F482392

General Info

Members Datasets Scaffolds Average Seq Length
824 227 824 144

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0032217|Ga0395899_0032217_1816_2325
Length 169
Sequence MKIRRSIKADQQGAAVIEAAIALPVLVVMIYGIFSIGQLFEANAGMQHALGEGARYATLCSSMSVSADGTTKTCAVHTGTEIKAMVANKLFGANNGNGTWDDPNLDTSTASSGYVTLTVTYHPLMKFAFYSLPSFTITRSKRIYLADVPGTSADCASGSSTVGSCSIYS

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
189 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2738738 2162886011 Unclassified 803
2 MRS1b_contig_816425 2162886011 Bacteria 858
3 MBSR1b_contig_6582152 2162886012 Unclassified 805
4 MBSR1b_contig_7487180 2162886012 Unclassified 1309
5 CNBas_1009180 3300000531 Unclassified 592
6 JGI24736J21556_1047311 3300001904 Unclassified 661
7 JGI24740J21852_10007956 3300001979 Bacteria 4272
8 JGI24740J21852_10096425 3300001979 Bacteria 757
9 JGI24739J22299_10001510 3300001989 Bacteria 8784
10 JGI24739J22299_10033107 3300001989 Bacteria 1772
11 JGI24739J22299_10077882 3300001989 Bacteria 1022
12 JGI24737J22298_10000293 3300001990 Bacteria 16594
13 JGI24737J22298_10001879 3300001990 Bacteria 7505
14 JGI24737J22298_10015945 3300001990 Bacteria 2426
15 JGI24737J22298_10021011 3300001990 Bacteria 2082
16 JGI24737J22298_10139634 3300001990 Unclassified 716
17 JGI24735J21928_10171374 3300002067 Unclassified 627
18 JGI24738J21930_10000671 3300002075 Bacteria 9929
19 rootH2_10273668 3300003320 Bacteria 1285
20 rootL2_10280324 3300003322 Bacteria 2984
21 rootH1_10348281 3300003323 Bacteria 1282
22 Ga0065712_10223242 3300005290 Unclassified 1026
23 Ga0065712_10305407 3300005290 Unclassified 853
24 Ga0065715_10130129 3300005293 Bacteria 2032
25 Ga0065715_10303161 3300005293 Bacteria 1036
26 Ga0065715_10310536 3300005293 Unclassified 1021
27 Ga0065715_10393119 3300005293 Unclassified 872
28 Ga0065715_10625605 3300005293 Bacteria 693
29 Ga0070658_10092523 3300005327 Bacteria 2493
30 Ga0070658_10187097 3300005327 Bacteria 1744
31 Ga0070658_10371799 3300005327 Bacteria 1225
32 Ga0070676_10001496 3300005328 Bacteria 11830
33 Ga0070676_10011918 3300005328 Bacteria 4737
34 Ga0070676_10075467 3300005328 Bacteria 2033
35 Ga0070676_10294066 3300005328 Unclassified 1099
36 Ga0070676_10703819 3300005328 Unclassified 738
37 Ga0070676_11484340 3300005328 Bacteria 522
38 Ga0070683_100006547 3300005329 Bacteria 9782
39 Ga0070683_100122723 3300005329 Bacteria 2454
40 Ga0070670_100002488 3300005331 Bacteria 15189
41 Ga0070670_100067267 3300005331 Bacteria 3075
42 Ga0070670_100146444 3300005331 Bacteria 2043
43 Ga0070670_100165214 3300005331 Bacteria 1919
44 Ga0070670_100518913 3300005331 Bacteria 1061
45 Ga0070670_101072826 3300005331 Unclassified 734
46 Ga0070677_10089575 3300005333 Unclassified 1335
47 Ga0070677_10096835 3300005333 Unclassified 1293
48 Ga0070677_10226910 3300005333 Bacteria 915
49 Ga0068869_100000094 3300005334 Bacteria 41359
50 Ga0068869_100038011 3300005334 Bacteria 3426
51 Ga0068869_100051534 3300005334 Bacteria 2986
52 Ga0068869_100129425 3300005334 Bacteria 1939
53 Ga0068869_100176989 3300005334 Bacteria 1670
54 Ga0068869_101180378 3300005334 Unclassified 672
55 Ga0070666_10020219 3300005335 Bacteria 4302
56 Ga0070666_10042190 3300005335 Bacteria 3051
57 Ga0070666_10118000 3300005335 Bacteria 1839
58 Ga0070666_10207699 3300005335 Bacteria 1378
59 Ga0070680_101245445 3300005336 Bacteria 644
60 Ga0070682_100098294 3300005337 Unclassified 1928
61 Ga0070682_100123675 3300005337 Bacteria 1740
62 Ga0068868_100001948 3300005338 Bacteria 14153
63 Ga0068868_100072159 3300005338 Bacteria 2754
64 Ga0070660_100004239 3300005339 Bacteria 9900
65 Ga0070660_100022428 3300005339 Bacteria 4669
66 Ga0070660_100056503 3300005339 Bacteria 3037
67 Ga0070660_100086216 3300005339 Bacteria 2470
68 Ga0070660_100184424 3300005339 Bacteria 1689
69 Ga0070660_100603999 3300005339 Unclassified 917
70 Ga0070660_100662954 3300005339 Unclassified 874
71 Ga0070689_100289735 3300005340 Bacteria 1360
72 Ga0070687_100689678 3300005343 Bacteria 712
73 Ga0070661_100003747 3300005344 Bacteria 10478
74 Ga0070661_100014559 3300005344 Bacteria 5544
75 Ga0070661_100073098 3300005344 Bacteria 2524
76 Ga0070661_100078415 3300005344 Bacteria 2436
77 Ga0070661_100080649 3300005344 Bacteria 2402
78 Ga0070661_100103784 3300005344 Bacteria 2117
79 Ga0070661_100459923 3300005344 Bacteria 1013
80 Ga0070661_100812430 3300005344 Bacteria 768
81 Ga0070661_101025563 3300005344 Bacteria 685
82 Ga0070692_10024487 3300005345 Bacteria 2967
83 Ga0070668_100000311 3300005347 Bacteria 32092
84 Ga0070668_100014598 3300005347 Bacteria 5871
85 Ga0070668_100036377 3300005347 Bacteria 3758
86 Ga0070668_100056574 3300005347 Bacteria 3030
87 Ga0070668_100228957 3300005347 Bacteria 1536
88 Ga0070668_100468558 3300005347 Bacteria 1086
89 Ga0070668_100659750 3300005347 Unclassified 920
90 Ga0070668_101321078 3300005347 Bacteria 656
91 Ga0070669_100000155 3300005353 Bacteria 61710
92 Ga0070669_100003672 3300005353 Bacteria 11068
93 Ga0070669_100069766 3300005353 Bacteria 2596
94 Ga0070669_100214262 3300005353 Bacteria 1521
95 Ga0070669_100576056 3300005353 Unclassified 941
96 Ga0070669_100626945 3300005353 Unclassified 903
97 Ga0070675_100031778 3300005354 Bacteria 4269
98 Ga0070675_100091624 3300005354 Bacteria 2547
99 Ga0070675_100343655 3300005354 Bacteria 1322
100 Ga0070675_100510002 3300005354 Bacteria 1084
101 Ga0070671_100099159 3300005355 Bacteria 2443
102 Ga0070671_100149229 3300005355 Unclassified 1974
103 Ga0070671_100250091 3300005355 Bacteria 1506
104 Ga0070671_101088384 3300005355 Bacteria 702
105 Ga0070674_100049256 3300005356 Bacteria 2896
106 Ga0070674_100506382 3300005356 Unclassified 1006
107 Ga0070674_101309058 3300005356 Unclassified 646
108 Ga0070673_100019549 3300005364 Bacteria 4864
109 Ga0070673_100075382 3300005364 Unclassified 2720
110 Ga0070673_100097307 3300005364 Bacteria 2417
111 Ga0070673_100108904 3300005364 Bacteria 2294
112 Ga0070673_100295256 3300005364 Bacteria 1425
113 Ga0070673_100420219 3300005364 Unclassified 1198
114 Ga0070673_101163073 3300005364 Unclassified 722
115 Ga0070688_100174444 3300005365 Bacteria 1486
116 Ga0070659_100000305 3300005366 Bacteria 38108
117 Ga0070659_100021439 3300005366 Bacteria 4921
118 Ga0070659_100022758 3300005366 Bacteria 4787
119 Ga0070659_100220033 3300005366 Unclassified 1567
120 Ga0070659_100370126 3300005366 Bacteria 1205
121 Ga0070659_100415178 3300005366 Bacteria 1138
122 Ga0070659_100533830 3300005366 Bacteria 1003
123 Ga0070659_102034089 3300005366 Bacteria 516
124 Ga0070667_100022892 3300005367 Bacteria 5180
125 Ga0070667_100029038 3300005367 Bacteria 4606
126 Ga0070667_100030696 3300005367 Bacteria 4482
127 Ga0070667_100043068 3300005367 Bacteria 3788
128 Ga0070667_100070149 3300005367 Bacteria 2983
129 Ga0070667_100072334 3300005367 Bacteria 2938
130 Ga0070667_100082262 3300005367 Bacteria 2756
131 Ga0070667_100382451 3300005367 Bacteria 1279
132 Ga0070667_100694772 3300005367 Bacteria 941
133 Ga0070714_100070117 3300005435 Bacteria 3030
134 Ga0070714_100282223 3300005435 Bacteria 1543
135 Ga0070713_100027237 3300005436 Bacteria 4498
136 Ga0070694_100205024 3300005444 Unclassified 1472
137 Ga0070694_100371702 3300005444 Bacteria 1113
138 Ga0070663_100007015 3300005455 Bacteria 6825
139 Ga0070663_100023038 3300005455 Bacteria 4169
140 Ga0070663_100057821 3300005455 Bacteria 2783
141 Ga0070663_100061273 3300005455 Bacteria 2709
142 Ga0070663_100067584 3300005455 Bacteria 2593
143 Ga0070663_100068550 3300005455 Bacteria 2575
144 Ga0070663_100189068 3300005455 Bacteria 1602
145 Ga0070663_100262966 3300005455 Bacteria 1369
146 Ga0070678_100072630 3300005456 Bacteria 2580
147 Ga0070678_101409446 3300005456 Unclassified 651
148 Ga0070662_100006089 3300005457 Bacteria 7749
149 Ga0070662_100017060 3300005457 Bacteria 4886
150 Ga0070662_100020874 3300005457 Bacteria 4467
151 Ga0070662_100046756 3300005457 Bacteria 3110
152 Ga0070662_100050613 3300005457 Bacteria 2997
153 Ga0070662_100078528 3300005457 Bacteria 2452
154 Ga0070662_100219559 3300005457 Bacteria 1516
155 Ga0070662_100282597 3300005457 Unclassified 1343
156 Ga0070662_100478933 3300005457 Unclassified 1036
157 Ga0070662_100657234 3300005457 Unclassified 885
158 Ga0070662_100736264 3300005457 Bacteria 835
159 Ga0070662_101174267 3300005457 Bacteria 659
160 Ga0070662_101769701 3300005457 Bacteria 534
161 Ga0070681_10044764 3300005458 Bacteria 4431
162 Ga0068867_100008791 3300005459 Bacteria 7132
163 Ga0068867_100039753 3300005459 Bacteria 3430
164 Ga0068867_100092554 3300005459 Bacteria 2296
165 Ga0068867_100122862 3300005459 Bacteria 2008
166 Ga0068867_100669214 3300005459 Unclassified 913
167 Ga0068867_100697801 3300005459 Bacteria 895
168 Ga0070685_10061622 3300005466 Bacteria 2197
169 Ga0070706_100327274 3300005467 Bacteria 1429
170 Ga0070679_100124128 3300005530 Unclassified 2565
171 Ga0070679_100635682 3300005530 Bacteria 1010
172 Ga0070679_100637483 3300005530 Bacteria 1008
173 Ga0070684_100005972 3300005535 Bacteria 9381
174 Ga0070684_100185799 3300005535 Bacteria 1890
175 Ga0070684_100642215 3300005535 Bacteria 988
176 Ga0068853_100014045 3300005539 Bacteria 6554
177 Ga0068853_100079638 3300005539 Bacteria 2865
178 Ga0068853_100140799 3300005539 Bacteria 2165
179 Ga0068853_100369814 3300005539 Unclassified 1337
180 Ga0068853_100472984 3300005539 Unclassified 1181
181 Ga0070672_100000797 3300005543 Bacteria 18794
182 Ga0070672_100014427 3300005543 Bacteria 5599
183 Ga0070672_100040507 3300005543 Bacteria 3575
184 Ga0070672_100143410 3300005543 Bacteria 1972
185 Ga0070672_100674817 3300005543 Bacteria 904
186 Ga0070686_100523873 3300005544 Bacteria 923
187 Ga0070695_100792069 3300005545 Bacteria 759
188 Ga0070695_100880612 3300005545 Unclassified 722
189 Ga0070696_100215828 3300005546 Bacteria 1438
190 Ga0070693_100058644 3300005547 Bacteria 2229
191 Ga0070693_100114799 3300005547 Unclassified 1662
192 Ga0070693_100189091 3300005547 Unclassified 1331
193 Ga0070693_100189123 3300005547 Bacteria 1330
194 Ga0070693_100746562 3300005547 Unclassified 721
195 Ga0070665_100000995 3300005548 Bacteria 35932
196 Ga0070665_100018705 3300005548 Bacteria 6945
197 Ga0070665_100093331 3300005548 Bacteria 3014
198 Ga0070665_100147062 3300005548 Bacteria 2359
199 Ga0070665_100266582 3300005548 Bacteria 1714
200 Ga0070665_100434400 3300005548 Bacteria 1322
201 Ga0070665_100508781 3300005548 Bacteria 1216
202 Ga0068855_100006968 3300005563 Bacteria 13718
203 Ga0068855_100017657 3300005563 Bacteria 8580
204 Ga0068855_100029523 3300005563 Bacteria 6553
205 Ga0068855_100188129 3300005563 Bacteria 2330
206 Ga0068855_100236653 3300005563 Bacteria 2042
207 Ga0068855_100626955 3300005563 Unclassified 1157
208 Ga0068855_100917273 3300005563 Bacteria 924
209 Ga0068855_101023067 3300005563 Bacteria 867
210 Ga0068855_101464336 3300005563 Bacteria 702
211 Ga0070664_100014224 3300005564 Bacteria 6490
212 Ga0070664_100015483 3300005564 Bacteria 6238
213 Ga0070664_100017113 3300005564 Bacteria 5951
214 Ga0070664_100037089 3300005564 Bacteria 4096
215 Ga0070664_100217343 3300005564 Bacteria 1709
216 Ga0070664_100993571 3300005564 Unclassified 789
217 Ga0068857_100007925 3300005577 Bacteria 9167
218 Ga0068857_100011070 3300005577 Bacteria 7848
219 Ga0068857_100013097 3300005577 Bacteria 7227
220 Ga0068857_100073362 3300005577 Unclassified 3049
221 Ga0068857_100687339 3300005577 Bacteria 971
222 Ga0068857_101867594 3300005577 Unclassified 588
