207640_10098051 | 3300025981 | Bacteria | 2048 |
| 569 | Ga0207640_10133097 | 3300025981 | Bacteria | 1800 |
| 570 | Ga0207640_10415241 | 3300025981 | Bacteria | 1100 |
| 571 | Ga0207640_11266644 | 3300025981 | Unclassified | 657 |
| 572 | Ga0207640_11367073 | 3300025981 | Bacteria | 634 |
| 573 | Ga0207658_10004594 | 3300025986 | Bacteria | 9582 |
| 574 | Ga0207658_10024798 | 3300025986 | Bacteria | 4197 |
| 575 | Ga0207658_10043342 | 3300025986 | Bacteria | 3270 |
| 576 | Ga0207658_10087800 | 3300025986 | Bacteria | 2402 |
| 577 | Ga0207658_10182969 | 3300025986 | Bacteria | 1736 |
| 578 | Ga0207658_10917976 | 3300025986 | Bacteria | 797 |
| 579 | Ga0207658_10929188 | 3300025986 | Unclassified | 792 |
| 580 | Ga0207677_10084470 | 3300026023 | Bacteria | 2288 |
| 581 | Ga0207677_10238822 | 3300026023 | Bacteria | 1468 |
| 582 | Ga0207703_10002562 | 3300026035 | Bacteria | 15697 |
| 583 | Ga0207703_10029829 | 3300026035 | Bacteria | 4306 |
| 584 | Ga0207703_10063198 | 3300026035 | Bacteria | 3034 |
| 585 | Ga0207703_10217056 | 3300026035 | Bacteria | 1708 |
| 586 | Ga0207639_10031388 | 3300026041 | Bacteria | 3904 |
| 587 | Ga0207639_10039603 | 3300026041 | Bacteria | 3512 |
| 588 | Ga0207639_10057262 | 3300026041 | Bacteria | 2992 |
| 589 | Ga0207639_10090089 | 3300026041 | Bacteria | 2452 |
| 590 | Ga0207639_10378026 | 3300026041 | Bacteria | 1271 |
| 591 | Ga0207639_11312508 | 3300026041 | Unclassified | 679 |
| 592 | Ga0207678_10001094 | 3300026067 | Bacteria | 24866 |
| 593 | Ga0207678_10004153 | 3300026067 | Bacteria | 13007 |
| 594 | Ga0207678_10009167 | 3300026067 | Bacteria | 8708 |
| 595 | Ga0207678_10020075 | 3300026067 | Bacteria | 5870 |
| 596 | Ga0207678_10089099 | 3300026067 | Bacteria | 2637 |
| 597 | Ga0207678_10147977 | 3300026067 | Bacteria | 2005 |
| 598 | Ga0207678_10178969 | 3300026067 | Bacteria | 1811 |
| 599 | Ga0207678_10188887 | 3300026067 | Unclassified | 1760 |
| 600 | Ga0207678_10443063 | 3300026067 | Bacteria | 1128 |
| 601 | Ga0207702_10012315 | 3300026078 | Bacteria | 7118 |
| 602 | Ga0207702_10050713 | 3300026078 | Bacteria | 3504 |
| 603 | Ga0207702_10088481 | 3300026078 | Bacteria | 2706 |
| 604 | Ga0207702_10100776 | 3300026078 | Bacteria | 2549 |
| 605 | Ga0207702_10176357 | 3300026078 | Bacteria | 1964 |
| 606 | Ga0207702_10356188 | 3300026078 | Bacteria | 1401 |
| 607 | Ga0207702_10445406 | 3300026078 | Bacteria | 1256 |
| 608 | Ga0207702_11413116 | 3300026078 | Bacteria | 690 |
| 609 | Ga0207641_10000248 | 3300026088 | Bacteria | 68877 |
| 610 | Ga0207641_10023188 | 3300026088 | Bacteria | 5114 |
| 611 | Ga0207641_10040068 | 3300026088 | Bacteria | 3919 |
| 612 | Ga0207641_10088129 | 3300026088 | Bacteria | 2709 |
| 613 | Ga0207641_10334108 | 3300026088 | Bacteria | 1440 |
| 614 | Ga0207641_10514755 | 3300026088 | Bacteria | 1163 |
| 615 | Ga0207648_10001456 | 3300026089 | Bacteria | 26049 |
| 616 | Ga0207648_10035979 | 3300026089 | Bacteria | 4363 |
| 617 | Ga0207648_10036060 | 3300026089 | Bacteria | 4357 |
| 618 | Ga0207648_10158592 | 3300026089 | Bacteria | 1998 |
| 619 | Ga0207648_10159270 | 3300026089 | Bacteria | 1994 |
| 620 | Ga0207648_10504736 | 3300026089 | Bacteria | 1107 |
| 621 | Ga0207676_10000761 | 3300026095 | Bacteria | 25222 |
| 622 | Ga0207676_10001326 | 3300026095 | Bacteria | 18391 |
| 623 | Ga0207676_10027785 | 3300026095 | Bacteria | 4218 |
| 624 | Ga0207676_11186640 | 3300026095 | Unclassified | 756 |
| 625 | Ga0207674_10000362 | 3300026116 | Bacteria | 58887 |
| 626 | Ga0207674_10000814 | 3300026116 | Bacteria | 40536 |
| 627 | Ga0207674_10012143 | 3300026116 | Bacteria | 9642 |
| 628 | Ga0207674_10021233 | 3300026116 | Bacteria | 6999 |
| 629 | Ga0207674_10051113 | 3300026116 | Bacteria | 4218 |
| 630 | Ga0207674_10072025 | 3300026116 | Bacteria | 3472 |
| 631 | Ga0207674_10163757 | 3300026116 | Bacteria | 2178 |
| 632 | Ga0207674_10701935 | 3300026116 | Unclassified | 977 |
| 633 | Ga0207674_10995421 | 3300026116 | Bacteria | 807 |
| 634 | Ga0207675_100036116 | 3300026118 | Bacteria | 4608 |
| 635 | Ga0207675_100289169 | 3300026118 | Bacteria | 1594 |
| 636 | Ga0207675_100592572 | 3300026118 | Unclassified | 1111 |
| 637 | Ga0207675_101941388 | 3300026118 | Unclassified | 607 |
| 638 | Ga0207683_10509393 | 3300026121 | Bacteria | 1112 |
| 639 | Ga0207698_10013270 | 3300026142 | Bacteria | 5428 |
| 640 | Ga0207698_10025015 | 3300026142 | Bacteria | 4198 |
| 641 | Ga0207698_10126650 | 3300026142 | Bacteria | 2173 |
| 642 | Ga0207698_10217026 | 3300026142 | Bacteria | 1726 |
| 643 | Ga0207698_10301129 | 3300026142 | Unclassified | 1492 |
| 644 | Ga0207698_10468207 | 3300026142 | Bacteria | 1220 |
| 645 | Ga0207698_10527207 | 3300026142 | Bacteria | 1154 |
| 646 | Ga0207698_11049354 | 3300026142 | Bacteria | 827 |
| 647 | Ga0210002_1034638 | 3300027617 | Unclassified | 847 |
| 648 | Ga0209974_10078376 | 3300027876 | Unclassified | 1134 |
| 649 | Ga0268266_10000318 | 3300028379 | Bacteria | 76400 |
| 650 | Ga0268266_10005319 | 3300028379 | Bacteria | 12063 |
| 651 | Ga0268266_10074969 | 3300028379 | Bacteria | 2938 |
| 652 | Ga0268266_10575129 | 3300028379 | Bacteria | 1081 |
| 653 | Ga0268266_10576564 | 3300028379 | Bacteria | 1079 |
| 654 | Ga0268266_10653760 | 3300028379 | Bacteria | 1012 |
| 655 | Ga0268266_11073145 | 3300028379 | Unclassified | 779 |
| 656 | Ga0268265_10000789 | 3300028380 | Bacteria | 30232 |
| 657 | Ga0268265_10005423 | 3300028380 | Bacteria | 8725 |
| 658 | Ga0268265_10012555 | 3300028380 | Bacteria | 5742 |
| 659 | Ga0268265_10029552 | 3300028380 | Bacteria | 3935 |
| 660 | Ga0268265_10075356 | 3300028380 | Unclassified | 2642 |
| 661 | Ga0268265_10108182 | 3300028380 | Bacteria | 2263 |
| 662 | Ga0268265_10633172 | 3300028380 | Bacteria | 1026 |
| 663 | Ga0268264_10006173 | 3300028381 | Bacteria | 10120 |
| 664 | Ga0268264_10009557 | 3300028381 | Bacteria | 8031 |
| 665 | Ga0268264_10054953 | 3300028381 | Bacteria | 3326 |
| 666 | Ga0268264_10056108 | 3300028381 | Bacteria | 3292 |
| 667 | Ga0268264_10119281 | 3300028381 | Bacteria | 2323 |
| 668 | Ga0268264_10148268 | 3300028381 | Bacteria | 2100 |
| 669 | Ga0268264_10235741 | 3300028381 | Bacteria | 1692 |
| 670 | Ga0268264_10413512 | 3300028381 | Unclassified | 1299 |
| 671 | Ga0307408_100362057 | 3300031548 | Bacteria | 1234 |
| 672 | Ga0307408_100481660 | 3300031548 | Bacteria | 1082 |
| 673 | Ga0307405_10097727 | 3300031731 | Bacteria | 1961 |
| 674 | Ga0307405_10515380 | 3300031731 | Bacteria | 961 |
| 675 | Ga0307405_10639763 | 3300031731 | Unclassified | 873 |
| 676 | Ga0307413_10003613 | 3300031824 | Bacteria | 6554 |
| 677 | Ga0307413_10008481 | 3300031824 | Bacteria | 4856 |
| 678 | Ga0307413_10459055 | 3300031824 | Bacteria | 1013 |
| 679 | Ga0307413_11104634 | 3300031824 | Bacteria | 685 |
| 680 | Ga0307413_11504801 | 3300031824 | Bacteria | 595 |
| 681 | Ga0307410_10005467 | 3300031852 | Bacteria | 6730 |
| 682 | Ga0307410_10020790 | 3300031852 | Bacteria | 4024 |
| 683 | Ga0307410_10027755 | 3300031852 | Bacteria | 3580 |
| 684 | Ga0307410_10069338 | 3300031852 | Bacteria | 2439 |
| 685 | Ga0307410_10091089 | 3300031852 | Bacteria | 2164 |
| 686 | Ga0307410_10146858 | 3300031852 | Unclassified | 1751 |
| 687 | Ga0307410_10449277 | 3300031852 | Bacteria | 1051 |
| 688 | Ga0307406_10043203 | 3300031901 | Bacteria | 2818 |
| 689 | Ga0307406_10194396 | 3300031901 | Bacteria | 1488 |
| 690 | Ga0307406_10333790 | 3300031901 | Unclassified | 1178 |
| 691 | Ga0307406_10879618 | 3300031901 | Unclassified | 761 |
| 692 | Ga0307407_10021132 | 3300031903 | Bacteria | 3350 |
| 693 | Ga0307407_10394157 | 3300031903 | Bacteria | 992 |
| 694 | Ga0307412_10006903 | 3300031911 | Bacteria | 6441 |
| 695 | Ga0307412_10171451 | 3300031911 | Bacteria | 1623 |
| 696 | Ga0307409_100004073 | 3300031995 | Bacteria | 8125 |
| 697 | Ga0307409_100026423 | 3300031995 | Bacteria | 4094 |
| 698 | Ga0307409_100030409 | 3300031995 | Bacteria | 3879 |
| 699 | Ga0307409_100177191 | 3300031995 | Bacteria | 1883 |
| 700 | Ga0307409_100408843 | 3300031995 | Bacteria | 1298 |
| 701 | Ga0307409_100471649 | 3300031995 | Bacteria | 1216 |
| 702 | Ga0307416_100554195 | 3300032002 | Bacteria | 1223 |
| 703 | Ga0307416_102519721 | 3300032002 | Unclassified | 613 |
| 704 | Ga0307414_10006161 | 3300032004 | Bacteria | 6665 |
| 705 | Ga0307414_10072352 | 3300032004 | Bacteria | 2490 |
| 706 | Ga0307414_10079778 | 3300032004 | Unclassified | 2391 |
| 707 | Ga0307414_10085292 | 3300032004 | Bacteria | 2326 |
| 708 | Ga0307414_10207051 | 3300032004 | Bacteria | 1600 |
| 709 | Ga0307414_10435337 | 3300032004 | Bacteria | 1147 |
| 710 | Ga0307414_10830701 | 3300032004 | Bacteria | 844 |
| 711 | Ga0307411_10000435 | 3300032005 | Bacteria | 14250 |
| 712 | Ga0307411_10000684 | 3300032005 | Bacteria | 12469 |
| 713 | Ga0307411_10966778 | 3300032005 | Unclassified | 760 |
| 714 | Ga0307415_100033282 | 3300032126 | Bacteria | 3345 |
| 715 | Ga0307415_100050442 | 3300032126 | Bacteria | 2820 |
| 716 | Ga0307415_100140050 | 3300032126 | Bacteria | 1846 |
| 717 | Ga0307415_100219141 | 3300032126 | Bacteria | 1524 |
| 718 | Ga0373929_0161293 | 3300035085 | Unclassified | 608 |
| 719 | Ga0395899_0032217 | 3300037312 | Bacteria | 3938 |
| 720 | Ga0395899_0171598 | 3300037312 | Bacteria | 1527 |
| 721 | Ga0395899_0202925 | 3300037312 | Unclassified | 1381 |
| 722 | Ga0395899_0625501 | 3300037312 | Unclassified | 683 |
| 723 | Ga0395900_0003019 | 3300037418 | Bacteria | 18309 |
| 724 | Ga0395900_0012506 | 3300037418 | Bacteria | 8681 |
