F482230

General Info

Members Datasets Scaffolds Average Seq Length
820 346 810 185

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0000584|Ga0495597_0000584_2246_2848
Length 200
Sequence LPGFAALAAFRVLFKDLRMQYETRFCSHCATPLQWLTVAEDGGDVQRLRCPACGWTHWNNPTPVLAAIVEHEGRVLLARNAAWPEKVFGLITGFMEAGESPEQGIAREVLEETGLVVQSQQLIGAYEFLRMNQVIIAYHVEATGQVQLSPELLEYRLVAPEKVQCWPAGTGQALATWLRSRGHEPQFIDFWRRDENAATA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2738541337 Pelomonas sp. BT06 Isolate Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
229 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
230 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
240 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
241 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
242 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
245 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
297 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
298 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
299 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
300 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
301 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
302 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
307 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
308 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
309 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
310 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
311 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
312 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
315 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
318 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
319 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
320 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
321 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
322 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
340 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.24
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 0.24
Rhizoplane 4.27
Rhizosphere 81.22
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001030 3300002705 Bacteria 13001
2 JGI25154J39366_1002784 3300002738 Bacteria 4193
3 JGI25157J39369_1000021 3300002741 Bacteria 163907
4 JGI25152J39213_1002732 3300002773 Bacteria 6443
5 JGI25153J46596_10010114 3300003215 Bacteria 4301
6 rootL2_10208104 3300003322 Bacteria 1009
7 Ga0055539_1000608 3300003752 Bacteria 9788
8 Ga0055539_1004575 3300003752 Bacteria 1837
9 Ga0055533_1000033 3300003756 Bacteria 265716
10 Ga0055526_1002081 3300003771 Bacteria 13745
11 Ga0055524_1000423 3300003775 Bacteria 35532
12 Ga0055530_10007972 3300003791 Bacteria 4330
13 Ga0055540_1000015 3300003792 Bacteria 232986
14 Ga0065165_1000401 3300005262 Bacteria 69929
15 Ga0065165_1007960 3300005262 Bacteria 5073
16 Ga0070658_10530030 3300005327 Bacteria 1019
17 Ga0070658_10679370 3300005327 Bacteria 893
18 Ga0070676_10002580 3300005328 Bacteria 9317
19 Ga0070683_100001824 3300005329 Bacteria 16612
20 Ga0070670_100024587 3300005331 Bacteria 5179
21 Ga0070670_100113628 3300005331 Bacteria 2334
22 Ga0070670_100305123 3300005331 Bacteria 1393
23 Ga0070670_100560868 3300005331 Bacteria 1019
24 Ga0070670_100642537 3300005331 Bacteria 951
25 Ga0070670_101109637 3300005331 Bacteria 722
26 Ga0070677_10024507 3300005333 Bacteria 2244
27 Ga0070677_10060494 3300005333 Bacteria 1561
28 Ga0070677_10172898 3300005333 Bacteria 1023
29 Ga0068869_100008068 3300005334 Bacteria 6767
30 Ga0068869_100011581 3300005334 Bacteria 5790
31 Ga0068869_100168532 3300005334 Bacteria 1709
32 Ga0070666_10000785 3300005335 Bacteria 19230
33 Ga0070666_10030100 3300005335 Bacteria 3574
34 Ga0070666_10242463 3300005335 Bacteria 1275
35 Ga0070666_10479421 3300005335 Bacteria 901
36 Ga0070680_100071875 3300005336 Bacteria 2843
37 Ga0068868_100007918 3300005338 Bacteria 7590
38 Ga0068868_100095787 3300005338 Bacteria 2396
39 Ga0068868_100533879 3300005338 Bacteria 1032
40 Ga0068868_100557441 3300005338 Bacteria 1011
41 Ga0070660_100288036 3300005339 Bacteria 1345
42 Ga0070660_100437523 3300005339 Bacteria 1084
43 Ga0070687_100035933 3300005343 Bacteria 2465
44 Ga0070687_100036816 3300005343 Bacteria 2442
45 Ga0070661_100010088 3300005344 Bacteria 6559
46 Ga0070661_100044171 3300005344 Bacteria 3255
47 Ga0070661_100607515 3300005344 Bacteria 885
48 Ga0070668_100020742 3300005347 Bacteria 4962
49 Ga0070668_100024278 3300005347 Bacteria 4592
50 Ga0070668_100262673 3300005347 Bacteria 1436
51 Ga0070669_100018661 3300005353 Bacteria 4957
52 Ga0070675_100000285 3300005354 Bacteria 33772
53 Ga0070675_100012138 3300005354 Bacteria 6755
54 Ga0070675_100045165 3300005354 Bacteria 3604
55 Ga0070675_100053552 3300005354 Bacteria 3319
56 Ga0070675_100193125 3300005354 Bacteria 1765
57 Ga0070675_100226883 3300005354 Bacteria 1628
58 Ga0070675_100496180 3300005354 Bacteria 1100
59 Ga0070671_100002193 3300005355 Bacteria 15088
60 Ga0070671_100029968 3300005355 Bacteria 4489
61 Ga0070671_100083482 3300005355 Bacteria 2671
62 Ga0070671_100371872 3300005355 Bacteria 1221
63 Ga0070674_100016028 3300005356 Bacteria 4693
64 Ga0070674_100242835 3300005356 Bacteria 1411
65 Ga0070674_101088983 3300005356 Bacteria 705
66 Ga0070673_100001009 3300005364 Bacteria 15963
67 Ga0070673_100013002 3300005364 Bacteria 5740
68 Ga0070673_100045390 3300005364 Bacteria 3408
69 Ga0070673_100058983 3300005364 Bacteria 3037
70 Ga0070673_100118743 3300005364 Bacteria 2202
71 Ga0070673_100360276 3300005364 Bacteria 1292
72 Ga0070673_100370306 3300005364 Bacteria 1275
73 Ga0070673_100374965 3300005364 Bacteria 1267
74 Ga0070673_100461506 3300005364 Bacteria 1144
75 Ga0070673_101063927 3300005364 Bacteria 755
76 Ga0070688_100036467 3300005365 Bacteria 2991
77 Ga0070659_100014835 3300005366 Bacteria 5826
78 Ga0070659_100077876 3300005366 Bacteria 2645
79 Ga0070659_100135626 3300005366 Bacteria 2001
80 Ga0070659_100181536 3300005366 Bacteria 1727
81 Ga0070659_100690844 3300005366 Bacteria 882
82 Ga0070667_100002773 3300005367 Bacteria 15141
83 Ga0070667_100003684 3300005367 Bacteria 13046
84 Ga0070667_100028108 3300005367 Bacteria 4680
85 Ga0070667_100212319 3300005367 Bacteria 1720
86 Ga0070705_100486477 3300005440 Bacteria 934
87 Ga0070700_100018609 3300005441 Bacteria 3996
88 Ga0070700_100372175 3300005441 Bacteria 1066
89 Ga0070663_100004332 3300005455 Bacteria 8320
90 Ga0070663_100263123 3300005455 Bacteria 1369
91 Ga0070663_100482505 3300005455 Bacteria 1026
92 Ga0070678_100013525 3300005456 Bacteria 5121
93 Ga0070678_100076132 3300005456 Bacteria 2527
94 Ga0070678_100156891 3300005456 Bacteria 1839
95 Ga0070678_100267740 3300005456 Bacteria 1440
96 Ga0070678_100346254 3300005456 Bacteria 1276
97 Ga0070662_100009041 3300005457 Bacteria 6499
98 Ga0070662_100020504 3300005457 Bacteria 4501
99 Ga0070662_100069801 3300005457 Bacteria 2588
100 Ga0070662_100249004 3300005457 Bacteria 1428
101 Ga0070681_10146961 3300005458 Bacteria 2286
102 Ga0070681_10309642 3300005458 Bacteria 1489
103 Ga0068867_100002447 3300005459 Bacteria 13049
104 Ga0068867_100004433 3300005459 Bacteria 9869
105 Ga0068867_100007433 3300005459 Bacteria 7748
106 Ga0068867_100039871 3300005459 Bacteria 3425
107 Ga0068867_100124950 3300005459 Bacteria 1992
108 Ga0068867_100224474 3300005459 Bacteria 1515
109 Ga0068867_100299742 3300005459 Bacteria 1325
110 Ga0070685_10657770 3300005466 Bacteria 760
111 Ga0070706_100272323 3300005467 Bacteria 1580
112 Ga0070679_100006907 3300005530 Bacteria 10586
113 Ga0068853_100246714 3300005539 Bacteria 1638
114 Ga0068853_100256719 3300005539 Bacteria 1606
115 Ga0068853_100560765 3300005539 Bacteria 1083
116 Ga0070672_100001055 3300005543 Bacteria 16808
117 Ga0070672_100004909 3300005543 Bacteria 8799
118 Ga0070672_100005119 3300005543 Bacteria 8650
119 Ga0070672_100135152 3300005543 Bacteria 2030
120 Ga0070672_100272432 3300005543 Bacteria 1430
121 Ga0070672_100360518 3300005543 Bacteria 1241
122 Ga0070672_100367637 3300005543 Bacteria 1228
123 Ga0070672_100454295 3300005543 Bacteria 1104
124 Ga0070686_100136845 3300005544 Bacteria 1701
125 Ga0070696_101111257 3300005546 Bacteria 665
126 Ga0070693_100014753 3300005547 Bacteria 4010
127 Ga0070693_100040019 3300005547 Bacteria 2630
128 Ga0070665_100368145 3300005548 Bacteria 1444
129 Ga0070665_100457227 3300005548 Bacteria 1287
130 Ga0068855_100112152 3300005563 Bacteria 3129
131 Ga0068855_100260848 3300005563 Bacteria 1930
132 Ga0068855_100438043 3300005563 Bacteria 1428
133 Ga0068855_100719572 3300005563 Bacteria 1067
134 Ga0070664_100204419 3300005564 Bacteria 1763
135 Ga0070664_100228694 3300005564 Bacteria 1667
136 Ga0068857_100030013 3300005577 Bacteria 4797
137 Ga0068857_100174232 3300005577 Bacteria 1956
138 Ga0068857_100616099 3300005577 Bacteria 1027
139 Ga0068854_100013259 3300005578 Bacteria 5404
140 Ga0068854_100103094 3300005578 Bacteria 2141
141 Ga0068854_100231854 3300005578 Bacteria 1466
142 Ga0068856_100000887 3300005614 Bacteria 32039
143 Ga0068856_100030381 3300005614 Bacteria 5282
144 Ga0068856_100071622 3300005614 Bacteria 3431
145 Ga0068856_100474074 3300005614 Bacteria 1272
146 Ga0068852_100005860 3300005616 Bacteria 8830
147 Ga0068852_100046534 3300005616 Bacteria 3698
148 Ga0068852_100059785 3300005616 Bacteria 3306
149 Ga0068852_100353942 3300005616 Bacteria 1434
150 Ga0068852_101374956 3300005616 Bacteria 728
151 Ga0068859_100006127 3300005617 Bacteria 12221
152 Ga0068859_100443281 3300005617 Bacteria 1395
153 Ga0068859_100973853 3300005617 Bacteria 931
154 Ga0068859_101944004 3300005617 Bacteria 649
155 Ga0068864_100008087 3300005618 Bacteria 8673
156 Ga0068864_100016853 3300005618 Bacteria 6088
157 Ga0068864_100023050 3300005618 Bacteria 5226
158 Ga0068864_100506024 3300005618 Bacteria 1163
159 Ga0068864_101392331 3300005618 Bacteria 703
160 Ga0068866_10009144 3300005718 Bacteria 4200
161 Ga0068866_10009815 3300005718 Bacteria 4080
162 Ga0068866_10271590 3300005718 Bacteria 1047
163 Ga0068861_100003647 3300005719 Bacteria 10261
164 Ga0068861_100004823 3300005719 Bacteria 9067
165 Ga0068861_100194135 3300005719 Bacteria 1700
166 Ga0068851_10021056 3300005834 Bacteria 3163
167 Ga0068851_10059184 3300005834 Bacteria 1960
168 Ga0068851_10085227 3300005834 Bacteria 1656
169 Ga0068851_10101746 3300005834 Bacteria 1525
170 Ga0068851_10276550 3300005834 Bacteria 959
171 Ga0068851_10326552 3300005834 Bacteria 888
172 Ga0068851_10564886 3300005834 Bacteria 689
173 Ga0068870_10171292 3300005840 Bacteria 1296
174 Ga0068863_100003799 3300005841 Bacteria 14929
175 Ga0068863_100004935 3300005841 Bacteria 13153
176 Ga0068863_100089393 3300005841 Bacteria 2920
177 Ga0068863_100106230 3300005841 Bacteria 2671
178 Ga0068863_100174157 3300005841 Bacteria 2065
179 Ga0068858_100002240 3300005842 Bacteria 19545
180 Ga0068858_100018725 3300005842 Bacteria 6480
181 Ga0068858_100088224 3300005842 Bacteria 2886
182 Ga0068860_100000445 3300005843 Bacteria 52236
183 Ga0068860_100011586 3300005843 Bacteria 8694
184 Ga0068860_100039326 3300005843 Bacteria 4523
185 Ga0068860_100545984 3300005843 Bacteria 1161
186 Ga0068860_100827891 3300005843 Bacteria 940
187 Ga0068860_101248688 3300005843 Bacteria 763
188 Ga0068862_100007883 3300005844 Bacteria 8812
189 Ga0068862_100032693 3300005844 Bacteria 4395
190 Ga0068862_100100314 3300005844 Bacteria 2532
191 Ga0068862_100506607 3300005844 Bacteria 1146
192 Ga0075364_10036027 3300006051 Bacteria 3199
193 Ga0070715_10295230 3300006163 Bacteria 865
194 Ga0075367_10133581 3300006178 Bacteria 1535
195 Ga0075366_10004769 3300006195 Bacteria 7313
196 Ga0075366_10053926 3300006195 Bacteria 2388
197 Ga0075366_10170492 3300006195 Bacteria 1320
198 Ga0075366_10195127 3300006195 Bacteria 1231
199 Ga0075366_10227101 3300006195 Bacteria 1137
200 Ga0075366_10289739 3300006195 Bacteria 1001
201 Ga0097621_100010996 3300006237 Bacteria 6648
202 Ga0097621_100011620 3300006237 Bacteria 6492
203 Ga0097621_100018005 3300006237 Bacteria 5383
204 Ga0075370_10005206 3300006353 Bacteria 6433
205 Ga0075370_10183503 3300006353 Bacteria 1232
206 Ga0075370_10228152 3300006353 Bacteria 1102
207 Ga0068871_100019544 3300006358 Bacteria 5174
208 Ga0068871_100030326 3300006358 Bacteria 4257
209 Ga0068871_100165884 3300006358 Bacteria 1891
210 Ga0068871_100308898 3300006358 Bacteria 1390
211 Ga0068871_100803377 3300006358 Bacteria 867
212 Ga0075434_100499961 3300006871 Bacteria 1237
213 Ga0068865_100016331 3300006881 Bacteria 4750
214 Ga0068865_100043762 3300006881 Bacteria 3061
215 Ga0068865_100186818 3300006881 Bacteria 1599
216 Ga0068865_100292425 3300006881 Bacteria 1301
217 Ga0097620_100006126 3300006931 Bacteria 12221
218 Ga0097620_100134911 3300006931 Bacteria 2541
219 Ga0097620_100443297 3300006931 Bacteria 1395
220 Ga0097620_100973874 3300006931 Bacteria 931
221 Ga0097620_101943922 3300006931 Bacteria 649
222 Ga0079104_1000219 3300006946 Bacteria 79928
223 Ga0105240_10056490 3300009093 Bacteria 4911
224 Ga0105245_10241285 3300009098 Bacteria 1752
225 Ga0105245_10468442 3300009098 Bacteria 1271
226 Ga0105245_10669515 3300009098 Bacteria 1069
227 Ga0105245_11584974 3300009098 Bacteria 706
228 Ga0105247_10075644 3300009101 Bacteria 2114
229 Ga0105243_10005579 3300009148 Bacteria 9801
230 Ga0105243_10027205 3300009148 Bacteria 4380
231 Ga0105243_10075641 3300009148 Bacteria 2734
232 Ga0105243_10076482 3300009148 Bacteria 2720
233 Ga0105243_10359554 3300009148 Bacteria 1339
234 Ga0105243_10471184 3300009148 Bacteria 1183
235 Ga0105242_10108564 3300009176 Bacteria 2362
236 Ga0105242_10223305 3300009176 Bacteria 1685
237 Ga0105242_10276735 3300009176 Bacteria 1523
238 Ga0105242_10820157 3300009176 Bacteria 923