223 Ga0068854_100015999 3300005578 Bacteria 4987
224 Ga0068854_100021442 3300005578 Bacteria 4385
225 Ga0068854_100024641 3300005578 Bacteria 4122
226 Ga0068854_100031846 3300005578 Bacteria 3666
227 Ga0068854_100098367 3300005578 Bacteria 2189
228 Ga0068854_100139016 3300005578 Bacteria 1862
229 Ga0068854_100333935 3300005578 Bacteria 1236
230 Ga0068854_100562479 3300005578 Bacteria 969
231 Ga0068854_101611710 3300005578 Bacteria 592
232 Ga0068856_100037364 3300005614 Bacteria 4766
233 Ga0068856_100069594 3300005614 Bacteria 3480
234 Ga0068856_100208614 3300005614 Bacteria 1968
235 Ga0068856_100275782 3300005614 Bacteria 1698
236 Ga0068856_100330248 3300005614 Bacteria 1542
237 Ga0068856_101296759 3300005614 Unclassified 744
238 Ga0068856_101592948 3300005614 Bacteria 666
239 Ga0068852_100011189 3300005616 Bacteria 6741
240 Ga0068852_100021745 3300005616 Bacteria 5131
241 Ga0068852_100056352 3300005616 Bacteria 3396
242 Ga0068852_100061331 3300005616 Bacteria 3268
243 Ga0068852_100086277 3300005616 Bacteria 2798
244 Ga0068852_100126757 3300005616 Bacteria 2346
245 Ga0068852_100170088 3300005616 Bacteria 2042
246 Ga0068852_100290295 3300005616 Bacteria 1580
247 Ga0068852_100369894 3300005616 Bacteria 1404
248 Ga0068852_100432382 3300005616 Unclassified 1300
249 Ga0068852_100478960 3300005616 Bacteria 1236
250 Ga0068859_100013299 3300005617 Bacteria 8258
251 Ga0068859_100032867 3300005617 Bacteria 5211
252 Ga0068859_100091183 3300005617 Bacteria 3098
253 Ga0068859_100105910 3300005617 Bacteria 2871
254 Ga0068859_100379146 3300005617 Unclassified 1510
255 Ga0068859_100913047 3300005617 Bacteria 962
256 Ga0068859_102035184 3300005617 Bacteria 634
257 Ga0068864_100000328 3300005618 Bacteria 41844
258 Ga0068864_100020388 3300005618 Bacteria 5545
259 Ga0068864_100032621 3300005618 Bacteria 4426
260 Ga0068864_101910336 3300005618 Unclassified 599
261 Ga0068866_10036527 3300005718 Bacteria 2408
262 Ga0068866_10251874 3300005718 Bacteria 1081
263 Ga0068861_100022847 3300005719 Bacteria 4509
264 Ga0068861_100484201 3300005719 Bacteria 1115
265 Ga0068861_102056389 3300005719 Unclassified 570
266 Ga0068851_10001318 3300005834 Bacteria 10811
267 Ga0068851_10010278 3300005834 Bacteria 4364
268 Ga0068851_10022059 3300005834 Bacteria 3098
269 Ga0068851_10106250 3300005834 Bacteria 1494
270 Ga0068851_10134324 3300005834 Bacteria 1340
271 Ga0068870_10882229 3300005840 Unclassified 631
272 Ga0068870_10937890 3300005840 Unclassified 614
273 Ga0068863_100000634 3300005841 Bacteria 35566
274 Ga0068863_100003869 3300005841 Bacteria 14810
275 Ga0068863_100172606 3300005841 Bacteria 2074
276 Ga0068863_100488539 3300005841 Bacteria 1211
277 Ga0068858_100004807 3300005842 Bacteria 13235
278 Ga0068858_100009244 3300005842 Bacteria 9411
279 Ga0068858_100014386 3300005842 Bacteria 7459
280 Ga0068858_100485958 3300005842 Bacteria 1192
281 Ga0068860_100006212 3300005843 Bacteria 12010
282 Ga0068860_100009697 3300005843 Bacteria 9564
283 Ga0068860_100021934 3300005843 Bacteria 6179
284 Ga0068860_100058772 3300005843 Bacteria 3656
285 Ga0068860_100072263 3300005843 Bacteria 3278
286 Ga0068860_100089367 3300005843 Bacteria 2933
287 Ga0068860_100258611 3300005843 Bacteria 1696
288 Ga0068860_100607621 3300005843 Archaea 1099
289 Ga0068860_100734478 3300005843 Bacteria 998
290 Ga0068862_100004541 3300005844 Bacteria 11701
291 Ga0068862_100005881 3300005844 Bacteria 10217
292 Ga0068862_100007340 3300005844 Bacteria 9155
293 Ga0068862_100035359 3300005844 Bacteria 4230
294 Ga0068862_100097434 3300005844 Unclassified 2568
295 Ga0068862_100166394 3300005844 Bacteria 1971
296 Ga0068862_100510985 3300005844 Unclassified 1142
297 Ga0068862_100572507 3300005844 Bacteria 1081
298 Ga0068862_100850991 3300005844 Bacteria 894
299 Ga0075364_10425388 3300006051 Bacteria 907
300 Ga0075362_10047063 3300006177 Bacteria 1920
301 Ga0075366_10326305 3300006195 Bacteria 941
302 Ga0068871_100022855 3300006358 Bacteria 4827
303 Ga0068871_100039675 3300006358 Bacteria 3769
304 Ga0075428_100625075 3300006844 Bacteria 1149
305 Ga0075434_100101616 3300006871 Bacteria 2882
306 Ga0075429_101932462 3300006880 Bacteria 511
307 Ga0068865_100012978 3300006881 Bacteria 5253
308 Ga0068865_100122966 3300006881 Unclassified 1933
309 Ga0097620_100013298 3300006931 Bacteria 8258
310 Ga0097620_100032867 3300006931 Bacteria 5211
311 Ga0097620_100091178 3300006931 Bacteria 3098
312 Ga0097620_100105916 3300006931 Bacteria 2871
313 Ga0097620_100379165 3300006931 Unclassified 1510
314 Ga0097620_100913064 3300006931 Bacteria 962
315 Ga0097620_102034893 3300006931 Bacteria 634
316 Ga0097620_102363650 3300006931 Unclassified 586
317 Ga0075435_100131542 3300007076 Bacteria 2094
318 Ga0105240_10086764 3300009093 Bacteria 3833
319 Ga0105240_10109890 3300009093 Bacteria 3338
320 Ga0105245_10000352 3300009098 Bacteria 42872
321 Ga0105245_10118397 3300009098 Bacteria 2471
322 Ga0114129_10892755 3300009147 Bacteria 1127
323 Ga0105243_10027980 3300009148 Bacteria 4325
324 Ga0105243_10499645 3300009148 Unclassified 1152
325 Ga0105243_10676307 3300009148 Bacteria 1003
326 Ga0105241_10041940 3300009174 Bacteria 3460
327 Ga0105241_10262565 3300009174 Bacteria 1468
328 Ga0105241_10952038 3300009174 Unclassified 800
329 Ga0105241_12022105 3300009174 Unclassified 568
330 Ga0105248_10020591 3300009177 Bacteria 7310
331 Ga0105248_10065081 3300009177 Bacteria 4092
332 Ga0105248_10113019 3300009177 Bacteria 3063
333 Ga0105248_10158843 3300009177 Bacteria 2550
334 Ga0105248_10234891 3300009177 Bacteria 2064
335 Ga0105248_10434350 3300009177 Bacteria 1479
336 Ga0105238_10526818 3300009551 Unclassified 1185
337 Ga0105238_10771481 3300009551 Bacteria 976
338 Ga0105238_11574156 3300009551 Bacteria 687
339 Ga0105249_10008677 3300009553 Bacteria 8855
340 Ga0105249_10021535 3300009553 Bacteria 5772
341 Ga0105249_10160529 3300009553 Bacteria 2172
342 Ga0105249_10161072 3300009553 Bacteria 2168
343 Ga0105249_11176046 3300009553 Unclassified 838
344 Ga0105249_11538183 3300009553 Bacteria 738
345 Ga0105249_12018237 3300009553 Bacteria 649
346 Ga0105249_13180518 3300009553 Unclassified 528
347 Ga0105239_10040842 3300010375 Bacteria 5083
348 Ga0105239_10063252 3300010375 Bacteria 4063
349 Ga0105239_11370718 3300010375 Unclassified 816
350 Ga0105239_12319576 3300010375 Bacteria 625
351 Ga0105246_10664287 3300011119 Unclassified 909
352 Ga0105246_11154647 3300011119 Unclassified 710
353 Ga0157316_1017401 3300012510 Bacteria 749
354 Ga0157373_10007015 3300013100 Bacteria 8395
355 Ga0157373_10029098 3300013100 Bacteria 3982
356 Ga0157373_10081989 3300013100 Bacteria 2273
357 Ga0157373_10148086 3300013100 Bacteria 1651
358 Ga0157373_10155299 3300013100 Unclassified 1610
359 Ga0157373_10335593 3300013100 Bacteria 1077
360 Ga0157373_10386291 3300013100 Bacteria 1002
361 Ga0157373_11015385 3300013100 Unclassified 619
362 Ga0157373_11285624 3300013100 Bacteria 553
363 Ga0157371_10001647 3300013102 Bacteria 22783
364 Ga0157371_10010308 3300013102 Bacteria 7293
365 Ga0157371_10028803 3300013102 Bacteria 4020
366 Ga0157371_10042483 3300013102 Bacteria 3240
367 Ga0157371_10072679 3300013102 Bacteria 2435
368 Ga0157371_10457035 3300013102 Unclassified 939
369 Ga0157371_10519396 3300013102 Unclassified 881
370 Ga0157371_10979654 3300013102 Unclassified 644
371 Ga0157370_10022825 3300013104 Bacteria 6222
372 Ga0157370_10071369 3300013104 Bacteria 3276
373 Ga0157370_10177811 3300013104 Bacteria 1978
374 Ga0157370_10497784 3300013104 Bacteria 1119
375 Ga0157370_11491513 3300013104 Bacteria 608
376 Ga0157369_10001177 3300013105 Bacteria 32602
377 Ga0157369_10012443 3300013105 Bacteria 9659
378 Ga0157369_10012489 3300013105 Bacteria 9636
379 Ga0157369_10059027 3300013105 Bacteria 4138
380 Ga0157369_10146686 3300013105 Bacteria 2495
381 Ga0157369_10261787 3300013105 Bacteria 1804
382 Ga0157369_10391297 3300013105 Bacteria 1442
383 Ga0157369_11684232 3300013105 Bacteria 644
384 Ga0157369_12673543 3300013105 Unclassified 503
385 Ga0157374_10029857 3300013296 Bacteria 4945
386 Ga0157374_10151117 3300013296 Bacteria 2258
387 Ga0157374_10452386 3300013296 Bacteria 1286
388 Ga0157378_10001977 3300013297 Bacteria 18333
389 Ga0157378_10295979 3300013297 Bacteria 1565
390 Ga0163162_10013433 3300013306 Bacteria 7993
391 Ga0163162_10046045 3300013306 Bacteria 4372
392 Ga0163162_10264258 3300013306 Bacteria 1852
393 Ga0163162_10651938 3300013306 Unclassified 1176
394 Ga0163162_10960173 3300013306 Unclassified 965
395 Ga0157372_10070897 3300013307 Bacteria 3922
396 Ga0157372_10081328 3300013307 Bacteria 3667
397 Ga0157372_10152605 3300013307 Bacteria 2667
398 Ga0157372_10265239 3300013307 Bacteria 1994
399 Ga0157375_10006981 3300013308 Bacteria 9863
400 Ga0157375_10075228 3300013308 Bacteria 3401
401 Ga0157375_10098321 3300013308 Bacteria 3003
402 Ga0157375_10232043 3300013308 Unclassified 2004
403 Ga0163163_10026163 3300014325 Bacteria 5573
404 Ga0163163_10500046 3300014325 Bacteria 1277
405 Ga0157380_10067716 3300014326 Plasmid 2876
406 Ga0157380_10070822 3300014326 Bacteria 2819
407 Ga0182008_10118950 3300014497 Bacteria 1312
408 Ga0157377_10053958 3300014745 Bacteria 2274
409 Ga0157379_10034679 3300014968 Bacteria 4500
410 Ga0157379_10054030 3300014968 Bacteria 3589
411 Ga0163161_10720808 3300017792 Bacteria 832
412 Ga0224712_10018528 3300022467 Bacteria 2329
413 Ga0207697_10000751 3300025315 Bacteria 18378
414 Ga0207656_10003025 3300025321 Bacteria 5751
415 Ga0207656_10007718 3300025321 Bacteria 3934
416 Ga0207656_10013094 3300025321 Bacteria 3163
417 Ga0207656_10030371 3300025321 Bacteria 2232
418 Ga0207656_10380321 3300025321 Unclassified 708
419 Ga0207682_10003496 3300025893 Bacteria 6810
420 Ga0207682_10098147 3300025893 Unclassified 1278
421 Ga0207688_10003129 3300025901 Bacteria 9035
422 Ga0207688_10011823 3300025901 Bacteria 4750
423 Ga0207688_10123940 3300025901 Bacteria 1510
424 Ga0207688_10236290 3300025901 Bacteria 1104
425 Ga0207680_10087320 3300025903 Bacteria 1974
426 Ga0207680_10089025 3300025903 Bacteria 1958
427 Ga0207680_10190700 3300025903 Bacteria 1391
428 Ga0207647_10000439 3300025904 Bacteria 34042
429 Ga0207647_10000446 3300025904 Bacteria 33539
430 Ga0207647_10026897 3300025904 Bacteria 3757
431 Ga0207647_10246991 3300025904 Bacteria 1024
432 Ga0207647_10273823 3300025904 Bacteria 964
433 Ga0207645_10002747 3300025907 Bacteria 13707
434 Ga0207645_10018707 3300025907 Bacteria 4549
435 Ga0207645_10019033 3300025907 Bacteria 4509
436 Ga0207645_10069759 3300025907 Bacteria 2248
437 Ga0207645_10321727 3300025907 Unclassified 1032
438 Ga0207643_10017186 3300025908 Bacteria 3951
439 Ga0207643_10081713 3300025908 Bacteria 1873
440 Ga0207705_10004596 3300025909 Bacteria 10419
441 Ga0207705_10038318 3300025909 Bacteria 3432
442 Ga0207705_10042629 3300025909 Bacteria 3258
443 Ga0207705_10071092 3300025909 Bacteria 2522
444 Ga0207705_10111594 3300025909 Bacteria 2021
445 Ga0207705_10119522 3300025909 Bacteria 1954
446 Ga0207684_10264557 3300025910 Bacteria 1484
447 Ga0207654_10215782 3300025911 Bacteria 1270
448 Ga0207654_10219261 3300025911 Bacteria 1261
449 Ga0207707_10141594 3300025912 Unclassified 2103
450 Ga0207695_10221443 3300025913 Unclassified 1799
451 Ga0207695_10286907 3300025913 Bacteria 1539
452 Ga0207660_10812034 3300025917 Bacteria 763
453 Ga0207662_10167404 3300025918 Bacteria 1408
454 Ga0207657_10002328 3300025919 Bacteria 20592
455 Ga0207657_10007110 3300025919 Bacteria 11497
456 Ga0207657_10014979 3300025919 Bacteria 7533