| 725 | Ga0395900_0071242 | 3300037418 | Bacteria | 3573 |
| 726 | Ga0395900_0091532 | 3300037418 | Bacteria | 3125 |
| 727 | Ga0395900_0107472 | 3300037418 | Bacteria | 2866 |
| 728 | Ga0395900_0177611 | 3300037418 | Bacteria | 2165 |
| 729 | Ga0395900_0178988 | 3300037418 | Bacteria | 2156 |
| 730 | Ga0395900_0251375 | 3300037418 | Bacteria | 1769 |
| 731 | Ga0395900_0271284 | 3300037418 | Bacteria | 1691 |
| 732 | Ga0395900_0351870 | 3300037418 | Bacteria | 1446 |
| 733 | Ga0395900_0435951 | 3300037418 | Unclassified | 1269 |
| 734 | Ga0395900_0506972 | 3300037418 | Bacteria | 1156 |
| 735 | Ga0395900_0645259 | 3300037418 | Bacteria | 996 |
| 736 | Ga0395900_0652541 | 3300037418 | Unclassified | 989 |
| 737 | Ga0395898_0025517 | 3300037466 | Bacteria | 5955 |
| 738 | Ga0395898_0036672 | 3300037466 | Bacteria | 4868 |
| 739 | Ga0395898_0088025 | 3300037466 | Bacteria | 2990 |
| 740 | Ga0395898_0099990 | 3300037466 | Bacteria | 2785 |
| 741 | Ga0395898_0301935 | 3300037466 | Bacteria | 1527 |
| 742 | Ga0395898_0780755 | 3300037466 | Unclassified | 896 |
| 743 | Ga0395905_0004032 | 3300037471 | Bacteria | 15414 |
| 744 | Ga0395905_0010096 | 3300037471 | Bacteria | 9204 |
| 745 | Ga0395905_0012671 | 3300037471 | Bacteria | 8112 |
| 746 | Ga0395905_0015825 | 3300037471 | Bacteria | 7164 |
| 747 | Ga0395905_0024841 | 3300037471 | Bacteria | 5654 |
| 748 | Ga0395905_0033171 | 3300037471 | Bacteria | 4851 |
| 749 | Ga0395905_0054313 | 3300037471 | Bacteria | 3749 |
| 750 | Ga0395905_0070855 | 3300037471 | Bacteria | 3267 |
| 751 | Ga0395905_0075399 | 3300037471 | Bacteria | 3161 |
| 752 | Ga0395905_0106578 | 3300037471 | Bacteria | 2631 |
| 753 | Ga0395905_0118792 | 3300037471 | Bacteria | 2485 |
| 754 | Ga0395905_0132012 | 3300037471 | Unclassified | 2349 |
| 755 | Ga0395905_0172929 | 3300037471 | Bacteria | 2029 |
| 756 | Ga0395905_0218162 | 3300037471 | Bacteria | 1786 |
| 757 | Ga0395905_0403154 | 3300037471 | Unclassified | 1263 |
| 758 | Ga0395905_0763791 | 3300037471 | Unclassified | 869 |
| 759 | Ga0395905_0922445 | 3300037471 | Bacteria | 776 |
| 760 | Ga0395901_0002158 | 3300038443 | Bacteria | 20096 |
| 761 | Ga0395901_0062289 | 3300038443 | Bacteria | 3882 |
| 762 | Ga0395901_0072179 | 3300038443 | Bacteria | 3598 |
| 763 | Ga0395901_0083176 | 3300038443 | Bacteria | 3346 |
| 764 | Ga0395901_0122941 | 3300038443 | Bacteria | 2727 |
| 765 | Ga0395901_0209922 | 3300038443 | Bacteria | 2038 |
| 766 | Ga0395901_0256130 | 3300038443 | Bacteria | 1822 |
| 767 | Ga0395901_0451913 | 3300038443 | Bacteria | 1314 |
| 768 | Ga0395901_0489436 | 3300038443 | Bacteria | 1253 |
| 769 | Ga0439432_168881 | 3300042006 | Unclassified | 639 |
| 770 | Ga0450917_001012 | 3300042120 | Bacteria | 2076 |
| 771 | Ga0450907_016387 | 3300042146 | Unclassified | 1237 |
| 772 | Ga0466969_0065588 | 3300044656 | Bacteria | 1755 |
| 773 | Ga0466969_0199970 | 3300044656 | Unclassified | 912 |
| 774 | Ga0466965_0422674 | 3300044683 | Bacteria | 739 |
| 775 | Ga0466966_0015374 | 3300044684 | Bacteria | 5060 |
| 776 | Ga0466966_0052755 | 3300044684 | Bacteria | 2581 |
| 777 | Ga0466961_0049492 | 3300044693 | Bacteria | 2686 |
| 778 | Ga0466961_0091612 | 3300044693 | Bacteria | 1919 |
| 779 | Ga0466961_0373545 | 3300044693 | Unclassified | 866 |
| 780 | Ga0466963_0015218 | 3300044694 | Bacteria | 4759 |
| 781 | Ga0466971_0004306 | 3300044719 | Bacteria | 6135 |
| 782 | Ga0466970_0005939 | 3300044765 | Bacteria | 6087 |
| 783 | Ga0466957_0036103 | 3300044842 | Bacteria | 2969 |
| 784 | Ga0466957_0055180 | 3300044842 | Bacteria | 2428 |
| 785 | Ga0466957_0577874 | 3300044842 | Unclassified | 785 |
| 786 | Ga0466960_0621058 | 3300044901 | Unclassified | 643 |
| 787 | Ga0466959_0035229 | 3300045049 | Bacteria | 3703 |
| 788 | Ga0466959_0061069 | 3300045049 | Bacteria | 2741 |
| 789 | Ga0466959_0340378 | 3300045049 | Unclassified | 1023 |
| 790 | Ga0466958_0094126 | 3300045836 | Bacteria | 1856 |
| 791 | Ga0466958_0258447 | 3300045836 | Bacteria | 1114 |
| 792 | Ga0466967_0015201 | 3300045976 | Bacteria | 6028 |
| 793 | Ga0466967_0023305 | 3300045976 | Bacteria | 5070 |
| 794 | Ga0495643_0204862 | 3300046522 | Unclassified | 945 |
| 795 | Ga0495663_0123981 | 3300046525 | Bacteria | 867 |
| 796 | Ga0495668_0869974 | 3300046616 | Bacteria | 500 |
| 797 | Ga0495659_0153185 | 3300046664 | Bacteria | 927 |
| 798 | Ga0495669_0349263 | 3300046684 | Unclassified | 715 |
| 799 | Ga0495672_0090704 | 3300047320 | Bacteria | 1679 |
| 800 | Ga0496101_1405484 | 3300048904 | Bacteria | 544 |
| 801 | Ga0496102_0934407 | 3300048905 | Bacteria | 789 |
| 802 | Ga0496102_1468310 | 3300048905 | Bacteria | 601 |
| 803 | Ga0496103_0294848 | 3300048906 | Bacteria | 1043 |
| 804 | Ga0496106_0240757 | 3300048909 | Bacteria | 1446 |
| 805 | Ga0496107_0142038 | 3300048910 | Bacteria | 1775 |
| 806 | Ga0496107_0919242 | 3300048910 | Unclassified | 637 |
| 807 | Ga0496109_0134445 | 3300048912 | Bacteria | 2310 |
| 808 | Ga0496109_0217689 | 3300048912 | Bacteria | 1796 |
| 809 | Ga0496109_0346128 | 3300048912 | Bacteria | 1404 |
| 810 | Ga0496110_0992202 | 3300048913 | Unclassified | 747 |
| 811 | Ga0496112_0681231 | 3300048915 | Bacteria | 957 |
| 812 | Ga0496113_0217082 | 3300048916 | Bacteria | 1524 |
| 813 | Ga0501041_0959017 | 3300049577 | Unclassified | 550 |
| 814 | Ga0501067_0026714 | 3300049583 | Bacteria | 3197 |
| 815 | Ga0501068_0190733 | 3300049584 | Unclassified | 1298 |
| 816 | Ga0501216_096652 | 3300049660 | Unclassified | 646 |
| 817 | nmdc:mga03683_42402_c1 | 3300050489 | Bacteria | 1872 |
| 818 | nmdc:mga05p37_1107438_c1 | 3300050507 | Bacteria | 828 |
| 819 | nmdc:mga09592_282551_c1 | 3300050508 | Bacteria | 1439 |
| 820 | nmdc:mga0n895_1157217_c1 | 3300050512 | Unclassified | 749 |
| 821 | nmdc:mga0a205_248_c1 | 3300050515 | Bacteria | 38486 |
| 822 | Ga0466962_0018606 | 3300061719 | Bacteria | 3341 |
| 823 | Ga0466962_0106472 | 3300061719 | Bacteria | 1348 |
| 824 | Ga0530510_1372939 | 3300061734 | Unclassified | 542 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061734 | Ga0530510_1372939 | Ga0530510_1372939_181_522 | 108 |
| 2 | 3300026089 | Ga0207648_10504736 | Ga0207648_105047362 | 115 |
| 3 | 3300025945 | Ga0207679_11027062 | Ga0207679_110270621 | 117 |
| 4 | 3300046664 | Ga0495659_0153185 | Ga0495659_0153185_549_917 | 117 |
| 5 | 3300005328 | Ga0070676_10075467 | Ga0070676_100754672 | 128 |
| 6 | 3300005333 | Ga0070677_10226910 | Ga0070677_102269102 | 128 |
| 7 | 3300005334 | Ga0068869_101180378 | Ga0068869_1011803781 | 128 |
| 8 | 3300005364 | Ga0070673_100295256 | Ga0070673_1002952562 | 128 |
| 9 | 3300005366 | Ga0070659_100415178 | Ga0070659_1004151782 | 128 |
| 10 | 3300005457 | Ga0070662_100046756 | Ga0070662_1000467562 | 128 |
| 11 | 3300005459 | Ga0068867_100697801 | Ga0068867_1006978012 | 128 |
| 12 | 3300005578 | Ga0068854_100015999 | Ga0068854_1000159996 | 128 |
| 13 | 3300005719 | Ga0068861_100484201 | Ga0068861_1004842012 | 128 |
| 14 | 3300009148 | Ga0105243_10676307 | Ga0105243_106763072 | 128 |
| 15 | 3300014326 | Ga0157380_10067716 | Ga0157380_100677164 | 128 |
| 16 | 3300025901 | Ga0207688_10123940 | Ga0207688_101239402 | 128 |
| 17 | 3300025907 | Ga0207645_10069759 | Ga0207645_100697592 | 128 |
| 18 | 3300025932 | Ga0207690_10099441 | Ga0207690_100994413 | 128 |
| 19 | 3300025933 | Ga0207706_10062782 | Ga0207706_100627824 | 128 |
| 20 | 3300025960 | Ga0207651_10865043 | Ga0207651_108650432 | 128 |
| 21 | 3300025981 | Ga0207640_10133097 | Ga0207640_101330972 | 128 |
| 22 | 3300026089 | Ga0207648_10159270 | Ga0207648_101592703 | 128 |
| 23 | 3300037471 | Ga0395905_0033171 | Ga0395905_0033171_2247_2735 | 128 |
| 24 | 3300038443 | Ga0395901_0072179 | Ga0395901_0072179_556_1044 | 128 |
| 25 | 3300027617 | Ga0210002_1034638 | Ga0210002_10346382 | 130 |
| 26 | 3300027876 | Ga0209974_10078376 | Ga0209974_100783762 | 130 |
| 27 | 3300037418 | Ga0395900_0435951 | Ga0395900_0435951_734_1144 | 130 |
| 28 | 3300005329 | Ga0070683_100122723 | Ga0070683_1001227233 | 133 |
| 29 | 3300005344 | Ga0070661_100103784 | Ga0070661_1001037843 | 133 |
| 30 | 3300005366 | Ga0070659_100370126 | Ga0070659_1003701261 | 133 |
| 31 | 3300005617 | Ga0068859_102035184 | Ga0068859_1020351842 | 133 |
| 32 | 3300006931 | Ga0097620_102034893 | Ga0097620_1020348932 | 133 |
| 33 | 3300025908 | Ga0207643_10081713 | Ga0207643_100817131 | 133 |
| 34 | 3300025932 | Ga0207690_11168442 | Ga0207690_111684422 | 133 |
| 35 | 3300037418 | Ga0395900_0091532 | Ga0395900_0091532_199_723 | 133 |
| 36 | 3300037466 | Ga0395898_0301935 | Ga0395898_0301935_992_1516 | 133 |
| 37 | 3300037471 | Ga0395905_0015825 | Ga0395905_0015825_2228_2665 | 133 |
| 38 | 3300037471 | Ga0395905_0024841 | Ga0395905_0024841_1246_1770 | 133 |
| 39 | 3300037471 | Ga0395905_0218162 | Ga0395905_0218162_1029_1445 | 133 |
| 40 | 3300038443 | Ga0395901_0062289 | Ga0395901_0062289_2889_3326 | 133 |
| 41 | 3300038443 | Ga0395901_0256130 | Ga0395901_0256130_802_1326 | 133 |
| 42 | 3300005435 | Ga0070714_100070117 | Ga0070714_1000701171 | 134 |
| 43 | 3300005614 | Ga0068856_100275782 | Ga0068856_1002757823 | 134 |
| 44 | 3300005844 | Ga0068862_100004541 | Ga0068862_1000045414 | 134 |
| 45 | 3300006844 | Ga0075428_100625075 | Ga0075428_1006250752 | 134 |
| 46 | 3300006880 | Ga0075429_101932462 | Ga0075429_1019324621 | 134 |
| 47 | 3300006931 | Ga0097620_102363650 | Ga0097620_1023636501 | 134 |
| 48 | 3300009177 | Ga0105248_10434350 | Ga0105248_104343501 | 134 |
| 49 | 3300013100 | Ga0157373_10081989 | Ga0157373_100819892 | 134 |