239 Ga0105242_11086935 3300009176 Bacteria 813
240 Ga0105248_10004957 3300009177 Bacteria 14713
241 Ga0105248_10085019 3300009177 Bacteria 3560
242 Ga0105248_10094534 3300009177 Bacteria 3366
243 Ga0105248_10102774 3300009177 Bacteria 3221
244 Ga0105248_10129449 3300009177 Bacteria 2847
245 Ga0105248_10143573 3300009177 Bacteria 2693
246 Ga0105248_10171731 3300009177 Bacteria 2443
247 Ga0105248_10177050 3300009177 Bacteria 2403
248 Ga0105248_11089692 3300009177 Bacteria 903
249 Ga0105237_10001461 3300009545 Bacteria 31169
250 Ga0105237_10136973 3300009545 Bacteria 2443
251 Ga0105238_10041551 3300009551 Bacteria 4656
252 Ga0105238_10080234 3300009551 Bacteria 3253
253 Ga0105238_10247603 3300009551 Bacteria 1760
254 Ga0105238_10276361 3300009551 Bacteria 1660
255 Ga0105249_10005956 3300009553 Bacteria 10564
256 Ga0105249_10095215 3300009553 Bacteria 2791
257 Ga0105249_10174875 3300009553 Bacteria 2084
258 Ga0105249_10209339 3300009553 Bacteria 1913
259 Ga0105249_11431945 3300009553 Bacteria 763
260 Ga0105239_10000798 3300010375 Bacteria 44685
261 Ga0105239_10260323 3300010375 Bacteria 1949
262 Ga0105246_10137453 3300011119 Bacteria 1833
263 Ga0105246_10427767 3300011119 Bacteria 1107
264 Ga0105246_10448240 3300011119 Bacteria 1084
265 Ga0157315_1002653 3300012508 Bacteria 1137
266 Ga0157373_10261401 3300013100 Bacteria 1225
267 Ga0157371_10116977 3300013102 Bacteria 1895
268 Ga0157371_10171560 3300013102 Bacteria 1550
269 Ga0157371_10376636 3300013102 Bacteria 1036
270 Ga0157370_10737177 3300013104 Bacteria 898
271 Ga0157369_10200535 3300013105 Bacteria 2095
272 Ga0157374_10034608 3300013296 Bacteria 4616
273 Ga0157374_10998650 3300013296 Bacteria 856
274 Ga0157378_10026414 3300013297 Bacteria 5118
275 Ga0157378_10446469 3300013297 Bacteria 1283
276 Ga0157378_10464780 3300013297 Bacteria 1258
277 Ga0157378_10661106 3300013297 Bacteria 1061
278 Ga0163162_10002995 3300013306 Bacteria 16145
279 Ga0163162_10018246 3300013306 Bacteria 6872
280 Ga0163162_10034726 3300013306 Bacteria 5020
281 Ga0163162_10281661 3300013306 Bacteria 1795
282 Ga0163162_10530677 3300013306 Bacteria 1306
283 Ga0157372_10021809 3300013307 Bacteria 6923
284 Ga0157372_10056661 3300013307 Bacteria 4378
285 Ga0157372_10456279 3300013307 Bacteria 1489
286 Ga0157375_10011447 3300013308 Bacteria 7833
287 Ga0157375_10022022 3300013308 Bacteria 5860
288 Ga0157375_10028630 3300013308 Bacteria 5227
289 Ga0157375_10073701 3300013308 Bacteria 3433
290 Ga0157375_10694567 3300013308 Bacteria 1171
291 Ga0157375_10905174 3300013308 Bacteria 1026
292 Ga0163163_10045264 3300014325 Bacteria 4319
293 Ga0163163_10397389 3300014325 Bacteria 1436
294 Ga0163163_10461235 3300014325 Bacteria 1331
295 Ga0163163_10656366 3300014325 Bacteria 1112
296 Ga0157380_10011565 3300014326 Bacteria 6378
297 Ga0157380_10038429 3300014326 Bacteria 3716
298 Ga0157380_10145152 3300014326 Bacteria 2044
299 Ga0157380_10211694 3300014326 Bacteria 1728
300 Ga0157380_10452633 3300014326 Bacteria 1233
301 Ga0157377_10000038 3300014745 Bacteria 113777
302 Ga0157377_10017418 3300014745 Bacteria 3715
303 Ga0157377_10270645 3300014745 Bacteria 1109
304 Ga0157379_10008098 3300014968 Bacteria 9127
305 Ga0157379_10076979 3300014968 Bacteria 2987
306 Ga0157379_10099388 3300014968 Bacteria 2612
307 Ga0157379_10111157 3300014968 Bacteria 2461
308 Ga0157379_10124316 3300014968 Bacteria 2321
309 Ga0157379_10287151 3300014968 Bacteria 1498
310 Ga0157379_10301319 3300014968 Bacteria 1461
311 Ga0157379_11144933 3300014968 Bacteria 746
312 Ga0157376_10016516 3300014969 Bacteria 5607
313 Ga0157376_10034451 3300014969 Bacteria 4089
314 Ga0157376_10336084 3300014969 Bacteria 1441
315 Ga0163161_10011344 3300017792 Bacteria 6179
316 Ga0163161_10023239 3300017792 Bacteria 4372
317 Ga0163161_10156286 3300017792 Bacteria 1736
318 Ga0206353_11541288 3300020082 Bacteria 709
319 Ga0213872_10000124 3300021361 Bacteria 72197
320 Ga0213872_10025664 3300021361 Bacteria 2708
321 Ga0213874_10066794 3300021377 Bacteria 1139
322 Ga0213876_10033899 3300021384 Bacteria 2692
323 Ga0209674_100064 3300025226 Bacteria 265769
324 Ga0209563_100005 3300025230 Bacteria 1774893
325 Ga0209563_100126 3300025230 Bacteria 113122
326 Ga0209258_100905 3300025242 Bacteria 15234
327 Ga0207425_1000135 3300025245 Bacteria 66450
328 Ga0209646_1000060 3300025246 Bacteria 256386
329 Ga0209026_1000049 3300025250 Bacteria 255273
330 Ga0209677_100099 3300025253 Bacteria 92370
331 Ga0209677_100229 3300025253 Bacteria 39781
332 Ga0209759_1000069 3300025256 Bacteria 182437
333 Ga0209759_1001738 3300025256 Bacteria 11175
334 Ga0209129_1000043 3300025258 Bacteria 298978
335 Ga0209565_1011977 3300025263 Bacteria 2086
336 Ga0209673_1006841 3300025273 Bacteria 5407
337 Ga0209673_1024511 3300025273 Bacteria 2025
338 Ga0209673_1030482 3300025273 Bacteria 1698
339 Ga0209675_1007084 3300025291 Bacteria 4369
340 Ga0209564_1000014 3300025295 Bacteria 621501
341 Ga0209758_1000492 3300025297 Bacteria 64511
342 Ga0209758_1005135 3300025297 Bacteria 10334
343 Ga0209050_1000493 3300025298 Bacteria 67885
344 Ga0209050_1000543 3300025298 Bacteria 62404
345 Ga0209256_1000092 3300025299 Bacteria 210547
346 Ga0209256_1061866 3300025299 Bacteria 869
347 Ga0209051_1000020 3300025303 Bacteria 508628
348 Ga0209051_1019596 3300025303 Bacteria 2945
349 Ga0209257_1000189 3300025304 Bacteria 153917
350 Ga0209257_1047791 3300025304 Bacteria 1228
351 Ga0207697_10029600 3300025315 Bacteria 2241
352 Ga0207697_10054283 3300025315 Bacteria 1660
353 Ga0207697_10059751 3300025315 Bacteria 1584
354 Ga0207697_10168221 3300025315 Bacteria 958
355 Ga0207656_10036966 3300025321 Bacteria 2052
356 Ga0207656_10050341 3300025321 Bacteria 1798
357 Ga0207656_10170497 3300025321 Bacteria 1040
358 Ga0207682_10001133 3300025893 Bacteria 12330
359 Ga0207682_10127067 3300025893 Bacteria 1135
360 Ga0207682_10203306 3300025893 Bacteria 911
361 Ga0207642_10011641 3300025899 Bacteria 3147
362 Ga0207642_10038390 3300025899 Bacteria 2072
363 Ga0207642_10472945 3300025899 Bacteria 763
364 Ga0207688_10209477 3300025901 Bacteria 1171
365 Ga0207680_10153557 3300025903 Bacteria 1537
366 Ga0207680_10300438 3300025903 Bacteria 1119
367 Ga0207680_10331701 3300025903 Bacteria 1066
368 Ga0207645_10001485 3300025907 Bacteria 19163
369 Ga0207645_10003455 3300025907 Bacteria 11994
370 Ga0207645_10032134 3300025907 Bacteria 3375
371 Ga0207645_10040758 3300025907 Bacteria 2974
372 Ga0207645_10086286 3300025907 Bacteria 2016
373 Ga0207645_10167509 3300025907 Bacteria 1439
374 Ga0207645_10431195 3300025907 Bacteria 889
375 Ga0207643_10043348 3300025908 Bacteria 2539
376 Ga0207643_10143132 3300025908 Bacteria 1429
377 Ga0207643_10485155 3300025908 Bacteria 789
378 Ga0207705_10035148 3300025909 Bacteria 3585
379 Ga0207705_10254922 3300025909 Bacteria 1338
380 Ga0207707_10217021 3300025912 Bacteria 1665
381 Ga0207695_10042429 3300025913 Bacteria 4859
382 Ga0207671_10010195 3300025914 Bacteria 7780
383 Ga0207671_10080694 3300025914 Bacteria 2439
384 Ga0207660_10047209 3300025917 Bacteria 3043
385 Ga0207662_10008374 3300025918 Bacteria 5661
386 Ga0207662_10098300 3300025918 Bacteria 1811
387 Ga0207657_10196071 3300025919 Bacteria 1627
388 Ga0207657_10260853 3300025919 Bacteria 1379
389 Ga0207649_10009230 3300025920 Bacteria 5393
390 Ga0207649_10332951 3300025920 Bacteria 1119
391 Ga0207649_10744991 3300025920 Bacteria 762
392 Ga0207652_10092835 3300025921 Bacteria 2655
393 Ga0207681_10004618 3300025923 Bacteria 8465
394 Ga0207681_10035795 3300025923 Bacteria 3273
395 Ga0207681_10259577 3300025923 Bacteria 1360
396 Ga0207681_10348704 3300025923 Bacteria 1184
397 Ga0207694_10025174 3300025924 Bacteria 4521
398 Ga0207694_10105545 3300025924 Bacteria 2237
399 Ga0207694_10178316 3300025924 Bacteria 1722
400 Ga0207694_10203967 3300025924 Bacteria 1609
401 Ga0207650_10003908 3300025925 Bacteria 10189
402 Ga0207650_10055912 3300025925 Bacteria 2931
403 Ga0207650_10110025 3300025925 Bacteria 2131
404 Ga0207650_10392359 3300025925 Bacteria 1148
405 Ga0207650_10421572 3300025925 Bacteria 1107
406 Ga0207659_10000477 3300025926 Bacteria 24093
407 Ga0207659_10032109 3300025926 Bacteria 3600
408 Ga0207659_10092971 3300025926 Bacteria 2256
409 Ga0207659_10204965 3300025926 Bacteria 1577
410 Ga0207687_10064103 3300025927 Bacteria 2604
411 Ga0207687_10246794 3300025927 Bacteria 1417
412 Ga0207687_10420010 3300025927 Bacteria 1103
413 Ga0207644_10002098 3300025931 Bacteria 12916
414 Ga0207644_10006058 3300025931 Bacteria 7888
415 Ga0207644_10012856 3300025931 Bacteria 5568
416 Ga0207644_10017153 3300025931 Bacteria 4884
417 Ga0207644_10028271 3300025931 Bacteria 3880
418 Ga0207644_10164021 3300025931 Bacteria 1729
419 Ga0207644_10310410 3300025931 Bacteria 1273
420 Ga0207690_10059776 3300025932 Bacteria 2584
421 Ga0207706_10000756 3300025933 Bacteria 33603
422 Ga0207706_10004450 3300025933 Bacteria 13166
423 Ga0207706_10051089 3300025933 Bacteria 3651
424 Ga0207706_10427490 3300025933 Bacteria 1147
425 Ga0207706_10512977 3300025933 Bacteria 1034
426 Ga0207706_10954362 3300025933 Bacteria 722
427 Ga0207686_10065322 3300025934 Bacteria 2320
428 Ga0207686_10104121 3300025934 Bacteria 1900
429 Ga0207686_10237298 3300025934 Bacteria 1325
430 Ga0207686_10271432 3300025934 Bacteria 1248
431 Ga0207709_10003694 3300025935 Bacteria 9012
432 Ga0207709_10012740 3300025935 Bacteria 4635
433 Ga0207709_10247401 3300025935 Bacteria 1300
434 Ga0207709_10323691 3300025935 Bacteria 1155
435 Ga0207670_10025777 3300025936 Bacteria 3696
436 Ga0207669_10006650 3300025937 Bacteria 5299
437 Ga0207669_10150979 3300025937 Bacteria 1627
438 Ga0207669_10504645 3300025937 Bacteria 968
439 Ga0207669_11106899 3300025937 Bacteria 669
440 Ga0207704_10027876 3300025938 Bacteria 3124
441 Ga0207704_10085743 3300025938 Bacteria 2052
442 Ga0207704_10128832 3300025938 Bacteria 1748
443 Ga0207704_10154010 3300025938 Bacteria 1626
444 Ga0207704_10214036 3300025938 Bacteria 1421
445 Ga0207665_10274839 3300025939 Bacteria 1252
446 Ga0207691_10003923 3300025940 Bacteria 14453
447 Ga0207691_10005630 3300025940 Bacteria 12112
448 Ga0207691_10017263 3300025940 Bacteria 6846
449 Ga0207691_10086956 3300025940 Bacteria 2804
450 Ga0207691_10111776 3300025940 Bacteria 2429
451 Ga0207691_10181038 3300025940 Bacteria 1842
452 Ga0207691_10183319 3300025940 Bacteria 1828
453 Ga0207691_10353869 3300025940 Bacteria 1256
454 Ga0207711_10021174 3300025941 Bacteria 5431
455 Ga0207711_10087955 3300025941 Bacteria 2727
456 Ga0207711_10173950 3300025941 Bacteria 1955
457 Ga0207711_10187313 3300025941 Bacteria 1884
458 Ga0207711_10398515 3300025941 Bacteria 1278
459 Ga0207711_10624137 3300025941 Bacteria 1006
460 Ga0207689_10006829 3300025942 Bacteria 10035
461 Ga0207689_10012976 3300025942 Bacteria 7115
462 Ga0207689_10015924 3300025942 Bacteria 6366
463 Ga0207689_10170138 3300025942 Bacteria 1796
464 Ga0207689_10290938 3300025942 Bacteria 1353
465 Ga0207689_10512444 3300025942 Bacteria 1006
466 Ga0207661_10109080 3300025944 Bacteria 2338
467 Ga0207661_10465463 3300025944 Bacteria 1153
468 Ga0207661_10744017 3300025944 Bacteria 902
469 Ga0207679_10187645 3300025945 Bacteria 1716
470 Ga0207667_10001779 3300025949 Bacteria 27124
471 Ga0207667_10027622 3300025949 Bacteria 6174
472 Ga0207667_10284225 3300025949 Bacteria 1690
473 Ga0207667_10389035 3300025949 Bacteria 1420
474 Ga0207651_10014724 3300025960 Bacteria 4525
475 Ga0207651_10016116 3300025960 Bacteria 4366
476 Ga0207651_10026134 3300025960 Bacteria 3641
477 Ga0207651_10063782 3300025960 Bacteria 2575
478 Ga0207651_10109427 3300025960 Bacteria 2070
479 Ga0207651_10528183 3300025960 Bacteria 1023
480 Ga0207651_10574223 3300025960 Bacteria 983
481 Ga0207651_10615298 3300025960 Bacteria 951
482 Ga0207712_10011348 3300025961 Bacteria 5675
483 Ga0207712_10066863 3300025961 Bacteria 2571
484 Ga0207712_10096638 3300025961 Bacteria 2187
485 Ga0207712_10208354 3300025961 Bacteria 1555
486 Ga0207712_10798811 3300025961 Bacteria 829
487 Ga0207668_10004912 3300025972 Bacteria 7862
488 Ga0207668_10060300 3300025972 Bacteria 2662
489 Ga0207668_10159802 3300025972 Bacteria 1754
490 Ga0207668_10643016 3300025972 Bacteria 928
491 Ga0207640_10050170 3300025981 Bacteria 2706
492 Ga0207640_10180862 3300025981 Bacteria 1581
493 Ga0207640_10236278 3300025981 Bacteria 1409
494 Ga0207640_10415126 3300025981 Bacteria 1100
495 Ga0207658_10001089 3300025986 Bacteria 21924
496 Ga0207658_10018268 3300025986 Bacteria 4839
497 Ga0207658_10027241 3300025986 Bacteria 4013
498 Ga0207658_10229553 3300025986 Bacteria 1566
499 Ga0207658_10365492 3300025986 Bacteria 1260
500 Ga0207677_10003776 3300026023 Bacteria 8043
501 Ga0207677_10041582 3300026023 Bacteria 3041
502 Ga0207677_10063934 3300026023 Bacteria 2560
503 Ga0207677_10192071 3300026023 Bacteria 1616
504 Ga0207703_10000996 3300026035 Bacteria 27254
505 Ga0207703_10011365 3300026035 Bacteria 6926
506 Ga0207703_10041270 3300026035 Bacteria 3695
507 Ga0207703_10292989 3300026035 Bacteria 1482
508 Ga0207703_10426963 3300026035 Bacteria 1234
509 Ga0207639_10026149 3300026041 Bacteria 4239
510 Ga0207639_10159358 3300026041 Bacteria 1900
511 Ga0207639_10378573 3300026041 Bacteria 1270
512 Ga0207678_10000966 3300026067 Bacteria 26297
513 Ga0207678_10022962 3300026067 Bacteria 5459
514 Ga0207678_10170485 3300026067 Bacteria 1858
515 Ga0207678_10248405 3300026067 Bacteria 1524
516 Ga0207678_10513594 3300026067 Bacteria 1045
517 Ga0207678_10886482 3300026067 Bacteria 789
518 Ga0207708_10012827 3300026075 Bacteria 6249
519 Ga0207708_10084433 3300026075 Bacteria 2441
520 Ga0207708_10796951 3300026075 Bacteria 813
521 Ga0207702_10001447 3300026078 Bacteria 23592
522 Ga0207702_10039270 3300026078 Bacteria 3965
523 Ga0207702_10095359 3300026078 Bacteria 2614