457 Ga0207657_10037709 3300025919 Bacteria 4312
458 Ga0207657_10040158 3300025919 Bacteria 4149
459 Ga0207657_10047906 3300025919 Bacteria 3733
460 Ga0207657_10050141 3300025919 Bacteria 3634
461 Ga0207657_10145350 3300025919 Bacteria 1935
462 Ga0207657_10218292 3300025919 Bacteria 1528
463 Ga0207657_10238570 3300025919 Bacteria 1452
464 Ga0207657_10267892 3300025919 Bacteria 1358
465 Ga0207657_10477087 3300025919 Bacteria 978
466 Ga0207649_10004861 3300025920 Bacteria 7267
467 Ga0207649_11369456 3300025920 Unclassified 560
468 Ga0207652_10076724 3300025921 Bacteria 2915
469 Ga0207652_10196500 3300025921 Unclassified 1815
470 Ga0207652_10488507 3300025921 Unclassified 1109
471 Ga0207681_10001284 3300025923 Bacteria 16212
472 Ga0207681_10007770 3300025923 Bacteria 6567
473 Ga0207681_10028732 3300025923 Bacteria 3605
474 Ga0207681_10039200 3300025923 Bacteria 3144
475 Ga0207681_10439902 3300025923 Unclassified 1059
476 Ga0207681_10474352 3300025923 Bacteria 1021
477 Ga0207694_11118144 3300025924 Bacteria 667
478 Ga0207650_10004951 3300025925 Bacteria 9102
479 Ga0207650_10018723 3300025925 Bacteria 4863
480 Ga0207650_10204572 3300025925 Unclassified 1583
481 Ga0207659_10028832 3300025926 Bacteria 3776
482 Ga0207659_10104748 3300025926 Bacteria 2139
483 Ga0207687_10025332 3300025927 Bacteria 3970
484 Ga0207687_10106282 3300025927 Bacteria 2075
485 Ga0207664_10143163 3300025929 Bacteria 2025
486 Ga0207644_10198958 3300025931 Bacteria 1580
487 Ga0207644_10326450 3300025931 Bacteria 1242
488 Ga0207690_10012741 3300025932 Bacteria 5039
489 Ga0207690_10014735 3300025932 Bacteria 4728
490 Ga0207690_10027796 3300025932 Bacteria 3578
491 Ga0207690_10032900 3300025932 Bacteria 3330
492 Ga0207690_10099441 3300025932 Bacteria 2074
493 Ga0207690_10129487 3300025932 Bacteria 1845
494 Ga0207690_10205050 3300025932 Bacteria 1500
495 Ga0207690_10317065 3300025932 Unclassified 1224
496 Ga0207690_10407053 3300025932 Bacteria 1086
497 Ga0207690_10622975 3300025932 Bacteria 882
498 Ga0207690_11168442 3300025932 Unclassified 642
499 Ga0207706_10000446 3300025933 Bacteria 44110
500 Ga0207706_10009416 3300025933 Bacteria 8966
501 Ga0207706_10013576 3300025933 Bacteria 7400
502 Ga0207706_10055491 3300025933 Bacteria 3493
503 Ga0207706_10062782 3300025933 Bacteria 3271
504 Ga0207706_10068347 3300025933 Bacteria 3126
505 Ga0207706_10079578 3300025933 Bacteria 2882
506 Ga0207706_10098659 3300025933 Bacteria 2570
507 Ga0207706_10185844 3300025933 Bacteria 1825
508 Ga0207706_10737392 3300025933 Unclassified 840
509 Ga0207709_10214557 3300025935 Bacteria 1384
510 Ga0207709_10348109 3300025935 Bacteria 1118
511 Ga0207669_10022197 3300025937 Bacteria 3367
512 Ga0207669_10249551 3300025937 Bacteria 1321
513 Ga0207669_10541031 3300025937 Unclassified 938
514 Ga0207704_10016682 3300025938 Bacteria 3782
515 Ga0207704_10133568 3300025938 Unclassified 1723
516 Ga0207704_10821357 3300025938 Bacteria 777
517 Ga0207691_10008977 3300025940 Bacteria 9589
518 Ga0207691_10021285 3300025940 Bacteria 6124
519 Ga0207691_10064947 3300025940 Bacteria 3305
520 Ga0207691_10117178 3300025940 Unclassified 2363
521 Ga0207691_10183214 3300025940 Bacteria 1829
522 Ga0207691_10512778 3300025940 Bacteria 1018
523 Ga0207711_10000218 3300025941 Bacteria 61467
524 Ga0207711_10035386 3300025941 Bacteria 4232
525 Ga0207711_10081823 3300025941 Bacteria 2822
526 Ga0207711_10178764 3300025941 Bacteria 1928
527 Ga0207711_10755981 3300025941 Bacteria 906
528 Ga0207689_10000064 3300025942 Bacteria 84222
529 Ga0207689_10008314 3300025942 Bacteria 9039
530 Ga0207689_10142528 3300025942 Bacteria 1974
531 Ga0207689_10752775 3300025942 Bacteria 822
532 Ga0207661_10051319 3300025944 Bacteria 3290
533 Ga0207661_10145090 3300025944 Bacteria 2047
534 Ga0207679_10007564 3300025945 Bacteria 6895
535 Ga0207679_10012810 3300025945 Bacteria 5481
536 Ga0207679_10033120 3300025945 Bacteria 3634
537 Ga0207679_10091597 3300025945 Bacteria 2353
538 Ga0207679_10099466 3300025945 Bacteria 2271
539 Ga0207679_11027062 3300025945 Bacteria 756
540 Ga0207679_11507049 3300025945 Unclassified 617
541 Ga0207667_10016908 3300025949 Bacteria 8229
542 Ga0207667_10027440 3300025949 Bacteria 6198
543 Ga0207667_10082526 3300025949 Bacteria 3329
544 Ga0207667_10386053 3300025949 Unclassified 1427
545 Ga0207667_10871696 3300025949 Bacteria 893
546 Ga0207667_10906072 3300025949 Bacteria 873
547 Ga0207651_10004881 3300025960 Bacteria 6836
548 Ga0207651_10190948 3300025960 Bacteria 1634
549 Ga0207651_10478877 3300025960 Bacteria 1072
550 Ga0207651_10494275 3300025960 Bacteria 1056
551 Ga0207651_10717469 3300025960 Unclassified 882
552 Ga0207651_10806962 3300025960 Bacteria 832
553 Ga0207651_10865043 3300025960 Bacteria 804
554 Ga0207651_11267245 3300025960 Unclassified 662
555 Ga0207712_10000474 3300025961 Bacteria 33783
556 Ga0207712_10030817 3300025961 Bacteria 3608
557 Ga0207712_10116724 3300025961 Bacteria 2012
558 Ga0207712_10828596 3300025961 Bacteria 814
559 Ga0207712_11537416 3300025961 Unclassified 596
560 Ga0207668_10000021 3300025972 Bacteria 137592
561 Ga0207668_10022745 3300025972 Bacteria 4018
562 Ga0207668_10112668 3300025972 Bacteria 2044
563 Ga0207668_10674807 3300025972 Bacteria 906
564 Ga0207668_10862919 3300025972 Bacteria 804
565 Ga0207668_10991685 3300025972 Unclassified 750
566 Ga0207668_11204573 3300025972 Bacteria 681
567 Ga0207640_10038139 3300025981 Bacteria 3030
568 Ga0207640_10098051 3300025981 Bacteria 2048
569 Ga0207640_10133097 3300025981 Bacteria 1800
570 Ga0207640_10415241 3300025981 Bacteria 1100
571 Ga0207640_11266644 3300025981 Unclassified 657
572 Ga0207640_11367073 3300025981 Bacteria 634
573 Ga0207658_10004594 3300025986 Bacteria 9582
574 Ga0207658_10024798 3300025986 Bacteria 4197
575 Ga0207658_10043342 3300025986 Bacteria 3270
576 Ga0207658_10087800 3300025986 Bacteria 2402
577 Ga0207658_10182969 3300025986 Bacteria 1736
578 Ga0207658_10917976 3300025986 Bacteria 797
579 Ga0207658_10929188 3300025986 Unclassified 792
580 Ga0207677_10084470 3300026023 Bacteria 2288
581 Ga0207677_10238822 3300026023 Bacteria 1468
582 Ga0207703_10002562 3300026035 Bacteria 15697
583 Ga0207703_10029829 3300026035 Bacteria 4306
584 Ga0207703_10063198 3300026035 Bacteria 3034
585 Ga0207703_10217056 3300026035 Bacteria 1708
586 Ga0207639_10031388 3300026041 Bacteria 3904
587 Ga0207639_10039603 3300026041 Bacteria 3512
588 Ga0207639_10057262 3300026041 Bacteria 2992
589 Ga0207639_10090089 3300026041 Bacteria 2452
590 Ga0207639_10378026 3300026041 Bacteria 1271
591 Ga0207639_11312508 3300026041 Unclassified 679
592 Ga0207678_10001094 3300026067 Bacteria 24866
593 Ga0207678_10004153 3300026067 Bacteria 13007
594 Ga0207678_10009167 3300026067 Bacteria 8708
595 Ga0207678_10020075 3300026067 Bacteria 5870
596 Ga0207678_10089099 3300026067 Bacteria 2637
597 Ga0207678_10147977 3300026067 Bacteria 2005
598 Ga0207678_10178969 3300026067 Bacteria 1811
599 Ga0207678_10188887 3300026067 Unclassified 1760
600 Ga0207678_10443063 3300026067 Bacteria 1128
601 Ga0207702_10012315 3300026078 Bacteria 7118
602 Ga0207702_10050713 3300026078 Bacteria 3504
603 Ga0207702_10088481 3300026078 Bacteria 2706
604 Ga0207702_10100776 3300026078 Bacteria 2549
605 Ga0207702_10176357 3300026078 Bacteria 1964
606 Ga0207702_10356188 3300026078 Bacteria 1401
607 Ga0207702_10445406 3300026078 Bacteria 1256
608 Ga0207702_11413116 3300026078 Bacteria 690
609 Ga0207641_10000248 3300026088 Bacteria 68877
610 Ga0207641_10023188 3300026088 Bacteria 5114
611 Ga0207641_10040068 3300026088 Bacteria 3919
612 Ga0207641_10088129 3300026088 Bacteria 2709
613 Ga0207641_10334108 3300026088 Bacteria 1440
614 Ga0207641_10514755 3300026088 Bacteria 1163
615 Ga0207648_10001456 3300026089 Bacteria 26049
616 Ga0207648_10035979 3300026089 Bacteria 4363
617 Ga0207648_10036060 3300026089 Bacteria 4357
618 Ga0207648_10158592 3300026089 Bacteria 1998
619 Ga0207648_10159270 3300026089 Bacteria 1994
620 Ga0207648_10504736 3300026089 Bacteria 1107
621 Ga0207676_10000761 3300026095 Bacteria 25222
622 Ga0207676_10001326 3300026095 Bacteria 18391
623 Ga0207676_10027785 3300026095 Bacteria 4218
624 Ga0207676_11186640 3300026095 Unclassified 756
625 Ga0207674_10000362 3300026116 Bacteria 58887
626 Ga0207674_10000814 3300026116 Bacteria 40536
627 Ga0207674_10012143 3300026116 Bacteria 9642
628 Ga0207674_10021233 3300026116 Bacteria 6999
629 Ga0207674_10051113 3300026116 Bacteria 4218
630 Ga0207674_10072025 3300026116 Bacteria 3472
631 Ga0207674_10163757 3300026116 Bacteria 2178
632 Ga0207674_10701935 3300026116 Unclassified 977
633 Ga0207674_10995421 3300026116 Bacteria 807
634 Ga0207675_100036116 3300026118 Bacteria 4608
635 Ga0207675_100289169 3300026118 Bacteria 1594
636 Ga0207675_100592572 3300026118 Unclassified 1111
637 Ga0207675_101941388 3300026118 Unclassified 607
638 Ga0207683_10509393 3300026121 Bacteria 1112
639 Ga0207698_10013270 3300026142 Bacteria 5428
640 Ga0207698_10025015 3300026142 Bacteria 4198
641 Ga0207698_10126650 3300026142 Bacteria 2173
642 Ga0207698_10217026 3300026142 Bacteria 1726
643 Ga0207698_10301129 3300026142 Unclassified 1492
644 Ga0207698_10468207 3300026142 Bacteria 1220
645 Ga0207698_10527207 3300026142 Bacteria 1154
646 Ga0207698_11049354 3300026142 Bacteria 827
647 Ga0210002_1034638 3300027617 Unclassified 847
648 Ga0209974_10078376 3300027876 Unclassified 1134
649 Ga0268266_10000318 3300028379 Bacteria 76400
650 Ga0268266_10005319 3300028379 Bacteria 12063
651 Ga0268266_10074969 3300028379 Bacteria 2938
652 Ga0268266_10575129 3300028379 Bacteria 1081
653 Ga0268266_10576564 3300028379 Bacteria 1079
654 Ga0268266_10653760 3300028379 Bacteria 1012
655 Ga0268266_11073145 3300028379 Unclassified 779
656 Ga0268265_10000789 3300028380 Bacteria 30232
657 Ga0268265_10005423 3300028380 Bacteria 8725
658 Ga0268265_10012555 3300028380 Bacteria 5742
659 Ga0268265_10029552 3300028380 Bacteria 3935
660 Ga0268265_10075356 3300028380 Unclassified 2642
661 Ga0268265_10108182 3300028380 Bacteria 2263
662 Ga0268265_10633172 3300028380 Bacteria 1026
663 Ga0268264_10006173 3300028381 Bacteria 10120
664 Ga0268264_10009557 3300028381 Bacteria 8031
665 Ga0268264_10054953 3300028381 Bacteria 3326
666 Ga0268264_10056108 3300028381 Bacteria 3292
667 Ga0268264_10119281 3300028381 Bacteria 2323
668 Ga0268264_10148268 3300028381 Bacteria 2100
669 Ga0268264_10235741 3300028381 Bacteria 1692
670 Ga0268264_10413512 3300028381 Unclassified 1299
671 Ga0307408_100362057 3300031548 Bacteria 1234
672 Ga0307408_100481660 3300031548 Bacteria 1082
673 Ga0307405_10097727 3300031731 Bacteria 1961
674 Ga0307405_10515380 3300031731 Bacteria 961
675 Ga0307405_10639763 3300031731 Unclassified 873
676 Ga0307413_10003613 3300031824 Bacteria 6554
677 Ga0307413_10008481 3300031824 Bacteria 4856
678 Ga0307413_10459055 3300031824 Bacteria 1013
679 Ga0307413_11104634 3300031824 Bacteria 685
680 Ga0307413_11504801 3300031824 Bacteria 595
681 Ga0307410_10005467 3300031852 Bacteria 6730
682 Ga0307410_10020790 3300031852 Bacteria 4024
683 Ga0307410_10027755 3300031852 Bacteria 3580
684 Ga0307410_10069338 3300031852 Bacteria 2439
685 Ga0307410_10091089 3300031852 Bacteria 2164
686 Ga0307410_10146858 3300031852 Unclassified 1751
687 Ga0307410_10449277 3300031852 Bacteria 1051
688 Ga0307406_10043203 3300031901 Bacteria 2818
689 Ga0307406_10194396 3300031901 Bacteria 1488
690 Ga0307406_10333790 3300031901 Unclassified 1178
691 Ga0307406_10879618 3300031901 Unclassified 761
692 Ga0307407_10021132 3300031903 Bacteria 3350