| 50 | 3300013105 | Ga0157369_12673543 | Ga0157369_126735431 | 134 |
| 51 | 3300013296 | Ga0157374_10029857 | Ga0157374_100298572 | 134 |
| 52 | 3300025941 | Ga0207711_10755981 | Ga0207711_107559812 | 134 |
| 53 | 3300026078 | Ga0207702_10088481 | Ga0207702_100884813 | 134 |
| 54 | 3300028380 | Ga0268265_10005423 | Ga0268265_100054237 | 134 |
| 55 | 3300031824 | Ga0307413_11104634 | Ga0307413_111046342 | 134 |
| 56 | 3300031852 | Ga0307410_10146858 | Ga0307410_101468583 | 134 |
| 57 | 3300031852 | Ga0307410_10449277 | Ga0307410_104492772 | 134 |
| 58 | 3300031995 | Ga0307409_100471649 | Ga0307409_1004716492 | 134 |
| 59 | 3300032126 | Ga0307415_100140050 | Ga0307415_1001400503 | 134 |
| 60 | 3300044656 | Ga0466969_0065588 | Ga0466969_0065588_896_1312 | 134 |
| 61 | 3300044683 | Ga0466965_0422674 | Ga0466965_0422674_247_663 | 134 |
| 62 | 3300044684 | Ga0466966_0052755 | Ga0466966_0052755_737_1153 | 134 |
| 63 | 3300044693 | Ga0466961_0091612 | Ga0466961_0091612_254_670 | 134 |
| 64 | 3300044694 | Ga0466963_0015218 | Ga0466963_0015218_1983_2399 | 134 |
| 65 | 3300044719 | Ga0466971_0004306 | Ga0466971_0004306_2253_2669 | 134 |
| 66 | 3300044765 | Ga0466970_0005939 | Ga0466970_0005939_2134_2550 | 134 |
| 67 | 3300044842 | Ga0466957_0036103 | Ga0466957_0036103_223_639 | 134 |
| 68 | 3300045049 | Ga0466959_0035229 | Ga0466959_0035229_253_669 | 134 |
| 69 | 3300045836 | Ga0466958_0258447 | Ga0466958_0258447_66_482 | 134 |
| 70 | 3300050507 | nmdc:mga05p37_1107438_c1 | nmdc:mga05p37_1107438_c1_250_669 | 134 |
| 71 | 3300061719 | Ga0466962_0018606 | Ga0466962_0018606_1567_1983 | 134 |
| 72 | 2162886011 | MRS1b_contig_816425 | MRS1b_0189.00002570 | 135 |
| 73 | 2162886012 | MBSR1b_contig_6582152 | MBSR1b_0030.00007150 | 135 |
| 74 | 3300000531 | CNBas_1009180 | CNBas_10091801 | 135 |
| 75 | 3300001904 | JGI24736J21556_1047311 | JGI24736J21556_10473111 | 135 |
| 76 | 3300001979 | JGI24740J21852_10007956 | JGI24740J21852_100079566 | 135 |
| 77 | 3300001989 | JGI24739J22299_10001510 | JGI24739J22299_100015107 | 135 |
| 78 | 3300001989 | JGI24739J22299_10033107 | JGI24739J22299_100331072 | 135 |
| 79 | 3300001990 | JGI24737J22298_10000293 | JGI24737J22298_1000029317 | 135 |
| 80 | 3300001990 | JGI24737J22298_10001879 | JGI24737J22298_1000187911 | 135 |
| 81 | 3300001990 | JGI24737J22298_10015945 | JGI24737J22298_100159453 | 135 |
| 82 | 3300001990 | JGI24737J22298_10139634 | JGI24737J22298_101396342 | 135 |
| 83 | 3300002067 | JGI24735J21928_10171374 | JGI24735J21928_101713742 | 135 |
| 84 | 3300002075 | JGI24738J21930_10000671 | JGI24738J21930_1000067111 | 135 |
| 85 | 3300003320 | rootH2_10273668 | rootH2_102736682 | 135 |
| 86 | 3300005290 | Ga0065712_10223242 | Ga0065712_102232422 | 135 |
| 87 | 3300005293 | Ga0065715_10130129 | Ga0065715_101301293 | 135 |
| 88 | 3300005293 | Ga0065715_10303161 | Ga0065715_103031612 | 135 |
| 89 | 3300005293 | Ga0065715_10625605 | Ga0065715_106256052 | 135 |
| 90 | 3300005327 | Ga0070658_10092523 | Ga0070658_100925233 | 135 |
| 91 | 3300005327 | Ga0070658_10187097 | Ga0070658_101870973 | 135 |
| 92 | 3300005327 | Ga0070658_10371799 | Ga0070658_103717992 | 135 |
| 93 | 3300005328 | Ga0070676_10001496 | Ga0070676_100014963 | 135 |
| 94 | 3300005328 | Ga0070676_10011918 | Ga0070676_100119184 | 135 |
| 95 | 3300005328 | Ga0070676_10703819 | Ga0070676_107038191 | 135 |
| 96 | 3300005328 | Ga0070676_11484340 | Ga0070676_114843401 | 135 |
| 97 | 3300005331 | Ga0070670_100067267 | Ga0070670_1000672673 | 135 |
| 98 | 3300005331 | Ga0070670_100146444 | Ga0070670_1001464442 | 135 |
| 99 | 3300005331 | Ga0070670_100165214 | Ga0070670_1001652142 | 135 |
| 100 | 3300005331 | Ga0070670_100518913 | Ga0070670_1005189132 | 135 |
| 101 | 3300005331 | Ga0070670_101072826 | Ga0070670_1010728262 | 135 |
| 102 | 3300005333 | Ga0070677_10089575 | Ga0070677_100895752 | 135 |
| 103 | 3300005334 | Ga0068869_100000094 | Ga0068869_10000009432 | 135 |
| 104 | 3300005334 | Ga0068869_100038011 | Ga0068869_1000380112 | 135 |
| 105 | 3300005334 | Ga0068869_100051534 | Ga0068869_1000515344 | 135 |
| 106 | 3300005334 | Ga0068869_100129425 | Ga0068869_1001294251 | 135 |
| 107 | 3300005334 | Ga0068869_100176989 | Ga0068869_1001769893 | 135 |
| 108 | 3300005335 | Ga0070666_10042190 | Ga0070666_100421902 | 135 |
| 109 | 3300005335 | Ga0070666_10118000 | Ga0070666_101180002 | 135 |
| 110 | 3300005335 | Ga0070666_10207699 | Ga0070666_102076992 | 135 |
| 111 | 3300005337 | Ga0070682_100098294 | Ga0070682_1000982943 | 135 |
| 112 | 3300005338 | Ga0068868_100001948 | Ga0068868_10000194816 | 135 |
| 113 | 3300005338 | Ga0068868_100072159 | Ga0068868_1000721593 | 135 |
| 114 | 3300005339 | Ga0070660_100004239 | Ga0070660_1000042399 | 135 |
| 115 | 3300005339 | Ga0070660_100022428 | Ga0070660_1000224283 | 135 |
| 116 | 3300005339 | Ga0070660_100056503 | Ga0070660_1000565031 | 135 |
| 117 | 3300005339 | Ga0070660_100603999 | Ga0070660_1006039992 | 135 |
| 118 | 3300005340 | Ga0070689_100289735 | Ga0070689_1002897352 | 135 |
| 119 | 3300005343 | Ga0070687_100689678 | Ga0070687_1006896782 | 135 |
| 120 | 3300005344 | Ga0070661_100003747 | Ga0070661_1000037475 | 135 |
| 121 | 3300005344 | Ga0070661_100014559 | Ga0070661_1000145593 | 135 |
| 122 | 3300005344 | Ga0070661_100459923 | Ga0070661_1004599232 | 135 |
| 123 | 3300005344 | Ga0070661_101025563 | Ga0070661_1010255632 | 135 |
| 124 | 3300005345 | Ga0070692_10024487 | Ga0070692_100244873 | 135 |
| 125 | 3300005347 | Ga0070668_100000311 | Ga0070668_1000003114 | 135 |
| 126 | 3300005347 | Ga0070668_100014598 | Ga0070668_1000145983 | 135 |
| 127 | 3300005347 | Ga0070668_100056574 | Ga0070668_1000565742 | 135 |
| 128 | 3300005347 | Ga0070668_100228957 | Ga0070668_1002289574 | 135 |
| 129 | 3300005347 | Ga0070668_100468558 | Ga0070668_1004685582 | 135 |
| 130 | 3300005347 | Ga0070668_100659750 | Ga0070668_1006597501 | 135 |
| 131 | 3300005347 | Ga0070668_101321078 | Ga0070668_1013210782 | 135 |
| 132 | 3300005353 | Ga0070669_100000155 | Ga0070669_1000001558 | 135 |
| 133 | 3300005353 | Ga0070669_100069766 | Ga0070669_1000697663 | 135 |
| 134 | 3300005353 | Ga0070669_100214262 | Ga0070669_1002142623 | 135 |
| 135 | 3300005353 | Ga0070669_100626945 | Ga0070669_1006269452 | 135 |
| 136 | 3300005354 | Ga0070675_100031778 | Ga0070675_1000317782 | 135 |
| 137 | 3300005354 | Ga0070675_100091624 | Ga0070675_1000916242 | 135 |
| 138 | 3300005354 | Ga0070675_100343655 | Ga0070675_1003436553 | 135 |
| 139 | 3300005355 | Ga0070671_100149229 | Ga0070671_1001492292 | 135 |
| 140 | 3300005355 | Ga0070671_100250091 | Ga0070671_1002500913 | 135 |
| 141 | 3300005355 | Ga0070671_101088384 | Ga0070671_1010883842 | 135 |
| 142 | 3300005356 | Ga0070674_100049256 | Ga0070674_1000492562 | 135 |
| 143 | 3300005356 | Ga0070674_101309058 | Ga0070674_1013090581 | 135 |
| 144 | 3300005364 | Ga0070673_100019549 | Ga0070673_1000195493 | 135 |
| 145 | 3300005364 | Ga0070673_100075382 | Ga0070673_1000753823 | 135 |
| 146 | 3300005364 | Ga0070673_100097307 | Ga0070673_1000973073 | 135 |
| 147 | 3300005364 | Ga0070673_100420219 | Ga0070673_1004202192 | 135 |
| 148 | 3300005364 | Ga0070673_101163073 | Ga0070673_1011630731 | 135 |
| 149 | 3300005365 | Ga0070688_100174444 | Ga0070688_1001744442 | 135 |
| 150 | 3300005366 | Ga0070659_100000305 | Ga0070659_10000030537 | 135 |
| 151 | 3300005366 | Ga0070659_100021439 | Ga0070659_1000214394 | 135 |
| 152 | 3300005366 | Ga0070659_100022758 | Ga0070659_1000227583 | 135 |
| 153 | 3300005366 | Ga0070659_100220033 | Ga0070659_1002200332 | 135 |
| 154 | 3300005366 | Ga0070659_100533830 | Ga0070659_1005338302 | 135 |
| 155 | 3300005366 | Ga0070659_102034089 | Ga0070659_1020340891 | 135 |
| 156 | 3300005367 | Ga0070667_100022892 | Ga0070667_1000228926 | 135 |
| 157 | 3300005367 | Ga0070667_100029038 | Ga0070667_1000290385 | 135 |
| 158 | 3300005367 | Ga0070667_100030696 | Ga0070667_1000306966 | 135 |
| 159 | 3300005367 | Ga0070667_100043068 | Ga0070667_1000430683 | 135 |
| 160 | 3300005367 | Ga0070667_100070149 | Ga0070667_1000701493 | 135 |
| 161 | 3300005367 | Ga0070667_100382451 | Ga0070667_1003824511 | 135 |
| 162 | 3300005367 | Ga0070667_100694772 | Ga0070667_1006947722 | 135 |
| 163 | 3300005444 | Ga0070694_100205024 | Ga0070694_1002050242 | 135 |
| 164 | 3300005444 | Ga0070694_100371702 | Ga0070694_1003717021 | 135 |
| 165 | 3300005455 | Ga0070663_100007015 | Ga0070663_1000070156 | 135 |
| 166 | 3300005455 | Ga0070663_100023038 | Ga0070663_1000230381 | 135 |
| 167 | 3300005455 | Ga0070663_100067584 | Ga0070663_1000675843 | 135 |
| 168 | 3300005455 | Ga0070663_100068550 | Ga0070663_1000685503 | 135 |
| 169 | 3300005455 | Ga0070663_100189068 | Ga0070663_1001890682 | 135 |
| 170 | 3300005455 | Ga0070663_100262966 | Ga0070663_1002629662 | 135 |
| 171 | 3300005456 | Ga0070678_100072630 | Ga0070678_1000726302 | 135 |
| 172 | 3300005456 | Ga0070678_101409446 | Ga0070678_1014094461 | 135 |
| 173 | 3300005457 | Ga0070662_100006089 | Ga0070662_1000060897 | 135 |
| 174 | 3300005457 | Ga0070662_100017060 | Ga0070662_1000170605 | 135 |
| 175 | 3300005457 | Ga0070662_100020874 | Ga0070662_1000208743 | 135 |
| 176 | 3300005457 | Ga0070662_100219559 | Ga0070662_1002195592 | 135 |
| 177 | 3300005457 | Ga0070662_100282597 | Ga0070662_1002825972 | 135 |
| 178 | 3300005457 | Ga0070662_100478933 | Ga0070662_1004789332 | 135 |
| 179 | 3300005457 | Ga0070662_100657234 | Ga0070662_1006572342 | 135 |
| 180 | 3300005457 | Ga0070662_100736264 | Ga0070662_1007362642 | 135 |
| 181 | 3300005457 | Ga0070662_101174267 | Ga0070662_1011742672 | 135 |