524 Ga0207702_10184339 3300026078 Bacteria 1924
525 Ga0207641_10007488 3300026088 Bacteria 9086
526 Ga0207641_10017054 3300026088 Bacteria 5942
527 Ga0207641_10027717 3300026088 Bacteria 4680
528 Ga0207641_10338895 3300026088 Bacteria 1430
529 Ga0207641_10627346 3300026088 Bacteria 1054
530 Ga0207641_10671194 3300026088 Bacteria 1019
531 Ga0207641_10933529 3300026088 Bacteria 862
532 Ga0207641_11081835 3300026088 Bacteria 800
533 Ga0207648_10000118 3300026089 Bacteria 77144
534 Ga0207648_10002634 3300026089 Bacteria 19183
535 Ga0207648_10003767 3300026089 Bacteria 15842
536 Ga0207648_10028344 3300026089 Bacteria 4965
537 Ga0207648_10034335 3300026089 Bacteria 4471
538 Ga0207648_10144132 3300026089 Bacteria 2101
539 Ga0207648_10154764 3300026089 Bacteria 2023
540 Ga0207648_10555413 3300026089 Bacteria 1055
541 Ga0207676_10002837 3300026095 Bacteria 12331
542 Ga0207676_10008453 3300026095 Bacteria 7319
543 Ga0207676_10075841 3300026095 Bacteria 2714
544 Ga0207676_10119394 3300026095 Bacteria 2220
545 Ga0207676_10709176 3300026095 Bacteria 975
546 Ga0207676_10778030 3300026095 Bacteria 932
547 Ga0207674_10040240 3300026116 Bacteria 4844
548 Ga0207674_10196958 3300026116 Bacteria 1964
549 Ga0207674_10320406 3300026116 Bacteria 1499
550 Ga0207675_100002744 3300026118 Bacteria 17315
551 Ga0207675_100003062 3300026118 Bacteria 16396
552 Ga0207675_100003340 3300026118 Bacteria 15701
553 Ga0207675_100054366 3300026118 Bacteria 3735
554 Ga0207675_101059939 3300026118 Bacteria 830
555 Ga0207683_10004250 3300026121 Bacteria 12360
556 Ga0207683_10098580 3300026121 Bacteria 2607
557 Ga0207683_10102117 3300026121 Bacteria 2560
558 Ga0207683_10113630 3300026121 Bacteria 2425
559 Ga0207683_10333210 3300026121 Bacteria 1391
560 Ga0207683_10665885 3300026121 Bacteria 964
561 Ga0207683_10706936 3300026121 Bacteria 934
562 Ga0207698_10022610 3300026142 Bacteria 4374
563 Ga0207698_10044988 3300026142 Bacteria 3322
564 Ga0207698_10076294 3300026142 Bacteria 2682
565 Ga0207698_10148841 3300026142 Bacteria 2029
566 Ga0207698_10553626 3300026142 Bacteria 1128
567 Ga0207698_11161424 3300026142 Bacteria 786
568 Ga0209281_1000074 3300027111 Bacteria 267848
569 Ga0268266_10202271 3300028379 Bacteria 1818
570 Ga0268266_10383588 3300028379 Bacteria 1326
571 Ga0268266_10494379 3300028379 Bacteria 1167
572 Ga0268265_10011082 3300028380 Bacteria 6092
573 Ga0268265_10029539 3300028380 Bacteria 3936
574 Ga0268265_10048060 3300028380 Bacteria 3201
575 Ga0268265_10895161 3300028380 Bacteria 871
576 Ga0268264_10001857 3300028381 Bacteria 19207
577 Ga0268264_10002570 3300028381 Bacteria 15905
578 Ga0268264_10005397 3300028381 Bacteria 10824
579 Ga0268264_10465785 3300028381 Bacteria 1227
580 Ga0268264_10493103 3300028381 Bacteria 1193
581 Ga0307517_10355623 3300028786 Bacteria 793
582 Ga0307515_10000188 3300028794 Bacteria 151439
583 Ga0307515_10000708 3300028794 Bacteria 76903
584 Ga0307515_10002971 3300028794 Bacteria 35983
585 Ga0307515_10005461 3300028794 Bacteria 25733
586 Ga0307515_10023160 3300028794 Bacteria 10900
587 Ga0307515_10499075 3300028794 Bacteria 828
588 Ga0307512_10226649 3300030522 Bacteria 967
589 Ga0307513_10008355 3300031456 Bacteria 13260
590 Ga0307513_10329372 3300031456 Bacteria 1282
591 Ga0307509_10229820 3300031507 Bacteria 1659
592 Ga0307509_10626761 3300031507 Bacteria 746
593 Ga0307408_100022119 3300031548 Bacteria 4315
594 Ga0307408_100998114 3300031548 Bacteria 771
595 Ga0307508_10000169 3300031616 Bacteria 78769
596 Ga0307514_10013831 3300031649 Bacteria 6687
597 Ga0307516_10000326 3300031730 Bacteria 61941
598 Ga0307516_10000897 3300031730 Bacteria 40914
599 Ga0307516_10004009 3300031730 Bacteria 18468
600 Ga0307516_10013751 3300031730 Bacteria 8596
601 Ga0307516_10363926 3300031730 Bacteria 1110
602 Ga0307516_10774532 3300031730 Bacteria 620
603 Ga0307405_10014690 3300031731 Bacteria 4219
604 Ga0307405_10271041 3300031731 Bacteria 1273
605 Ga0307412_10017136 3300031911 Bacteria 4332
606 Ga0307412_10643894 3300031911 Bacteria 903
607 Ga0307409_100002191 3300031995 Bacteria 10092
608 Ga0307416_100002040 3300032002 Bacteria 11368
609 Ga0307415_100012627 3300032126 Bacteria 4891
610 Ga0373926_0096227 3300035083 Bacteria 1104
611 Ga0373928_0006412 3300035084 Bacteria 2262
612 Ga0373944_0073850 3300035089 Bacteria 1116
613 Ga0373951_0035326 3300035091 Bacteria 1190
614 Ga0373923_0121198 3300035111 Bacteria 1169
615 Ga0373943_0088252 3300035170 Bacteria 1602
616 Ga0373931_0109225 3300035691 Bacteria 1567
617 Ga0373931_0267977 3300035691 Bacteria 1044
618 Ga0373927_0039242 3300035695 Bacteria 3073
619 Ga0373933_0044022 3300035724 Bacteria 2643
620 Ga0373947_0377373 3300035725 Bacteria 954
621 Ga0373947_0730224 3300035725 Bacteria 676
622 Ga0373937_0010021 3300036401 Bacteria 8264
623 Ga0373937_0010446 3300036401 Bacteria 8106
624 Ga0373937_0019374 3300036401 Bacteria 6091
625 Ga0373925_0009400 3300037068 Bacteria 7117
626 Ga0395898_0013276 3300037466 Bacteria 8484
627 Ga0395905_0023405 3300037471 Bacteria 5837
628 Ga0395905_0092607 3300037471 Bacteria 2834
629 Ga0395905_0500396 3300037471 Bacteria 1115
630 Ga0395901_0025620 3300038443 Bacteria 6055
631 Ga0436365_0269082 3300039437 Bacteria 3442
632 Ga0436361_0638016 3300039447 Bacteria 61418
633 Ga0436361_1079715 3300039447 Bacteria 4877
634 Ga0451789_1262443 3300041443 Bacteria 2071
635 Ga0451793_0222243 3300041452 Bacteria 1201
636 Ga0451795_0973934 3300041456 Bacteria 932
637 Ga0451798_0696078 3300041458 Bacteria 2059
638 Ga0451798_0943568 3300041458 Bacteria 661
639 Ga0451800_0201523 3300041459 Bacteria 2889
640 Ga0451802_0764781 3300041460 Bacteria 707
641 Ga0451807_0144702 3300041486 Bacteria 669
642 Ga0451807_2247218 3300041486 Bacteria 1199
643 Ga0451833_1413866 3300041491 Bacteria 1447
644 Ga0451837_1331648 3300041494 Bacteria 1031
645 Ga0451839_1398550 3300041496 Bacteria 1305
646 Ga0451839_1477579 3300041496 Bacteria 994
647 Ga0451853_0706420 3300041512 Bacteria 1172
648 Ga0451853_1001559 3300041512 Bacteria 1296
649 Ga0451853_1709673 3300041512 Bacteria 788
650 Ga0439455_0000995 3300042012 Bacteria 4450
651 Ga0450917_001576 3300042120 Bacteria 1634
652 Ga0450888_005436 3300042126 Bacteria 1359
653 Ga0450890_001208 3300042127 Bacteria 3743
654 Ga0450897_016535 3300042128 Bacteria 761
655 Ga0439464_0018264 3300042439 Bacteria 1907
656 Ga0450893_0003848 3300042532 Bacteria 2378
657 Ga0450901_022267 3300042533 Bacteria 683
658 Ga0451577_0008482 3300042876 Bacteria 10003
659 Ga0451577_0011912 3300042876 Bacteria 8199
660 Ga0451577_0015837 3300042876 Bacteria 6997
661 Ga0451577_0031249 3300042876 Bacteria 4806
662 Ga0451577_0210878 3300042876 Bacteria 1755
663 Ga0451577_0416698 3300042876 Bacteria 1219
664 Ga0451577_0586475 3300042876 Bacteria 1012
665 Ga0453683_0099201 3300044673 Bacteria 1829
666 Ga0453684_0137499 3300044712 Bacteria 2922
667 Ga0453684_0157052 3300044712 Bacteria 2695
668 Ga0453684_0314595 3300044712 Bacteria 1775
669 Ga0466960_0111680 3300044901 Bacteria 1421
670 Ga0451576_0015228 3300045051 Bacteria 8526
671 Ga0451576_0019110 3300045051 Bacteria 7487
672 Ga0451576_0039970 3300045051 Bacteria 4966
673 Ga0451576_0179833 3300045051 Bacteria 2208
674 Ga0451576_0223298 3300045051 Bacteria 1967
675 Ga0451576_0457407 3300045051 Bacteria 1340
676 Ga0451576_0659431 3300045051 Bacteria 1100
677 Ga0451576_1115371 3300045051 Bacteria 825
678 Ga0451576_1230914 3300045051 Bacteria 781
679 Ga0466967_1017864 3300045976 Bacteria 825
680 Ga0495603_0195820 3300046455 Bacteria 1168
681 Ga0495629_0025312 3300046459 Bacteria 4220
682 Ga0495629_0238822 3300046459 Bacteria 1251
683 Ga0495638_0174148 3300046460 Bacteria 1232
684 Ga0495580_0099089 3300046472 Bacteria 2027
685 Ga0495580_0180471 3300046472 Bacteria 1458
686 Ga0495582_0150989 3300046473 Bacteria 1319
687 Ga0495662_0288837 3300046476 Bacteria 807
688 Ga0495664_0660250 3300046477 Bacteria 619
689 Ga0495608_0051711 3300046511 Bacteria 2722
690 Ga0495610_0146960 3300046512 Bacteria 1009
691 Ga0495620_0110947 3300046515 Bacteria 1087
692 Ga0495632_0006463 3300046519 Bacteria 7529
693 Ga0495632_0115020 3300046519 Bacteria 1260
694 Ga0495643_0021831 3300046522 Bacteria 3664
695 Ga0495652_0496418 3300046529 Bacteria 847
696 Ga0495640_0579661 3300046533 Bacteria 679
697 Ga0495586_0150238 3300046535 Bacteria 1310
698 Ga0495586_0305057 3300046535 Bacteria 912
699 Ga0495598_0027037 3300046537 Bacteria 1579
700 Ga0495621_0101233 3300046539 Bacteria 1097
701 Ga0495621_0270309 3300046539 Bacteria 698
702 Ga0495597_0000584 3300046542 Bacteria 30197
703 Ga0495645_0126462 3300046543 Bacteria 1796
704 Ga0495645_0245601 3300046543 Bacteria 1192
705 Ga0495625_0001533 3300046660 Bacteria 27598
706 Ga0495625_0208647 3300046660 Bacteria 1285
707 Ga0495635_0251003 3300046663 Bacteria 1193
708 Ga0495599_0288996 3300046678 Bacteria 992
709 Ga0495647_0142634 3300046681 Bacteria 1022
710 Ga0495658_0016429 3300046683 Bacteria 3810
711 Ga0495658_0115438 3300046683 Bacteria 1618
712 Ga0495658_0163292 3300046683 Bacteria 1375
713 Ga0495658_0167940 3300046683 Bacteria 1356
714 Ga0495613_0060723 3300046689 Bacteria 2768
715 Ga0495671_0386898 3300046692 Bacteria 670
716 Ga0495674_0671787 3300047319 Bacteria 815
717 Ga0495680_0145655 3300047322 Bacteria 1730
718 Ga0495681_0153145 3300047470 Bacteria 966
719 Ga0495684_0139402 3300047471 Bacteria 1819
720 Ga0496100_0122492 3300048903 Bacteria 1821
721 Ga0496100_0468249 3300048903 Bacteria 968
722 Ga0496101_0178180 3300048904 Bacteria 1636
723 Ga0496101_0763857 3300048904 Bacteria 763
724 Ga0496102_0089284 3300048905 Bacteria 2851
725 Ga0496104_0300869 3300048907 Bacteria 1516
726 Ga0496104_0393688 3300048907 Bacteria 1298
727 Ga0496104_0490063 3300048907 Bacteria 1140
728 Ga0496105_0465025 3300048908 Bacteria 997
729 Ga0496106_0100627 3300048909 Bacteria 2242
730 Ga0496106_0355947 3300048909 Bacteria 1176
731 Ga0496107_0025360 3300048910 Bacteria 4198
732 Ga0496108_0037095 3300048911 Bacteria 4059
733 Ga0496108_0258500 3300048911 Bacteria 1515
734 Ga0496108_1188953 3300048911 Bacteria 645
735 Ga0496109_0140298 3300048912 Bacteria 2260
736 Ga0496109_0179647 3300048912 Bacteria 1987
737 Ga0496110_0318454 3300048913 Bacteria 1417
738 Ga0496110_1118654 3300048913 Bacteria 696
739 Ga0496111_0016712 3300048914 Bacteria 5062
740 Ga0496112_0059693 3300048915 Bacteria 3758
741 Ga0496112_0698405 3300048915 Bacteria 942
742 Ga0496113_0006211 3300048916 Bacteria 7549
743 Ga0496113_0183866 3300048916 Bacteria 1657
744 Ga0496114_0007670 3300048917 Bacteria 8534
745 Ga0496114_0225156 3300048917 Bacteria 1647
746 Ga0501291_004192 3300049514 Bacteria 1831
747 Ga0501292_023759 3300049515 Bacteria 1003
748 Ga0501296_005483 3300049519 Bacteria 1418
749 Ga0501297_007094 3300049520 Bacteria 1209
750 Ga0501298_004484 3300049521 Bacteria 2203
751 Ga0501300_004947 3300049523 Bacteria 1969
752 Ga0501314_005420 3300049530 Bacteria 1086
753 Ga0501046_0000008 3300049580 Bacteria 351167
754 Ga0501047_0000003 3300049581 Bacteria 508375
755 Ga0501048_0042937 3300049582 Bacteria 3236
756 Ga0501048_0673799 3300049582 Bacteria 743
757 Ga0501206_003159 3300049653 Bacteria 2093
758 Ga0501207_024199 3300049654 Bacteria 990
759 Ga0501211_009028 3300049658 Bacteria 974
760 Ga0501217_145269 3300049661 Bacteria 705
761 Ga0501222_001642 3300049662 Bacteria 3107
762 Ga0501235_008379 3300049669 Bacteria 2256
763 Ga0501255_010837 3300049684 Bacteria 1039
764 Ga0501257_020153 3300049686 Bacteria 1564
765 Ga0501258_008448 3300049687 Bacteria 1059
766 Ga0501221_002992 3300049704 Bacteria 2785
767 Ga0501225_0011455 3300049705 Bacteria 2493
768 Ga0501262_002721 3300049759 Bacteria 1995
769 Ga0501262_030401 3300049759 Bacteria 776
770 Ga0501267_002045 3300049764 Bacteria 1783
771 Ga0501272_041492 3300049769 Bacteria 615
772 Ga0501280_020979 3300049776 Bacteria 972
773 Ga0501281_04548 3300049777 Bacteria 973
774 Ga0501283_001477 3300049779 Bacteria 3042
775 Ga0501045_0012726 3300049824 Bacteria 5927
776 nmdc:mga03683_375809_c1 3300050489 Bacteria 676
777 nmdc:mga00v17_19912_c1 3300050491 Bacteria 3837
778 nmdc:mga0k408_109524_c1 3300050493 Bacteria 1632
779 nmdc:mga0k408_122481_c1 3300050493 Bacteria 1541
780 nmdc:mga0k408_26432_c1 3300050493 Bacteria 3291
781 nmdc:mga0k408_446561_c1 3300050493 Bacteria 768
782 nmdc:mga0k408_734_c1 3300050493 Bacteria 16164
783 nmdc:mga0k408_7916_c1 3300050493 Bacteria 2187
784 nmdc:mga06z11_209697_c1 3300050494 Bacteria 1135
785 nmdc:mga07m45_10993_c1 3300050496 Bacteria 4745
786 nmdc:mga07m45_208795_c1 3300050496 Bacteria 1136
787 nmdc:mga07m45_215138_c1 3300050496 Bacteria 1118
788 nmdc:mga07m45_53267_c1 3300050496 Bacteria 2286
789 nmdc:mga07m45_67997_c1 3300050496 Bacteria 2025
790 nmdc:mga07m45_7428_c1 3300050496 Bacteria 5601
791 nmdc:mga09592_6537_c1 3300050508 Bacteria 9494
792 nmdc:mga09592_930274_c1 3300050508 Bacteria 729
793 nmdc:mga0qj67_328911_c1 3300050509 Bacteria 1237
794 nmdc:mga0n895_653332_c1 3300050512 Bacteria 1050
795 Ga0495601_0063743 3300053077 Bacteria 2343
796 Ga0495595_0187504 3300053084 Bacteria 1027
797 Ga0495619_0028690 3300053085 Bacteria 3591
798 Ga0495619_0303277 3300053085 Bacteria 1106
799 Ga0500646_0088162 3300053090 Bacteria 957
800 Ga0500651_0107719 3300053093 Bacteria 1703
801 Ga0500628_035543 3300053129 Bacteria 1108
802 Ga0500642_0003464 3300053130 Bacteria 4773
803 Ga0500652_000027 3300053131 Bacteria 98912
804 Ga0500655_032751 3300053133 Bacteria 1004
805 Ga0500577_0147047 3300053142 Bacteria 997
806 Ga0500604_0011664 3300053151 Bacteria 2364
807 Ga0500622_0000221 3300053156 Bacteria 59833
808 Ga0500645_018285 3300053730 Bacteria 2190
809 Ga0500587_001055 3300053739 Bacteria 3758
810 Ga0501082_0139543 3300060353 Bacteria 2104