693 Ga0307407_10394157 3300031903 Bacteria 992
694 Ga0307412_10006903 3300031911 Bacteria 6441
695 Ga0307412_10171451 3300031911 Bacteria 1623
696 Ga0307409_100004073 3300031995 Bacteria 8125
697 Ga0307409_100026423 3300031995 Bacteria 4094
698 Ga0307409_100030409 3300031995 Bacteria 3879
699 Ga0307409_100177191 3300031995 Bacteria 1883
700 Ga0307409_100408843 3300031995 Bacteria 1298
701 Ga0307409_100471649 3300031995 Bacteria 1216
702 Ga0307416_100554195 3300032002 Bacteria 1223
703 Ga0307416_102519721 3300032002 Unclassified 613
704 Ga0307414_10006161 3300032004 Bacteria 6665
705 Ga0307414_10072352 3300032004 Bacteria 2490
706 Ga0307414_10079778 3300032004 Unclassified 2391
707 Ga0307414_10085292 3300032004 Bacteria 2326
708 Ga0307414_10207051 3300032004 Bacteria 1600
709 Ga0307414_10435337 3300032004 Bacteria 1147
710 Ga0307414_10830701 3300032004 Bacteria 844
711 Ga0307411_10000435 3300032005 Bacteria 14250
712 Ga0307411_10000684 3300032005 Bacteria 12469
713 Ga0307411_10966778 3300032005 Unclassified 760
714 Ga0307415_100033282 3300032126 Bacteria 3345
715 Ga0307415_100050442 3300032126 Bacteria 2820
716 Ga0307415_100140050 3300032126 Bacteria 1846
717 Ga0307415_100219141 3300032126 Bacteria 1524
718 Ga0373929_0161293 3300035085 Unclassified 608
719 Ga0395899_0032217 3300037312 Bacteria 3938
720 Ga0395899_0171598 3300037312 Bacteria 1527
721 Ga0395899_0202925 3300037312 Unclassified 1381
722 Ga0395899_0625501 3300037312 Unclassified 683
723 Ga0395900_0003019 3300037418 Bacteria 18309
724 Ga0395900_0012506 3300037418 Bacteria 8681
725 Ga0395900_0071242 3300037418 Bacteria 3573
726 Ga0395900_0091532 3300037418 Bacteria 3125
727 Ga0395900_0107472 3300037418 Bacteria 2866
728 Ga0395900_0177611 3300037418 Bacteria 2165
729 Ga0395900_0178988 3300037418 Bacteria 2156
730 Ga0395900_0251375 3300037418 Bacteria 1769
731 Ga0395900_0271284 3300037418 Bacteria 1691
732 Ga0395900_0351870 3300037418 Bacteria 1446
733 Ga0395900_0435951 3300037418 Unclassified 1269
734 Ga0395900_0506972 3300037418 Bacteria 1156
735 Ga0395900_0645259 3300037418 Bacteria 996
736 Ga0395900_0652541 3300037418 Unclassified 989
737 Ga0395898_0025517 3300037466 Bacteria 5955
738 Ga0395898_0036672 3300037466 Bacteria 4868
739 Ga0395898_0088025 3300037466 Bacteria 2990
740 Ga0395898_0099990 3300037466 Bacteria 2785
741 Ga0395898_0301935 3300037466 Bacteria 1527
742 Ga0395898_0780755 3300037466 Unclassified 896
743 Ga0395905_0004032 3300037471 Bacteria 15414
744 Ga0395905_0010096 3300037471 Bacteria 9204
745 Ga0395905_0012671 3300037471 Bacteria 8112
746 Ga0395905_0015825 3300037471 Bacteria 7164
747 Ga0395905_0024841 3300037471 Bacteria 5654
748 Ga0395905_0033171 3300037471 Bacteria 4851
749 Ga0395905_0054313 3300037471 Bacteria 3749
750 Ga0395905_0070855 3300037471 Bacteria 3267
751 Ga0395905_0075399 3300037471 Bacteria 3161
752 Ga0395905_0106578 3300037471 Bacteria 2631
753 Ga0395905_0118792 3300037471 Bacteria 2485
754 Ga0395905_0132012 3300037471 Unclassified 2349
755 Ga0395905_0172929 3300037471 Bacteria 2029
756 Ga0395905_0218162 3300037471 Bacteria 1786
757 Ga0395905_0403154 3300037471 Unclassified 1263
758 Ga0395905_0763791 3300037471 Unclassified 869
759 Ga0395905_0922445 3300037471 Bacteria 776
760 Ga0395901_0002158 3300038443 Bacteria 20096
761 Ga0395901_0062289 3300038443 Bacteria 3882
762 Ga0395901_0072179 3300038443 Bacteria 3598
763 Ga0395901_0083176 3300038443 Bacteria 3346
764 Ga0395901_0122941 3300038443 Bacteria 2727
765 Ga0395901_0209922 3300038443 Bacteria 2038
766 Ga0395901_0256130 3300038443 Bacteria 1822
767 Ga0395901_0451913 3300038443 Bacteria 1314
768 Ga0395901_0489436 3300038443 Bacteria 1253
769 Ga0439432_168881 3300042006 Unclassified 639
770 Ga0450917_001012 3300042120 Bacteria 2076
771 Ga0450907_016387 3300042146 Unclassified 1237
772 Ga0466969_0065588 3300044656 Bacteria 1755
773 Ga0466969_0199970 3300044656 Unclassified 912
774 Ga0466965_0422674 3300044683 Bacteria 739
775 Ga0466966_0015374 3300044684 Bacteria 5060
776 Ga0466966_0052755 3300044684 Bacteria 2581
777 Ga0466961_0049492 3300044693 Bacteria 2686
778 Ga0466961_0091612 3300044693 Bacteria 1919
779 Ga0466961_0373545 3300044693 Unclassified 866
780 Ga0466963_0015218 3300044694 Bacteria 4759
781 Ga0466971_0004306 3300044719 Bacteria 6135
782 Ga0466970_0005939 3300044765 Bacteria 6087
783 Ga0466957_0036103 3300044842 Bacteria 2969
784 Ga0466957_0055180 3300044842 Bacteria 2428
785 Ga0466957_0577874 3300044842 Unclassified 785
786 Ga0466960_0621058 3300044901 Unclassified 643
787 Ga0466959_0035229 3300045049 Bacteria 3703
788 Ga0466959_0061069 3300045049 Bacteria 2741
789 Ga0466959_0340378 3300045049 Unclassified 1023
790 Ga0466958_0094126 3300045836 Bacteria 1856
791 Ga0466958_0258447 3300045836 Bacteria 1114
792 Ga0466967_0015201 3300045976 Bacteria 6028
793 Ga0466967_0023305 3300045976 Bacteria 5070
794 Ga0495643_0204862 3300046522 Unclassified 945
795 Ga0495663_0123981 3300046525 Bacteria 867
796 Ga0495668_0869974 3300046616 Bacteria 500
797 Ga0495659_0153185 3300046664 Bacteria 927
798 Ga0495669_0349263 3300046684 Unclassified 715
799 Ga0495672_0090704 3300047320 Bacteria 1679
800 Ga0496101_1405484 3300048904 Bacteria 544
801 Ga0496102_0934407 3300048905 Bacteria 789
802 Ga0496102_1468310 3300048905 Bacteria 601
803 Ga0496103_0294848 3300048906 Bacteria 1043
804 Ga0496106_0240757 3300048909 Bacteria 1446
805 Ga0496107_0142038 3300048910 Bacteria 1775
806 Ga0496107_0919242 3300048910 Unclassified 637
807 Ga0496109_0134445 3300048912 Bacteria 2310
808 Ga0496109_0217689 3300048912 Bacteria 1796
809 Ga0496109_0346128 3300048912 Bacteria 1404
810 Ga0496110_0992202 3300048913 Unclassified 747
811 Ga0496112_0681231 3300048915 Bacteria 957
812 Ga0496113_0217082 3300048916 Bacteria 1524
813 Ga0501041_0959017 3300049577 Unclassified 550
814 Ga0501067_0026714 3300049583 Bacteria 3197
815 Ga0501068_0190733 3300049584 Unclassified 1298
816 Ga0501216_096652 3300049660 Unclassified 646
817 nmdc:mga03683_42402_c1 3300050489 Bacteria 1872
818 nmdc:mga05p37_1107438_c1 3300050507 Bacteria 828
819 nmdc:mga09592_282551_c1 3300050508 Bacteria 1439
820 nmdc:mga0n895_1157217_c1 3300050512 Unclassified 749
821 nmdc:mga0a205_248_c1 3300050515 Bacteria 38486
822 Ga0466962_0018606 3300061719 Bacteria 3341
823 Ga0466962_0106472 3300061719 Bacteria 1348
824 Ga0530510_1372939 3300061734 Unclassified 542

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_1372939 Ga0530510_1372939_181_522 108
2 3300026089 Ga0207648_10504736 Ga0207648_105047362 115
3 3300025945 Ga0207679_11027062 Ga0207679_110270621 117
4 3300046664 Ga0495659_0153185 Ga0495659_0153185_549_917 117
5 3300005328 Ga0070676_10075467 Ga0070676_100754672 128
6 3300005333 Ga0070677_10226910 Ga0070677_102269102 128
7 3300005334 Ga0068869_101180378 Ga0068869_1011803781 128
8 3300005364 Ga0070673_100295256 Ga0070673_1002952562 128
9 3300005366 Ga0070659_100415178 Ga0070659_1004151782 128
10 3300005457 Ga0070662_100046756 Ga0070662_1000467562 128
11 3300005459 Ga0068867_100697801 Ga0068867_1006978012 128
12 3300005578 Ga0068854_100015999 Ga0068854_1000159996 128
13 3300005719 Ga0068861_100484201 Ga0068861_1004842012 128
14 3300009148 Ga0105243_10676307 Ga0105243_106763072 128
15 3300014326 Ga0157380_10067716 Ga0157380_100677164 128
16 3300025901 Ga0207688_10123940 Ga0207688_101239402 128
17 3300025907 Ga0207645_10069759 Ga0207645_100697592 128
18 3300025932 Ga0207690_10099441 Ga0207690_100994413 128
19 3300025933 Ga0207706_10062782 Ga0207706_100627824 128
20 3300025960 Ga0207651_10865043 Ga0207651_108650432 128
21 3300025981 Ga0207640_10133097 Ga0207640_101330972 128
22 3300026089 Ga0207648_10159270 Ga0207648_101592703 128
23 3300037471 Ga0395905_0033171 Ga0395905_0033171_2247_2735 128
24 3300038443 Ga0395901_0072179 Ga0395901_0072179_556_1044 128
25 3300027617 Ga0210002_1034638 Ga0210002_10346382 130
26 3300027876 Ga0209974_10078376 Ga0209974_100783762 130
27 3300037418 Ga0395900_0435951 Ga0395900_0435951_734_1144 130
28 3300005329 Ga0070683_100122723 Ga0070683_1001227233 133
29 3300005344 Ga0070661_100103784 Ga0070661_1001037843 133
30 3300005366 Ga0070659_100370126 Ga0070659_1003701261 133
31 3300005617 Ga0068859_102035184 Ga0068859_1020351842 133
32 3300006931 Ga0097620_102034893 Ga0097620_1020348932 133
33 3300025908 Ga0207643_10081713 Ga0207643_100817131 133
34 3300025932 Ga0207690_11168442 Ga0207690_111684422 133
35 3300037418 Ga0395900_0091532 Ga0395900_0091532_199_723 133
36 3300037466 Ga0395898_0301935 Ga0395898_0301935_992_1516 133
37 3300037471 Ga0395905_0015825 Ga0395905_0015825_2228_2665 133
38 3300037471 Ga0395905_0024841 Ga0395905_0024841_1246_1770 133
39 3300037471 Ga0395905_0218162 Ga0395905_0218162_1029_1445 133
40 3300038443 Ga0395901_0062289 Ga0395901_0062289_2889_3326 133
41 3300038443 Ga0395901_0256130 Ga0395901_0256130_802_1326 133
42 3300005435 Ga0070714_100070117 Ga0070714_1000701171 134
43 3300005614 Ga0068856_100275782 Ga0068856_1002757823 134
44 3300005844 Ga0068862_100004541 Ga0068862_1000045414 134
45 3300006844 Ga0075428_100625075 Ga0075428_1006250752 134
46 3300006880 Ga0075429_101932462 Ga0075429_1019324621 134
47 3300006931 Ga0097620_102363650 Ga0097620_1023636501 134
48 3300009177 Ga0105248_10434350 Ga0105248_104343501 134
49 3300013100 Ga0157373_10081989 Ga0157373_100819892 134
50 3300013105 Ga0157369_12673543 Ga0157369_126735431 134
51 3300013296 Ga0157374_10029857 Ga0157374_100298572 134
52 3300025941 Ga0207711_10755981 Ga0207711_107559812 134
53 3300026078 Ga0207702_10088481 Ga0207702_100884813 134
54 3300028380 Ga0268265_10005423 Ga0268265_100054237 134
55 3300031824 Ga0307413_11104634 Ga0307413_111046342 134
56 3300031852 Ga0307410_10146858 Ga0307410_101468583 134
57 3300031852 Ga0307410_10449277 Ga0307410_104492772 134
58 3300031995 Ga0307409_100471649 Ga0307409_1004716492 134
59 3300032126 Ga0307415_100140050 Ga0307415_1001400503 134
60 3300044656 Ga0466969_0065588 Ga0466969_0065588_896_1312 134
61 3300044683 Ga0466965_0422674 Ga0466965_0422674_247_663 134
62 3300044684 Ga0466966_0052755 Ga0466966_0052755_737_1153 134
63 3300044693 Ga0466961_0091612 Ga0466961_0091612_254_670 134
64 3300044694 Ga0466963_0015218 Ga0466963_0015218_1983_2399 134
65 3300044719 Ga0466971_0004306 Ga0466971_0004306_2253_2669 134
66 3300044765 Ga0466970_0005939 Ga0466970_0005939_2134_2550 134
67 3300044842 Ga0466957_0036103 Ga0466957_0036103_223_639 134
68 3300045049 Ga0466959_0035229 Ga0466959_0035229_253_669 134
69 3300045836 Ga0466958_0258447 Ga0466958_0258447_66_482 134
70 3300050507 nmdc:mga05p37_1107438_c1 nmdc:mga05p37_1107438_c1_250_669 134
71 3300061719 Ga0466962_0018606 Ga0466962_0018606_1567_1983 134
72 2162886011 MRS1b_contig_816425 MRS1b_0189.00002570 135
73 2162886012 MBSR1b_contig_6582152 MBSR1b_0030.00007150 135
74 3300000531 CNBas_1009180 CNBas_10091801 135
75 3300001904 JGI24736J21556_1047311 JGI24736J21556_10473111 135
76 3300001979 JGI24740J21852_10007956 JGI24740J21852_100079566 135
77 3300001989 JGI24739J22299_10001510 JGI24739J22299_100015107 135
78 3300001989 JGI24739J22299_10033107 JGI24739J22299_100331072 135
79 3300001990 JGI24737J22298_10000293 JGI24737J22298_1000029317 135
80 3300001990 JGI24737J22298_10001879 JGI24737J22298_1000187911 135
81 3300001990 JGI24737J22298_10015945 JGI24737J22298_100159453 135
82 3300001990 JGI24737J22298_10139634 JGI24737J22298_101396342 135
83 3300002067 JGI24735J21928_10171374 JGI24735J21928_101713742 135