| 182 | 3300005457 | Ga0070662_101769701 | Ga0070662_1017697011 | 135 |
| 183 | 3300005458 | Ga0070681_10044764 | Ga0070681_100447644 | 135 |
| 184 | 3300005459 | Ga0068867_100008791 | Ga0068867_1000087916 | 135 |
| 185 | 3300005459 | Ga0068867_100039753 | Ga0068867_1000397532 | 135 |
| 186 | 3300005459 | Ga0068867_100092554 | Ga0068867_1000925543 | 135 |
| 187 | 3300005459 | Ga0068867_100669214 | Ga0068867_1006692142 | 135 |
| 188 | 3300005466 | Ga0070685_10061622 | Ga0070685_100616222 | 135 |
| 189 | 3300005467 | Ga0070706_100327274 | Ga0070706_1003272742 | 135 |
| 190 | 3300005530 | Ga0070679_100124128 | Ga0070679_1001241282 | 135 |
| 191 | 3300005535 | Ga0070684_100185799 | Ga0070684_1001857993 | 135 |
| 192 | 3300005535 | Ga0070684_100642215 | Ga0070684_1006422151 | 135 |
| 193 | 3300005539 | Ga0068853_100014045 | Ga0068853_1000140458 | 135 |
| 194 | 3300005539 | Ga0068853_100079638 | Ga0068853_1000796383 | 135 |
| 195 | 3300005539 | Ga0068853_100140799 | Ga0068853_1001407993 | 135 |
| 196 | 3300005539 | Ga0068853_100369814 | Ga0068853_1003698142 | 135 |
| 197 | 3300005539 | Ga0068853_100472984 | Ga0068853_1004729842 | 135 |
| 198 | 3300005543 | Ga0070672_100000797 | Ga0070672_10000079721 | 135 |
| 199 | 3300005543 | Ga0070672_100014427 | Ga0070672_1000144275 | 135 |
| 200 | 3300005543 | Ga0070672_100040507 | Ga0070672_1000405073 | 135 |
| 201 | 3300005543 | Ga0070672_100674817 | Ga0070672_1006748172 | 135 |
| 202 | 3300005544 | Ga0070686_100523873 | Ga0070686_1005238732 | 135 |
| 203 | 3300005545 | Ga0070695_100792069 | Ga0070695_1007920691 | 135 |
| 204 | 3300005545 | Ga0070695_100880612 | Ga0070695_1008806122 | 135 |
| 205 | 3300005546 | Ga0070696_100215828 | Ga0070696_1002158282 | 135 |
| 206 | 3300005547 | Ga0070693_100058644 | Ga0070693_1000586442 | 135 |
| 207 | 3300005547 | Ga0070693_100114799 | Ga0070693_1001147992 | 135 |
| 208 | 3300005547 | Ga0070693_100189091 | Ga0070693_1001890912 | 135 |
| 209 | 3300005547 | Ga0070693_100746562 | Ga0070693_1007465621 | 135 |
| 210 | 3300005548 | Ga0070665_100000995 | Ga0070665_1000009959 | 135 |
| 211 | 3300005548 | Ga0070665_100018705 | Ga0070665_10001870510 | 135 |
| 212 | 3300005548 | Ga0070665_100093331 | Ga0070665_1000933314 | 135 |
| 213 | 3300005548 | Ga0070665_100147062 | Ga0070665_1001470623 | 135 |
| 214 | 3300005548 | Ga0070665_100266582 | Ga0070665_1002665822 | 135 |
| 215 | 3300005548 | Ga0070665_100434400 | Ga0070665_1004344002 | 135 |
| 216 | 3300005548 | Ga0070665_100508781 | Ga0070665_1005087812 | 135 |
| 217 | 3300005563 | Ga0068855_100006968 | Ga0068855_1000069684 | 135 |
| 218 | 3300005563 | Ga0068855_100029523 | Ga0068855_1000295236 | 135 |
| 219 | 3300005563 | Ga0068855_100917273 | Ga0068855_1009172732 | 135 |
| 220 | 3300005563 | Ga0068855_101023067 | Ga0068855_1010230672 | 135 |
| 221 | 3300005564 | Ga0070664_100014224 | Ga0070664_1000142242 | 135 |
| 222 | 3300005564 | Ga0070664_100015483 | Ga0070664_1000154836 | 135 |
| 223 | 3300005564 | Ga0070664_100017113 | Ga0070664_1000171136 | 135 |
| 224 | 3300005564 | Ga0070664_100037089 | Ga0070664_1000370893 | 135 |
| 225 | 3300005577 | Ga0068857_100007925 | Ga0068857_10000792513 | 135 |
| 226 | 3300005577 | Ga0068857_100011070 | Ga0068857_1000110704 | 135 |
| 227 | 3300005577 | Ga0068857_100013097 | Ga0068857_10001309711 | 135 |
| 228 | 3300005577 | Ga0068857_100073362 | Ga0068857_1000733623 | 135 |
| 229 | 3300005577 | Ga0068857_100687339 | Ga0068857_1006873392 | 135 |
| 230 | 3300005578 | Ga0068854_100021442 | Ga0068854_1000214423 | 135 |
| 231 | 3300005578 | Ga0068854_100024641 | Ga0068854_1000246414 | 135 |
| 232 | 3300005578 | Ga0068854_100031846 | Ga0068854_1000318464 | 135 |
| 233 | 3300005578 | Ga0068854_100098367 | Ga0068854_1000983672 | 135 |
| 234 | 3300005578 | Ga0068854_100139016 | Ga0068854_1001390163 | 135 |
| 235 | 3300005578 | Ga0068854_100333935 | Ga0068854_1003339353 | 135 |
| 236 | 3300005578 | Ga0068854_100562479 | Ga0068854_1005624792 | 135 |
| 237 | 3300005578 | Ga0068854_101611710 | Ga0068854_1016117102 | 135 |
| 238 | 3300005614 | Ga0068856_101592948 | Ga0068856_1015929481 | 135 |
| 239 | 3300005616 | Ga0068852_100021745 | Ga0068852_1000217454 | 135 |
| 240 | 3300005616 | Ga0068852_100056352 | Ga0068852_1000563524 | 135 |
| 241 | 3300005616 | Ga0068852_100061331 | Ga0068852_1000613312 | 135 |
| 242 | 3300005616 | Ga0068852_100086277 | Ga0068852_1000862772 | 135 |
| 243 | 3300005616 | Ga0068852_100170088 | Ga0068852_1001700882 | 135 |
| 244 | 3300005616 | Ga0068852_100369894 | Ga0068852_1003698942 | 135 |
| 245 | 3300005616 | Ga0068852_100432382 | Ga0068852_1004323822 | 135 |
| 246 | 3300005617 | Ga0068859_100013299 | Ga0068859_1000132993 | 135 |
| 247 | 3300005617 | Ga0068859_100032867 | Ga0068859_1000328675 | 135 |
| 248 | 3300005617 | Ga0068859_100105910 | Ga0068859_1001059103 | 135 |
| 249 | 3300005617 | Ga0068859_100379146 | Ga0068859_1003791463 | 135 |
| 250 | 3300005617 | Ga0068859_100913047 | Ga0068859_1009130472 | 135 |
| 251 | 3300005618 | Ga0068864_100000328 | Ga0068864_10000032847 | 135 |
| 252 | 3300005618 | Ga0068864_100020388 | Ga0068864_1000203885 | 135 |
| 253 | 3300005618 | Ga0068864_101910336 | Ga0068864_1019103362 | 135 |
| 254 | 3300005718 | Ga0068866_10036527 | Ga0068866_100365273 | 135 |
| 255 | 3300005718 | Ga0068866_10251874 | Ga0068866_102518743 | 135 |
| 256 | 3300005719 | Ga0068861_100022847 | Ga0068861_1000228476 | 135 |
| 257 | 3300005834 | Ga0068851_10001318 | Ga0068851_1000131814 | 135 |
| 258 | 3300005834 | Ga0068851_10010278 | Ga0068851_100102783 | 135 |
| 259 | 3300005834 | Ga0068851_10022059 | Ga0068851_100220593 | 135 |
| 260 | 3300005840 | Ga0068870_10882229 | Ga0068870_108822292 | 135 |
| 261 | 3300005840 | Ga0068870_10937890 | Ga0068870_109378902 | 135 |
| 262 | 3300005841 | Ga0068863_100000634 | Ga0068863_1000006344 | 135 |
| 263 | 3300005841 | Ga0068863_100172606 | Ga0068863_1001726063 | 135 |
| 264 | 3300005841 | Ga0068863_100488539 | Ga0068863_1004885392 | 135 |
| 265 | 3300005842 | Ga0068858_100004807 | Ga0068858_10000480716 | 135 |
| 266 | 3300005842 | Ga0068858_100009244 | Ga0068858_1000092447 | 135 |
| 267 | 3300005842 | Ga0068858_100014386 | Ga0068858_1000143863 | 135 |
| 268 | 3300005843 | Ga0068860_100006212 | Ga0068860_1000062122 | 135 |
| 269 | 3300005843 | Ga0068860_100009697 | Ga0068860_1000096976 | 135 |
| 270 | 3300005843 | Ga0068860_100021934 | Ga0068860_1000219344 | 135 |
| 271 | 3300005843 | Ga0068860_100072263 | Ga0068860_1000722633 | 135 |
| 272 | 3300005843 | Ga0068860_100089367 | Ga0068860_1000893675 | 135 |
| 273 | 3300005843 | Ga0068860_100258611 | Ga0068860_1002586113 | 135 |
| 274 | 3300005843 | Ga0068860_100607621 | Ga0068860_1006076211 | 135 |
| 275 | 3300005843 | Ga0068860_100734478 | Ga0068860_1007344782 | 135 |
| 276 | 3300005844 | Ga0068862_100005881 | Ga0068862_1000058812 | 135 |
| 277 | 3300005844 | Ga0068862_100007340 | Ga0068862_1000073404 | 135 |
| 278 | 3300005844 | Ga0068862_100035359 | Ga0068862_1000353597 | 135 |
| 279 | 3300005844 | Ga0068862_100097434 | Ga0068862_1000974343 | 135 |
| 280 | 3300005844 | Ga0068862_100166394 | Ga0068862_1001663943 | 135 |
| 281 | 3300005844 | Ga0068862_100510985 | Ga0068862_1005109852 | 135 |
| 282 | 3300005844 | Ga0068862_100572507 | Ga0068862_1005725072 | 135 |
| 283 | 3300005844 | Ga0068862_100850991 | Ga0068862_1008509912 | 135 |
| 284 | 3300006051 | Ga0075364_10425388 | Ga0075364_104253882 | 135 |
| 285 | 3300006177 | Ga0075362_10047063 | Ga0075362_100470632 | 135 |
| 286 | 3300006195 | Ga0075366_10326305 | Ga0075366_103263052 | 135 |
| 287 | 3300006358 | Ga0068871_100022855 | Ga0068871_1000228554 | 135 |
| 288 | 3300006358 | Ga0068871_100039675 | Ga0068871_1000396754 | 135 |
| 289 | 3300006871 | Ga0075434_100101616 | Ga0075434_1001016162 | 135 |
| 290 | 3300006881 | Ga0068865_100012978 | Ga0068865_1000129784 | 135 |
| 291 | 3300006881 | Ga0068865_100122966 | Ga0068865_1001229662 | 135 |
| 292 | 3300006931 | Ga0097620_100013298 | Ga0097620_1000132983 | 135 |
| 293 | 3300006931 | Ga0097620_100032867 | Ga0097620_1000328674 | 135 |
| 294 | 3300006931 | Ga0097620_100105916 | Ga0097620_1001059163 | 135 |
| 295 | 3300006931 | Ga0097620_100379165 | Ga0097620_1003791653 | 135 |
| 296 | 3300006931 | Ga0097620_100913064 | Ga0097620_1009130642 | 135 |
| 297 | 3300007076 | Ga0075435_100131542 | Ga0075435_1001315423 | 135 |
| 298 | 3300009093 | Ga0105240_10086764 | Ga0105240_100867643 | 135 |
| 299 | 3300009093 | Ga0105240_10109890 | Ga0105240_101098904 | 135 |
| 300 | 3300009098 | Ga0105245_10000352 | Ga0105245_100003526 | 135 |
| 301 | 3300009098 | Ga0105245_10118397 | Ga0105245_101183973 | 135 |
| 302 | 3300009147 | Ga0114129_10892755 | Ga0114129_108927552 | 135 |
| 303 | 3300009148 | Ga0105243_10027980 | Ga0105243_100279803 | 135 |
| 304 | 3300009148 | Ga0105243_10499645 | Ga0105243_104996454 | 135 |
| 305 | 3300009174 | Ga0105241_10041940 | Ga0105241_100419403 | 135 |
| 306 | 3300009174 | Ga0105241_10262565 | Ga0105241_102625653 | 135 |
| 307 | 3300009174 | Ga0105241_12022105 | Ga0105241_120221052 | 135 |
| 308 | 3300009177 | Ga0105248_10020591 | Ga0105248_100205916 | 135 |
| 309 | 3300009177 | Ga0105248_10113019 | Ga0105248_101130193 | 135 |
| 310 | 3300009177 | Ga0105248_10158843 | Ga0105248_101588433 | 135 |
| 311 | 3300009177 | Ga0105248_10234891 | Ga0105248_102348912 | 135 |
| 312 | 3300009551 | Ga0105238_10526818 | Ga0105238_105268182 | 135 |
| 313 | 3300009551 | Ga0105238_10771481 | Ga0105238_107714812 | 135 |
| 314 | 3300009553 | Ga0105249_10008677 | Ga0105249_100086777 | 135 |