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10004009 Ga0307516_1000400911 160
2 3300042128 Ga0450897_016535 Ga0450897_016535_247_744 165
3 iso_pu_bacteria 2643221544 2643745691 173
4 iso_pu_bacteria 2643221646 2644257649 173
5 iso_pu_bacteria 2738541337 2739058631 173
6 3300044712 Ga0453684_0157052 Ga0453684_0157052_463_990 174
7 3300005262 Ga0065165_1000401 Ga0065165_100040130 175
8 3300021361 Ga0213872_10025664 Ga0213872_100256644 175
9 3300039447 Ga0436361_1079715 Ga0436361_1079715_3510_4040 175
10 3300046511 Ga0495608_0051711 Ga0495608_0051711_2177_2704 175
11 3300025230 Ga0209563_100005 Ga0209563_100005719 176
12 3300028794 Ga0307515_10499075 Ga0307515_104990752 176
13 3300042876 Ga0451577_0031249 Ga0451577_0031249_3771_4304 176
14 3300045051 Ga0451576_0179833 Ga0451576_0179833_1544_2077 176
15 3300045051 Ga0451576_0223298 Ga0451576_0223298_827_1360 176
16 3300045051 Ga0451576_1115371 Ga0451576_1115371_269_802 176
17 iso_pu_bacteria 2643221644 2644246337 176
18 3300005364 Ga0070673_101063927 Ga0070673_1010639271 177
19 3300028794 Ga0307515_10000188 Ga0307515_1000018871 177
20 3300042120 Ga0450917_001576 Ga0450917_001576_172_711 177
21 3300042126 Ga0450888_005436 Ga0450888_005436_331_870 177
22 3300042127 Ga0450890_001208 Ga0450890_001208_2993_3532 177
23 3300042532 Ga0450893_0003848 Ga0450893_0003848_481_1020 177
24 3300042533 Ga0450901_022267 Ga0450901_022267_126_665 177
25 3300042876 Ga0451577_0015837 Ga0451577_0015837_2818_3354 177
26 3300042876 Ga0451577_0586475 Ga0451577_0586475_357_893 177
27 3300044673 Ga0453683_0099201 Ga0453683_0099201_466_1002 177
28 3300044712 Ga0453684_0314595 Ga0453684_0314595_1163_1699 177
29 3300045051 Ga0451576_0015228 Ga0451576_0015228_1498_2034 177
30 3300045051 Ga0451576_0457407 Ga0451576_0457407_130_669 177
31 3300046477 Ga0495664_0660250 Ga0495664_0660250_70_609 177
32 3300049514 Ga0501291_004192 Ga0501291_004192_122_658 177
33 3300049519 Ga0501296_005483 Ga0501296_005483_548_1084 177
34 3300049520 Ga0501297_007094 Ga0501297_007094_452_988 177
35 3300049521 Ga0501298_004484 Ga0501298_004484_969_1505 177
36 3300049523 Ga0501300_004947 Ga0501300_004947_190_726 177
37 3300049530 Ga0501314_005420 Ga0501314_005420_414_950 177
38 3300049653 Ga0501206_003159 Ga0501206_003159_676_1212 177
39 3300049658 Ga0501211_009028 Ga0501211_009028_99_635 177
40 3300049661 Ga0501217_145269 Ga0501217_145269_58_594 177
41 3300049662 Ga0501222_001642 Ga0501222_001642_2020_2556 177
42 3300049669 Ga0501235_008379 Ga0501235_008379_237_773 177
43 3300049684 Ga0501255_010837 Ga0501255_010837_318_854 177
44 3300049687 Ga0501258_008448 Ga0501258_008448_29_565 177
45 3300049704 Ga0501221_002992 Ga0501221_002992_1630_2166 177
46 3300049705 Ga0501225_0011455 Ga0501225_0011455_1135_1671 177
47 3300049759 Ga0501262_002721 Ga0501262_002721_757_1293 177
48 3300049764 Ga0501267_002045 Ga0501267_002045_51_587 177
49 3300049769 Ga0501272_041492 Ga0501272_041492_28_564 177
50 3300049776 Ga0501280_020979 Ga0501280_020979_314_850 177
51 3300049779 Ga0501283_001477 Ga0501283_001477_1689_2225 177
52 3300050508 nmdc:mga09592_6537_c1 nmdc:mga09592_6537_c1_8859_9395 177
53 3300050509 nmdc:mga0qj67_328911_c1 nmdc:mga0qj67_328911_c1_526_1062 177
54 3300005347 Ga0070668_100262673 Ga0070668_1002626733 178
55 3300005356 Ga0070674_100242835 Ga0070674_1002428352 178
56 3300005441 Ga0070700_100018609 Ga0070700_1000186094 178
57 3300005456 Ga0070678_100076132 Ga0070678_1000761324 178
58 3300005459 Ga0068867_100002447 Ga0068867_1000024475 178
59 3300005543 Ga0070672_100454295 Ga0070672_1004542953 178
60 3300005548 Ga0070665_100368145 Ga0070665_1003681452 178
61 3300005616 Ga0068852_101374956 Ga0068852_1013749561 178
62 3300005617 Ga0068859_100973853 Ga0068859_1009738532 178
63 3300005718 Ga0068866_10009144 Ga0068866_100091445 178
64 3300005719 Ga0068861_100004823 Ga0068861_1000048235 178
65 3300005834 Ga0068851_10564886 Ga0068851_105648861 178
66 3300005841 Ga0068863_100174157 Ga0068863_1001741574 178
67 3300005842 Ga0068858_100088224 Ga0068858_1000882244 178
68 3300005843 Ga0068860_100011586 Ga0068860_1000115865 178
69 3300005843 Ga0068860_100545984 Ga0068860_1005459842 178
70 3300005844 Ga0068862_100032693 Ga0068862_1000326933 178
71 3300005844 Ga0068862_100100314 Ga0068862_1001003144 178
72 3300006195 Ga0075366_10289739 Ga0075366_102897392 178
73 3300006358 Ga0068871_100803377 Ga0068871_1008033772 178
74 3300006881 Ga0068865_100016331 Ga0068865_1000163312 178
75 3300006931 Ga0097620_100134911 Ga0097620_1001349114 178
76 3300006931 Ga0097620_100973874 Ga0097620_1009738742 178
77 3300009093 Ga0105240_10056490 Ga0105240_100564904 178
78 3300009148 Ga0105243_10027205 Ga0105243_100272054 178
79 3300009148 Ga0105243_10075641 Ga0105243_100756412 178
80 3300009545 Ga0105237_10001461 Ga0105237_1000146112 178
81 3300009551 Ga0105238_10041551 Ga0105238_100415513 178
82 3300009553 Ga0105249_10005956 Ga0105249_100059564 178
83 3300010375 Ga0105239_10000798 Ga0105239_1000079840 178
84 3300013297 Ga0157378_10026414 Ga0157378_100264142 178
85 3300013306 Ga0163162_10002995 Ga0163162_1000299515 178
86 3300014326 Ga0157380_10038429 Ga0157380_100384295 178
87 3300014968 Ga0157379_10287151 Ga0157379_102871512 178
88 3300014968 Ga0157379_10301319 Ga0157379_103013192 178
89 3300025273 Ga0209673_1030482 Ga0209673_10304822 178
90 3300025299 Ga0209256_1061866 Ga0209256_10618661 178
91 3300025899 Ga0207642_10011641 Ga0207642_100116415 178
92 3300025913 Ga0207695_10042429 Ga0207695_100424294 178
93 3300025914 Ga0207671_10010195 Ga0207671_100101956 178
94 3300025923 Ga0207681_10035795 Ga0207681_100357953 178
95 3300025924 Ga0207694_10025174 Ga0207694_100251745 178
96 3300025925 Ga0207650_10421572 Ga0207650_104215722 178
97 3300025935 Ga0207709_10012740 Ga0207709_100127406 178
98 3300025935 Ga0207709_10323691 Ga0207709_103236912 178
99 3300025938 Ga0207704_10214036 Ga0207704_102140362 178
100 3300025940 Ga0207691_10111776 Ga0207691_101117762 178
101 3300025942 Ga0207689_10290938 Ga0207689_102909382 178
102 3300025961 Ga0207712_10208354 Ga0207712_102083541 178
103 3300025986 Ga0207658_10365492 Ga0207658_103654923 178
104 3300026035 Ga0207703_10426963 Ga0207703_104269633 178
105 3300026041 Ga0207639_10026149 Ga0207639_100261492 178
106 3300026075 Ga0207708_10084433 Ga0207708_100844332 178
107 3300026088 Ga0207641_10627346 Ga0207641_106273462 178
108 3300026088 Ga0207641_11081835 Ga0207641_110818352 178
109 3300026089 Ga0207648_10002634 Ga0207648_1000263411 178
110 3300026118 Ga0207675_100003062 Ga0207675_1000030626 178
111 3300026142 Ga0207698_11161424 Ga0207698_111614242 178
112 3300028379 Ga0268266_10494379 Ga0268266_104943792 178
113 3300028380 Ga0268265_10048060 Ga0268265_100480604 178
114 3300028381 Ga0268264_10002570 Ga0268264_100025705 178
115 3300028381 Ga0268264_10465785 Ga0268264_104657852 178
116 3300031730 Ga0307516_10363926 Ga0307516_103639263 178
117 3300035083 Ga0373926_0096227 Ga0373926_0096227_247_786 178
118 3300035695 Ga0373927_0039242 Ga0373927_0039242_132_671 178
119 3300036401 Ga0373937_0019374 Ga0373937_0019374_249_788 178
120 3300042012 Ga0439455_0000995 Ga0439455_0000995_3528_4070 178
121 3300042876 Ga0451577_0008482 Ga0451577_0008482_5583_6122 178
122 3300042876 Ga0451577_0210878 Ga0451577_0210878_804_1343 178
123 3300045051 Ga0451576_0019110 Ga0451576_0019110_3306_3845 178
124 3300045051 Ga0451576_0039970 Ga0451576_0039970_1004_1543 178
125 3300045051 Ga0451576_0659431 Ga0451576_0659431_109_651 178
126 3300046692 Ga0495671_0386898 Ga0495671_0386898_58_597 178
127 3300049582 Ga0501048_0673799 Ga0501048_0673799_188_727 178
128 3300050493 nmdc:mga0k408_446561_c1 nmdc:mga0k408_446561_c1_148_687 178
129 3300005336 Ga0070680_100071875 Ga0070680_1000718755 179
130 3300005458 Ga0070681_10309642 Ga0070681_103096423 179
131 3300005530 Ga0070679_100006907 Ga0070679_1000069076 179
132 3300005563 Ga0068855_100438043 Ga0068855_1004380432 179
133 3300005616 Ga0068852_100046534 Ga0068852_1000465342 179
134 3300025912 Ga0207707_10217021 Ga0207707_102170212 179
135 3300025917 Ga0207660_10047209 Ga0207660_100472092 179
136 3300025921 Ga0207652_10092835 Ga0207652_100928353 179
137 3300025949 Ga0207667_10027622 Ga0207667_100276223 179
138 3300026142 Ga0207698_10022610 Ga0207698_100226104 179
139 3300031730 Ga0307516_10774532 Ga0307516_107745321 179
140 3300031911 Ga0307412_10017136 Ga0307412_100171362 179
141 3300046542 Ga0495597_0000584 Ga0495597_0000584_2246_2848 179
142 3300050489 nmdc:mga03683_375809_c1 nmdc:mga03683_375809_c1_79_621 179
143 3300050496 nmdc:mga07m45_10993_c1 nmdc:mga07m45_10993_c1_3260_3802 179
144 iso_pu_bacteria 2585428057 2587728881 179
145 iso_pu_bacteria 2585428058 2587736482 179
146 3300005364 Ga0070673_100461506 Ga0070673_1004615062 180
147 3300005366 Ga0070659_100690844 Ga0070659_1006908442 180
148 3300005455 Ga0070663_100263123 Ga0070663_1002631233 180
149 3300005467 Ga0070706_100272323 Ga0070706_1002723233 180
150 3300005834 Ga0068851_10085227 Ga0068851_100852272 180
151 3300005843 Ga0068860_100827891 Ga0068860_1008278912 180
152 3300014968 Ga0157379_10099388 Ga0157379_100993882 180
153 3300025907 Ga0207645_10032134 Ga0207645_100321345 180
154 3300025960 Ga0207651_10615298 Ga0207651_106152982 180
155 3300025981 Ga0207640_10236278 Ga0207640_102362782 180
156 3300026035 Ga0207703_10292989 Ga0207703_102929892 180
157 3300026067 Ga0207678_10248405 Ga0207678_102484052 180
158 3300026078 Ga0207702_10095359 Ga0207702_100953592 180
159 3300026089 Ga0207648_10154764 Ga0207648_101547643 180
160 3300031507 Ga0307509_10229820 Ga0307509_102298203 180
161 3300031507 Ga0307509_10626761 Ga0307509_106267611 180
162 3300031548 Ga0307408_100998114 Ga0307408_1009981141 180
163 3300031731 Ga0307405_10271041 Ga0307405_102710412 180
164 3300031911 Ga0307412_10643894 Ga0307412_106438941 180
165 3300049515 Ga0501292_023759 Ga0501292_023759_221_766 180
166 3300049654 Ga0501207_024199 Ga0501207_024199_347_892 180
167 3300049686 Ga0501257_020153 Ga0501257_020153_606_1151 180
168 3300049759 Ga0501262_030401 Ga0501262_030401_160_705 180
169 3300049777 Ga0501281_04548 Ga0501281_04548_30_575 180
170 iso_pu_bacteria 2643221592 2643970510 180
171 iso_pu_bacteria 2643221625 2644142753 180
172 iso_pu_bacteria 2643221648 2644272686 180
173 3300005356 Ga0070674_101088983 Ga0070674_1010889831 181
174 3300013306 Ga0163162_10281661 Ga0163162_102816613 181
175 3300021361 Ga0213872_10000124 Ga0213872_1000012414 181
176 3300031730 Ga0307516_10000326 Ga0307516_100003269 181
177 3300039447 Ga0436361_0638016 Ga0436361_0638016_1416_1973 181
178 3300041460 Ga0451802_0764781 Ga0451802_0764781_71_637 181
179 3300041486 Ga0451807_0144702 Ga0451807_0144702_62_628 181
180 3300042876 Ga0451577_0416698 Ga0451577_0416698_227_778 181
181 3300044712 Ga0453684_0137499 Ga0453684_0137499_450_1001 181
182 3300049580 Ga0501046_0000008 Ga0501046_0000008_88245_88793 181
183 3300049581 Ga0501047_0000003 Ga0501047_0000003_111427_111975 181
184 3300049582 Ga0501048_0042937 Ga0501048_0042937_1916_2464 181
185 3300049824 Ga0501045_0012726 Ga0501045_0012726_1942_2490 181
186 3300060353 Ga0501082_0139543 Ga0501082_0139543_1293_1841 181
187 iso_pu_bacteria 2585428062 2587758584 181
188 3300002773 JGI25152J39213_1002732 JGI25152J39213_10027323 182
189 3300003215 JGI25153J46596_10010114 JGI25153J46596_100101145 182
190 3300003322 rootL2_10208104 rootL2_102081042 182
191 3300003771 Ga0055526_1002081 Ga0055526_10020814 182
192 3300006051 Ga0075364_10036027 Ga0075364_100360273 182
193 3300006178 Ga0075367_10133581 Ga0075367_101335812 182
194 3300006195 Ga0075366_10004769 Ga0075366_100047695 182
195 3300006195 Ga0075366_10170492 Ga0075366_101704922 182
196 3300006353 Ga0075370_10228152 Ga0075370_102281522 182
197 3300009098 Ga0105245_11584974 Ga0105245_115849741 182
198 3300025245 Ga0207425_1000135 Ga0207425_100013537 182
199 3300025258 Ga0209129_1000043 Ga0209129_1000043245 182
200 3300025273 Ga0209673_1024511 Ga0209673_10245113 182
201 3300025295 Ga0209564_1000014 Ga0209564_1000014352 182
202 3300025297 Ga0209758_1000492 Ga0209758_100049229 182
203 3300025297 Ga0209758_1005135 Ga0209758_100513510 182
204 3300025304 Ga0209257_1047791 Ga0209257_10477912 182
205 3300028786 Ga0307517_10355623 Ga0307517_103556232 182
206 3300028794 Ga0307515_10000708 Ga0307515_1000070852 182
207 3300028794 Ga0307515_10002971 Ga0307515_1000297130 182
208 3300030522 Ga0307512_10226649 Ga0307512_102266492 182
209 3300031616 Ga0307508_10000169 Ga0307508_1000016932 182
210 3300041443 Ga0451789_1262443 Ga0451789_1262443_1056_1607 182
211 3300041452 Ga0451793_0222243 Ga0451793_0222243_413_964 182
212 3300041458 Ga0451798_0696078 Ga0451798_0696078_1217_1768 182
213 3300041459 Ga0451800_0201523 Ga0451800_0201523_1669_2220 182
214 3300041496 Ga0451839_1477579 Ga0451839_1477579_147_698 182
215 3300041512 Ga0451853_0706420 Ga0451853_0706420_330_881 182
216 3300044901 Ga0466960_0111680 Ga0466960_0111680_195_743 182
217 3300046460 Ga0495638_0174148 Ga0495638_0174148_118_669 182
218 3300046515 Ga0495620_0110947 Ga0495620_0110947_522_1073 182
219 3300046519 Ga0495632_0006463 Ga0495632_0006463_5420_5971 182
220 3300046660 Ga0495625_0208647 Ga0495625_0208647_106_657 182
221 3300050491 nmdc:mga00v17_19912_c1 nmdc:mga00v17_19912_c1_1640_2197 182
222 3300050493 nmdc:mga0k408_26432_c1 nmdc:mga0k408_26432_c1_540_1091 182
223 3300050494 nmdc:mga06z11_209697_c1 nmdc:mga06z11_209697_c1_278_829 182
224 3300050496 nmdc:mga07m45_208795_c1 nmdc:mga07m45_208795_c1_499_1050 182
225 3300053093 Ga0500651_0107719 Ga0500651_0107719_796_1347 182
226 3300053129 Ga0500628_035543 Ga0500628_035543_221_772 182
227 3300053130 Ga0500642_0003464 Ga0500642_0003464_2567_3118 182
228 3300053131 Ga0500652_000027 Ga0500652_000027_90548_91099 182
229 3300053133 Ga0500655_032751 Ga0500655_032751_189_740 182
230 3300053142 Ga0500577_0147047 Ga0500577_0147047_149_700 182
231 3300053151 Ga0500604_0011664 Ga0500604_0011664_963_1514 182
232 3300053156 Ga0500622_0000221 Ga0500622_0000221_54013_54564 182
233 3300005262 Ga0065165_1007960 Ga0065165_10079602 183
234 3300005355 Ga0070671_100029968 Ga0070671_1000299685 183
235 3300005364 Ga0070673_100360276 Ga0070673_1003602762 183
236 3300025273 Ga0209673_1006841 Ga0209673_10068415 183
237 3300025298 Ga0209050_1000493 Ga0209050_100049338 183
238 3300025303 Ga0209051_1019596 Ga0209051_10195963 183
239 3300025923 Ga0207681_10259577 Ga0207681_102595772 183
240 3300025960 Ga0207651_10574223 Ga0207651_105742232 183
241 3300037471 Ga0395905_0092607 Ga0395905_0092607_1824_2378 183
242 3300053730 Ga0500645_018285 Ga0500645_018285_1557_2111 183
243 3300003775 Ga0055524_1000423 Ga0055524_10004238 184
244 3300005328 Ga0070676_10002580 Ga0070676_100025805 184
245 3300005333 Ga0070677_10060494 Ga0070677_100604943 184
246 3300005334 Ga0068869_100011581 Ga0068869_1000115815 184
247 3300005354 Ga0070675_100193125 Ga0070675_1001931252 184
248 3300005440 Ga0070705_100486477 Ga0070705_1004864772 184
249 3300005459 Ga0068867_100004433 Ga0068867_1000044339 184
250 3300005543 Ga0070672_100004909 Ga0070672_1000049093 184
251 3300005577 Ga0068857_100030013 Ga0068857_1000300136 184
252 3300005840 Ga0068870_10171292 Ga0068870_101712922 184
253 3300006195 Ga0075366_10195127 Ga0075366_101951272 184
254 3300006195 Ga0075366_10227101 Ga0075366_102271012 184
255 3300006353 Ga0075370_10183503 Ga0075370_101835032 184
256 3300006881 Ga0068865_100292425 Ga0068865_1002924252 184
257 3300006946 Ga0079104_1000219 Ga0079104_100021929 184
258 3300009098 Ga0105245_10669515 Ga0105245_106695153 184
259 3300009148 Ga0105243_10471184 Ga0105243_104711843 184
260 3300011119 Ga0105246_10137453 Ga0105246_101374533 184
261 3300013297 Ga0157378_10464780 Ga0157378_104647803 184
262 3300025263 Ga0209565_1011977 Ga0209565_10119773 184
263 3300025291 Ga0209675_1007084 Ga0209675_10070842 184
264 3300025299 Ga0209256_1000092 Ga0209256_100009230 184
265 3300025907 Ga0207645_10001485 Ga0207645_1000148514 184
266 3300025908 Ga0207643_10043348 Ga0207643_100433483 184
267 3300025927 Ga0207687_10420010 Ga0207687_104200102 184
268 3300025931 Ga0207644_10028271 Ga0207644_100282715 184
269 3300025938 Ga0207704_10128832 Ga0207704_101288323 184
270 3300025940 Ga0207691_10003923 Ga0207691_100039236 184
271 3300025942 Ga0207689_10012976 Ga0207689_100129765 184
272 3300025972 Ga0207668_10643016 Ga0207668_106430162 184
273 3300026089 Ga0207648_10003767 Ga0207648_100037676 184
274 3300026116 Ga0207674_10040240 Ga0207674_100402403 184
275 3300027111 Ga0209281_1000074 Ga0209281_100007452 184
276 3300028794 Ga0307515_10023160 Ga0307515_100231607 184
277 3300031456 Ga0307513_10008355 Ga0307513_100083558 184
278 3300031456 Ga0307513_10329372 Ga0307513_103293722 184
279 3300031649 Ga0307514_10013831 Ga0307514_100138316 184
280 3300031730 Ga0307516_10013751 Ga0307516_100137514 184
281 3300041456 Ga0451795_0973934 Ga0451795_0973934_249_806 184
282 3300041486 Ga0451807_2247218 Ga0451807_2247218_456_1013 184
283 3300041491 Ga0451833_1413866 Ga0451833_1413866_455_1012 184
284 3300041494 Ga0451837_1331648 Ga0451837_1331648_374_931 184
285 3300046512 Ga0495610_0146960 Ga0495610_0146960_289_846 184
286 3300046519 Ga0495632_0115020 Ga0495632_0115020_679_1236 184
287 3300046522 Ga0495643_0021831 Ga0495643_0021831_2156_2713 184
288 3300046660 Ga0495625_0001533 Ga0495625_0001533_19523_20080 184
289 3300048917 Ga0496114_0007670 Ga0496114_0007670_3410_3967 184
290 3300050493 nmdc:mga0k408_109524_c1 nmdc:mga0k408_109524_c1_848_1408 184
291 3300050493 nmdc:mga0k408_122481_c1 nmdc:mga0k408_122481_c1_16_573 184
292 3300050493 nmdc:mga0k408_734_c1 nmdc:mga0k408_734_c1_13975_14532 184
293 3300050496 nmdc:mga07m45_215138_c1 nmdc:mga07m45_215138_c1_277_834 184
294 3300050496 nmdc:mga07m45_53267_c1 nmdc:mga07m45_53267_c1_749_1306 184
295 3300053090 Ga0500646_0088162 Ga0500646_0088162_34_591 184
296 3300053739 Ga0500587_001055 Ga0500587_001055_2732_3289 184
297 3300003791 Ga0055530_10007972 Ga0055530_100079728 185
298 3300003792 Ga0055540_1000015 Ga0055540_100001562 185
299 3300005329 Ga0070683_100001824 Ga0070683_1000018244 185
300 3300005334 Ga0068869_100008068 Ga0068869_1000080686 185
301 3300005335 Ga0070666_10242463 Ga0070666_102424633 185
302 3300005339 Ga0070660_100288036 Ga0070660_1002880361 185
303 3300005344 Ga0070661_100010088 Ga0070661_1000100884 185
304 3300005347 Ga0070668_100024278 Ga0070668_1000242782 185
305 3300005354 Ga0070675_100000285 Ga0070675_10000028535 185
306 3300005366 Ga0070659_100014835 Ga0070659_1000148356 185
307 3300005366 Ga0070659_100181536 Ga0070659_1001815363 185
308 3300005367 Ga0070667_100028108 Ga0070667_1000281083 185
309 3300005455 Ga0070663_100004332 Ga0070663_1000043328 185
310 3300005456 Ga0070678_100267740 Ga0070678_1002677402 185
311 3300005457 Ga0070662_100020504 Ga0070662_1000205044 185
312 3300005458 Ga0070681_10146961 Ga0070681_101469612 185
313 3300005539 Ga0068853_100256719 Ga0068853_1002567193 185
314 3300005543 Ga0070672_100272432 Ga0070672_1002724323 185
315 3300005544 Ga0070686_100136845 Ga0070686_1001368452 185
316 3300005546 Ga0070696_101111257 Ga0070696_1011112571 185
317 3300005547 Ga0070693_100014753 Ga0070693_1000147533 185
318 3300005563 Ga0068855_100719572 Ga0068855_1007195722 185
319 3300005564 Ga0070664_100204419 Ga0070664_1002044193 185
320 3300005614 Ga0068856_100071622 Ga0068856_1000716224 185
321 3300005614 Ga0068856_100474074 Ga0068856_1004740742 185
322 3300005617 Ga0068859_101944004 Ga0068859_1019440041 185
323 3300005618 Ga0068864_100023050 Ga0068864_1000230502 185
324 3300005618 Ga0068864_101392331 Ga0068864_1013923311 185
325 3300005719 Ga0068861_100003647 Ga0068861_1000036478 185
326 3300005834 Ga0068851_10021056 Ga0068851_100210562 185
327 3300005834 Ga0068851_10326552 Ga0068851_103265522 185
328 3300005841 Ga0068863_100089393 Ga0068863_1000893934 185
329 3300005843 Ga0068860_100039326 Ga0068860_1000393267 185
330 3300005843 Ga0068860_101248688 Ga0068860_1012486882 185
331 3300005844 Ga0068862_100506607 Ga0068862_1005066072 185
332 3300006237 Ga0097621_100010996 Ga0097621_1000109966 185
333 3300006871 Ga0075434_100499961 Ga0075434_1004999613 185
334 3300006931 Ga0097620_101943922 Ga0097620_1019439221 185
335 3300009098 Ga0105245_10241285 Ga0105245_102412852 185
336 3300009176 Ga0105242_11086935 Ga0105242_110869352 185
337 3300009177 Ga0105248_10085019 Ga0105248_100850195 185
338 3300009177 Ga0105248_10177050 Ga0105248_101770502 185
339 3300009551 Ga0105238_10276361 Ga0105238_102763612 185
340 3300009553 Ga0105249_10174875 Ga0105249_101748752 185
341 3300010375 Ga0105239_10260323 Ga0105239_102603233 185
342 3300012508 Ga0157315_1002653 Ga0157315_10026531 185
343 3300013100 Ga0157373_10261401 Ga0157373_102614012 185
344 3300013102 Ga0157371_10171560 Ga0157371_101715601 185
345 3300013104 Ga0157370_10737177 Ga0157370_107371772 185
346 3300013105 Ga0157369_10200535 Ga0157369_102005352 185
347 3300013296 Ga0157374_10034608 Ga0157374_100346085 185
348 3300013306 Ga0163162_10034726 Ga0163162_100347266 185
349 3300013307 Ga0157372_10021809 Ga0157372_100218094 185
350 3300013307 Ga0157372_10056661 Ga0157372_100566614 185
351 3300013308 Ga0157375_10028630 Ga0157375_100286302 185
352 3300014326 Ga0157380_10211694 Ga0157380_102116943 185
353 3300014745 Ga0157377_10017418 Ga0157377_100174182 185
354 3300014968 Ga0157379_10008098 Ga0157379_100080986 185
355 3300014968 Ga0157379_10111157 Ga0157379_101111573 185
356 3300014968 Ga0157379_11144933 Ga0157379_111449332 185
357 3300014969 Ga0157376_10016516 Ga0157376_100165162 185
358 3300017792 Ga0163161_10023239 Ga0163161_100232395 185
359 3300020082 Ga0206353_11541288 Ga0206353_115412881 185
360 3300021377 Ga0213874_10066794 Ga0213874_100667942 185
361 3300021384 Ga0213876_10033899 Ga0213876_100338993 185
362 3300025298 Ga0209050_1000543 Ga0209050_100054363 185
363 3300025303 Ga0209051_1000020 Ga0209051_1000020310 185
364 3300025304 Ga0209257_1000189 Ga0209257_100018944 185
365 3300025315 Ga0207697_10059751 Ga0207697_100597512 185
366 3300025321 Ga0207656_10170497 Ga0207656_101704972 185
367 3300025903 Ga0207680_10153557 Ga0207680_101535573 185
368 3300025907 Ga0207645_10040758 Ga0207645_100407584 185
369 3300025919 Ga0207657_10260853 Ga0207657_102608532 185
370 3300025920 Ga0207649_10009230 Ga0207649_100092303 185
371 3300025924 Ga0207694_10178316 Ga0207694_101783161 185
372 3300025926 Ga0207659_10092971 Ga0207659_100929712 185
373 3300025927 Ga0207687_10246794 Ga0207687_102467943 185
374 3300025933 Ga0207706_10000756 Ga0207706_100007566 185
375 3300025938 Ga0207704_10154010 Ga0207704_101540102 185
376 3300025940 Ga0207691_10017263 Ga0207691_100172636 185
377 3300025941 Ga0207711_10173950 Ga0207711_101739503 185
378 3300025941 Ga0207711_10624137 Ga0207711_106241372 185
379 3300025942 Ga0207689_10006829 Ga0207689_100068295 185
380 3300025949 Ga0207667_10389035 Ga0207667_103890352 185
381 3300025961 Ga0207712_10066863 Ga0207712_100668633 185
382 3300025972 Ga0207668_10060300 Ga0207668_100603004 185
383 3300025986 Ga0207658_10027241 Ga0207658_100272412 185
384 3300025986 Ga0207658_10229553 Ga0207658_102295532 185
385 3300026023 Ga0207677_10041582 Ga0207677_100415824 185
386 3300026035 Ga0207703_10041270 Ga0207703_100412702 185
387 3300026041 Ga0207639_10378573 Ga0207639_103785733 185
388 3300026067 Ga0207678_10000966 Ga0207678_100009666 185
389 3300026067 Ga0207678_10022962 Ga0207678_100229625 185
390 3300026078 Ga0207702_10184339 Ga0207702_101843393 185
391 3300026088 Ga0207641_10671194 Ga0207641_106711942 185
392 3300026088 Ga0207641_10933529 Ga0207641_109335292 185
393 3300026095 Ga0207676_10119394 Ga0207676_101193942 185
394 3300026095 Ga0207676_10778030 Ga0207676_107780302 185
395 3300026116 Ga0207674_10320406 Ga0207674_103204061 185
396 3300026118 Ga0207675_100002744 Ga0207675_10000274412 185
397 3300026121 Ga0207683_10333210 Ga0207683_103332102 185
398 3300026142 Ga0207698_10076294 Ga0207698_100762943 185
399 3300026142 Ga0207698_10553626 Ga0207698_105536262 185
400 3300028380 Ga0268265_10895161 Ga0268265_108951611 185
401 3300028381 Ga0268264_10005397 Ga0268264_100053977 185
402 3300035084 Ga0373928_0006412 Ga0373928_0006412_1349_1909 185
403 3300035091 Ga0373951_0035326 Ga0373951_0035326_230_790 185
404 3300035691 Ga0373931_0267977 Ga0373931_0267977_377_937 185
405 3300039437 Ga0436365_0269082 Ga0436365_0269082_1078_1638 185
406 3300045051 Ga0451576_1230914 Ga0451576_1230914_200_760 185
407 3300048903 Ga0496100_0122492 Ga0496100_0122492_1220_1780 185
408 3300048904 Ga0496101_0178180 Ga0496101_0178180_842_1402 185
409 3300048904 Ga0496101_0763857 Ga0496101_0763857_129_689 185
410 3300048905 Ga0496102_0089284 Ga0496102_0089284_168_728 185