84 3300002075 JGI24738J21930_10000671 JGI24738J21930_1000067111 135
85 3300003320 rootH2_10273668 rootH2_102736682 135
86 3300005290 Ga0065712_10223242 Ga0065712_102232422 135
87 3300005293 Ga0065715_10130129 Ga0065715_101301293 135
88 3300005293 Ga0065715_10303161 Ga0065715_103031612 135
89 3300005293 Ga0065715_10625605 Ga0065715_106256052 135
90 3300005327 Ga0070658_10092523 Ga0070658_100925233 135
91 3300005327 Ga0070658_10187097 Ga0070658_101870973 135
92 3300005327 Ga0070658_10371799 Ga0070658_103717992 135
93 3300005328 Ga0070676_10001496 Ga0070676_100014963 135
94 3300005328 Ga0070676_10011918 Ga0070676_100119184 135
95 3300005328 Ga0070676_10703819 Ga0070676_107038191 135
96 3300005328 Ga0070676_11484340 Ga0070676_114843401 135
97 3300005331 Ga0070670_100067267 Ga0070670_1000672673 135
98 3300005331 Ga0070670_100146444 Ga0070670_1001464442 135
99 3300005331 Ga0070670_100165214 Ga0070670_1001652142 135
100 3300005331 Ga0070670_100518913 Ga0070670_1005189132 135
101 3300005331 Ga0070670_101072826 Ga0070670_1010728262 135
102 3300005333 Ga0070677_10089575 Ga0070677_100895752 135
103 3300005334 Ga0068869_100000094 Ga0068869_10000009432 135
104 3300005334 Ga0068869_100038011 Ga0068869_1000380112 135
105 3300005334 Ga0068869_100051534 Ga0068869_1000515344 135
106 3300005334 Ga0068869_100129425 Ga0068869_1001294251 135
107 3300005334 Ga0068869_100176989 Ga0068869_1001769893 135
108 3300005335 Ga0070666_10042190 Ga0070666_100421902 135
109 3300005335 Ga0070666_10118000 Ga0070666_101180002 135
110 3300005335 Ga0070666_10207699 Ga0070666_102076992 135
111 3300005337 Ga0070682_100098294 Ga0070682_1000982943 135
112 3300005338 Ga0068868_100001948 Ga0068868_10000194816 135
113 3300005338 Ga0068868_100072159 Ga0068868_1000721593 135
114 3300005339 Ga0070660_100004239 Ga0070660_1000042399 135
115 3300005339 Ga0070660_100022428 Ga0070660_1000224283 135
116 3300005339 Ga0070660_100056503 Ga0070660_1000565031 135
117 3300005339 Ga0070660_100603999 Ga0070660_1006039992 135
118 3300005340 Ga0070689_100289735 Ga0070689_1002897352 135
119 3300005343 Ga0070687_100689678 Ga0070687_1006896782 135
120 3300005344 Ga0070661_100003747 Ga0070661_1000037475 135
121 3300005344 Ga0070661_100014559 Ga0070661_1000145593 135
122 3300005344 Ga0070661_100459923 Ga0070661_1004599232 135
123 3300005344 Ga0070661_101025563 Ga0070661_1010255632 135
124 3300005345 Ga0070692_10024487 Ga0070692_100244873 135
125 3300005347 Ga0070668_100000311 Ga0070668_1000003114 135
126 3300005347 Ga0070668_100014598 Ga0070668_1000145983 135
127 3300005347 Ga0070668_100056574 Ga0070668_1000565742 135
128 3300005347 Ga0070668_100228957 Ga0070668_1002289574 135
129 3300005347 Ga0070668_100468558 Ga0070668_1004685582 135
130 3300005347 Ga0070668_100659750 Ga0070668_1006597501 135
131 3300005347 Ga0070668_101321078 Ga0070668_1013210782 135
132 3300005353 Ga0070669_100000155 Ga0070669_1000001558 135
133 3300005353 Ga0070669_100069766 Ga0070669_1000697663 135
134 3300005353 Ga0070669_100214262 Ga0070669_1002142623 135
135 3300005353 Ga0070669_100626945 Ga0070669_1006269452 135
136 3300005354 Ga0070675_100031778 Ga0070675_1000317782 135
137 3300005354 Ga0070675_100091624 Ga0070675_1000916242 135
138 3300005354 Ga0070675_100343655 Ga0070675_1003436553 135
139 3300005355 Ga0070671_100149229 Ga0070671_1001492292 135
140 3300005355 Ga0070671_100250091 Ga0070671_1002500913 135
141 3300005355 Ga0070671_101088384 Ga0070671_1010883842 135
142 3300005356 Ga0070674_100049256 Ga0070674_1000492562 135
143 3300005356 Ga0070674_101309058 Ga0070674_1013090581 135
144 3300005364 Ga0070673_100019549 Ga0070673_1000195493 135
145 3300005364 Ga0070673_100075382 Ga0070673_1000753823 135
146 3300005364 Ga0070673_100097307 Ga0070673_1000973073 135
147 3300005364 Ga0070673_100420219 Ga0070673_1004202192 135
148 3300005364 Ga0070673_101163073 Ga0070673_1011630731 135
149 3300005365 Ga0070688_100174444 Ga0070688_1001744442 135
150 3300005366 Ga0070659_100000305 Ga0070659_10000030537 135
151 3300005366 Ga0070659_100021439 Ga0070659_1000214394 135
152 3300005366 Ga0070659_100022758 Ga0070659_1000227583 135
153 3300005366 Ga0070659_100220033 Ga0070659_1002200332 135
154 3300005366 Ga0070659_100533830 Ga0070659_1005338302 135
155 3300005366 Ga0070659_102034089 Ga0070659_1020340891 135
156 3300005367 Ga0070667_100022892 Ga0070667_1000228926 135
157 3300005367 Ga0070667_100029038 Ga0070667_1000290385 135
158 3300005367 Ga0070667_100030696 Ga0070667_1000306966 135
159 3300005367 Ga0070667_100043068 Ga0070667_1000430683 135
160 3300005367 Ga0070667_100070149 Ga0070667_1000701493 135
161 3300005367 Ga0070667_100382451 Ga0070667_1003824511 135
162 3300005367 Ga0070667_100694772 Ga0070667_1006947722 135
163 3300005444 Ga0070694_100205024 Ga0070694_1002050242 135
164 3300005444 Ga0070694_100371702 Ga0070694_1003717021 135
165 3300005455 Ga0070663_100007015 Ga0070663_1000070156 135
166 3300005455 Ga0070663_100023038 Ga0070663_1000230381 135
167 3300005455 Ga0070663_100067584 Ga0070663_1000675843 135
168 3300005455 Ga0070663_100068550 Ga0070663_1000685503 135
169 3300005455 Ga0070663_100189068 Ga0070663_1001890682 135
170 3300005455 Ga0070663_100262966 Ga0070663_1002629662 135
171 3300005456 Ga0070678_100072630 Ga0070678_1000726302 135
172 3300005456 Ga0070678_101409446 Ga0070678_1014094461 135
173 3300005457 Ga0070662_100006089 Ga0070662_1000060897 135
174 3300005457 Ga0070662_100017060 Ga0070662_1000170605 135
175 3300005457 Ga0070662_100020874 Ga0070662_1000208743 135
176 3300005457 Ga0070662_100219559 Ga0070662_1002195592 135
177 3300005457 Ga0070662_100282597 Ga0070662_1002825972 135
178 3300005457 Ga0070662_100478933 Ga0070662_1004789332 135
179 3300005457 Ga0070662_100657234 Ga0070662_1006572342 135
180 3300005457 Ga0070662_100736264 Ga0070662_1007362642 135
181 3300005457 Ga0070662_101174267 Ga0070662_1011742672 135
182 3300005457 Ga0070662_101769701 Ga0070662_1017697011 135
183 3300005458 Ga0070681_10044764 Ga0070681_100447644 135
184 3300005459 Ga0068867_100008791 Ga0068867_1000087916 135
185 3300005459 Ga0068867_100039753 Ga0068867_1000397532 135
186 3300005459 Ga0068867_100092554 Ga0068867_1000925543 135
187 3300005459 Ga0068867_100669214 Ga0068867_1006692142 135
188 3300005466 Ga0070685_10061622 Ga0070685_100616222 135
189 3300005467 Ga0070706_100327274 Ga0070706_1003272742 135
190 3300005530 Ga0070679_100124128 Ga0070679_1001241282 135
191 3300005535 Ga0070684_100185799 Ga0070684_1001857993 135
192 3300005535 Ga0070684_100642215 Ga0070684_1006422151 135
193 3300005539 Ga0068853_100014045 Ga0068853_1000140458 135
194 3300005539 Ga0068853_100079638 Ga0068853_1000796383 135
195 3300005539 Ga0068853_100140799 Ga0068853_1001407993 135
196 3300005539 Ga0068853_100369814 Ga0068853_1003698142 135
197 3300005539 Ga0068853_100472984 Ga0068853_1004729842 135
198 3300005543 Ga0070672_100000797 Ga0070672_10000079721 135
199 3300005543 Ga0070672_100014427 Ga0070672_1000144275 135
200 3300005543 Ga0070672_100040507 Ga0070672_1000405073 135
201 3300005543 Ga0070672_100674817 Ga0070672_1006748172 135
202 3300005544 Ga0070686_100523873 Ga0070686_1005238732 135
203 3300005545 Ga0070695_100792069 Ga0070695_1007920691 135
204 3300005545 Ga0070695_100880612 Ga0070695_1008806122 135
205 3300005546 Ga0070696_100215828 Ga0070696_1002158282 135
206 3300005547 Ga0070693_100058644 Ga0070693_1000586442 135
207 3300005547 Ga0070693_100114799 Ga0070693_1001147992 135
208 3300005547 Ga0070693_100189091 Ga0070693_1001890912 135
209 3300005547 Ga0070693_100746562 Ga0070693_1007465621 135
210 3300005548 Ga0070665_100000995 Ga0070665_1000009959 135
211 3300005548 Ga0070665_100018705 Ga0070665_10001870510 135
212 3300005548 Ga0070665_100093331 Ga0070665_1000933314 135
213 3300005548 Ga0070665_100147062 Ga0070665_1001470623 135
214 3300005548 Ga0070665_100266582 Ga0070665_1002665822 135
215 3300005548 Ga0070665_100434400 Ga0070665_1004344002 135
216 3300005548 Ga0070665_100508781 Ga0070665_1005087812 135
217 3300005563 Ga0068855_100006968 Ga0068855_1000069684 135
218 3300005563 Ga0068855_100029523 Ga0068855_1000295236 135
219 3300005563 Ga0068855_100917273 Ga0068855_1009172732 135
220 3300005563 Ga0068855_101023067 Ga0068855_1010230672 135
221 3300005564 Ga0070664_100014224 Ga0070664_1000142242 135
222 3300005564 Ga0070664_100015483 Ga0070664_1000154836 135
223 3300005564 Ga0070664_100017113 Ga0070664_1000171136 135
224 3300005564 Ga0070664_100037089 Ga0070664_1000370893 135
225 3300005577 Ga0068857_100007925 Ga0068857_10000792513 135
226 3300005577 Ga0068857_100011070 Ga0068857_1000110704 135
227 3300005577 Ga0068857_100013097 Ga0068857_10001309711 135
228 3300005577 Ga0068857_100073362 Ga0068857_1000733623 135
229 3300005577 Ga0068857_100687339 Ga0068857_1006873392 135
230 3300005578 Ga0068854_100021442 Ga0068854_1000214423 135
231 3300005578 Ga0068854_100024641 Ga0068854_1000246414 135
232 3300005578 Ga0068854_100031846 Ga0068854_1000318464 135
233 3300005578 Ga0068854_100098367 Ga0068854_1000983672 135
234 3300005578 Ga0068854_100139016 Ga0068854_1001390163 135
235 3300005578 Ga0068854_100333935 Ga0068854_1003339353 135
236 3300005578 Ga0068854_100562479 Ga0068854_1005624792 135
237 3300005578 Ga0068854_101611710 Ga0068854_1016117102 135
238 3300005614 Ga0068856_101592948 Ga0068856_1015929481 135
239 3300005616 Ga0068852_100021745 Ga0068852_1000217454 135
240 3300005616 Ga0068852_100056352 Ga0068852_1000563524 135
241 3300005616 Ga0068852_100061331 Ga0068852_1000613312 135
242 3300005616 Ga0068852_100086277 Ga0068852_1000862772 135
243 3300005616 Ga0068852_100170088 Ga0068852_1001700882 135
244 3300005616 Ga0068852_100369894 Ga0068852_1003698942 135
245 3300005616 Ga0068852_100432382 Ga0068852_1004323822 135
246 3300005617 Ga0068859_100013299 Ga0068859_1000132993 135
247 3300005617 Ga0068859_100032867 Ga0068859_1000328675 135
248 3300005617 Ga0068859_100105910 Ga0068859_1001059103 135
249 3300005617 Ga0068859_100379146 Ga0068859_1003791463 135
250 3300005617 Ga0068859_100913047 Ga0068859_1009130472 135
251 3300005618 Ga0068864_100000328 Ga0068864_10000032847 135
252 3300005618 Ga0068864_100020388 Ga0068864_1000203885 135
253 3300005618 Ga0068864_101910336 Ga0068864_1019103362 135
254 3300005718 Ga0068866_10036527 Ga0068866_100365273 135
255 3300005718 Ga0068866_10251874 Ga0068866_102518743 135
256 3300005719 Ga0068861_100022847 Ga0068861_1000228476 135
257 3300005834 Ga0068851_10001318 Ga0068851_1000131814 135
258 3300005834 Ga0068851_10010278 Ga0068851_100102783 135
259 3300005834 Ga0068851_10022059 Ga0068851_100220593 135
260 3300005840 Ga0068870_10882229 Ga0068870_108822292 135
261 3300005840 Ga0068870_10937890 Ga0068870_109378902 135
262 3300005841 Ga0068863_100000634 Ga0068863_1000006344 135
263 3300005841 Ga0068863_100172606 Ga0068863_1001726063 135
264 3300005841 Ga0068863_100488539 Ga0068863_1004885392 135
265 3300005842 Ga0068858_100004807 Ga0068858_10000480716 135
266 3300005842 Ga0068858_100009244 Ga0068858_1000092447 135
267 3300005842 Ga0068858_100014386 Ga0068858_1000143863 135
268 3300005843 Ga0068860_100006212 Ga0068860_1000062122 135
269 3300005843 Ga0068860_100009697 Ga0068860_1000096976 135
270 3300005843 Ga0068860_100021934 Ga0068860_1000219344 135
271 3300005843 Ga0068860_100072263 Ga0068860_1000722633 135
272 3300005843 Ga0068860_100089367 Ga0068860_1000893675 135
273 3300005843 Ga0068860_100258611 Ga0068860_1002586113 135
274 3300005843 Ga0068860_100607621 Ga0068860_1006076211 135
275 3300005843 Ga0068860_100734478 Ga0068860_1007344782 135