| 315 | 3300009553 | Ga0105249_10160529 | Ga0105249_101605293 | 135 |
| 316 | 3300009553 | Ga0105249_10161072 | Ga0105249_101610723 | 135 |
| 317 | 3300009553 | Ga0105249_11176046 | Ga0105249_111760462 | 135 |
| 318 | 3300009553 | Ga0105249_11538183 | Ga0105249_115381832 | 135 |
| 319 | 3300009553 | Ga0105249_12018237 | Ga0105249_120182372 | 135 |
| 320 | 3300009553 | Ga0105249_13180518 | Ga0105249_131805181 | 135 |
| 321 | 3300010375 | Ga0105239_10040842 | Ga0105239_100408422 | 135 |
| 322 | 3300010375 | Ga0105239_10063252 | Ga0105239_100632523 | 135 |
| 323 | 3300010375 | Ga0105239_12319576 | Ga0105239_123195762 | 135 |
| 324 | 3300011119 | Ga0105246_10664287 | Ga0105246_106642872 | 135 |
| 325 | 3300011119 | Ga0105246_11154647 | Ga0105246_111546472 | 135 |
| 326 | 3300012510 | Ga0157316_1017401 | Ga0157316_10174012 | 135 |
| 327 | 3300013100 | Ga0157373_10007015 | Ga0157373_100070154 | 135 |
| 328 | 3300013100 | Ga0157373_10029098 | Ga0157373_100290985 | 135 |
| 329 | 3300013100 | Ga0157373_10148086 | Ga0157373_101480862 | 135 |
| 330 | 3300013100 | Ga0157373_10335593 | Ga0157373_103355931 | 135 |
| 331 | 3300013100 | Ga0157373_11015385 | Ga0157373_110153852 | 135 |
| 332 | 3300013102 | Ga0157371_10001647 | Ga0157371_1000164725 | 135 |
| 333 | 3300013102 | Ga0157371_10457035 | Ga0157371_104570352 | 135 |
| 334 | 3300013102 | Ga0157371_10519396 | Ga0157371_105193962 | 135 |
| 335 | 3300013102 | Ga0157371_10979654 | Ga0157371_109796542 | 135 |
| 336 | 3300013104 | Ga0157370_10177811 | Ga0157370_101778113 | 135 |
| 337 | 3300013105 | Ga0157369_10391297 | Ga0157369_103912972 | 135 |
| 338 | 3300013105 | Ga0157369_11684232 | Ga0157369_116842322 | 135 |
| 339 | 3300013296 | Ga0157374_10452386 | Ga0157374_104523862 | 135 |
| 340 | 3300013297 | Ga0157378_10001977 | Ga0157378_1000197718 | 135 |
| 341 | 3300013297 | Ga0157378_10295979 | Ga0157378_102959792 | 135 |
| 342 | 3300013306 | Ga0163162_10013433 | Ga0163162_100134336 | 135 |
| 343 | 3300013306 | Ga0163162_10046045 | Ga0163162_100460455 | 135 |
| 344 | 3300013306 | Ga0163162_10264258 | Ga0163162_102642582 | 135 |
| 345 | 3300013306 | Ga0163162_10651938 | Ga0163162_106519382 | 135 |
| 346 | 3300013306 | Ga0163162_10960173 | Ga0163162_109601732 | 135 |
| 347 | 3300013307 | Ga0157372_10070897 | Ga0157372_100708974 | 135 |
| 348 | 3300013307 | Ga0157372_10152605 | Ga0157372_101526053 | 135 |
| 349 | 3300013307 | Ga0157372_10265239 | Ga0157372_102652392 | 135 |
| 350 | 3300013308 | Ga0157375_10006981 | Ga0157375_1000698111 | 135 |
| 351 | 3300013308 | Ga0157375_10075228 | Ga0157375_100752282 | 135 |
| 352 | 3300013308 | Ga0157375_10098321 | Ga0157375_100983213 | 135 |
| 353 | 3300013308 | Ga0157375_10232043 | Ga0157375_102320431 | 135 |
| 354 | 3300014325 | Ga0163163_10500046 | Ga0163163_105000462 | 135 |
| 355 | 3300014497 | Ga0182008_10118950 | Ga0182008_101189502 | 135 |
| 356 | 3300014745 | Ga0157377_10053958 | Ga0157377_100539582 | 135 |
| 357 | 3300014968 | Ga0157379_10034679 | Ga0157379_100346796 | 135 |
| 358 | 3300017792 | Ga0163161_10720808 | Ga0163161_107208082 | 135 |
| 359 | 3300025315 | Ga0207697_10000751 | Ga0207697_100007514 | 135 |
| 360 | 3300025321 | Ga0207656_10003025 | Ga0207656_100030253 | 135 |
| 361 | 3300025321 | Ga0207656_10007718 | Ga0207656_100077183 | 135 |
| 362 | 3300025321 | Ga0207656_10030371 | Ga0207656_100303713 | 135 |
| 363 | 3300025321 | Ga0207656_10380321 | Ga0207656_103803212 | 135 |
| 364 | 3300025893 | Ga0207682_10098147 | Ga0207682_100981472 | 135 |
| 365 | 3300025901 | Ga0207688_10003129 | Ga0207688_100031299 | 135 |
| 366 | 3300025901 | Ga0207688_10011823 | Ga0207688_100118233 | 135 |
| 367 | 3300025901 | Ga0207688_10236290 | Ga0207688_102362902 | 135 |
| 368 | 3300025903 | Ga0207680_10087320 | Ga0207680_100873202 | 135 |
| 369 | 3300025903 | Ga0207680_10089025 | Ga0207680_100890251 | 135 |
| 370 | 3300025904 | Ga0207647_10000439 | Ga0207647_1000043929 | 135 |
| 371 | 3300025904 | Ga0207647_10000446 | Ga0207647_1000044630 | 135 |
| 372 | 3300025904 | Ga0207647_10246991 | Ga0207647_102469912 | 135 |
| 373 | 3300025907 | Ga0207645_10002747 | Ga0207645_1000274717 | 135 |
| 374 | 3300025907 | Ga0207645_10019033 | Ga0207645_100190334 | 135 |
| 375 | 3300025907 | Ga0207645_10321727 | Ga0207645_103217272 | 135 |
| 376 | 3300025908 | Ga0207643_10017186 | Ga0207643_100171866 | 135 |
| 377 | 3300025909 | Ga0207705_10004596 | Ga0207705_1000459612 | 135 |
| 378 | 3300025909 | Ga0207705_10038318 | Ga0207705_100383181 | 135 |
| 379 | 3300025909 | Ga0207705_10071092 | Ga0207705_100710925 | 135 |
| 380 | 3300025909 | Ga0207705_10111594 | Ga0207705_101115943 | 135 |
| 381 | 3300025910 | Ga0207684_10264557 | Ga0207684_102645572 | 135 |
| 382 | 3300025911 | Ga0207654_10219261 | Ga0207654_102192612 | 135 |
| 383 | 3300025912 | Ga0207707_10141594 | Ga0207707_101415943 | 135 |
| 384 | 3300025913 | Ga0207695_10221443 | Ga0207695_102214432 | 135 |
| 385 | 3300025913 | Ga0207695_10286907 | Ga0207695_102869073 | 135 |
| 386 | 3300025918 | Ga0207662_10167404 | Ga0207662_101674042 | 135 |
| 387 | 3300025919 | Ga0207657_10002328 | Ga0207657_1000232817 | 135 |
| 388 | 3300025919 | Ga0207657_10007110 | Ga0207657_100071102 | 135 |
| 389 | 3300025919 | Ga0207657_10037709 | Ga0207657_100377093 | 135 |
| 390 | 3300025919 | Ga0207657_10047906 | Ga0207657_100479063 | 135 |
| 391 | 3300025919 | Ga0207657_10050141 | Ga0207657_100501412 | 135 |
| 392 | 3300025919 | Ga0207657_10218292 | Ga0207657_102182923 | 135 |
| 393 | 3300025919 | Ga0207657_10238570 | Ga0207657_102385702 | 135 |
| 394 | 3300025919 | Ga0207657_10477087 | Ga0207657_104770872 | 135 |
| 395 | 3300025920 | Ga0207649_10004861 | Ga0207649_1000486110 | 135 |
| 396 | 3300025920 | Ga0207649_11369456 | Ga0207649_113694561 | 135 |
| 397 | 3300025921 | Ga0207652_10076724 | Ga0207652_100767243 | 135 |
| 398 | 3300025921 | Ga0207652_10196500 | Ga0207652_101965003 | 135 |
| 399 | 3300025921 | Ga0207652_10488507 | Ga0207652_104885072 | 135 |
| 400 | 3300025923 | Ga0207681_10001284 | Ga0207681_100012848 | 135 |
| 401 | 3300025923 | Ga0207681_10007770 | Ga0207681_100077704 | 135 |
| 402 | 3300025923 | Ga0207681_10039200 | Ga0207681_100392004 | 135 |
| 403 | 3300025923 | Ga0207681_10439902 | Ga0207681_104399022 | 135 |
| 404 | 3300025925 | Ga0207650_10018723 | Ga0207650_100187233 | 135 |
| 405 | 3300025925 | Ga0207650_10204572 | Ga0207650_102045723 | 135 |
| 406 | 3300025926 | Ga0207659_10028832 | Ga0207659_100288324 | 135 |
| 407 | 3300025927 | Ga0207687_10025332 | Ga0207687_100253323 | 135 |
| 408 | 3300025927 | Ga0207687_10106282 | Ga0207687_101062822 | 135 |
| 409 | 3300025931 | Ga0207644_10326450 | Ga0207644_103264502 | 135 |
| 410 | 3300025932 | Ga0207690_10012741 | Ga0207690_100127416 | 135 |
| 411 | 3300025932 | Ga0207690_10014735 | Ga0207690_100147353 | 135 |
| 412 | 3300025932 | Ga0207690_10027796 | Ga0207690_100277962 | 135 |
| 413 | 3300025932 | Ga0207690_10032900 | Ga0207690_100329002 | 135 |
| 414 | 3300025932 | Ga0207690_10205050 | Ga0207690_102050503 | 135 |
| 415 | 3300025932 | Ga0207690_10317065 | Ga0207690_103170652 | 135 |
| 416 | 3300025932 | Ga0207690_10407053 | Ga0207690_104070532 | 135 |
| 417 | 3300025933 | Ga0207706_10000446 | Ga0207706_1000044648 | 135 |
| 418 | 3300025933 | Ga0207706_10009416 | Ga0207706_100094162 | 135 |
| 419 | 3300025933 | Ga0207706_10013576 | Ga0207706_100135767 | 135 |
| 420 | 3300025933 | Ga0207706_10055491 | Ga0207706_100554912 | 135 |
| 421 | 3300025933 | Ga0207706_10079578 | Ga0207706_100795783 | 135 |
| 422 | 3300025933 | Ga0207706_10185844 | Ga0207706_101858443 | 135 |
| 423 | 3300025933 | Ga0207706_10737392 | Ga0207706_107373922 | 135 |
| 424 | 3300025935 | Ga0207709_10214557 | Ga0207709_102145573 | 135 |
| 425 | 3300025935 | Ga0207709_10348109 | Ga0207709_103481093 | 135 |
| 426 | 3300025937 | Ga0207669_10022197 | Ga0207669_100221974 | 135 |
| 427 | 3300025937 | Ga0207669_10249551 | Ga0207669_102495512 | 135 |
| 428 | 3300025938 | Ga0207704_10016682 | Ga0207704_100166823 | 135 |
| 429 | 3300025938 | Ga0207704_10133568 | Ga0207704_101335683 | 135 |
| 430 | 3300025938 | Ga0207704_10821357 | Ga0207704_108213572 | 135 |
| 431 | 3300025940 | Ga0207691_10008977 | Ga0207691_100089773 | 135 |
| 432 | 3300025940 | Ga0207691_10021285 | Ga0207691_100212856 | 135 |
| 433 | 3300025940 | Ga0207691_10117178 | Ga0207691_101171783 | 135 |
| 434 | 3300025940 | Ga0207691_10183214 | Ga0207691_101832143 | 135 |
| 435 | 3300025941 | Ga0207711_10035386 | Ga0207711_100353865 | 135 |
| 436 | 3300025941 | Ga0207711_10081823 | Ga0207711_100818233 | 135 |
| 437 | 3300025941 | Ga0207711_10178764 | Ga0207711_101787642 | 135 |
| 438 | 3300025942 | Ga0207689_10000064 | Ga0207689_1000006432 | 135 |
| 439 | 3300025942 | Ga0207689_10008314 | Ga0207689_100083144 | 135 |
| 440 | 3300025942 | Ga0207689_10142528 | Ga0207689_101425283 | 135 |
| 441 | 3300025942 | Ga0207689_10752775 | Ga0207689_107527752 | 135 |
| 442 | 3300025944 | Ga0207661_10145090 | Ga0207661_101450903 | 135 |
| 443 | 3300025945 | Ga0207679_10007564 | Ga0207679_1000756410 | 135 |
| 444 | 3300025945 | Ga0207679_10012810 | Ga0207679_100128106 | 135 |
| 445 | 3300025945 | Ga0207679_10033120 | Ga0207679_100331206 | 135 |
| 446 | 3300025945 | Ga0207679_11507049 | Ga0207679_115070491 | 135 |
| 447 | 3300025949 | Ga0207667_10027440 | Ga0207667_100274405 | 135 |
| 448 | 3300025949 | Ga0207667_10082526 | Ga0207667_100825265 | 135 |
| 449 | 3300025949 | Ga0207667_10871696 | Ga0207667_108716962 | 135 |
| 450 | 3300025949 | Ga0207667_10906072 | Ga0207667_109060722 | 135 |