411 3300048907 Ga0496104_0300869 Ga0496104_0300869_429_989 185
412 3300048908 Ga0496105_0465025 Ga0496105_0465025_268_828 185
413 3300048910 Ga0496107_0025360 Ga0496107_0025360_1721_2281 185
414 3300048912 Ga0496109_0140298 Ga0496109_0140298_43_603 185
415 3300048913 Ga0496110_0318454 Ga0496110_0318454_188_748 185
416 3300048914 Ga0496111_0016712 Ga0496111_0016712_493_1053 185
417 3300048915 Ga0496112_0059693 Ga0496112_0059693_440_1000 185
418 3300048915 Ga0496112_0698405 Ga0496112_0698405_37_597 185
419 3300048916 Ga0496113_0006211 Ga0496113_0006211_5529_6089 185
420 3300048916 Ga0496113_0183866 Ga0496113_0183866_776_1336 185
421 3300048917 Ga0496114_0225156 Ga0496114_0225156_825_1385 185
422 3300050512 nmdc:mga0n895_653332_c1 nmdc:mga0n895_653332_c1_230_790 185
423 3300005327 Ga0070658_10530030 Ga0070658_105300301 186
424 3300005331 Ga0070670_100024587 Ga0070670_1000245873 186
425 3300005331 Ga0070670_100113628 Ga0070670_1001136283 186
426 3300005331 Ga0070670_100305123 Ga0070670_1003051233 186
427 3300005331 Ga0070670_100560868 Ga0070670_1005608681 186
428 3300005331 Ga0070670_100642537 Ga0070670_1006425372 186
429 3300005331 Ga0070670_101109637 Ga0070670_1011096371 186
430 3300005333 Ga0070677_10024507 Ga0070677_100245072 186
431 3300005333 Ga0070677_10172898 Ga0070677_101728982 186
432 3300005334 Ga0068869_100168532 Ga0068869_1001685321 186
433 3300005335 Ga0070666_10000785 Ga0070666_1000078518 186
434 3300005335 Ga0070666_10030100 Ga0070666_100301003 186
435 3300005335 Ga0070666_10479421 Ga0070666_104794212 186
436 3300005338 Ga0068868_100007918 Ga0068868_1000079182 186
437 3300005338 Ga0068868_100095787 Ga0068868_1000957872 186
438 3300005338 Ga0068868_100533879 Ga0068868_1005338791 186
439 3300005338 Ga0068868_100557441 Ga0068868_1005574413 186
440 3300005339 Ga0070660_100437523 Ga0070660_1004375231 186
441 3300005343 Ga0070687_100035933 Ga0070687_1000359334 186
442 3300005343 Ga0070687_100036816 Ga0070687_1000368163 186
443 3300005344 Ga0070661_100044171 Ga0070661_1000441712 186
444 3300005344 Ga0070661_100607515 Ga0070661_1006075152 186
445 3300005347 Ga0070668_100020742 Ga0070668_1000207423 186
446 3300005353 Ga0070669_100018661 Ga0070669_1000186617 186
447 3300005354 Ga0070675_100012138 Ga0070675_1000121383 186
448 3300005354 Ga0070675_100045165 Ga0070675_1000451655 186
449 3300005354 Ga0070675_100053552 Ga0070675_1000535522 186
450 3300005354 Ga0070675_100226883 Ga0070675_1002268832 186
451 3300005354 Ga0070675_100496180 Ga0070675_1004961801 186
452 3300005355 Ga0070671_100002193 Ga0070671_1000021933 186
453 3300005355 Ga0070671_100083482 Ga0070671_1000834822 186
454 3300005355 Ga0070671_100371872 Ga0070671_1003718722 186
455 3300005356 Ga0070674_100016028 Ga0070674_1000160286 186
456 3300005364 Ga0070673_100001009 Ga0070673_1000010096 186
457 3300005364 Ga0070673_100013002 Ga0070673_1000130025 186
458 3300005364 Ga0070673_100058983 Ga0070673_1000589834 186
459 3300005364 Ga0070673_100118743 Ga0070673_1001187431 186
460 3300005364 Ga0070673_100370306 Ga0070673_1003703063 186
461 3300005364 Ga0070673_100374965 Ga0070673_1003749652 186
462 3300005365 Ga0070688_100036467 Ga0070688_1000364673 186
463 3300005367 Ga0070667_100002773 Ga0070667_1000027737 186
464 3300005367 Ga0070667_100003684 Ga0070667_1000036849 186
465 3300005367 Ga0070667_100212319 Ga0070667_1002123192 186
466 3300005441 Ga0070700_100372175 Ga0070700_1003721752 186
467 3300005455 Ga0070663_100482505 Ga0070663_1004825052 186
468 3300005456 Ga0070678_100013525 Ga0070678_1000135255 186
469 3300005456 Ga0070678_100156891 Ga0070678_1001568912 186
470 3300005456 Ga0070678_100346254 Ga0070678_1003462542 186
471 3300005457 Ga0070662_100009041 Ga0070662_1000090413 186
472 3300005457 Ga0070662_100069801 Ga0070662_1000698014 186
473 3300005457 Ga0070662_100249004 Ga0070662_1002490043 186
474 3300005459 Ga0068867_100007433 Ga0068867_1000074334 186
475 3300005459 Ga0068867_100039871 Ga0068867_1000398713 186
476 3300005459 Ga0068867_100124950 Ga0068867_1001249502 186
477 3300005459 Ga0068867_100224474 Ga0068867_1002244743 186
478 3300005459 Ga0068867_100299742 Ga0068867_1002997421 186
479 3300005466 Ga0070685_10657770 Ga0070685_106577701 186
480 3300005539 Ga0068853_100246714 Ga0068853_1002467143 186
481 3300005543 Ga0070672_100001055 Ga0070672_10000105516 186
482 3300005543 Ga0070672_100005119 Ga0070672_1000051195 186
483 3300005543 Ga0070672_100135152 Ga0070672_1001351522 186
484 3300005543 Ga0070672_100360518 Ga0070672_1003605183 186
485 3300005543 Ga0070672_100367637 Ga0070672_1003676372 186
486 3300005547 Ga0070693_100040019 Ga0070693_1000400194 186
487 3300005548 Ga0070665_100457227 Ga0070665_1004572272 186
488 3300005564 Ga0070664_100228694 Ga0070664_1002286942 186
489 3300005578 Ga0068854_100103094 Ga0068854_1001030942 186
490 3300005578 Ga0068854_100231854 Ga0068854_1002318542 186
491 3300005616 Ga0068852_100005860 Ga0068852_1000058608 186
492 3300005616 Ga0068852_100059785 Ga0068852_1000597852 186
493 3300005616 Ga0068852_100353942 Ga0068852_1003539422 186
494 3300005617 Ga0068859_100006127 Ga0068859_10000612711 186
495 3300005617 Ga0068859_100443281 Ga0068859_1004432812 186
496 3300005618 Ga0068864_100008087 Ga0068864_1000080875 186
497 3300005618 Ga0068864_100016853 Ga0068864_1000168532 186
498 3300005618 Ga0068864_100506024 Ga0068864_1005060242 186
499 3300005718 Ga0068866_10009815 Ga0068866_100098155 186
500 3300005718 Ga0068866_10271590 Ga0068866_102715902 186
501 3300005719 Ga0068861_100194135 Ga0068861_1001941352 186
502 3300005834 Ga0068851_10059184 Ga0068851_100591843 186
503 3300005834 Ga0068851_10101746 Ga0068851_101017461 186
504 3300005834 Ga0068851_10276550 Ga0068851_102765503 186
505 3300005841 Ga0068863_100003799 Ga0068863_1000037998 186
506 3300005841 Ga0068863_100004935 Ga0068863_1000049355 186
507 3300005841 Ga0068863_100106230 Ga0068863_1001062304 186
508 3300005842 Ga0068858_100002240 Ga0068858_10000224015 186
509 3300005842 Ga0068858_100018725 Ga0068858_1000187254 186
510 3300005843 Ga0068860_100000445 Ga0068860_10000044514 186
511 3300005844 Ga0068862_100007883 Ga0068862_1000078835 186
512 3300006163 Ga0070715_10295230 Ga0070715_102952301 186
513 3300006237 Ga0097621_100011620 Ga0097621_1000116205 186
514 3300006237 Ga0097621_100018005 Ga0097621_1000180057 186
515 3300006358 Ga0068871_100019544 Ga0068871_1000195445 186
516 3300006358 Ga0068871_100030326 Ga0068871_1000303265 186
517 3300006358 Ga0068871_100165884 Ga0068871_1001658843 186
518 3300006358 Ga0068871_100308898 Ga0068871_1003088983 186
519 3300006881 Ga0068865_100043762 Ga0068865_1000437624 186
520 3300006881 Ga0068865_100186818 Ga0068865_1001868182 186
521 3300006931 Ga0097620_100006126 Ga0097620_10000612611 186
522 3300006931 Ga0097620_100443297 Ga0097620_1004432972 186
523 3300009098 Ga0105245_10468442 Ga0105245_104684422 186
524 3300009101 Ga0105247_10075644 Ga0105247_100756444 186
525 3300009148 Ga0105243_10005579 Ga0105243_100055795 186
526 3300009148 Ga0105243_10076482 Ga0105243_100764824 186
527 3300009148 Ga0105243_10359554 Ga0105243_103595542 186
528 3300009176 Ga0105242_10108564 Ga0105242_101085642 186
529 3300009176 Ga0105242_10223305 Ga0105242_102233052 186
530 3300009176 Ga0105242_10276735 Ga0105242_102767353 186
531 3300009176 Ga0105242_10820157 Ga0105242_108201572 186
532 3300009177 Ga0105248_10004957 Ga0105248_100049572 186
533 3300009177 Ga0105248_10094534 Ga0105248_100945342 186
534 3300009177 Ga0105248_10102774 Ga0105248_101027744 186
535 3300009177 Ga0105248_10129449 Ga0105248_101294494 186
536 3300009177 Ga0105248_10143573 Ga0105248_101435732 186
537 3300009177 Ga0105248_10171731 Ga0105248_101717314 186
538 3300009177 Ga0105248_11089692 Ga0105248_110896922 186
539 3300009553 Ga0105249_10095215 Ga0105249_100952155 186
540 3300009553 Ga0105249_10209339 Ga0105249_102093393 186
541 3300009553 Ga0105249_11431945 Ga0105249_114319452 186
542 3300011119 Ga0105246_10427767 Ga0105246_104277672 186
543 3300011119 Ga0105246_10448240 Ga0105246_104482401 186
544 3300013102 Ga0157371_10116977 Ga0157371_101169772 186
545 3300013102 Ga0157371_10376636 Ga0157371_103766363 186
546 3300013296 Ga0157374_10998650 Ga0157374_109986501 186
547 3300013297 Ga0157378_10446469 Ga0157378_104464692 186
548 3300013297 Ga0157378_10661106 Ga0157378_106611062 186
549 3300013306 Ga0163162_10018246 Ga0163162_100182468 186
550 3300013306 Ga0163162_10530677 Ga0163162_105306772 186
551 3300013308 Ga0157375_10011447 Ga0157375_100114475 186
552 3300013308 Ga0157375_10022022 Ga0157375_100220222 186
553 3300013308 Ga0157375_10073701 Ga0157375_100737014 186
554 3300013308 Ga0157375_10694567 Ga0157375_106945673 186
555 3300013308 Ga0157375_10905174 Ga0157375_109051743 186
556 3300014325 Ga0163163_10045264 Ga0163163_100452642 186
557 3300014325 Ga0163163_10397389 Ga0163163_103973892 186
558 3300014325 Ga0163163_10461235 Ga0163163_104612352 186
559 3300014325 Ga0163163_10656366 Ga0163163_106563663 186
560 3300014326 Ga0157380_10011565 Ga0157380_100115658 186
561 3300014326 Ga0157380_10145152 Ga0157380_101451522 186
562 3300014326 Ga0157380_10452633 Ga0157380_104526332 186
563 3300014745 Ga0157377_10000038 Ga0157377_1000003860 186
564 3300014745 Ga0157377_10270645 Ga0157377_102706453 186
565 3300014968 Ga0157379_10076979 Ga0157379_100769794 186
566 3300014968 Ga0157379_10124316 Ga0157379_101243163 186
567 3300014969 Ga0157376_10034451 Ga0157376_100344512 186
568 3300014969 Ga0157376_10336084 Ga0157376_103360842 186
569 3300017792 Ga0163161_10011344 Ga0163161_100113442 186
570 3300017792 Ga0163161_10156286 Ga0163161_101562863 186
571 3300025315 Ga0207697_10029600 Ga0207697_100296002 186
572 3300025315 Ga0207697_10054283 Ga0207697_100542833 186
573 3300025315 Ga0207697_10168221 Ga0207697_101682212 186
574 3300025321 Ga0207656_10036966 Ga0207656_100369662 186
575 3300025321 Ga0207656_10050341 Ga0207656_100503413 186
576 3300025893 Ga0207682_10001133 Ga0207682_1000113311 186
577 3300025893 Ga0207682_10127067 Ga0207682_101270672 186
578 3300025893 Ga0207682_10203306 Ga0207682_102033062 186
579 3300025899 Ga0207642_10038390 Ga0207642_100383903 186
580 3300025899 Ga0207642_10472945 Ga0207642_104729452 186
581 3300025901 Ga0207688_10209477 Ga0207688_102094772 186
582 3300025903 Ga0207680_10300438 Ga0207680_103004383 186
583 3300025903 Ga0207680_10331701 Ga0207680_103317012 186
584 3300025907 Ga0207645_10003455 Ga0207645_100034557 186
585 3300025907 Ga0207645_10086286 Ga0207645_100862863 186
586 3300025907 Ga0207645_10167509 Ga0207645_101675092 186
587 3300025907 Ga0207645_10431195 Ga0207645_104311952 186
588 3300025908 Ga0207643_10143132 Ga0207643_101431323 186
589 3300025908 Ga0207643_10485155 Ga0207643_104851551 186
590 3300025909 Ga0207705_10035148 Ga0207705_100351482 186
591 3300025918 Ga0207662_10008374 Ga0207662_100083743 186
592 3300025918 Ga0207662_10098300 Ga0207662_100983002 186
593 3300025919 Ga0207657_10196071 Ga0207657_101960712 186
594 3300025920 Ga0207649_10332951 Ga0207649_103329513 186
595 3300025920 Ga0207649_10744991 Ga0207649_107449912 186
596 3300025923 Ga0207681_10004618 Ga0207681_100046188 186
597 3300025923 Ga0207681_10348704 Ga0207681_103487042 186
598 3300025925 Ga0207650_10003908 Ga0207650_100039083 186
599 3300025925 Ga0207650_10055912 Ga0207650_100559122 186
600 3300025925 Ga0207650_10110025 Ga0207650_101100252 186
601 3300025925 Ga0207650_10392359 Ga0207650_103923592 186
602 3300025926 Ga0207659_10000477 Ga0207659_1000047726 186
603 3300025926 Ga0207659_10032109 Ga0207659_100321095 186
604 3300025926 Ga0207659_10204965 Ga0207659_102049652 186
605 3300025927 Ga0207687_10064103 Ga0207687_100641034 186
606 3300025931 Ga0207644_10002098 Ga0207644_100020985 186
607 3300025931 Ga0207644_10006058 Ga0207644_100060585 186
608 3300025931 Ga0207644_10012856 Ga0207644_100128565 186
609 3300025931 Ga0207644_10017153 Ga0207644_100171533 186
610 3300025931 Ga0207644_10164021 Ga0207644_101640212 186
611 3300025931 Ga0207644_10310410 Ga0207644_103104102 186
612 3300025933 Ga0207706_10004450 Ga0207706_1000445014 186
613 3300025933 Ga0207706_10051089 Ga0207706_100510892 186
614 3300025933 Ga0207706_10427490 Ga0207706_104274902 186
615 3300025933 Ga0207706_10512977 Ga0207706_105129772 186
616 3300025933 Ga0207706_10954362 Ga0207706_109543621 186
617 3300025934 Ga0207686_10065322 Ga0207686_100653223 186
618 3300025934 Ga0207686_10104121 Ga0207686_101041213 186
619 3300025934 Ga0207686_10237298 Ga0207686_102372982 186
620 3300025934 Ga0207686_10271432 Ga0207686_102714323 186
621 3300025935 Ga0207709_10003694 Ga0207709_100036946 186
622 3300025935 Ga0207709_10247401 Ga0207709_102474013 186
623 3300025936 Ga0207670_10025777 Ga0207670_100257775 186
624 3300025937 Ga0207669_10006650 Ga0207669_100066507 186
625 3300025937 Ga0207669_10150979 Ga0207669_101509792 186
626 3300025937 Ga0207669_10504645 Ga0207669_105046452 186
627 3300025937 Ga0207669_11106899 Ga0207669_111068991 186
628 3300025938 Ga0207704_10027876 Ga0207704_100278763 186
629 3300025938 Ga0207704_10085743 Ga0207704_100857433 186
630 3300025939 Ga0207665_10274839 Ga0207665_102748392 186
631 3300025940 Ga0207691_10005630 Ga0207691_100056308 186
632 3300025940 Ga0207691_10086956 Ga0207691_100869564 186
633 3300025940 Ga0207691_10181038 Ga0207691_101810382 186
634 3300025940 Ga0207691_10183319 Ga0207691_101833192 186
635 3300025940 Ga0207691_10353869 Ga0207691_103538692 186
636 3300025941 Ga0207711_10021174 Ga0207711_100211745 186
637 3300025941 Ga0207711_10087955 Ga0207711_100879552 186
638 3300025941 Ga0207711_10187313 Ga0207711_101873132 186
639 3300025941 Ga0207711_10398515 Ga0207711_103985153 186
640 3300025942 Ga0207689_10015924 Ga0207689_100159245 186
641 3300025942 Ga0207689_10170138 Ga0207689_101701383 186
642 3300025942 Ga0207689_10512444 Ga0207689_105124442 186
643 3300025944 Ga0207661_10109080 Ga0207661_101090802 186
644 3300025944 Ga0207661_10744017 Ga0207661_107440172 186
645 3300025945 Ga0207679_10187645 Ga0207679_101876452 186
646 3300025960 Ga0207651_10014724 Ga0207651_100147245 186
647 3300025960 Ga0207651_10016116 Ga0207651_100161163 186
648 3300025960 Ga0207651_10063782 Ga0207651_100637823 186
649 3300025960 Ga0207651_10109427 Ga0207651_101094274 186
650 3300025960 Ga0207651_10528183 Ga0207651_105281831 186
651 3300025961 Ga0207712_10011348 Ga0207712_100113487 186
652 3300025961 Ga0207712_10096638 Ga0207712_100966383 186
653 3300025961 Ga0207712_10798811 Ga0207712_107988111 186
654 3300025972 Ga0207668_10004912 Ga0207668_100049127 186
655 3300025972 Ga0207668_10159802 Ga0207668_101598023 186
656 3300025981 Ga0207640_10180862 Ga0207640_101808622 186
657 3300025981 Ga0207640_10415126 Ga0207640_104151262 186
658 3300025986 Ga0207658_10001089 Ga0207658_1000108918 186
659 3300025986 Ga0207658_10018268 Ga0207658_100182685 186
660 3300026023 Ga0207677_10003776 Ga0207677_100037762 186
661 3300026023 Ga0207677_10063934 Ga0207677_100639343 186
662 3300026023 Ga0207677_10192071 Ga0207677_101920712 186
663 3300026035 Ga0207703_10000996 Ga0207703_1000099618 186
664 3300026035 Ga0207703_10011365 Ga0207703_100113652 186
665 3300026067 Ga0207678_10170485 Ga0207678_101704852 186
666 3300026067 Ga0207678_10513594 Ga0207678_105135942 186
667 3300026067 Ga0207678_10886482 Ga0207678_108864822 186
668 3300026075 Ga0207708_10012827 Ga0207708_100128275 186
669 3300026075 Ga0207708_10796951 Ga0207708_107969512 186
670 3300026088 Ga0207641_10007488 Ga0207641_100074885 186
671 3300026088 Ga0207641_10017054 Ga0207641_100170542 186
672 3300026088 Ga0207641_10027717 Ga0207641_100277171 186
673 3300026088 Ga0207641_10338895 Ga0207641_103388952 186
674 3300026089 Ga0207648_10000118 Ga0207648_1000011860 186
675 3300026089 Ga0207648_10028344 Ga0207648_100283445 186
676 3300026089 Ga0207648_10034335 Ga0207648_100343353 186
677 3300026089 Ga0207648_10144132 Ga0207648_101441322 186
678 3300026089 Ga0207648_10555413 Ga0207648_105554132 186
679 3300026095 Ga0207676_10002837 Ga0207676_100028379 186
680 3300026095 Ga0207676_10008453 Ga0207676_100084535 186
681 3300026095 Ga0207676_10075841 Ga0207676_100758412 186
682 3300026095 Ga0207676_10709176 Ga0207676_107091762 186
683 3300026118 Ga0207675_100003340 Ga0207675_10000334011 186
684 3300026118 Ga0207675_100054366 Ga0207675_1000543663 186
685 3300026118 Ga0207675_101059939 Ga0207675_1010599392 186
686 3300026121 Ga0207683_10004250 Ga0207683_100042505 186
687 3300026121 Ga0207683_10098580 Ga0207683_100985802 186
688 3300026121 Ga0207683_10102117 Ga0207683_101021173 186
689 3300026121 Ga0207683_10113630 Ga0207683_101136302 186
690 3300026121 Ga0207683_10665885 Ga0207683_106658852 186
691 3300026121 Ga0207683_10706936 Ga0207683_107069362 186
692 3300026142 Ga0207698_10044988 Ga0207698_100449883 186
693 3300026142 Ga0207698_10148841 Ga0207698_101488413 186
694 3300028379 Ga0268266_10202271 Ga0268266_102022712 186
695 3300028379 Ga0268266_10383588 Ga0268266_103835883 186
696 3300028380 Ga0268265_10011082 Ga0268265_100110822 186
697 3300028380 Ga0268265_10029539 Ga0268265_100295393 186
698 3300028381 Ga0268264_10001857 Ga0268264_100018572 186
699 3300028381 Ga0268264_10493103 Ga0268264_104931032 186
700 3300031548 Ga0307408_100022119 Ga0307408_1000221192 186
701 3300031731 Ga0307405_10014690 Ga0307405_100146904 186
702 3300031995 Ga0307409_100002191 Ga0307409_1000021915 186
703 3300032002 Ga0307416_100002040 Ga0307416_1000020409 186
704 3300032126 Ga0307415_100012627 Ga0307415_1000126272 186
705 3300035089 Ga0373944_0073850 Ga0373944_0073850_117_680 186
706 3300035111 Ga0373923_0121198 Ga0373923_0121198_247_810 186
707 3300035170 Ga0373943_0088252 Ga0373943_0088252_39_602 186
708 3300035724 Ga0373933_0044022 Ga0373933_0044022_1393_1956 186
709 3300035725 Ga0373947_0377373 Ga0373947_0377373_32_595 186
710 3300035725 Ga0373947_0730224 Ga0373947_0730224_98_661 186
711 3300036401 Ga0373937_0010021 Ga0373937_0010021_5905_6468 186
712 3300036401 Ga0373937_0010446 Ga0373937_0010446_7355_7918 186
713 3300037068 Ga0373925_0009400 Ga0373925_0009400_6171_6734 186
714 3300041458 Ga0451798_0943568 Ga0451798_0943568_39_614 186
715 3300041496 Ga0451839_1398550 Ga0451839_1398550_651_1214 186
716 3300041512 Ga0451853_1001559 Ga0451853_1001559_218_781 186
717 3300041512 Ga0451853_1709673 Ga0451853_1709673_68_640 186
718 3300042439 Ga0439464_0018264 Ga0439464_0018264_61_624 186
719 3300042876 Ga0451577_0011912 Ga0451577_0011912_5394_5957 186
720 3300046455 Ga0495603_0195820 Ga0495603_0195820_103_666 186
721 3300046459 Ga0495629_0025312 Ga0495629_0025312_1728_2291 186
722 3300046459 Ga0495629_0238822 Ga0495629_0238822_223_786 186
723 3300046472 Ga0495580_0099089 Ga0495580_0099089_252_815 186
724 3300046472 Ga0495580_0180471 Ga0495580_0180471_144_707 186
725 3300046473 Ga0495582_0150989 Ga0495582_0150989_513_1076 186
726 3300046476 Ga0495662_0288837 Ga0495662_0288837_163_726 186
727 3300046529 Ga0495652_0496418 Ga0495652_0496418_126_689 186
728 3300046533 Ga0495640_0579661 Ga0495640_0579661_20_583 186
729 3300046535 Ga0495586_0150238 Ga0495586_0150238_327_890 186
730 3300046535 Ga0495586_0305057 Ga0495586_0305057_331_894 186
731 3300046537 Ga0495598_0027037 Ga0495598_0027037_519_1082 186
732 3300046539 Ga0495621_0101233 Ga0495621_0101233_433_996 186
733 3300046539 Ga0495621_0270309 Ga0495621_0270309_113_676 186
734 3300046543 Ga0495645_0126462 Ga0495645_0126462_354_917 186
735 3300046543 Ga0495645_0245601 Ga0495645_0245601_618_1181 186
736 3300046663 Ga0495635_0251003 Ga0495635_0251003_368_931 186
737 3300046678 Ga0495599_0288996 Ga0495599_0288996_341_904 186
738 3300046681 Ga0495647_0142634 Ga0495647_0142634_280_843 186
739 3300046683 Ga0495658_0016429 Ga0495658_0016429_3096_3659 186
740 3300046683 Ga0495658_0115438 Ga0495658_0115438_227_790 186
741 3300046683 Ga0495658_0163292 Ga0495658_0163292_380_943 186
742 3300046683 Ga0495658_0167940 Ga0495658_0167940_32_595 186
743 3300046689 Ga0495613_0060723 Ga0495613_0060723_1862_2425 186
744 3300047319 Ga0495674_0671787 Ga0495674_0671787_184_747 186
745 3300047322 Ga0495680_0145655 Ga0495680_0145655_150_713 186
746 3300047470 Ga0495681_0153145 Ga0495681_0153145_143_706 186
747 3300047471 Ga0495684_0139402 Ga0495684_0139402_917_1480 186
748 3300048903 Ga0496100_0468249 Ga0496100_0468249_270_833 186
749 3300048907 Ga0496104_0393688 Ga0496104_0393688_144_707 186
750 3300048907 Ga0496104_0490063 Ga0496104_0490063_405_968 186
751 3300048909 Ga0496106_0355947 Ga0496106_0355947_81_644 186
752 3300048911 Ga0496108_0037095 Ga0496108_0037095_330_893 186
753 3300048911 Ga0496108_1188953 Ga0496108_1188953_17_580 186
754 3300048912 Ga0496109_0179647 Ga0496109_0179647_428_991 186
755 3300048913 Ga0496110_1118654 Ga0496110_1118654_73_636 186
756 3300050508 nmdc:mga09592_930274_c1 nmdc:mga09592_930274_c1_128_691 186
757 3300053077 Ga0495601_0063743 Ga0495601_0063743_893_1456 186
758 3300053084 Ga0495595_0187504 Ga0495595_0187504_439_1002 186
759 3300053085 Ga0495619_0028690 Ga0495619_0028690_1520_2083 186
760 3300053085 Ga0495619_0303277 Ga0495619_0303277_204_767 186
761 3300006353 Ga0075370_10005206 Ga0075370_100052062 187
762 3300037471 Ga0395905_0023405 Ga0395905_0023405_4181_4747 187
763 3300045976 Ga0466967_1017864 Ga0466967_1017864_55_621 187
764 3300050496 nmdc:mga07m45_7428_c1 nmdc:mga07m45_7428_c1_1318_1887 187
765 3300005614 Ga0068856_100030381 Ga0068856_1000303815 188
766 3300009551 Ga0105238_10247603 Ga0105238_102476033 188
767 3300025924 Ga0207694_10105545 Ga0207694_101055453 188
768 3300026078 Ga0207702_10039270 Ga0207702_100392702 188
769 3300028794 Ga0307515_10005461 Ga0307515_100054616 188
770 3300031730 Ga0307516_10000897 Ga0307516_100008974 188
771 3300037466 Ga0395898_0013276 Ga0395898_0013276_3686_4255 189
772 3300002705 JGI25156J39149_1001030 JGI25156J39149_100103013 190
773 3300002738 JGI25154J39366_1002784 JGI25154J39366_10027846 190
774 3300002741 JGI25157J39369_1000021 JGI25157J39369_1000021129 190
775 3300003752 Ga0055539_1000608 Ga0055539_10006083 190
776 3300003752 Ga0055539_1004575 Ga0055539_10045753 190
777 3300003756 Ga0055533_1000033 Ga0055533_100003326 190
778 3300005327 Ga0070658_10679370 Ga0070658_106793701 190
779 3300005364 Ga0070673_100045390 Ga0070673_1000453903 190
780 3300005366 Ga0070659_100077876 Ga0070659_1000778762 190
781 3300005366 Ga0070659_100135626 Ga0070659_1001356263 190
782 3300005539 Ga0068853_100560765 Ga0068853_1005607652 190
783 3300005563 Ga0068855_100112152 Ga0068855_1001121522 190
784 3300005563 Ga0068855_100260848 Ga0068855_1002608482 190
785 3300005577 Ga0068857_100174232 Ga0068857_1001742323 190
786 3300005577 Ga0068857_100616099 Ga0068857_1006160992 190
787 3300005578 Ga0068854_100013259 Ga0068854_1000132594 190
788 3300005614 Ga0068856_100000887 Ga0068856_10000088726 190
789 3300006195 Ga0075366_10053926 Ga0075366_100539262 190
790 3300009545 Ga0105237_10136973 Ga0105237_101369732 190
791 3300009551 Ga0105238_10080234 Ga0105238_100802342 190
792 3300013307 Ga0157372_10456279 Ga0157372_104562793 190
793 3300025226 Ga0209674_100064 Ga0209674_100064223 190
794 3300025230 Ga0209563_100126 Ga0209563_10012682 190
795 3300025242 Ga0209258_100905 Ga0209258_10090511 190
796 3300025246 Ga0209646_1000060 Ga0209646_100006027 190
797 3300025250 Ga0209026_1000049 Ga0209026_100004925 190
798 3300025253 Ga0209677_100099 Ga0209677_10009988 190
799 3300025253 Ga0209677_100229 Ga0209677_10022940 190
800 3300025256 Ga0209759_1000069 Ga0209759_100006925 190
801 3300025256 Ga0209759_1001738 Ga0209759_100173813 190
802 3300025909 Ga0207705_10254922 Ga0207705_102549222 190
803 3300025914 Ga0207671_10080694 Ga0207671_100806944 190
804 3300025924 Ga0207694_10203967 Ga0207694_102039672 190
805 3300025932 Ga0207690_10059776 Ga0207690_100597762 190
806 3300025944 Ga0207661_10465463 Ga0207661_104654632 190
807 3300025949 Ga0207667_10001779 Ga0207667_1000177916 190
808 3300025949 Ga0207667_10284225 Ga0207667_102842252 190
809 3300025960 Ga0207651_10026134 Ga0207651_100261343 190
810 3300025981 Ga0207640_10050170 Ga0207640_100501704 190
811 3300026041 Ga0207639_10159358 Ga0207639_101593582 190
812 3300026078 Ga0207702_10001447 Ga0207702_100014473 190
813 3300026116 Ga0207674_10196958 Ga0207674_101969582 190
814 3300035691 Ga0373931_0109225 Ga0373931_0109225_884_1456 190
815 3300037471 Ga0395905_0500396 Ga0395905_0500396_209_781 190
816 3300038443 Ga0395901_0025620 Ga0395901_0025620_5049_5621 190
817 3300048909 Ga0496106_0100627 Ga0496106_0100627_456_1031 190
818 3300048911 Ga0496108_0258500 Ga0496108_0258500_532_1158 190
819 3300050493 nmdc:mga0k408_7916_c1 nmdc:mga0k408_7916_c1_136_708 190
820 3300050496 nmdc:mga07m45_67997_c1 nmdc:mga07m45_67997_c1_339_911 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14803