276 3300005844 Ga0068862_100005881 Ga0068862_1000058812 135
277 3300005844 Ga0068862_100007340 Ga0068862_1000073404 135
278 3300005844 Ga0068862_100035359 Ga0068862_1000353597 135
279 3300005844 Ga0068862_100097434 Ga0068862_1000974343 135
280 3300005844 Ga0068862_100166394 Ga0068862_1001663943 135
281 3300005844 Ga0068862_100510985 Ga0068862_1005109852 135
282 3300005844 Ga0068862_100572507 Ga0068862_1005725072 135
283 3300005844 Ga0068862_100850991 Ga0068862_1008509912 135
284 3300006051 Ga0075364_10425388 Ga0075364_104253882 135
285 3300006177 Ga0075362_10047063 Ga0075362_100470632 135
286 3300006195 Ga0075366_10326305 Ga0075366_103263052 135
287 3300006358 Ga0068871_100022855 Ga0068871_1000228554 135
288 3300006358 Ga0068871_100039675 Ga0068871_1000396754 135
289 3300006871 Ga0075434_100101616 Ga0075434_1001016162 135
290 3300006881 Ga0068865_100012978 Ga0068865_1000129784 135
291 3300006881 Ga0068865_100122966 Ga0068865_1001229662 135
292 3300006931 Ga0097620_100013298 Ga0097620_1000132983 135
293 3300006931 Ga0097620_100032867 Ga0097620_1000328674 135
294 3300006931 Ga0097620_100105916 Ga0097620_1001059163 135
295 3300006931 Ga0097620_100379165 Ga0097620_1003791653 135
296 3300006931 Ga0097620_100913064 Ga0097620_1009130642 135
297 3300007076 Ga0075435_100131542 Ga0075435_1001315423 135
298 3300009093 Ga0105240_10086764 Ga0105240_100867643 135
299 3300009093 Ga0105240_10109890 Ga0105240_101098904 135
300 3300009098 Ga0105245_10000352 Ga0105245_100003526 135
301 3300009098 Ga0105245_10118397 Ga0105245_101183973 135
302 3300009147 Ga0114129_10892755 Ga0114129_108927552 135
303 3300009148 Ga0105243_10027980 Ga0105243_100279803 135
304 3300009148 Ga0105243_10499645 Ga0105243_104996454 135
305 3300009174 Ga0105241_10041940 Ga0105241_100419403 135
306 3300009174 Ga0105241_10262565 Ga0105241_102625653 135
307 3300009174 Ga0105241_12022105 Ga0105241_120221052 135
308 3300009177 Ga0105248_10020591 Ga0105248_100205916 135
309 3300009177 Ga0105248_10113019 Ga0105248_101130193 135
310 3300009177 Ga0105248_10158843 Ga0105248_101588433 135
311 3300009177 Ga0105248_10234891 Ga0105248_102348912 135
312 3300009551 Ga0105238_10526818 Ga0105238_105268182 135
313 3300009551 Ga0105238_10771481 Ga0105238_107714812 135
314 3300009553 Ga0105249_10008677 Ga0105249_100086777 135
315 3300009553 Ga0105249_10160529 Ga0105249_101605293 135
316 3300009553 Ga0105249_10161072 Ga0105249_101610723 135
317 3300009553 Ga0105249_11176046 Ga0105249_111760462 135
318 3300009553 Ga0105249_11538183 Ga0105249_115381832 135
319 3300009553 Ga0105249_12018237 Ga0105249_120182372 135
320 3300009553 Ga0105249_13180518 Ga0105249_131805181 135
321 3300010375 Ga0105239_10040842 Ga0105239_100408422 135
322 3300010375 Ga0105239_10063252 Ga0105239_100632523 135
323 3300010375 Ga0105239_12319576 Ga0105239_123195762 135
324 3300011119 Ga0105246_10664287 Ga0105246_106642872 135
325 3300011119 Ga0105246_11154647 Ga0105246_111546472 135
326 3300012510 Ga0157316_1017401 Ga0157316_10174012 135
327 3300013100 Ga0157373_10007015 Ga0157373_100070154 135
328 3300013100 Ga0157373_10029098 Ga0157373_100290985 135
329 3300013100 Ga0157373_10148086 Ga0157373_101480862 135
330 3300013100 Ga0157373_10335593 Ga0157373_103355931 135
331 3300013100 Ga0157373_11015385 Ga0157373_110153852 135
332 3300013102 Ga0157371_10001647 Ga0157371_1000164725 135
333 3300013102 Ga0157371_10457035 Ga0157371_104570352 135
334 3300013102 Ga0157371_10519396 Ga0157371_105193962 135
335 3300013102 Ga0157371_10979654 Ga0157371_109796542 135
336 3300013104 Ga0157370_10177811 Ga0157370_101778113 135
337 3300013105 Ga0157369_10391297 Ga0157369_103912972 135
338 3300013105 Ga0157369_11684232 Ga0157369_116842322 135
339 3300013296 Ga0157374_10452386 Ga0157374_104523862 135
340 3300013297 Ga0157378_10001977 Ga0157378_1000197718 135
341 3300013297 Ga0157378_10295979 Ga0157378_102959792 135
342 3300013306 Ga0163162_10013433 Ga0163162_100134336 135
343 3300013306 Ga0163162_10046045 Ga0163162_100460455 135
344 3300013306 Ga0163162_10264258 Ga0163162_102642582 135
345 3300013306 Ga0163162_10651938 Ga0163162_106519382 135
346 3300013306 Ga0163162_10960173 Ga0163162_109601732 135
347 3300013307 Ga0157372_10070897 Ga0157372_100708974 135
348 3300013307 Ga0157372_10152605 Ga0157372_101526053 135
349 3300013307 Ga0157372_10265239 Ga0157372_102652392 135
350 3300013308 Ga0157375_10006981 Ga0157375_1000698111 135
351 3300013308 Ga0157375_10075228 Ga0157375_100752282 135
352 3300013308 Ga0157375_10098321 Ga0157375_100983213 135
353 3300013308 Ga0157375_10232043 Ga0157375_102320431 135
354 3300014325 Ga0163163_10500046 Ga0163163_105000462 135
355 3300014497 Ga0182008_10118950 Ga0182008_101189502 135
356 3300014745 Ga0157377_10053958 Ga0157377_100539582 135
357 3300014968 Ga0157379_10034679 Ga0157379_100346796 135
358 3300017792 Ga0163161_10720808 Ga0163161_107208082 135
359 3300025315 Ga0207697_10000751 Ga0207697_100007514 135
360 3300025321 Ga0207656_10003025 Ga0207656_100030253 135
361 3300025321 Ga0207656_10007718 Ga0207656_100077183 135
362 3300025321 Ga0207656_10030371 Ga0207656_100303713 135
363 3300025321 Ga0207656_10380321 Ga0207656_103803212 135
364 3300025893 Ga0207682_10098147 Ga0207682_100981472 135
365 3300025901 Ga0207688_10003129 Ga0207688_100031299 135
366 3300025901 Ga0207688_10011823 Ga0207688_100118233 135
367 3300025901 Ga0207688_10236290 Ga0207688_102362902 135
368 3300025903 Ga0207680_10087320 Ga0207680_100873202 135
369 3300025903 Ga0207680_10089025 Ga0207680_100890251 135
370 3300025904 Ga0207647_10000439 Ga0207647_1000043929 135
371 3300025904 Ga0207647_10000446 Ga0207647_1000044630 135
372 3300025904 Ga0207647_10246991 Ga0207647_102469912 135
373 3300025907 Ga0207645_10002747 Ga0207645_1000274717 135
374 3300025907 Ga0207645_10019033 Ga0207645_100190334 135
375 3300025907 Ga0207645_10321727 Ga0207645_103217272 135
376 3300025908 Ga0207643_10017186 Ga0207643_100171866 135
377 3300025909 Ga0207705_10004596 Ga0207705_1000459612 135
378 3300025909 Ga0207705_10038318 Ga0207705_100383181 135
379 3300025909 Ga0207705_10071092 Ga0207705_100710925 135
380 3300025909 Ga0207705_10111594 Ga0207705_101115943 135
381 3300025910 Ga0207684_10264557 Ga0207684_102645572 135
382 3300025911 Ga0207654_10219261 Ga0207654_102192612 135
383 3300025912 Ga0207707_10141594 Ga0207707_101415943 135
384 3300025913 Ga0207695_10221443 Ga0207695_102214432 135
385 3300025913 Ga0207695_10286907 Ga0207695_102869073 135
386 3300025918 Ga0207662_10167404 Ga0207662_101674042 135
387 3300025919 Ga0207657_10002328 Ga0207657_1000232817 135
388 3300025919 Ga0207657_10007110 Ga0207657_100071102 135
389 3300025919 Ga0207657_10037709 Ga0207657_100377093 135
390 3300025919 Ga0207657_10047906 Ga0207657_100479063 135
391 3300025919 Ga0207657_10050141 Ga0207657_100501412 135
392 3300025919 Ga0207657_10218292 Ga0207657_102182923 135
393 3300025919 Ga0207657_10238570 Ga0207657_102385702 135
394 3300025919 Ga0207657_10477087 Ga0207657_104770872 135
395 3300025920 Ga0207649_10004861 Ga0207649_1000486110 135
396 3300025920 Ga0207649_11369456 Ga0207649_113694561 135
397 3300025921 Ga0207652_10076724 Ga0207652_100767243 135
398 3300025921 Ga0207652_10196500 Ga0207652_101965003 135
399 3300025921 Ga0207652_10488507 Ga0207652_104885072 135
400 3300025923 Ga0207681_10001284 Ga0207681_100012848 135
401 3300025923 Ga0207681_10007770 Ga0207681_100077704 135
402 3300025923 Ga0207681_10039200 Ga0207681_100392004 135
403 3300025923 Ga0207681_10439902 Ga0207681_104399022 135
404 3300025925 Ga0207650_10018723 Ga0207650_100187233 135
405 3300025925 Ga0207650_10204572 Ga0207650_102045723 135
406 3300025926 Ga0207659_10028832 Ga0207659_100288324 135
407 3300025927 Ga0207687_10025332 Ga0207687_100253323 135
408 3300025927 Ga0207687_10106282 Ga0207687_101062822 135
409 3300025931 Ga0207644_10326450 Ga0207644_103264502 135
410 3300025932 Ga0207690_10012741 Ga0207690_100127416 135
411 3300025932 Ga0207690_10014735 Ga0207690_100147353 135
412 3300025932 Ga0207690_10027796 Ga0207690_100277962 135
413 3300025932 Ga0207690_10032900 Ga0207690_100329002 135
414 3300025932 Ga0207690_10205050 Ga0207690_102050503 135
415 3300025932 Ga0207690_10317065 Ga0207690_103170652 135
416 3300025932 Ga0207690_10407053 Ga0207690_104070532 135
417 3300025933 Ga0207706_10000446 Ga0207706_1000044648 135
418 3300025933 Ga0207706_10009416 Ga0207706_100094162 135
419 3300025933 Ga0207706_10013576 Ga0207706_100135767 135
420 3300025933 Ga0207706_10055491 Ga0207706_100554912 135
421 3300025933 Ga0207706_10079578 Ga0207706_100795783 135
422 3300025933 Ga0207706_10185844 Ga0207706_101858443 135
423 3300025933 Ga0207706_10737392 Ga0207706_107373922 135
424 3300025935 Ga0207709_10214557 Ga0207709_102145573 135
425 3300025935 Ga0207709_10348109 Ga0207709_103481093 135
426 3300025937 Ga0207669_10022197 Ga0207669_100221974 135
427 3300025937 Ga0207669_10249551 Ga0207669_102495512 135
428 3300025938 Ga0207704_10016682 Ga0207704_100166823 135
429 3300025938 Ga0207704_10133568 Ga0207704_101335683 135
430 3300025938 Ga0207704_10821357 Ga0207704_108213572 135
431 3300025940 Ga0207691_10008977 Ga0207691_100089773 135
432 3300025940 Ga0207691_10021285 Ga0207691_100212856 135
433 3300025940 Ga0207691_10117178 Ga0207691_101171783 135
434 3300025940 Ga0207691_10183214 Ga0207691_101832143 135
435 3300025941 Ga0207711_10035386 Ga0207711_100353865 135
436 3300025941 Ga0207711_10081823 Ga0207711_100818233 135
437 3300025941 Ga0207711_10178764 Ga0207711_101787642 135
438 3300025942 Ga0207689_10000064 Ga0207689_1000006432 135
439 3300025942 Ga0207689_10008314 Ga0207689_100083144 135
440 3300025942 Ga0207689_10142528 Ga0207689_101425283 135
441 3300025942 Ga0207689_10752775 Ga0207689_107527752 135
442 3300025944 Ga0207661_10145090 Ga0207661_101450903 135
443 3300025945 Ga0207679_10007564 Ga0207679_1000756410 135
444 3300025945 Ga0207679_10012810 Ga0207679_100128106 135
445 3300025945 Ga0207679_10033120 Ga0207679_100331206 135
446 3300025945 Ga0207679_11507049 Ga0207679_115070491 135
447 3300025949 Ga0207667_10027440 Ga0207667_100274405 135
448 3300025949 Ga0207667_10082526 Ga0207667_100825265 135
449 3300025949 Ga0207667_10871696 Ga0207667_108716962 135
450 3300025949 Ga0207667_10906072 Ga0207667_109060722 135
451 3300025960 Ga0207651_10004881 Ga0207651_100048817 135
452 3300025960 Ga0207651_10190948 Ga0207651_101909483 135
453 3300025960 Ga0207651_10478877 Ga0207651_104788773 135
454 3300025960 Ga0207651_10494275 Ga0207651_104942752 135
455 3300025960 Ga0207651_10717469 Ga0207651_107174692 135
456 3300025960 Ga0207651_10806962 Ga0207651_108069622 135
457 3300025961 Ga0207712_10000474 Ga0207712_1000047432 135
458 3300025961 Ga0207712_10116724 Ga0207712_101167242 135
459 3300025961 Ga0207712_10828596 Ga0207712_108285962 135
460 3300025961 Ga0207712_11537416 Ga0207712_115374162 135
461 3300025972 Ga0207668_10000021 Ga0207668_1000002155 135
462 3300025972 Ga0207668_10022745 Ga0207668_100227456 135
463 3300025972 Ga0207668_10112668 Ga0207668_101126681 135
464 3300025972 Ga0207668_10862919 Ga0207668_108629192 135
465 3300025972 Ga0207668_10991685 Ga0207668_109916852 135
466 3300025972 Ga0207668_11204573 Ga0207668_112045731 135
467 3300025981 Ga0207640_10038139 Ga0207640_100381392 135
468 3300025981 Ga0207640_10098051 Ga0207640_100980513 135
469 3300025981 Ga0207640_11266644 Ga0207640_112666442 135
470 3300025981 Ga0207640_11367073 Ga0207640_113670732 135
471 3300025986 Ga0207658_10004594 Ga0207658_100045946 135