| 451 | 3300025960 | Ga0207651_10004881 | Ga0207651_100048817 | 135 |
| 452 | 3300025960 | Ga0207651_10190948 | Ga0207651_101909483 | 135 |
| 453 | 3300025960 | Ga0207651_10478877 | Ga0207651_104788773 | 135 |
| 454 | 3300025960 | Ga0207651_10494275 | Ga0207651_104942752 | 135 |
| 455 | 3300025960 | Ga0207651_10717469 | Ga0207651_107174692 | 135 |
| 456 | 3300025960 | Ga0207651_10806962 | Ga0207651_108069622 | 135 |
| 457 | 3300025961 | Ga0207712_10000474 | Ga0207712_1000047432 | 135 |
| 458 | 3300025961 | Ga0207712_10116724 | Ga0207712_101167242 | 135 |
| 459 | 3300025961 | Ga0207712_10828596 | Ga0207712_108285962 | 135 |
| 460 | 3300025961 | Ga0207712_11537416 | Ga0207712_115374162 | 135 |
| 461 | 3300025972 | Ga0207668_10000021 | Ga0207668_1000002155 | 135 |
| 462 | 3300025972 | Ga0207668_10022745 | Ga0207668_100227456 | 135 |
| 463 | 3300025972 | Ga0207668_10112668 | Ga0207668_101126681 | 135 |
| 464 | 3300025972 | Ga0207668_10862919 | Ga0207668_108629192 | 135 |
| 465 | 3300025972 | Ga0207668_10991685 | Ga0207668_109916852 | 135 |
| 466 | 3300025972 | Ga0207668_11204573 | Ga0207668_112045731 | 135 |
| 467 | 3300025981 | Ga0207640_10038139 | Ga0207640_100381392 | 135 |
| 468 | 3300025981 | Ga0207640_10098051 | Ga0207640_100980513 | 135 |
| 469 | 3300025981 | Ga0207640_11266644 | Ga0207640_112666442 | 135 |
| 470 | 3300025981 | Ga0207640_11367073 | Ga0207640_113670732 | 135 |
| 471 | 3300025986 | Ga0207658_10004594 | Ga0207658_100045946 | 135 |
| 472 | 3300025986 | Ga0207658_10024798 | Ga0207658_100247984 | 135 |
| 473 | 3300025986 | Ga0207658_10043342 | Ga0207658_100433423 | 135 |
| 474 | 3300025986 | Ga0207658_10087800 | Ga0207658_100878003 | 135 |
| 475 | 3300025986 | Ga0207658_10182969 | Ga0207658_101829692 | 135 |
| 476 | 3300025986 | Ga0207658_10917976 | Ga0207658_109179762 | 135 |
| 477 | 3300026023 | Ga0207677_10084470 | Ga0207677_100844702 | 135 |
| 478 | 3300026023 | Ga0207677_10238822 | Ga0207677_102388223 | 135 |
| 479 | 3300026035 | Ga0207703_10002562 | Ga0207703_100025627 | 135 |
| 480 | 3300026035 | Ga0207703_10029829 | Ga0207703_100298297 | 135 |
| 481 | 3300026035 | Ga0207703_10063198 | Ga0207703_100631983 | 135 |
| 482 | 3300026041 | Ga0207639_10031388 | Ga0207639_100313884 | 135 |
| 483 | 3300026041 | Ga0207639_10039603 | Ga0207639_100396034 | 135 |
| 484 | 3300026041 | Ga0207639_10057262 | Ga0207639_100572624 | 135 |
| 485 | 3300026041 | Ga0207639_10090089 | Ga0207639_100900892 | 135 |
| 486 | 3300026041 | Ga0207639_10378026 | Ga0207639_103780262 | 135 |
| 487 | 3300026041 | Ga0207639_11312508 | Ga0207639_113125082 | 135 |
| 488 | 3300026067 | Ga0207678_10001094 | Ga0207678_1000109425 | 135 |
| 489 | 3300026067 | Ga0207678_10004153 | Ga0207678_100041533 | 135 |
| 490 | 3300026067 | Ga0207678_10089099 | Ga0207678_100890993 | 135 |
| 491 | 3300026067 | Ga0207678_10178969 | Ga0207678_101789692 | 135 |
| 492 | 3300026067 | Ga0207678_10188887 | Ga0207678_101888872 | 135 |
| 493 | 3300026067 | Ga0207678_10443063 | Ga0207678_104430632 | 135 |
| 494 | 3300026078 | Ga0207702_10356188 | Ga0207702_103561882 | 135 |
| 495 | 3300026078 | Ga0207702_11413116 | Ga0207702_114131161 | 135 |
| 496 | 3300026088 | Ga0207641_10023188 | Ga0207641_100231883 | 135 |
| 497 | 3300026088 | Ga0207641_10040068 | Ga0207641_100400683 | 135 |
| 498 | 3300026088 | Ga0207641_10088129 | Ga0207641_100881295 | 135 |
| 499 | 3300026088 | Ga0207641_10334108 | Ga0207641_103341082 | 135 |
| 500 | 3300026088 | Ga0207641_10514755 | Ga0207641_105147552 | 135 |
| 501 | 3300026089 | Ga0207648_10001456 | Ga0207648_100014562 | 135 |
| 502 | 3300026089 | Ga0207648_10035979 | Ga0207648_100359794 | 135 |
| 503 | 3300026089 | Ga0207648_10036060 | Ga0207648_100360604 | 135 |
| 504 | 3300026095 | Ga0207676_10000761 | Ga0207676_100007614 | 135 |
| 505 | 3300026095 | Ga0207676_10001326 | Ga0207676_1000132611 | 135 |
| 506 | 3300026095 | Ga0207676_11186640 | Ga0207676_111866402 | 135 |
| 507 | 3300026116 | Ga0207674_10000362 | Ga0207674_1000036267 | 135 |
| 508 | 3300026116 | Ga0207674_10000814 | Ga0207674_1000081426 | 135 |
| 509 | 3300026116 | Ga0207674_10012143 | Ga0207674_1001214312 | 135 |
| 510 | 3300026116 | Ga0207674_10051113 | Ga0207674_100511134 | 135 |
| 511 | 3300026116 | Ga0207674_10163757 | Ga0207674_101637572 | 135 |
| 512 | 3300026116 | Ga0207674_10995421 | Ga0207674_109954212 | 135 |
| 513 | 3300026118 | Ga0207675_100036116 | Ga0207675_1000361166 | 135 |
| 514 | 3300026118 | Ga0207675_100289169 | Ga0207675_1002891692 | 135 |
| 515 | 3300026118 | Ga0207675_100592572 | Ga0207675_1005925722 | 135 |
| 516 | 3300026118 | Ga0207675_101941388 | Ga0207675_1019413882 | 135 |
| 517 | 3300026121 | Ga0207683_10509393 | Ga0207683_105093931 | 135 |
| 518 | 3300026142 | Ga0207698_10013270 | Ga0207698_100132708 | 135 |
| 519 | 3300026142 | Ga0207698_10217026 | Ga0207698_102170262 | 135 |
| 520 | 3300026142 | Ga0207698_10301129 | Ga0207698_103011292 | 135 |
| 521 | 3300026142 | Ga0207698_10468207 | Ga0207698_104682072 | 135 |
| 522 | 3300026142 | Ga0207698_11049354 | Ga0207698_110493541 | 135 |
| 523 | 3300028379 | Ga0268266_10000318 | Ga0268266_1000031833 | 135 |
| 524 | 3300028379 | Ga0268266_10005319 | Ga0268266_1000531913 | 135 |
| 525 | 3300028379 | Ga0268266_10074969 | Ga0268266_100749693 | 135 |
| 526 | 3300028379 | Ga0268266_10575129 | Ga0268266_105751292 | 135 |
| 527 | 3300028379 | Ga0268266_10576564 | Ga0268266_105765642 | 135 |
| 528 | 3300028379 | Ga0268266_11073145 | Ga0268266_110731452 | 135 |
| 529 | 3300028380 | Ga0268265_10000789 | Ga0268265_100007897 | 135 |
| 530 | 3300028380 | Ga0268265_10012555 | Ga0268265_100125556 | 135 |
| 531 | 3300028380 | Ga0268265_10029552 | Ga0268265_100295524 | 135 |
| 532 | 3300028380 | Ga0268265_10075356 | Ga0268265_100753562 | 135 |
| 533 | 3300028380 | Ga0268265_10108182 | Ga0268265_101081824 | 135 |
| 534 | 3300028380 | Ga0268265_10633172 | Ga0268265_106331722 | 135 |
| 535 | 3300028381 | Ga0268264_10006173 | Ga0268264_100061734 | 135 |
| 536 | 3300028381 | Ga0268264_10009557 | Ga0268264_100095578 | 135 |
| 537 | 3300028381 | Ga0268264_10056108 | Ga0268264_100561085 | 135 |
| 538 | 3300028381 | Ga0268264_10119281 | Ga0268264_101192812 | 135 |
| 539 | 3300028381 | Ga0268264_10148268 | Ga0268264_101482682 | 135 |
| 540 | 3300028381 | Ga0268264_10235741 | Ga0268264_102357412 | 135 |
| 541 | 3300028381 | Ga0268264_10413512 | Ga0268264_104135123 | 135 |
| 542 | 3300031548 | Ga0307408_100362057 | Ga0307408_1003620572 | 135 |
| 543 | 3300031824 | Ga0307413_10459055 | Ga0307413_104590552 | 135 |
| 544 | 3300031824 | Ga0307413_11504801 | Ga0307413_115048012 | 135 |
| 545 | 3300031852 | Ga0307410_10069338 | Ga0307410_100693383 | 135 |
| 546 | 3300031852 | Ga0307410_10091089 | Ga0307410_100910893 | 135 |
| 547 | 3300031901 | Ga0307406_10194396 | Ga0307406_101943963 | 135 |
| 548 | 3300031903 | Ga0307407_10394157 | Ga0307407_103941572 | 135 |
| 549 | 3300031995 | Ga0307409_100026423 | Ga0307409_1000264234 | 135 |
| 550 | 3300032002 | Ga0307416_100554195 | Ga0307416_1005541951 | 135 |
| 551 | 3300032002 | Ga0307416_102519721 | Ga0307416_1025197212 | 135 |
| 552 | 3300032004 | Ga0307414_10079778 | Ga0307414_100797782 | 135 |
| 553 | 3300032004 | Ga0307414_10085292 | Ga0307414_100852922 | 135 |
| 554 | 3300032004 | Ga0307414_10435337 | Ga0307414_104353372 | 135 |
| 555 | 3300032005 | Ga0307411_10966778 | Ga0307411_109667782 | 135 |
| 556 | 3300035085 | Ga0373929_0161293 | Ga0373929_0161293_12_434 | 135 |
| 557 | 3300037312 | Ga0395899_0171598 | Ga0395899_0171598_1077_1499 | 135 |
| 558 | 3300037418 | Ga0395900_0177611 | Ga0395900_0177611_421_843 | 135 |
| 559 | 3300037418 | Ga0395900_0178988 | Ga0395900_0178988_90_512 | 135 |
| 560 | 3300037418 | Ga0395900_0351870 | Ga0395900_0351870_285_707 | 135 |
| 561 | 3300037418 | Ga0395900_0506972 | Ga0395900_0506972_667_1089 | 135 |
| 562 | 3300037418 | Ga0395900_0652541 | Ga0395900_0652541_28_450 | 135 |
| 563 | 3300037466 | Ga0395898_0099990 | Ga0395898_0099990_2246_2668 | 135 |
| 564 | 3300037471 | Ga0395905_0004032 | Ga0395905_0004032_13187_13609 | 135 |
| 565 | 3300037471 | Ga0395905_0054313 | Ga0395905_0054313_1449_1871 | 135 |
| 566 | 3300037471 | Ga0395905_0118792 | Ga0395905_0118792_1650_2072 | 135 |
| 567 | 3300037471 | Ga0395905_0172929 | Ga0395905_0172929_247_669 | 135 |
| 568 | 3300037471 | Ga0395905_0403154 | Ga0395905_0403154_593_1000 | 135 |
| 569 | 3300037471 | Ga0395905_0922445 | Ga0395905_0922445_224_637 | 135 |
| 570 | 3300038443 | Ga0395901_0083176 | Ga0395901_0083176_2331_2753 | 135 |
| 571 | 3300038443 | Ga0395901_0209922 | Ga0395901_0209922_1039_1461 | 135 |
| 572 | 3300042120 | Ga0450917_001012 | Ga0450917_001012_283_705 | 135 |
| 573 | 3300044901 | Ga0466960_0621058 | Ga0466960_0621058_217_630 | 135 |
| 574 | 3300046522 | Ga0495643_0204862 | Ga0495643_0204862_465_887 | 135 |
| 575 | 3300046525 | Ga0495663_0123981 | Ga0495663_0123981_100_513 | 135 |
| 576 | 3300046616 | Ga0495668_0869974 | Ga0495668_0869974_17_430 | 135 |
| 577 | 3300046684 | Ga0495669_0349263 | Ga0495669_0349263_116_538 | 135 |
| 578 | 3300047320 | Ga0495672_0090704 | Ga0495672_0090704_1141_1563 | 135 |
| 579 | 3300048904 | Ga0496101_1405484 | Ga0496101_1405484_63_476 | 135 |
| 580 | 3300048905 | Ga0496102_0934407 | Ga0496102_0934407_159_581 | 135 |
| 581 | 3300048905 | Ga0496102_1468310 | Ga0496102_1468310_157_591 | 135 |
| 582 | 3300048906 | Ga0496103_0294848 | Ga0496103_0294848_356_778 | 135 |
| 583 | 3300048909 | Ga0496106_0240757 | Ga0496106_0240757_304_720 | 135 |