Nudix_N_2

Nudix N-terminal

24

59

0.84

PF00293

NUDIX

NUDIX domain

60

179

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.8605 43 149
4v14-assembly1.cif.gz_A structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae 0.856 43 148
5isy-assembly1.cif.gz_A crystal structure of nudix family protein with nad 0.8535 7 149
4v14-assembly2.cif.gz_B structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae 0.8523 45 148
5isy-assembly1.cif.gz_C crystal structure of nudix family protein with nad 0.8521 7 149
ID Description Score Start End Superfamily
af_Q19427_210_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8839 45 146 3.90.79.10
af_P53164_221_376_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8812 45 146 3.90.79.10
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8725 43 146 3.90.79.10
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8644 43 145 3.90.79.10
4v14B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8523 45 148 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A847VK60-F1-model_v4 NUDIX domain-containing protein 1 43 174
AF-A0A3N5FKE5-F1-model_v4 NUDIX hydrolase 0.9807 79 175 GO:0016787
AF-A0A2R5EL96-F1-model_v4 Nudix hydrolase domain-containing protein 0.9765 46 167 GO:0016787
AF-A0A318GX15-F1-model_v4 Nudix hydrolase family protein 0.9688 2 175 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A4BTP3-F1-model_v4 Pyrophosphatase, MutT/nudix family protein 0.9672 46 168 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.97 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map