472 3300025986 Ga0207658_10024798 Ga0207658_100247984 135
473 3300025986 Ga0207658_10043342 Ga0207658_100433423 135
474 3300025986 Ga0207658_10087800 Ga0207658_100878003 135
475 3300025986 Ga0207658_10182969 Ga0207658_101829692 135
476 3300025986 Ga0207658_10917976 Ga0207658_109179762 135
477 3300026023 Ga0207677_10084470 Ga0207677_100844702 135
478 3300026023 Ga0207677_10238822 Ga0207677_102388223 135
479 3300026035 Ga0207703_10002562 Ga0207703_100025627 135
480 3300026035 Ga0207703_10029829 Ga0207703_100298297 135
481 3300026035 Ga0207703_10063198 Ga0207703_100631983 135
482 3300026041 Ga0207639_10031388 Ga0207639_100313884 135
483 3300026041 Ga0207639_10039603 Ga0207639_100396034 135
484 3300026041 Ga0207639_10057262 Ga0207639_100572624 135
485 3300026041 Ga0207639_10090089 Ga0207639_100900892 135
486 3300026041 Ga0207639_10378026 Ga0207639_103780262 135
487 3300026041 Ga0207639_11312508 Ga0207639_113125082 135
488 3300026067 Ga0207678_10001094 Ga0207678_1000109425 135
489 3300026067 Ga0207678_10004153 Ga0207678_100041533 135
490 3300026067 Ga0207678_10089099 Ga0207678_100890993 135
491 3300026067 Ga0207678_10178969 Ga0207678_101789692 135
492 3300026067 Ga0207678_10188887 Ga0207678_101888872 135
493 3300026067 Ga0207678_10443063 Ga0207678_104430632 135
494 3300026078 Ga0207702_10356188 Ga0207702_103561882 135
495 3300026078 Ga0207702_11413116 Ga0207702_114131161 135
496 3300026088 Ga0207641_10023188 Ga0207641_100231883 135
497 3300026088 Ga0207641_10040068 Ga0207641_100400683 135
498 3300026088 Ga0207641_10088129 Ga0207641_100881295 135
499 3300026088 Ga0207641_10334108 Ga0207641_103341082 135
500 3300026088 Ga0207641_10514755 Ga0207641_105147552 135
501 3300026089 Ga0207648_10001456 Ga0207648_100014562 135
502 3300026089 Ga0207648_10035979 Ga0207648_100359794 135
503 3300026089 Ga0207648_10036060 Ga0207648_100360604 135
504 3300026095 Ga0207676_10000761 Ga0207676_100007614 135
505 3300026095 Ga0207676_10001326 Ga0207676_1000132611 135
506 3300026095 Ga0207676_11186640 Ga0207676_111866402 135
507 3300026116 Ga0207674_10000362 Ga0207674_1000036267 135
508 3300026116 Ga0207674_10000814 Ga0207674_1000081426 135
509 3300026116 Ga0207674_10012143 Ga0207674_1001214312 135
510 3300026116 Ga0207674_10051113 Ga0207674_100511134 135
511 3300026116 Ga0207674_10163757 Ga0207674_101637572 135
512 3300026116 Ga0207674_10995421 Ga0207674_109954212 135
513 3300026118 Ga0207675_100036116 Ga0207675_1000361166 135
514 3300026118 Ga0207675_100289169 Ga0207675_1002891692 135
515 3300026118 Ga0207675_100592572 Ga0207675_1005925722 135
516 3300026118 Ga0207675_101941388 Ga0207675_1019413882 135
517 3300026121 Ga0207683_10509393 Ga0207683_105093931 135
518 3300026142 Ga0207698_10013270 Ga0207698_100132708 135
519 3300026142 Ga0207698_10217026 Ga0207698_102170262 135
520 3300026142 Ga0207698_10301129 Ga0207698_103011292 135
521 3300026142 Ga0207698_10468207 Ga0207698_104682072 135
522 3300026142 Ga0207698_11049354 Ga0207698_110493541 135
523 3300028379 Ga0268266_10000318 Ga0268266_1000031833 135
524 3300028379 Ga0268266_10005319 Ga0268266_1000531913 135
525 3300028379 Ga0268266_10074969 Ga0268266_100749693 135
526 3300028379 Ga0268266_10575129 Ga0268266_105751292 135
527 3300028379 Ga0268266_10576564 Ga0268266_105765642 135
528 3300028379 Ga0268266_11073145 Ga0268266_110731452 135
529 3300028380 Ga0268265_10000789 Ga0268265_100007897 135
530 3300028380 Ga0268265_10012555 Ga0268265_100125556 135
531 3300028380 Ga0268265_10029552 Ga0268265_100295524 135
532 3300028380 Ga0268265_10075356 Ga0268265_100753562 135
533 3300028380 Ga0268265_10108182 Ga0268265_101081824 135
534 3300028380 Ga0268265_10633172 Ga0268265_106331722 135
535 3300028381 Ga0268264_10006173 Ga0268264_100061734 135
536 3300028381 Ga0268264_10009557 Ga0268264_100095578 135
537 3300028381 Ga0268264_10056108 Ga0268264_100561085 135
538 3300028381 Ga0268264_10119281 Ga0268264_101192812 135
539 3300028381 Ga0268264_10148268 Ga0268264_101482682 135
540 3300028381 Ga0268264_10235741 Ga0268264_102357412 135
541 3300028381 Ga0268264_10413512 Ga0268264_104135123 135
542 3300031548 Ga0307408_100362057 Ga0307408_1003620572 135
543 3300031824 Ga0307413_10459055 Ga0307413_104590552 135
544 3300031824 Ga0307413_11504801 Ga0307413_115048012 135
545 3300031852 Ga0307410_10069338 Ga0307410_100693383 135
546 3300031852 Ga0307410_10091089 Ga0307410_100910893 135
547 3300031901 Ga0307406_10194396 Ga0307406_101943963 135
548 3300031903 Ga0307407_10394157 Ga0307407_103941572 135
549 3300031995 Ga0307409_100026423 Ga0307409_1000264234 135
550 3300032002 Ga0307416_100554195 Ga0307416_1005541951 135
551 3300032002 Ga0307416_102519721 Ga0307416_1025197212 135
552 3300032004 Ga0307414_10079778 Ga0307414_100797782 135
553 3300032004 Ga0307414_10085292 Ga0307414_100852922 135
554 3300032004 Ga0307414_10435337 Ga0307414_104353372 135
555 3300032005 Ga0307411_10966778 Ga0307411_109667782 135
556 3300035085 Ga0373929_0161293 Ga0373929_0161293_12_434 135
557 3300037312 Ga0395899_0171598 Ga0395899_0171598_1077_1499 135
558 3300037418 Ga0395900_0177611 Ga0395900_0177611_421_843 135
559 3300037418 Ga0395900_0178988 Ga0395900_0178988_90_512 135
560 3300037418 Ga0395900_0351870 Ga0395900_0351870_285_707 135
561 3300037418 Ga0395900_0506972 Ga0395900_0506972_667_1089 135
562 3300037418 Ga0395900_0652541 Ga0395900_0652541_28_450 135
563 3300037466 Ga0395898_0099990 Ga0395898_0099990_2246_2668 135
564 3300037471 Ga0395905_0004032 Ga0395905_0004032_13187_13609 135
565 3300037471 Ga0395905_0054313 Ga0395905_0054313_1449_1871 135
566 3300037471 Ga0395905_0118792 Ga0395905_0118792_1650_2072 135
567 3300037471 Ga0395905_0172929 Ga0395905_0172929_247_669 135
568 3300037471 Ga0395905_0403154 Ga0395905_0403154_593_1000 135
569 3300037471 Ga0395905_0922445 Ga0395905_0922445_224_637 135
570 3300038443 Ga0395901_0083176 Ga0395901_0083176_2331_2753 135
571 3300038443 Ga0395901_0209922 Ga0395901_0209922_1039_1461 135
572 3300042120 Ga0450917_001012 Ga0450917_001012_283_705 135
573 3300044901 Ga0466960_0621058 Ga0466960_0621058_217_630 135
574 3300046522 Ga0495643_0204862 Ga0495643_0204862_465_887 135
575 3300046525 Ga0495663_0123981 Ga0495663_0123981_100_513 135
576 3300046616 Ga0495668_0869974 Ga0495668_0869974_17_430 135
577 3300046684 Ga0495669_0349263 Ga0495669_0349263_116_538 135
578 3300047320 Ga0495672_0090704 Ga0495672_0090704_1141_1563 135
579 3300048904 Ga0496101_1405484 Ga0496101_1405484_63_476 135
580 3300048905 Ga0496102_0934407 Ga0496102_0934407_159_581 135
581 3300048905 Ga0496102_1468310 Ga0496102_1468310_157_591 135
582 3300048906 Ga0496103_0294848 Ga0496103_0294848_356_778 135
583 3300048909 Ga0496106_0240757 Ga0496106_0240757_304_720 135
584 3300048910 Ga0496107_0142038 Ga0496107_0142038_12_434 135
585 3300048910 Ga0496107_0919242 Ga0496107_0919242_128_562 135
586 3300048912 Ga0496109_0134445 Ga0496109_0134445_360_773 135
587 3300048912 Ga0496109_0217689 Ga0496109_0217689_237_659 135
588 3300048912 Ga0496109_0346128 Ga0496109_0346128_396_818 135
589 3300048913 Ga0496110_0992202 Ga0496110_0992202_109_522 135
590 3300048915 Ga0496112_0681231 Ga0496112_0681231_17_451 135
591 3300048916 Ga0496113_0217082 Ga0496113_0217082_694_1128 135
592 3300049577 Ga0501041_0959017 Ga0501041_0959017_67_474 135
593 3300049583 Ga0501067_0026714 Ga0501067_0026714_1908_2330 135
594 3300049584 Ga0501068_0190733 Ga0501068_0190733_684_1106 135
595 3300050489 nmdc:mga03683_42402_c1 nmdc:mga03683_42402_c1_748_1170 135
596 3300050508 nmdc:mga09592_282551_c1 nmdc:mga09592_282551_c1_962_1384 135
597 3300050512 nmdc:mga0n895_1157217_c1 nmdc:mga0n895_1157217_c1_121_543 135
598 3300050515 nmdc:mga0a205_248_c1 nmdc:mga0a205_248_c1_30956_31378 135
599 3300001979 JGI24740J21852_10096425 JGI24740J21852_100964252 136
600 3300001989 JGI24739J22299_10077882 JGI24739J22299_100778822 136
601 3300005328 Ga0070676_10294066 Ga0070676_102940661 136
602 3300005335 Ga0070666_10020219 Ga0070666_100202195 136
603 3300005336 Ga0070680_101245445 Ga0070680_1012454451 136
604 3300005337 Ga0070682_100123675 Ga0070682_1001236752 136
605 3300005339 Ga0070660_100184424 Ga0070660_1001844242 136
606 3300005344 Ga0070661_100073098 Ga0070661_1000730983 136
607 3300005355 Ga0070671_100099159 Ga0070671_1000991593 136
608 3300005364 Ga0070673_100108904 Ga0070673_1001089043 136
609 3300005367 Ga0070667_100072334 Ga0070667_1000723343 136
610 3300005455 Ga0070663_100057821 Ga0070663_1000578214 136
611 3300005457 Ga0070662_100078528 Ga0070662_1000785283 136
612 3300005459 Ga0068867_100122862 Ga0068867_1001228622 136
613 3300005530 Ga0070679_100635682 Ga0070679_1006356822 136
614 3300005530 Ga0070679_100637483 Ga0070679_1006374832 136
615 3300005547 Ga0070693_100189123 Ga0070693_1001891232 136
616 3300005563 Ga0068855_100188129 Ga0068855_1001881293 136
617 3300005564 Ga0070664_100217343 Ga0070664_1002173432 136
618 3300005616 Ga0068852_100478960 Ga0068852_1004789602 136
619 3300005834 Ga0068851_10106250 Ga0068851_101062502 136
620 3300009174 Ga0105241_10952038 Ga0105241_109520382 136
621 3300009551 Ga0105238_11574156 Ga0105238_115741562 136
622 3300013100 Ga0157373_11285624 Ga0157373_112856242 136
623 3300013102 Ga0157371_10072679 Ga0157371_100726793 136
624 3300025321 Ga0207656_10013094 Ga0207656_100130942 136
625 3300025903 Ga0207680_10190700 Ga0207680_101907002 136
626 3300025904 Ga0207647_10026897 Ga0207647_100268973 136
627 3300025907 Ga0207645_10018707 Ga0207645_100187076 136
628 3300025909 Ga0207705_10042629 Ga0207705_100426292 136
629 3300025911 Ga0207654_10215782 Ga0207654_102157822 136
630 3300025917 Ga0207660_10812034 Ga0207660_108120342 136
631 3300025919 Ga0207657_10040158 Ga0207657_100401584 136
632 3300025924 Ga0207694_11118144 Ga0207694_111181441 136
633 3300025931 Ga0207644_10198958 Ga0207644_101989583 136
634 3300025932 Ga0207690_10129487 Ga0207690_101294873 136
635 3300025933 Ga0207706_10098659 Ga0207706_100986593 136
636 3300025940 Ga0207691_10512778 Ga0207691_105127782 136
637 3300025945 Ga0207679_10091597 Ga0207679_100915973 136
638 3300025960 Ga0207651_11267245 Ga0207651_112672452 136
639 3300025986 Ga0207658_10929188 Ga0207658_109291881 136
640 3300026067 Ga0207678_10009167 Ga0207678_100091679 136
641 3300026078 Ga0207702_10100776 Ga0207702_101007762 136
642 3300026089 Ga0207648_10158592 Ga0207648_101585922 136
643 3300026116 Ga0207674_10072025 Ga0207674_100720254 136
644 3300028379 Ga0268266_10653760 Ga0268266_106537602 136
645 3300003323 rootH1_10348281 rootH1_103482812 139
646 3300005344 Ga0070661_100078415 Ga0070661_1000784153 139
647 3300005353 Ga0070669_100576056 Ga0070669_1005760562 139
648 3300005367 Ga0070667_100082262 Ga0070667_1000822622 139
649 3300005435 Ga0070714_100282223 Ga0070714_1002822231 139
650 3300005436 Ga0070713_100027237 Ga0070713_1000272372 139
651 3300005614 Ga0068856_100037364 Ga0068856_1000373643 139
652 3300005614 Ga0068856_100330248 Ga0068856_1003302483 139
653 3300005616 Ga0068852_100126757 Ga0068852_1001267572 139
654 3300005617 Ga0068859_100091183 Ga0068859_1000911832 139
655 3300005618 Ga0068864_100032621 Ga0068864_1000326212 139
656 3300005834 Ga0068851_10134324 Ga0068851_101343242 139
657 3300005841 Ga0068863_100003869 Ga0068863_10000386918 139
658 3300005842 Ga0068858_100485958 Ga0068858_1004859582 139
659 3300005843 Ga0068860_100058772 Ga0068860_1000587724 139
660 3300006931 Ga0097620_100091178 Ga0097620_1000911782 139
661 3300009177 Ga0105248_10065081 Ga0105248_100650813 139
662 3300009553 Ga0105249_10021535 Ga0105249_100215356 139
663 3300013104 Ga0157370_10497784 Ga0157370_104977842 139
664 3300013105 Ga0157369_10261787 Ga0157369_102617873 139
665 3300013296 Ga0157374_10151117 Ga0157374_101511172 139
666 3300014325 Ga0163163_10026163 Ga0163163_100261634 139
667 3300014968 Ga0157379_10054030 Ga0157379_100540303 139
668 3300025909 Ga0207705_10119522 Ga0207705_101195223 139
669 3300025919 Ga0207657_10014979 Ga0207657_100149794 139
670 3300025923 Ga0207681_10474352 Ga0207681_104743522 139
671 3300025929 Ga0207664_10143163 Ga0207664_101431633 139
672 3300025941 Ga0207711_10000218 Ga0207711_1000021862 139
673 3300025961 Ga0207712_10030817 Ga0207712_100308174 139
674 3300026035 Ga0207703_10217056 Ga0207703_102170562 139
675 3300026067 Ga0207678_10147977 Ga0207678_101479772 139
676 3300026078 Ga0207702_10176357 Ga0207702_101763573 139
677 3300026078 Ga0207702_10445406 Ga0207702_104454062 139
678 3300026088 Ga0207641_10000248 Ga0207641_1000024870 139
679 3300026095 Ga0207676_10027785 Ga0207676_100277853 139
680 3300026142 Ga0207698_10126650 Ga0207698_101266502 139
681 3300028381 Ga0268264_10054953 Ga0268264_100549532 139
682 3300037312 Ga0395899_0032217 Ga0395899_0032217_1816_2325 139
683 3300037312 Ga0395899_0625501 Ga0395899_0625501_85_570 139
684 3300037418 Ga0395900_0012506 Ga0395900_0012506_6388_6897 139
685 3300037418 Ga0395900_0251375 Ga0395900_0251375_866_1351 139
686 3300037466 Ga0395898_0036672 Ga0395898_0036672_2467_2976 139
687 3300037466 Ga0395898_0780755 Ga0395898_0780755_190_678 139
688 3300037471 Ga0395905_0075399 Ga0395905_0075399_1109_1618 139
689 3300037471 Ga0395905_0763791 Ga0395905_0763791_248_736 139
690 3300038443 Ga0395901_0122941 Ga0395901_0122941_573_1082 139
691 3300044842 Ga0466957_0055180 Ga0466957_0055180_654_1157 139
692 3300045976 Ga0466967_0015201 Ga0466967_0015201_4507_5010 139
693 3300001990 JGI24737J22298_10021011 JGI24737J22298_100210111 140
694 3300003322 rootL2_10280324 rootL2_102803243 140
695 3300005329 Ga0070683_100006547 Ga0070683_1000065478 140
696 3300005339 Ga0070660_100662954 Ga0070660_1006629542 140
697 3300005344 Ga0070661_100812430 Ga0070661_1008124302 140
698 3300005535 Ga0070684_100005972 Ga0070684_1000059722 140
699 3300005563 Ga0068855_100017657 Ga0068855_10001765710 140
700 3300005563 Ga0068855_100236653 Ga0068855_1002366532 140
701 3300005563 Ga0068855_100626955 Ga0068855_1006269552 140
702 3300005563 Ga0068855_101464336 Ga0068855_1014643361 140
703 3300005577 Ga0068857_101867594 Ga0068857_1018675941 140
704 3300005614 Ga0068856_100069594 Ga0068856_1000695942 140
705 3300005614 Ga0068856_100208614 Ga0068856_1002086143 140
706 3300005614 Ga0068856_101296759 Ga0068856_1012967592 140
707 3300005616 Ga0068852_100011189 Ga0068852_1000111897 140
708 3300010375 Ga0105239_11370718 Ga0105239_113707181 140
709 3300013100 Ga0157373_10155299 Ga0157373_101552992 140
710 3300013102 Ga0157371_10010308 Ga0157371_100103082 140
711 3300013102 Ga0157371_10028803 Ga0157371_100288034 140
712 3300013102 Ga0157371_10042483 Ga0157371_100424834 140
713 3300013104 Ga0157370_10022825 Ga0157370_100228254 140
714 3300013104 Ga0157370_10071369 Ga0157370_100713692 140
715 3300013104 Ga0157370_11491513 Ga0157370_114915131 140
716 3300013105 Ga0157369_10001177 Ga0157369_100011776 140
717 3300013105 Ga0157369_10012443 Ga0157369_100124436 140
718 3300013105 Ga0157369_10012489 Ga0157369_100124893 140
719 3300013105 Ga0157369_10059027 Ga0157369_100590274 140
720 3300013105 Ga0157369_10146686 Ga0157369_101466862 140
721 3300013307 Ga0157372_10081328 Ga0157372_100813284 140
722 3300022467 Ga0224712_10018528 Ga0224712_100185281 140
723 3300025904 Ga0207647_10273823 Ga0207647_102738232 140
724 3300025919 Ga0207657_10267892 Ga0207657_102678922 140
725 3300025944 Ga0207661_10051319 Ga0207661_100513192 140
726 3300025949 Ga0207667_10016908 Ga0207667_1001690810 140
727 3300025949 Ga0207667_10386053 Ga0207667_103860533 140
728 3300026078 Ga0207702_10012315 Ga0207702_1001231510 140
729 3300026078 Ga0207702_10050713 Ga0207702_100507133 140
730 3300026116 Ga0207674_10021233 Ga0207674_100212337 140
731 3300026116 Ga0207674_10701935 Ga0207674_107019352 140
732 3300026142 Ga0207698_10025015 Ga0207698_100250153 140
733 3300037312 Ga0395899_0202925 Ga0395899_0202925_404_898 140
734 3300037418 Ga0395900_0003019 Ga0395900_0003019_15152_15646 140
735 3300037418 Ga0395900_0071242 Ga0395900_0071242_2144_2638 140
736 3300037418 Ga0395900_0107472 Ga0395900_0107472_802_1287 140
737 3300037418 Ga0395900_0271284 Ga0395900_0271284_688_1179 140
738 3300037418 Ga0395900_0645259 Ga0395900_0645259_115_621 140
739 3300037466 Ga0395898_0025517 Ga0395898_0025517_719_1213 140
740 3300037466 Ga0395898_0088025 Ga0395898_0088025_1622_2116 140
741 3300037471 Ga0395905_0010096 Ga0395905_0010096_3032_3526 140
742 3300037471 Ga0395905_0012671 Ga0395905_0012671_4233_4724 140
743 3300037471 Ga0395905_0070855 Ga0395905_0070855_2533_3027 140
744 3300037471 Ga0395905_0106578 Ga0395905_0106578_1781_2275 140
745 3300037471 Ga0395905_0132012 Ga0395905_0132012_1473_1979 140
746 3300038443 Ga0395901_0002158 Ga0395901_0002158_1339_1833 140
747 3300038443 Ga0395901_0451913 Ga0395901_0451913_624_1130 140
748 3300038443 Ga0395901_0489436 Ga0395901_0489436_535_1029 140
749 3300044656 Ga0466969_0199970 Ga0466969_0199970_69_557 140
750 3300044684 Ga0466966_0015374 Ga0466966_0015374_2259_2747 140
751 3300044693 Ga0466961_0049492 Ga0466961_0049492_309_797 140
752 3300044693 Ga0466961_0373545 Ga0466961_0373545_204_692 140
753 3300044842 Ga0466957_0577874 Ga0466957_0577874_106_594 140
754 3300045049 Ga0466959_0061069 Ga0466959_0061069_337_825 140
755 3300045049 Ga0466959_0340378 Ga0466959_0340378_352_840 140
756 3300045836 Ga0466958_0094126 Ga0466958_0094126_1113_1601 140
757 3300045976 Ga0466967_0023305 Ga0466967_0023305_272_760 140
758 3300061719 Ga0466962_0106472 Ga0466962_0106472_591_1079 140
759 3300005339 Ga0070660_100086216 Ga0070660_1000862162 141
760 3300005344 Ga0070661_100080649 Ga0070661_1000806493 141
761 3300005455 Ga0070663_100061273 Ga0070663_1000612732 141
762 3300005616 Ga0068852_100290295 Ga0068852_1002902953 141
763 3300013100 Ga0157373_10386291 Ga0157373_103862912 141
764 3300025919 Ga0207657_10145350 Ga0207657_101453502 141
765 3300025932 Ga0207690_10622975 Ga0207690_106229752 141
766 3300025981 Ga0207640_10415241 Ga0207640_104152412 141
767 3300026067 Ga0207678_10020075 Ga0207678_100200753 141
768 3300026142 Ga0207698_10527207 Ga0207698_105272072 141
769 2162886011 MRS1b_contig_2738738 MRS1b_0647.00000630 142
770 2162886012 MBSR1b_contig_7487180 MBSR1b_0276.00000910 142
771 3300005290 Ga0065712_10305407 Ga0065712_103054071 142
772 3300005293 Ga0065715_10310536 Ga0065715_103105361 142
773 3300005293 Ga0065715_10393119 Ga0065715_103931192 142
774 3300005331 Ga0070670_100002488 Ga0070670_10000248812 142
775 3300005333 Ga0070677_10096835 Ga0070677_100968353 142
776 3300005347 Ga0070668_100036377 Ga0070668_1000363772 142
777 3300005353 Ga0070669_100003672 Ga0070669_1000036728 142
778 3300005354 Ga0070675_100510002 Ga0070675_1005100022 142
779 3300005356 Ga0070674_100506382 Ga0070674_1005063822 142
780 3300005457 Ga0070662_100050613 Ga0070662_1000506134 142
781 3300005543 Ga0070672_100143410 Ga0070672_1001434101 142
782 3300005564 Ga0070664_100993571 Ga0070664_1009935711 142
783 3300005719 Ga0068861_102056389 Ga0068861_1020563891 142
784 3300014326 Ga0157380_10070822 Ga0157380_100708224 142
785 3300025893 Ga0207682_10003496 Ga0207682_100034964 142
786 3300025923 Ga0207681_10028732 Ga0207681_100287323 142
787 3300025925 Ga0207650_10004951 Ga0207650_100049513 142
788 3300025926 Ga0207659_10104748 Ga0207659_101047483 142
789 3300025933 Ga0207706_10068347 Ga0207706_100683472 142
790 3300025937 Ga0207669_10541031 Ga0207669_105410312 142
791 3300025940 Ga0207691_10064947 Ga0207691_100649473 142
792 3300025945 Ga0207679_10099466 Ga0207679_100994663 142
793 3300025972 Ga0207668_10674807 Ga0207668_106748072 142
794 3300031548 Ga0307408_100481660 Ga0307408_1004816601 142
795 3300031731 Ga0307405_10097727 Ga0307405_100977273 142
796 3300031731 Ga0307405_10515380 Ga0307405_105153802 142
797 3300031731 Ga0307405_10639763 Ga0307405_106397632 142
798 3300031824 Ga0307413_10003613 Ga0307413_100036135 142
799 3300031824 Ga0307413_10008481 Ga0307413_100084814 142
800 3300031852 Ga0307410_10005467 Ga0307410_100054673 142
801 3300031852 Ga0307410_10020790 Ga0307410_100207904 142
802 3300031852 Ga0307410_10027755 Ga0307410_100277552 142
803 3300031901 Ga0307406_10043203 Ga0307406_100432033 142
804 3300031901 Ga0307406_10333790 Ga0307406_103337902 142
805 3300031901 Ga0307406_10879618 Ga0307406_108796182 142
806 3300031903 Ga0307407_10021132 Ga0307407_100211323 142
807 3300031911 Ga0307412_10006903 Ga0307412_100069033 142
808 3300031911 Ga0307412_10171451 Ga0307412_101714511 142
809 3300031995 Ga0307409_100004073 Ga0307409_1000040731 142
810 3300031995 Ga0307409_100030409 Ga0307409_1000304092 142
811 3300031995 Ga0307409_100177191 Ga0307409_1001771912 142
812 3300031995 Ga0307409_100408843 Ga0307409_1004088432 142
813 3300032004 Ga0307414_10006161 Ga0307414_100061613 142
814 3300032004 Ga0307414_10072352 Ga0307414_100723523 142
815 3300032004 Ga0307414_10207051 Ga0307414_102070513 142
816 3300032004 Ga0307414_10830701 Ga0307414_108307011 142
817 3300032005 Ga0307411_10000435 Ga0307411_1000043513 142
818 3300032005 Ga0307411_10000684 Ga0307411_100006847 142
819 3300032126 Ga0307415_100033282 Ga0307415_1000332824 142
820 3300032126 Ga0307415_100050442 Ga0307415_1000504423 142
821 3300032126 Ga0307415_100219141 Ga0307415_1002191413 142
822 3300042006 Ga0439432_168881 Ga0439432_168881_12_491 142
823 3300042146 Ga0450907_016387 Ga0450907_016387_409_885 142
824 3300049660 Ga0501216_096652 Ga0501216_096652_168_596 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07811

TadE

TadE-like protein

13

55

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tc1-assembly1.cif.gz_G in situ structures of the genome and genome-delivery apparatus in ssrna bacteriophage ms2 0.7176 91 132
2qux-assembly4.cif.gz_K pp7 coat protein dimer in complex with rna hairpin 0.7141 91 132
6tlb-assembly1.cif.gz_C-2 plasmodium falciparum lipocalin (pf3d7_0925900) 0.7009 91 126
5ixm-assembly1.cif.gz_B the lps transporter lptde from yersinia pestis, core complex 0.6719 89 132
5iv8-assembly1.cif.gz_B the lps transporter lptde from klebsiella pneumoniae, core complex 0.6697 89 132
ID Description Score Start End Superfamily
af_A0A0R0L6S4_8_83_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7504 91 132 3.30.420.10
af_Q8I2Q0_30_206_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.743 91 130 2.40.128.20
af_Q0VBB0_16_173_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7219 102 132 3.30.530.20
af_A0A0R0K9Z2_296_445_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7141 101 132 3.30.530.20
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7133 89 130 3.10.420.10
ID Description Score Start End GO Terms
AF-A0A7V9E0T5-F1-model_v4 Pilus assembly protein 0.9694 19 133
AF-A0A520YF62-F1-model_v4 Pilus assembly protein 0.9257 11 135 GO:0016020
AF-A0A6G7ZFH3-F1-model_v4 Pilus assembly protein 0.9033 10 138 GO:0016020
AF-A0A7V9E0T5-F1-model_v4 Pilus assembly protein 0.9003 19 133
AF-A0A6G7YS04-F1-model_v4 Pilus assembly protein 0.8903 11 135 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.33 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map