| 584 | 3300048910 | Ga0496107_0142038 | Ga0496107_0142038_12_434 | 135 |
| 585 | 3300048910 | Ga0496107_0919242 | Ga0496107_0919242_128_562 | 135 |
| 586 | 3300048912 | Ga0496109_0134445 | Ga0496109_0134445_360_773 | 135 |
| 587 | 3300048912 | Ga0496109_0217689 | Ga0496109_0217689_237_659 | 135 |
| 588 | 3300048912 | Ga0496109_0346128 | Ga0496109_0346128_396_818 | 135 |
| 589 | 3300048913 | Ga0496110_0992202 | Ga0496110_0992202_109_522 | 135 |
| 590 | 3300048915 | Ga0496112_0681231 | Ga0496112_0681231_17_451 | 135 |
| 591 | 3300048916 | Ga0496113_0217082 | Ga0496113_0217082_694_1128 | 135 |
| 592 | 3300049577 | Ga0501041_0959017 | Ga0501041_0959017_67_474 | 135 |
| 593 | 3300049583 | Ga0501067_0026714 | Ga0501067_0026714_1908_2330 | 135 |
| 594 | 3300049584 | Ga0501068_0190733 | Ga0501068_0190733_684_1106 | 135 |
| 595 | 3300050489 | nmdc:mga03683_42402_c1 | nmdc:mga03683_42402_c1_748_1170 | 135 |
| 596 | 3300050508 | nmdc:mga09592_282551_c1 | nmdc:mga09592_282551_c1_962_1384 | 135 |
| 597 | 3300050512 | nmdc:mga0n895_1157217_c1 | nmdc:mga0n895_1157217_c1_121_543 | 135 |
| 598 | 3300050515 | nmdc:mga0a205_248_c1 | nmdc:mga0a205_248_c1_30956_31378 | 135 |
| 599 | 3300001979 | JGI24740J21852_10096425 | JGI24740J21852_100964252 | 136 |
| 600 | 3300001989 | JGI24739J22299_10077882 | JGI24739J22299_100778822 | 136 |
| 601 | 3300005328 | Ga0070676_10294066 | Ga0070676_102940661 | 136 |
| 602 | 3300005335 | Ga0070666_10020219 | Ga0070666_100202195 | 136 |
| 603 | 3300005336 | Ga0070680_101245445 | Ga0070680_1012454451 | 136 |
| 604 | 3300005337 | Ga0070682_100123675 | Ga0070682_1001236752 | 136 |
| 605 | 3300005339 | Ga0070660_100184424 | Ga0070660_1001844242 | 136 |
| 606 | 3300005344 | Ga0070661_100073098 | Ga0070661_1000730983 | 136 |
| 607 | 3300005355 | Ga0070671_100099159 | Ga0070671_1000991593 | 136 |
| 608 | 3300005364 | Ga0070673_100108904 | Ga0070673_1001089043 | 136 |
| 609 | 3300005367 | Ga0070667_100072334 | Ga0070667_1000723343 | 136 |
| 610 | 3300005455 | Ga0070663_100057821 | Ga0070663_1000578214 | 136 |
| 611 | 3300005457 | Ga0070662_100078528 | Ga0070662_1000785283 | 136 |
| 612 | 3300005459 | Ga0068867_100122862 | Ga0068867_1001228622 | 136 |
| 613 | 3300005530 | Ga0070679_100635682 | Ga0070679_1006356822 | 136 |
| 614 | 3300005530 | Ga0070679_100637483 | Ga0070679_1006374832 | 136 |
| 615 | 3300005547 | Ga0070693_100189123 | Ga0070693_1001891232 | 136 |
| 616 | 3300005563 | Ga0068855_100188129 | Ga0068855_1001881293 | 136 |
| 617 | 3300005564 | Ga0070664_100217343 | Ga0070664_1002173432 | 136 |
| 618 | 3300005616 | Ga0068852_100478960 | Ga0068852_1004789602 | 136 |
| 619 | 3300005834 | Ga0068851_10106250 | Ga0068851_101062502 | 136 |
| 620 | 3300009174 | Ga0105241_10952038 | Ga0105241_109520382 | 136 |
| 621 | 3300009551 | Ga0105238_11574156 | Ga0105238_115741562 | 136 |
| 622 | 3300013100 | Ga0157373_11285624 | Ga0157373_112856242 | 136 |
| 623 | 3300013102 | Ga0157371_10072679 | Ga0157371_100726793 | 136 |
| 624 | 3300025321 | Ga0207656_10013094 | Ga0207656_100130942 | 136 |
| 625 | 3300025903 | Ga0207680_10190700 | Ga0207680_101907002 | 136 |
| 626 | 3300025904 | Ga0207647_10026897 | Ga0207647_100268973 | 136 |
| 627 | 3300025907 | Ga0207645_10018707 | Ga0207645_100187076 | 136 |
| 628 | 3300025909 | Ga0207705_10042629 | Ga0207705_100426292 | 136 |
| 629 | 3300025911 | Ga0207654_10215782 | Ga0207654_102157822 | 136 |
| 630 | 3300025917 | Ga0207660_10812034 | Ga0207660_108120342 | 136 |
| 631 | 3300025919 | Ga0207657_10040158 | Ga0207657_100401584 | 136 |
| 632 | 3300025924 | Ga0207694_11118144 | Ga0207694_111181441 | 136 |
| 633 | 3300025931 | Ga0207644_10198958 | Ga0207644_101989583 | 136 |
| 634 | 3300025932 | Ga0207690_10129487 | Ga0207690_101294873 | 136 |
| 635 | 3300025933 | Ga0207706_10098659 | Ga0207706_100986593 | 136 |
| 636 | 3300025940 | Ga0207691_10512778 | Ga0207691_105127782 | 136 |
| 637 | 3300025945 | Ga0207679_10091597 | Ga0207679_100915973 | 136 |
| 638 | 3300025960 | Ga0207651_11267245 | Ga0207651_112672452 | 136 |
| 639 | 3300025986 | Ga0207658_10929188 | Ga0207658_109291881 | 136 |
| 640 | 3300026067 | Ga0207678_10009167 | Ga0207678_100091679 | 136 |
| 641 | 3300026078 | Ga0207702_10100776 | Ga0207702_101007762 | 136 |
| 642 | 3300026089 | Ga0207648_10158592 | Ga0207648_101585922 | 136 |
| 643 | 3300026116 | Ga0207674_10072025 | Ga0207674_100720254 | 136 |
| 644 | 3300028379 | Ga0268266_10653760 | Ga0268266_106537602 | 136 |
| 645 | 3300003323 | rootH1_10348281 | rootH1_103482812 | 139 |
| 646 | 3300005344 | Ga0070661_100078415 | Ga0070661_1000784153 | 139 |
| 647 | 3300005353 | Ga0070669_100576056 | Ga0070669_1005760562 | 139 |
| 648 | 3300005367 | Ga0070667_100082262 | Ga0070667_1000822622 | 139 |
| 649 | 3300005435 | Ga0070714_100282223 | Ga0070714_1002822231 | 139 |
| 650 | 3300005436 | Ga0070713_100027237 | Ga0070713_1000272372 | 139 |
| 651 | 3300005614 | Ga0068856_100037364 | Ga0068856_1000373643 | 139 |
| 652 | 3300005614 | Ga0068856_100330248 | Ga0068856_1003302483 | 139 |
| 653 | 3300005616 | Ga0068852_100126757 | Ga0068852_1001267572 | 139 |
| 654 | 3300005617 | Ga0068859_100091183 | Ga0068859_1000911832 | 139 |
| 655 | 3300005618 | Ga0068864_100032621 | Ga0068864_1000326212 | 139 |
| 656 | 3300005834 | Ga0068851_10134324 | Ga0068851_101343242 | 139 |
| 657 | 3300005841 | Ga0068863_100003869 | Ga0068863_10000386918 | 139 |
| 658 | 3300005842 | Ga0068858_100485958 | Ga0068858_1004859582 | 139 |
| 659 | 3300005843 | Ga0068860_100058772 | Ga0068860_1000587724 | 139 |
| 660 | 3300006931 | Ga0097620_100091178 | Ga0097620_1000911782 | 139 |
| 661 | 3300009177 | Ga0105248_10065081 | Ga0105248_100650813 | 139 |
| 662 | 3300009553 | Ga0105249_10021535 | Ga0105249_100215356 | 139 |
| 663 | 3300013104 | Ga0157370_10497784 | Ga0157370_104977842 | 139 |
| 664 | 3300013105 | Ga0157369_10261787 | Ga0157369_102617873 | 139 |
| 665 | 3300013296 | Ga0157374_10151117 | Ga0157374_101511172 | 139 |
| 666 | 3300014325 | Ga0163163_10026163 | Ga0163163_100261634 | 139 |
| 667 | 3300014968 | Ga0157379_10054030 | Ga0157379_100540303 | 139 |
| 668 | 3300025909 | Ga0207705_10119522 | Ga0207705_101195223 | 139 |
| 669 | 3300025919 | Ga0207657_10014979 | Ga0207657_100149794 | 139 |
| 670 | 3300025923 | Ga0207681_10474352 | Ga0207681_104743522 | 139 |
| 671 | 3300025929 | Ga0207664_10143163 | Ga0207664_101431633 | 139 |
| 672 | 3300025941 | Ga0207711_10000218 | Ga0207711_1000021862 | 139 |
| 673 | 3300025961 | Ga0207712_10030817 | Ga0207712_100308174 | 139 |
| 674 | 3300026035 | Ga0207703_10217056 | Ga0207703_102170562 | 139 |
| 675 | 3300026067 | Ga0207678_10147977 | Ga0207678_101479772 | 139 |
| 676 | 3300026078 | Ga0207702_10176357 | Ga0207702_101763573 | 139 |
| 677 | 3300026078 | Ga0207702_10445406 | Ga0207702_104454062 | 139 |
| 678 | 3300026088 | Ga0207641_10000248 | Ga0207641_1000024870 | 139 |
| 679 | 3300026095 | Ga0207676_10027785 | Ga0207676_100277853 | 139 |
| 680 | 3300026142 | Ga0207698_10126650 | Ga0207698_101266502 | 139 |
| 681 | 3300028381 | Ga0268264_10054953 | Ga0268264_100549532 | 139 |
| 682 | 3300037312 | Ga0395899_0032217 | Ga0395899_0032217_1816_2325 | 139 |
| 683 | 3300037312 | Ga0395899_0625501 | Ga0395899_0625501_85_570 | 139 |
| 684 | 3300037418 | Ga0395900_0012506 | Ga0395900_0012506_6388_6897 | 139 |
| 685 | 3300037418 | Ga0395900_0251375 | Ga0395900_0251375_866_1351 | 139 |
| 686 | 3300037466 | Ga0395898_0036672 | Ga0395898_0036672_2467_2976 | 139 |
| 687 | 3300037466 | Ga0395898_0780755 | Ga0395898_0780755_190_678 | 139 |
| 688 | 3300037471 | Ga0395905_0075399 | Ga0395905_0075399_1109_1618 | 139 |
| 689 | 3300037471 | Ga0395905_0763791 | Ga0395905_0763791_248_736 | 139 |
| 690 | 3300038443 | Ga0395901_0122941 | Ga0395901_0122941_573_1082 | 139 |
| 691 | 3300044842 | Ga0466957_0055180 | Ga0466957_0055180_654_1157 | 139 |
| 692 | 3300045976 | Ga0466967_0015201 | Ga0466967_0015201_4507_5010 | 139 |
| 693 | 3300001990 | JGI24737J22298_10021011 | JGI24737J22298_100210111 | 140 |
| 694 | 3300003322 | rootL2_10280324 | rootL2_102803243 | 140 |
| 695 | 3300005329 | Ga0070683_100006547 | Ga0070683_1000065478 | 140 |
| 696 | 3300005339 | Ga0070660_100662954 | Ga0070660_1006629542 | 140 |
| 697 | 3300005344 | Ga0070661_100812430 | Ga0070661_1008124302 | 140 |
| 698 | 3300005535 | Ga0070684_100005972 | Ga0070684_1000059722 | 140 |
| 699 | 3300005563 | Ga0068855_100017657 | Ga0068855_10001765710 | 140 |
| 700 | 3300005563 | Ga0068855_100236653 | Ga0068855_1002366532 | 140 |
| 701 | 3300005563 | Ga0068855_100626955 | Ga0068855_1006269552 | 140 |
| 702 | 3300005563 | Ga0068855_101464336 | Ga0068855_1014643361 | 140 |
| 703 | 3300005577 | Ga0068857_101867594 | Ga0068857_1018675941 | 140 |
| 704 | 3300005614 | Ga0068856_100069594 | Ga0068856_1000695942 | 140 |
| 705 | 3300005614 | Ga0068856_100208614 | Ga0068856_1002086143 | 140 |
| 706 | 3300005614 | Ga0068856_101296759 | Ga0068856_1012967592 | 140 |
| 707 | 3300005616 | Ga0068852_100011189 | Ga0068852_1000111897 | 140 |
| 708 | 3300010375 | Ga0105239_11370718 | Ga0105239_113707181 | 140 |
| 709 | 3300013100 | Ga0157373_10155299 | Ga0157373_101552992 | 140 |
| 710 | 3300013102 | Ga0157371_10010308 | Ga0157371_100103082 | 140 |
| 711 | 3300013102 | Ga0157371_10028803 | Ga0157371_100288034 | 140 |
| 712 | 3300013102 | Ga0157371_10042483 | Ga0157371_100424834 | 140 |
| 713 | 3300013104 | Ga0157370_10022825 | Ga0157370_100228254 | 140 |
| 714 | 3300013104 | Ga0157370_10071369 | Ga0157370_100713692 | 140 |
| 715 | 3300013104 | Ga0157370_11491513 | Ga0157370_114915131 | 140 |
| 716 | 3300013105 | Ga0157369_10001177 | Ga0157369_100011776 | 140 |
| 717 | 3300013105 | Ga0157369_10012443 | Ga0157369_100124436 | 140 |
| 718 | 3300013105 | Ga0157369_10012489 | Ga0157369_100124893 | 140 |
| 719 | 3300013105 | Ga0157369_10059027 | Ga0157369_100590274 | 140 |
| 720 | 3300013105 | Ga0157369_10146686 | Ga0157369_101466862 | 140 |
| 721 | 3300013307 | Ga0157372_10081328 | Ga0157372_100813284 | 140 |
| 722 | 3300022467 | Ga0224712_10018528 | Ga0224712_100185281 | 140 |
| 723 | 3300025904 | Ga0207647_10273823 | Ga0207647_102738232 | 140 |
| 724 | 3300025919 | Ga0207657_10267892 | Ga0207657_102678922 | 140 |
| 725 | 3300025944 | Ga0207661_10051319 | Ga0207661_100513192 | 140 |
| 726 | 3300025949 | Ga0207667_10016908 | Ga0207667_1001690810 | 140 |
| 727 | 3300025949 | Ga0207667_10386053 | Ga0207667_103860533 | 140 |
| 728 | 3300026078 | Ga0207702_10012315 | Ga0207702_1001231510 | 140 |
| 729 | 3300026078 | Ga0207702_10050713 | Ga0207702_100507133 | 140 |
| 730 | 3300026116 | Ga0207674_10021233 | Ga0207674_100212337 | 140 |
| 731 | 3300026116 | Ga0207674_10701935 | Ga0207674_107019352 | 140 |
| 732 | 3300026142 | Ga0207698_10025015 | Ga0207698_100250153 | 140 |
| 733 | 3300037312 | Ga0395899_0202925 | Ga0395899_0202925_404_898 | 140 |
| 734 | 3300037418 | Ga0395900_0003019 | Ga0395900_0003019_15152_15646 | 140 |
| 735 | 3300037418 | Ga0395900_0071242 | Ga0395900_0071242_2144_2638 | 140 |
| 736 | 3300037418 | Ga0395900_0107472 | Ga0395900_0107472_802_1287 | 140 |
| 737 | 3300037418 | Ga0395900_0271284 | Ga0395900_0271284_688_1179 | 140 |
| 738 | 3300037418 | Ga0395900_0645259 | Ga0395900_0645259_115_621 | 140 |
| 739 | 3300037466 | Ga0395898_0025517 | Ga0395898_0025517_719_1213 | 140 |
| 740 | 3300037466 | Ga0395898_0088025 | Ga0395898_0088025_1622_2116 | 140 |
| 741 | 3300037471 | Ga0395905_0010096 | Ga0395905_0010096_3032_3526 | 140 |
| 742 | 3300037471 | Ga0395905_0012671 | Ga0395905_0012671_4233_4724 | 140 |
| 743 | 3300037471 | Ga0395905_0070855 | Ga0395905_0070855_2533_3027 | 140 |
| 744 | 3300037471 | Ga0395905_0106578 | Ga0395905_0106578_1781_2275 | 140 |
| 745 | 3300037471 | Ga0395905_0132012 | Ga0395905_0132012_1473_1979 | 140 |
| 746 | 3300038443 | Ga0395901_0002158 | Ga0395901_0002158_1339_1833 | 140 |
| 747 | 3300038443 | Ga0395901_0451913 | Ga0395901_0451913_624_1130 | 140 |
| 748 | 3300038443 | Ga0395901_0489436 | Ga0395901_0489436_535_1029 | 140 |
| 749 | 3300044656 | Ga0466969_0199970 | Ga0466969_0199970_69_557 | 140 |
| 750 | 3300044684 | Ga0466966_0015374 | Ga0466966_0015374_2259_2747 | 140 |
| 751 | 3300044693 | Ga0466961_0049492 | Ga0466961_0049492_309_797 | 140 |
| 752 | 3300044693 | Ga0466961_0373545 | Ga0466961_0373545_204_692 | 140 |
| 753 | 3300044842 | Ga0466957_0577874 | Ga0466957_0577874_106_594 | 140 |
| 754 | 3300045049 | Ga0466959_0061069 | Ga0466959_0061069_337_825 | 140 |
| 755 | 3300045049 | Ga0466959_0340378 | Ga0466959_0340378_352_840 | 140 |
| 756 | 3300045836 | Ga0466958_0094126 | Ga0466958_0094126_1113_1601 | 140 |
| 757 | 3300045976 | Ga0466967_0023305 | Ga0466967_0023305_272_760 | 140 |
| 758 | 3300061719 | Ga0466962_0106472 | Ga0466962_0106472_591_1079 | 140 |
| 759 | 3300005339 | Ga0070660_100086216 | Ga0070660_1000862162 | 141 |
| 760 | 3300005344 | Ga0070661_100080649 | Ga0070661_1000806493 | 141 |
| 761 | 3300005455 | Ga0070663_100061273 | Ga0070663_1000612732 | 141 |
| 762 | 3300005616 | Ga0068852_100290295 | Ga0068852_1002902953 | 141 |
| 763 | 3300013100 | Ga0157373_10386291 | Ga0157373_103862912 | 141 |
| 764 | 3300025919 | Ga0207657_10145350 | Ga0207657_101453502 | 141 |
| 765 | 3300025932 | Ga0207690_10622975 | Ga0207690_106229752 | 141 |
| 766 | 3300025981 | Ga0207640_10415241 | Ga0207640_104152412 | 141 |
| 767 | 3300026067 | Ga0207678_10020075 | Ga0207678_100200753 | 141 |
| 768 | 3300026142 | Ga0207698_10527207 | Ga0207698_105272072 | 141 |
| 769 | 2162886011 | MRS1b_contig_2738738 | MRS1b_0647.00000630 | 142 |
| 770 | 2162886012 | MBSR1b_contig_7487180 | MBSR1b_0276.00000910 | 142 |
| 771 | 3300005290 | Ga0065712_10305407 | Ga0065712_103054071 | 142 |
| 772 | 3300005293 | Ga0065715_10310536 | Ga0065715_103105361 | 142 |
| 773 | 3300005293 | Ga0065715_10393119 | Ga0065715_103931192 | 142 |
| 774 | 3300005331 | Ga0070670_100002488 | Ga0070670_10000248812 | 142 |
| 775 | 3300005333 | Ga0070677_10096835 | Ga0070677_100968353 | 142 |
| 776 | 3300005347 | Ga0070668_100036377 | Ga0070668_1000363772 | 142 |
| 777 | 3300005353 | Ga0070669_100003672 | Ga0070669_1000036728 | 142 |
| 778 | 3300005354 | Ga0070675_100510002 | Ga0070675_1005100022 | 142 |
| 779 | 3300005356 | Ga0070674_100506382 | Ga0070674_1005063822 | 142 |
| 780 | 3300005457 | Ga0070662_100050613 | Ga0070662_1000506134 | 142 |
| 781 | 3300005543 | Ga0070672_100143410 | Ga0070672_1001434101 | 142 |
| 782 | 3300005564 | Ga0070664_100993571 | Ga0070664_1009935711 | 142 |
| 783 | 3300005719 | Ga0068861_102056389 | Ga0068861_1020563891 | 142 |
| 784 | 3300014326 | Ga0157380_10070822 | Ga0157380_100708224 | 142 |
| 785 | 3300025893 | Ga0207682_10003496 | Ga0207682_100034964 | 142 |
| 786 | 3300025923 | Ga0207681_10028732 | Ga0207681_100287323 | 142 |
| 787 | 3300025925 | Ga0207650_10004951 | Ga0207650_100049513 | 142 |
| 788 | 3300025926 | Ga0207659_10104748 | Ga0207659_101047483 | 142 |
| 789 | 3300025933 | Ga0207706_10068347 | Ga0207706_100683472 | 142 |
| 790 | 3300025937 | Ga0207669_10541031 | Ga0207669_105410312 | 142 |
| 791 | 3300025940 | Ga0207691_10064947 | Ga0207691_100649473 | 142 |
| 792 | 3300025945 | Ga0207679_10099466 | Ga0207679_100994663 | 142 |
| 793 | 3300025972 | Ga0207668_10674807 | Ga0207668_106748072 | 142 |
| 794 | 3300031548 | Ga0307408_100481660 | Ga0307408_1004816601 | 142 |
| 795 | 3300031731 | Ga0307405_10097727 | Ga0307405_100977273 | 142 |
| 796 | 3300031731 | Ga0307405_10515380 | Ga0307405_105153802 | 142 |
| 797 | 3300031731 | Ga0307405_10639763 | Ga0307405_106397632 | 142 |
| 798 | 3300031824 | Ga0307413_10003613 | Ga0307413_100036135 | 142 |
| 799 | 3300031824 | Ga0307413_10008481 | Ga0307413_100084814 | 142 |
| 800 | 3300031852 | Ga0307410_10005467 | Ga0307410_100054673 | 142 |
| 801 | 3300031852 | Ga0307410_10020790 | Ga0307410_100207904 | 142 |
| 802 | 3300031852 | Ga0307410_10027755 | Ga0307410_100277552 | 142 |
| 803 | 3300031901 | Ga0307406_10043203 | Ga0307406_100432033 | 142 |
| 804 | 3300031901 | Ga0307406_10333790 | Ga0307406_103337902 | 142 |
| 805 | 3300031901 | Ga0307406_10879618 | Ga0307406_108796182 | 142 |
| 806 | 3300031903 | Ga0307407_10021132 | Ga0307407_100211323 | 142 |
| 807 | 3300031911 | Ga0307412_10006903 | Ga0307412_100069033 | 142 |
| 808 | 3300031911 | Ga0307412_10171451 | Ga0307412_101714511 | 142 |
| 809 | 3300031995 | Ga0307409_100004073 | Ga0307409_1000040731 | 142 |
| 810 | 3300031995 | Ga0307409_100030409 | Ga0307409_1000304092 | 142 |
| 811 | 3300031995 | Ga0307409_100177191 | Ga0307409_1001771912 | 142 |
| 812 | 3300031995 | Ga0307409_100408843 | Ga0307409_1004088432 | 142 |
| 813 | 3300032004 | Ga0307414_10006161 | Ga0307414_100061613 | 142 |
| 814 | 3300032004 | Ga0307414_10072352 | Ga0307414_100723523 | 142 |
| 815 | 3300032004 | Ga0307414_10207051 | Ga0307414_102070513 | 142 |
| 816 | 3300032004 | Ga0307414_10830701 | Ga0307414_108307011 | 142 |
| 817 | 3300032005 | Ga0307411_10000435 | Ga0307411_1000043513 | 142 |
| 818 | 3300032005 | Ga0307411_10000684 | Ga0307411_100006847 | 142 |
| 819 | 3300032126 | Ga0307415_100033282 | Ga0307415_1000332824 | 142 |
| 820 | 3300032126 | Ga0307415_100050442 | Ga0307415_1000504423 | 142 |
| 821 | 3300032126 | Ga0307415_100219141 | Ga0307415_1002191413 | 142 |
| 822 | 3300042006 | Ga0439432_168881 | Ga0439432_168881_12_491 | 142 |
| 823 | 3300042146 | Ga0450907_016387 | Ga0450907_016387_409_885 | 142 |
| 824 | 3300049660 | Ga0501216_096652 | Ga0501216_096652_168_596 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tc1-assembly1.cif.gz_G | in situ structures of the genome and genome-delivery apparatus in ssrna bacteriophage ms2 | 0.7176 | 91 | 132 |
| 2qux-assembly4.cif.gz_K | pp7 coat protein dimer in complex with rna hairpin | 0.7141 | 91 | 132 |
| 6tlb-assembly1.cif.gz_C-2 | plasmodium falciparum lipocalin (pf3d7_0925900) | 0.7009 | 91 | 126 |
| 5ixm-assembly1.cif.gz_B | the lps transporter lptde from yersinia pestis, core complex | 0.6719 | 89 | 132 |
| 5iv8-assembly1.cif.gz_B | the lps transporter lptde from klebsiella pneumoniae, core complex | 0.6697 | 89 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0L6S4_8_83_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7504 | 91 | 132 | 3.30.420.10 |
| af_Q8I2Q0_30_206_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.743 | 91 | 130 | 2.40.128.20 |
| af_Q0VBB0_16_173_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7219 | 102 | 132 | 3.30.530.20 |
| af_A0A0R0K9Z2_296_445_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7141 | 101 | 132 | 3.30.530.20 |
| 1qynD00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7133 | 89 | 130 | 3.10.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9E0T5-F1-model_v4 | Pilus assembly protein | 0.9694 | 19 | 133 |
|
| AF-A0A520YF62-F1-model_v4 | Pilus assembly protein | 0.9257 | 11 | 135 |
GO:0016020
|
| AF-A0A6G7ZFH3-F1-model_v4 | Pilus assembly protein | 0.9033 | 10 | 138 |
GO:0016020
|
| AF-A0A7V9E0T5-F1-model_v4 | Pilus assembly protein | 0.9003 | 19 | 133 |
|
| AF-A0A6G7YS04-F1-model_v4 | Pilus assembly protein | 0.8903 | 11 | 135 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar