F482230
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 820 | 346 | 810 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300046542|Ga0495597_0000584|Ga0495597_0000584_2246_2848 |
| Length | 200 |
| Sequence | LPGFAALAAFRVLFKDLRMQYETRFCSHCATPLQWLTVAEDGGDVQRLRCPACGWTHWNNPTPVLAAIVEHEGRVLLARNAAWPEKVFGLITGFMEAGESPEQGIAREVLEETGLVVQSQQLIGAYEFLRMNQVIIAYHVEATGQVQLSPELLEYRLVAPEKVQCWPAGTGQALATWLRSRGHEPQFIDFWRRDENAATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 235 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 240 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 241 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 242 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 245 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 297 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 298 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 299 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 300 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 302 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 307 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 308 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 310 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 311 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 314 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 316 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 319 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 320 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 321 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 322 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 338 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 340 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 341 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.54 |
| Metatranscriptomes | 0.24 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.78 |
| Nodule | 0.24 |
| Rhizoplane | 4.27 |
| Rhizosphere | 81.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001030 | 3300002705 | Bacteria | 13001 |
| 2 | JGI25154J39366_1002784 | 3300002738 | Bacteria | 4193 |
| 3 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 4 | JGI25152J39213_1002732 | 3300002773 | Bacteria | 6443 |
| 5 | JGI25153J46596_10010114 | 3300003215 | Bacteria | 4301 |
| 6 | rootL2_10208104 | 3300003322 | Bacteria | 1009 |
| 7 | Ga0055539_1000608 | 3300003752 | Bacteria | 9788 |
| 8 | Ga0055539_1004575 | 3300003752 | Bacteria | 1837 |
| 9 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 10 | Ga0055526_1002081 | 3300003771 | Bacteria | 13745 |
| 11 | Ga0055524_1000423 | 3300003775 | Bacteria | 35532 |
| 12 | Ga0055530_10007972 | 3300003791 | Bacteria | 4330 |
| 13 | Ga0055540_1000015 | 3300003792 | Bacteria | 232986 |
| 14 | Ga0065165_1000401 | 3300005262 | Bacteria | 69929 |
| 15 | Ga0065165_1007960 | 3300005262 | Bacteria | 5073 |
| 16 | Ga0070658_10530030 | 3300005327 | Bacteria | 1019 |
| 17 | Ga0070658_10679370 | 3300005327 | Bacteria | 893 |
| 18 | Ga0070676_10002580 | 3300005328 | Bacteria | 9317 |
| 19 | Ga0070683_100001824 | 3300005329 | Bacteria | 16612 |
| 20 | Ga0070670_100024587 | 3300005331 | Bacteria | 5179 |
| 21 | Ga0070670_100113628 | 3300005331 | Bacteria | 2334 |
| 22 | Ga0070670_100305123 | 3300005331 | Bacteria | 1393 |
| 23 | Ga0070670_100560868 | 3300005331 | Bacteria | 1019 |
| 24 | Ga0070670_100642537 | 3300005331 | Bacteria | 951 |
| 25 | Ga0070670_101109637 | 3300005331 | Bacteria | 722 |
| 26 | Ga0070677_10024507 | 3300005333 | Bacteria | 2244 |
| 27 | Ga0070677_10060494 | 3300005333 | Bacteria | 1561 |
| 28 | Ga0070677_10172898 | 3300005333 | Bacteria | 1023 |
| 29 | Ga0068869_100008068 | 3300005334 | Bacteria | 6767 |
| 30 | Ga0068869_100011581 | 3300005334 | Bacteria | 5790 |
| 31 | Ga0068869_100168532 | 3300005334 | Bacteria | 1709 |
| 32 | Ga0070666_10000785 | 3300005335 | Bacteria | 19230 |
| 33 | Ga0070666_10030100 | 3300005335 | Bacteria | 3574 |
| 34 | Ga0070666_10242463 | 3300005335 | Bacteria | 1275 |
| 35 | Ga0070666_10479421 | 3300005335 | Bacteria | 901 |
| 36 | Ga0070680_100071875 | 3300005336 | Bacteria | 2843 |
| 37 | Ga0068868_100007918 | 3300005338 | Bacteria | 7590 |
| 38 | Ga0068868_100095787 | 3300005338 | Bacteria | 2396 |
| 39 | Ga0068868_100533879 | 3300005338 | Bacteria | 1032 |
| 40 | Ga0068868_100557441 | 3300005338 | Bacteria | 1011 |
| 41 | Ga0070660_100288036 | 3300005339 | Bacteria | 1345 |
| 42 | Ga0070660_100437523 | 3300005339 | Bacteria | 1084 |
| 43 | Ga0070687_100035933 | 3300005343 | Bacteria | 2465 |
| 44 | Ga0070687_100036816 | 3300005343 | Bacteria | 2442 |
| 45 | Ga0070661_100010088 | 3300005344 | Bacteria | 6559 |
| 46 | Ga0070661_100044171 | 3300005344 | Bacteria | 3255 |
| 47 | Ga0070661_100607515 | 3300005344 | Bacteria | 885 |
| 48 | Ga0070668_100020742 | 3300005347 | Bacteria | 4962 |
| 49 | Ga0070668_100024278 | 3300005347 | Bacteria | 4592 |
| 50 | Ga0070668_100262673 | 3300005347 | Bacteria | 1436 |
| 51 | Ga0070669_100018661 | 3300005353 | Bacteria | 4957 |
| 52 | Ga0070675_100000285 | 3300005354 | Bacteria | 33772 |
| 53 | Ga0070675_100012138 | 3300005354 | Bacteria | 6755 |
| 54 | Ga0070675_100045165 | 3300005354 | Bacteria | 3604 |
| 55 | Ga0070675_100053552 | 3300005354 | Bacteria | 3319 |
| 56 | Ga0070675_100193125 | 3300005354 | Bacteria | 1765 |
| 57 | Ga0070675_100226883 | 3300005354 | Bacteria | 1628 |
| 58 | Ga0070675_100496180 | 3300005354 | Bacteria | 1100 |
| 59 | Ga0070671_100002193 | 3300005355 | Bacteria | 15088 |
| 60 | Ga0070671_100029968 | 3300005355 | Bacteria | 4489 |
| 61 | Ga0070671_100083482 | 3300005355 | Bacteria | 2671 |
| 62 | Ga0070671_100371872 | 3300005355 | Bacteria | 1221 |
| 63 | Ga0070674_100016028 | 3300005356 | Bacteria | 4693 |
| 64 | Ga0070674_100242835 | 3300005356 | Bacteria | 1411 |
| 65 | Ga0070674_101088983 | 3300005356 | Bacteria | 705 |
| 66 | Ga0070673_100001009 | 3300005364 | Bacteria | 15963 |
| 67 | Ga0070673_100013002 | 3300005364 | Bacteria | 5740 |
| 68 | Ga0070673_100045390 | 3300005364 | Bacteria | 3408 |
| 69 | Ga0070673_100058983 | 3300005364 | Bacteria | 3037 |
| 70 | Ga0070673_100118743 | 3300005364 | Bacteria | 2202 |
| 71 | Ga0070673_100360276 | 3300005364 | Bacteria | 1292 |
| 72 | Ga0070673_100370306 | 3300005364 | Bacteria | 1275 |
| 73 | Ga0070673_100374965 | 3300005364 | Bacteria | 1267 |
| 74 | Ga0070673_100461506 | 3300005364 | Bacteria | 1144 |
| 75 | Ga0070673_101063927 | 3300005364 | Bacteria | 755 |
| 76 | Ga0070688_100036467 | 3300005365 | Bacteria | 2991 |
| 77 | Ga0070659_100014835 | 3300005366 | Bacteria | 5826 |
| 78 | Ga0070659_100077876 | 3300005366 | Bacteria | 2645 |
| 79 | Ga0070659_100135626 | 3300005366 | Bacteria | 2001 |
| 80 | Ga0070659_100181536 | 3300005366 | Bacteria | 1727 |
| 81 | Ga0070659_100690844 | 3300005366 | Bacteria | 882 |
| 82 | Ga0070667_100002773 | 3300005367 | Bacteria | 15141 |
| 83 | Ga0070667_100003684 | 3300005367 | Bacteria | 13046 |
| 84 | Ga0070667_100028108 | 3300005367 | Bacteria | 4680 |
| 85 | Ga0070667_100212319 | 3300005367 | Bacteria | 1720 |
| 86 | Ga0070705_100486477 | 3300005440 | Bacteria | 934 |
| 87 | Ga0070700_100018609 | 3300005441 | Bacteria | 3996 |
| 88 | Ga0070700_100372175 | 3300005441 | Bacteria | 1066 |
| 89 | Ga0070663_100004332 | 3300005455 | Bacteria | 8320 |
| 90 | Ga0070663_100263123 | 3300005455 | Bacteria | 1369 |
| 91 | Ga0070663_100482505 | 3300005455 | Bacteria | 1026 |
| 92 | Ga0070678_100013525 | 3300005456 | Bacteria | 5121 |
| 93 | Ga0070678_100076132 | 3300005456 | Bacteria | 2527 |
| 94 | Ga0070678_100156891 | 3300005456 | Bacteria | 1839 |
| 95 | Ga0070678_100267740 | 3300005456 | Bacteria | 1440 |
| 96 | Ga0070678_100346254 | 3300005456 | Bacteria | 1276 |
| 97 | Ga0070662_100009041 | 3300005457 | Bacteria | 6499 |
| 98 | Ga0070662_100020504 | 3300005457 | Bacteria | 4501 |
| 99 | Ga0070662_100069801 | 3300005457 | Bacteria | 2588 |
| 100 | Ga0070662_100249004 | 3300005457 | Bacteria | 1428 |
| 101 | Ga0070681_10146961 | 3300005458 | Bacteria | 2286 |
| 102 | Ga0070681_10309642 | 3300005458 | Bacteria | 1489 |
| 103 | Ga0068867_100002447 | 3300005459 | Bacteria | 13049 |
| 104 | Ga0068867_100004433 | 3300005459 | Bacteria | 9869 |
| 105 | Ga0068867_100007433 | 3300005459 | Bacteria | 7748 |
| 106 | Ga0068867_100039871 | 3300005459 | Bacteria | 3425 |
| 107 | Ga0068867_100124950 | 3300005459 | Bacteria | 1992 |
| 108 | Ga0068867_100224474 | 3300005459 | Bacteria | 1515 |
| 109 | Ga0068867_100299742 | 3300005459 | Bacteria | 1325 |
| 110 | Ga0070685_10657770 | 3300005466 | Bacteria | 760 |
| 111 | Ga0070706_100272323 | 3300005467 | Bacteria | 1580 |
| 112 | Ga0070679_100006907 | 3300005530 | Bacteria | 10586 |
| 113 | Ga0068853_100246714 | 3300005539 | Bacteria | 1638 |
| 114 | Ga0068853_100256719 | 3300005539 | Bacteria | 1606 |
| 115 | Ga0068853_100560765 | 3300005539 | Bacteria | 1083 |
| 116 | Ga0070672_100001055 | 3300005543 | Bacteria | 16808 |
| 117 | Ga0070672_100004909 | 3300005543 | Bacteria | 8799 |
| 118 | Ga0070672_100005119 | 3300005543 | Bacteria | 8650 |
| 119 | Ga0070672_100135152 | 3300005543 | Bacteria | 2030 |
| 120 | Ga0070672_100272432 | 3300005543 | Bacteria | 1430 |
| 121 | Ga0070672_100360518 | 3300005543 | Bacteria | 1241 |
| 122 | Ga0070672_100367637 | 3300005543 | Bacteria | 1228 |
| 123 | Ga0070672_100454295 | 3300005543 | Bacteria | 1104 |
| 124 | Ga0070686_100136845 | 3300005544 | Bacteria | 1701 |
| 125 | Ga0070696_101111257 | 3300005546 | Bacteria | 665 |
| 126 | Ga0070693_100014753 | 3300005547 | Bacteria | 4010 |
| 127 | Ga0070693_100040019 | 3300005547 | Bacteria | 2630 |
| 128 | Ga0070665_100368145 | 3300005548 | Bacteria | 1444 |
| 129 | Ga0070665_100457227 | 3300005548 | Bacteria | 1287 |
| 130 | Ga0068855_100112152 | 3300005563 | Bacteria | 3129 |
| 131 | Ga0068855_100260848 | 3300005563 | Bacteria | 1930 |
| 132 | Ga0068855_100438043 | 3300005563 | Bacteria | 1428 |
| 133 | Ga0068855_100719572 | 3300005563 | Bacteria | 1067 |
| 134 | Ga0070664_100204419 | 3300005564 | Bacteria | 1763 |
| 135 | Ga0070664_100228694 | 3300005564 | Bacteria | 1667 |
| 136 | Ga0068857_100030013 | 3300005577 | Bacteria | 4797 |
| 137 | Ga0068857_100174232 | 3300005577 | Bacteria | 1956 |
| 138 | Ga0068857_100616099 | 3300005577 | Bacteria | 1027 |
| 139 | Ga0068854_100013259 | 3300005578 | Bacteria | 5404 |
| 140 | Ga0068854_100103094 | 3300005578 | Bacteria | 2141 |
| 141 | Ga0068854_100231854 | 3300005578 | Bacteria | 1466 |
| 142 | Ga0068856_100000887 | 3300005614 | Bacteria | 32039 |
| 143 | Ga0068856_100030381 | 3300005614 | Bacteria | 5282 |
| 144 | Ga0068856_100071622 | 3300005614 | Bacteria | 3431 |
| 145 | Ga0068856_100474074 | 3300005614 | Bacteria | 1272 |
| 146 | Ga0068852_100005860 | 3300005616 | Bacteria | 8830 |
| 147 | Ga0068852_100046534 | 3300005616 | Bacteria | 3698 |
| 148 | Ga0068852_100059785 | 3300005616 | Bacteria | 3306 |
| 149 | Ga0068852_100353942 | 3300005616 | Bacteria | 1434 |
| 150 | Ga0068852_101374956 | 3300005616 | Bacteria | 728 |
| 151 | Ga0068859_100006127 | 3300005617 | Bacteria | 12221 |
| 152 | Ga0068859_100443281 | 3300005617 | Bacteria | 1395 |
| 153 | Ga0068859_100973853 | 3300005617 | Bacteria | 931 |
| 154 | Ga0068859_101944004 | 3300005617 | Bacteria | 649 |
| 155 | Ga0068864_100008087 | 3300005618 | Bacteria | 8673 |
| 156 | Ga0068864_100016853 | 3300005618 | Bacteria | 6088 |
| 157 | Ga0068864_100023050 | 3300005618 | Bacteria | 5226 |
| 158 | Ga0068864_100506024 | 3300005618 | Bacteria | 1163 |
| 159 | Ga0068864_101392331 | 3300005618 | Bacteria | 703 |
| 160 | Ga0068866_10009144 | 3300005718 | Bacteria | 4200 |
| 161 | Ga0068866_10009815 | 3300005718 | Bacteria | 4080 |
| 162 | Ga0068866_10271590 | 3300005718 | Bacteria | 1047 |
| 163 | Ga0068861_100003647 | 3300005719 | Bacteria | 10261 |
| 164 | Ga0068861_100004823 | 3300005719 | Bacteria | 9067 |
| 165 | Ga0068861_100194135 | 3300005719 | Bacteria | 1700 |
| 166 | Ga0068851_10021056 | 3300005834 | Bacteria | 3163 |
| 167 | Ga0068851_10059184 | 3300005834 | Bacteria | 1960 |
| 168 | Ga0068851_10085227 | 3300005834 | Bacteria | 1656 |
| 169 | Ga0068851_10101746 | 3300005834 | Bacteria | 1525 |
| 170 | Ga0068851_10276550 | 3300005834 | Bacteria | 959 |
| 171 | Ga0068851_10326552 | 3300005834 | Bacteria | 888 |
| 172 | Ga0068851_10564886 | 3300005834 | Bacteria | 689 |
| 173 | Ga0068870_10171292 | 3300005840 | Bacteria | 1296 |
| 174 | Ga0068863_100003799 | 3300005841 | Bacteria | 14929 |
| 175 | Ga0068863_100004935 | 3300005841 | Bacteria | 13153 |
| 176 | Ga0068863_100089393 | 3300005841 | Bacteria | 2920 |
| 177 | Ga0068863_100106230 | 3300005841 | Bacteria | 2671 |
| 178 | Ga0068863_100174157 | 3300005841 | Bacteria | 2065 |
| 179 | Ga0068858_100002240 | 3300005842 | Bacteria | 19545 |
| 180 | Ga0068858_100018725 | 3300005842 | Bacteria | 6480 |
| 181 | Ga0068858_100088224 | 3300005842 | Bacteria | 2886 |
| 182 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 183 | Ga0068860_100011586 | 3300005843 | Bacteria | 8694 |
| 184 | Ga0068860_100039326 | 3300005843 | Bacteria | 4523 |
| 185 | Ga0068860_100545984 | 3300005843 | Bacteria | 1161 |
| 186 | Ga0068860_100827891 | 3300005843 | Bacteria | 940 |
| 187 | Ga0068860_101248688 | 3300005843 | Bacteria | 763 |
| 188 | Ga0068862_100007883 | 3300005844 | Bacteria | 8812 |
| 189 | Ga0068862_100032693 | 3300005844 | Bacteria | 4395 |
| 190 | Ga0068862_100100314 | 3300005844 | Bacteria | 2532 |
| 191 | Ga0068862_100506607 | 3300005844 | Bacteria | 1146 |
| 192 | Ga0075364_10036027 | 3300006051 | Bacteria | 3199 |
| 193 | Ga0070715_10295230 | 3300006163 | Bacteria | 865 |
| 194 | Ga0075367_10133581 | 3300006178 | Bacteria | 1535 |
| 195 | Ga0075366_10004769 | 3300006195 | Bacteria | 7313 |
| 196 | Ga0075366_10053926 | 3300006195 | Bacteria | 2388 |
| 197 | Ga0075366_10170492 | 3300006195 | Bacteria | 1320 |
| 198 | Ga0075366_10195127 | 3300006195 | Bacteria | 1231 |
| 199 | Ga0075366_10227101 | 3300006195 | Bacteria | 1137 |
| 200 | Ga0075366_10289739 | 3300006195 | Bacteria | 1001 |
| 201 | Ga0097621_100010996 | 3300006237 | Bacteria | 6648 |
| 202 | Ga0097621_100011620 | 3300006237 | Bacteria | 6492 |
| 203 | Ga0097621_100018005 | 3300006237 | Bacteria | 5383 |
| 204 | Ga0075370_10005206 | 3300006353 | Bacteria | 6433 |
| 205 | Ga0075370_10183503 | 3300006353 | Bacteria | 1232 |
| 206 | Ga0075370_10228152 | 3300006353 | Bacteria | 1102 |
| 207 | Ga0068871_100019544 | 3300006358 | Bacteria | 5174 |
| 208 | Ga0068871_100030326 | 3300006358 | Bacteria | 4257 |
| 209 | Ga0068871_100165884 | 3300006358 | Bacteria | 1891 |
| 210 | Ga0068871_100308898 | 3300006358 | Bacteria | 1390 |
| 211 | Ga0068871_100803377 | 3300006358 | Bacteria | 867 |
| 212 | Ga0075434_100499961 | 3300006871 | Bacteria | 1237 |
| 213 | Ga0068865_100016331 | 3300006881 | Bacteria | 4750 |
| 214 | Ga0068865_100043762 | 3300006881 | Bacteria | 3061 |
| 215 | Ga0068865_100186818 | 3300006881 | Bacteria | 1599 |
| 216 | Ga0068865_100292425 | 3300006881 | Bacteria | 1301 |
| 217 | Ga0097620_100006126 | 3300006931 | Bacteria | 12221 |
| 218 | Ga0097620_100134911 | 3300006931 | Bacteria | 2541 |
| 219 | Ga0097620_100443297 | 3300006931 | Bacteria | 1395 |
| 220 | Ga0097620_100973874 | 3300006931 | Bacteria | 931 |
| 221 | Ga0097620_101943922 | 3300006931 | Bacteria | 649 |
| 222 | Ga0079104_1000219 | 3300006946 | Bacteria | 79928 |
| 223 | Ga0105240_10056490 | 3300009093 | Bacteria | 4911 |
| 224 | Ga0105245_10241285 | 3300009098 | Bacteria | 1752 |
| 225 | Ga0105245_10468442 | 3300009098 | Bacteria | 1271 |
| 226 | Ga0105245_10669515 | 3300009098 | Bacteria | 1069 |
| 227 | Ga0105245_11584974 | 3300009098 | Bacteria | 706 |
| 228 | Ga0105247_10075644 | 3300009101 | Bacteria | 2114 |
| 229 | Ga0105243_10005579 | 3300009148 | Bacteria | 9801 |
| 230 | Ga0105243_10027205 | 3300009148 | Bacteria | 4380 |
| 231 | Ga0105243_10075641 | 3300009148 | Bacteria | 2734 |
| 232 | Ga0105243_10076482 | 3300009148 | Bacteria | 2720 |
| 233 | Ga0105243_10359554 | 3300009148 | Bacteria | 1339 |
| 234 | Ga0105243_10471184 | 3300009148 | Bacteria | 1183 |
| 235 | Ga0105242_10108564 | 3300009176 | Bacteria | 2362 |
| 236 | Ga0105242_10223305 | 3300009176 | Bacteria | 1685 |
| 237 | Ga0105242_10276735 | 3300009176 | Bacteria | 1523 |
| 238 | Ga0105242_10820157 | 3300009176 | Bacteria | 923 |
| 239 | Ga0105242_11086935 | 3300009176 | Bacteria | 813 |
| 240 | Ga0105248_10004957 | 3300009177 | Bacteria | 14713 |
| 241 | Ga0105248_10085019 | 3300009177 | Bacteria | 3560 |
| 242 | Ga0105248_10094534 | 3300009177 | Bacteria | 3366 |
| 243 | Ga0105248_10102774 | 3300009177 | Bacteria | 3221 |
| 244 | Ga0105248_10129449 | 3300009177 | Bacteria | 2847 |
| 245 | Ga0105248_10143573 | 3300009177 | Bacteria | 2693 |
| 246 | Ga0105248_10171731 | 3300009177 | Bacteria | 2443 |
| 247 | Ga0105248_10177050 | 3300009177 | Bacteria | 2403 |
| 248 | Ga0105248_11089692 | 3300009177 | Bacteria | 903 |
| 249 | Ga0105237_10001461 | 3300009545 | Bacteria | 31169 |
| 250 | Ga0105237_10136973 | 3300009545 | Bacteria | 2443 |
| 251 | Ga0105238_10041551 | 3300009551 | Bacteria | 4656 |
| 252 | Ga0105238_10080234 | 3300009551 | Bacteria | 3253 |
| 253 | Ga0105238_10247603 | 3300009551 | Bacteria | 1760 |
| 254 | Ga0105238_10276361 | 3300009551 | Bacteria | 1660 |
| 255 | Ga0105249_10005956 | 3300009553 | Bacteria | 10564 |
| 256 | Ga0105249_10095215 | 3300009553 | Bacteria | 2791 |
| 257 | Ga0105249_10174875 | 3300009553 | Bacteria | 2084 |
| 258 | Ga0105249_10209339 | 3300009553 | Bacteria | 1913 |
| 259 | Ga0105249_11431945 | 3300009553 | Bacteria | 763 |
| 260 | Ga0105239_10000798 | 3300010375 | Bacteria | 44685 |
| 261 | Ga0105239_10260323 | 3300010375 | Bacteria | 1949 |
| 262 | Ga0105246_10137453 | 3300011119 | Bacteria | 1833 |
| 263 | Ga0105246_10427767 | 3300011119 | Bacteria | 1107 |
| 264 | Ga0105246_10448240 | 3300011119 | Bacteria | 1084 |
| 265 | Ga0157315_1002653 | 3300012508 | Bacteria | 1137 |
| 266 | Ga0157373_10261401 | 3300013100 | Bacteria | 1225 |
| 267 | Ga0157371_10116977 | 3300013102 | Bacteria | 1895 |
| 268 | Ga0157371_10171560 | 3300013102 | Bacteria | 1550 |
| 269 | Ga0157371_10376636 | 3300013102 | Bacteria | 1036 |
| 270 | Ga0157370_10737177 | 3300013104 | Bacteria | 898 |
| 271 | Ga0157369_10200535 | 3300013105 | Bacteria | 2095 |
| 272 | Ga0157374_10034608 | 3300013296 | Bacteria | 4616 |
| 273 | Ga0157374_10998650 | 3300013296 | Bacteria | 856 |
| 274 | Ga0157378_10026414 | 3300013297 | Bacteria | 5118 |
| 275 | Ga0157378_10446469 | 3300013297 | Bacteria | 1283 |
| 276 | Ga0157378_10464780 | 3300013297 | Bacteria | 1258 |
| 277 | Ga0157378_10661106 | 3300013297 | Bacteria | 1061 |
| 278 | Ga0163162_10002995 | 3300013306 | Bacteria | 16145 |
| 279 | Ga0163162_10018246 | 3300013306 | Bacteria | 6872 |
| 280 | Ga0163162_10034726 | 3300013306 | Bacteria | 5020 |
| 281 | Ga0163162_10281661 | 3300013306 | Bacteria | 1795 |
| 282 | Ga0163162_10530677 | 3300013306 | Bacteria | 1306 |
| 283 | Ga0157372_10021809 | 3300013307 | Bacteria | 6923 |
| 284 | Ga0157372_10056661 | 3300013307 | Bacteria | 4378 |
| 285 | Ga0157372_10456279 | 3300013307 | Bacteria | 1489 |
| 286 | Ga0157375_10011447 | 3300013308 | Bacteria | 7833 |
| 287 | Ga0157375_10022022 | 3300013308 | Bacteria | 5860 |
| 288 | Ga0157375_10028630 | 3300013308 | Bacteria | 5227 |
| 289 | Ga0157375_10073701 | 3300013308 | Bacteria | 3433 |
| 290 | Ga0157375_10694567 | 3300013308 | Bacteria | 1171 |
| 291 | Ga0157375_10905174 | 3300013308 | Bacteria | 1026 |
| 292 | Ga0163163_10045264 | 3300014325 | Bacteria | 4319 |
| 293 | Ga0163163_10397389 | 3300014325 | Bacteria | 1436 |
| 294 | Ga0163163_10461235 | 3300014325 | Bacteria | 1331 |
| 295 | Ga0163163_10656366 | 3300014325 | Bacteria | 1112 |
| 296 | Ga0157380_10011565 | 3300014326 | Bacteria | 6378 |
| 297 | Ga0157380_10038429 | 3300014326 | Bacteria | 3716 |
| 298 | Ga0157380_10145152 | 3300014326 | Bacteria | 2044 |
| 299 | Ga0157380_10211694 | 3300014326 | Bacteria | 1728 |
| 300 | Ga0157380_10452633 | 3300014326 | Bacteria | 1233 |
| 301 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 302 | Ga0157377_10017418 | 3300014745 | Bacteria | 3715 |
| 303 | Ga0157377_10270645 | 3300014745 | Bacteria | 1109 |
| 304 | Ga0157379_10008098 | 3300014968 | Bacteria | 9127 |
| 305 | Ga0157379_10076979 | 3300014968 | Bacteria | 2987 |
| 306 | Ga0157379_10099388 | 3300014968 | Bacteria | 2612 |
| 307 | Ga0157379_10111157 | 3300014968 | Bacteria | 2461 |
| 308 | Ga0157379_10124316 | 3300014968 | Bacteria | 2321 |
| 309 | Ga0157379_10287151 | 3300014968 | Bacteria | 1498 |
| 310 | Ga0157379_10301319 | 3300014968 | Bacteria | 1461 |
| 311 | Ga0157379_11144933 | 3300014968 | Bacteria | 746 |
| 312 | Ga0157376_10016516 | 3300014969 | Bacteria | 5607 |
| 313 | Ga0157376_10034451 | 3300014969 | Bacteria | 4089 |
| 314 | Ga0157376_10336084 | 3300014969 | Bacteria | 1441 |
| 315 | Ga0163161_10011344 | 3300017792 | Bacteria | 6179 |
| 316 | Ga0163161_10023239 | 3300017792 | Bacteria | 4372 |
| 317 | Ga0163161_10156286 | 3300017792 | Bacteria | 1736 |
| 318 | Ga0206353_11541288 | 3300020082 | Bacteria | 709 |
| 319 | Ga0213872_10000124 | 3300021361 | Bacteria | 72197 |
| 320 | Ga0213872_10025664 | 3300021361 | Bacteria | 2708 |
| 321 | Ga0213874_10066794 | 3300021377 | Bacteria | 1139 |
| 322 | Ga0213876_10033899 | 3300021384 | Bacteria | 2692 |
| 323 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 324 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 325 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 326 | Ga0209258_100905 | 3300025242 | Bacteria | 15234 |
| 327 | Ga0207425_1000135 | 3300025245 | Bacteria | 66450 |
| 328 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 329 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 330 | Ga0209677_100099 | 3300025253 | Bacteria | 92370 |
| 331 | Ga0209677_100229 | 3300025253 | Bacteria | 39781 |
| 332 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 333 | Ga0209759_1001738 | 3300025256 | Bacteria | 11175 |
| 334 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 335 | Ga0209565_1011977 | 3300025263 | Bacteria | 2086 |
| 336 | Ga0209673_1006841 | 3300025273 | Bacteria | 5407 |
| 337 | Ga0209673_1024511 | 3300025273 | Bacteria | 2025 |
| 338 | Ga0209673_1030482 | 3300025273 | Bacteria | 1698 |
| 339 | Ga0209675_1007084 | 3300025291 | Bacteria | 4369 |
| 340 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 341 | Ga0209758_1000492 | 3300025297 | Bacteria | 64511 |
| 342 | Ga0209758_1005135 | 3300025297 | Bacteria | 10334 |
| 343 | Ga0209050_1000493 | 3300025298 | Bacteria | 67885 |
| 344 | Ga0209050_1000543 | 3300025298 | Bacteria | 62404 |
| 345 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 346 | Ga0209256_1061866 | 3300025299 | Bacteria | 869 |
| 347 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 348 | Ga0209051_1019596 | 3300025303 | Bacteria | 2945 |
| 349 | Ga0209257_1000189 | 3300025304 | Bacteria | 153917 |
| 350 | Ga0209257_1047791 | 3300025304 | Bacteria | 1228 |
| 351 | Ga0207697_10029600 | 3300025315 | Bacteria | 2241 |
| 352 | Ga0207697_10054283 | 3300025315 | Bacteria | 1660 |
| 353 | Ga0207697_10059751 | 3300025315 | Bacteria | 1584 |
| 354 | Ga0207697_10168221 | 3300025315 | Bacteria | 958 |
| 355 | Ga0207656_10036966 | 3300025321 | Bacteria | 2052 |
| 356 | Ga0207656_10050341 | 3300025321 | Bacteria | 1798 |
| 357 | Ga0207656_10170497 | 3300025321 | Bacteria | 1040 |
| 358 | Ga0207682_10001133 | 3300025893 | Bacteria | 12330 |
| 359 | Ga0207682_10127067 | 3300025893 | Bacteria | 1135 |
| 360 | Ga0207682_10203306 | 3300025893 | Bacteria | 911 |
| 361 | Ga0207642_10011641 | 3300025899 | Bacteria | 3147 |
| 362 | Ga0207642_10038390 | 3300025899 | Bacteria | 2072 |
| 363 | Ga0207642_10472945 | 3300025899 | Bacteria | 763 |
| 364 | Ga0207688_10209477 | 3300025901 | Bacteria | 1171 |
| 365 | Ga0207680_10153557 | 3300025903 | Bacteria | 1537 |
| 366 | Ga0207680_10300438 | 3300025903 | Bacteria | 1119 |
| 367 | Ga0207680_10331701 | 3300025903 | Bacteria | 1066 |
| 368 | Ga0207645_10001485 | 3300025907 | Bacteria | 19163 |
| 369 | Ga0207645_10003455 | 3300025907 | Bacteria | 11994 |
| 370 | Ga0207645_10032134 | 3300025907 | Bacteria | 3375 |
| 371 | Ga0207645_10040758 | 3300025907 | Bacteria | 2974 |
| 372 | Ga0207645_10086286 | 3300025907 | Bacteria | 2016 |
| 373 | Ga0207645_10167509 | 3300025907 | Bacteria | 1439 |
| 374 | Ga0207645_10431195 | 3300025907 | Bacteria | 889 |
| 375 | Ga0207643_10043348 | 3300025908 | Bacteria | 2539 |
| 376 | Ga0207643_10143132 | 3300025908 | Bacteria | 1429 |
| 377 | Ga0207643_10485155 | 3300025908 | Bacteria | 789 |
| 378 | Ga0207705_10035148 | 3300025909 | Bacteria | 3585 |
| 379 | Ga0207705_10254922 | 3300025909 | Bacteria | 1338 |
| 380 | Ga0207707_10217021 | 3300025912 | Bacteria | 1665 |
| 381 | Ga0207695_10042429 | 3300025913 | Bacteria | 4859 |
| 382 | Ga0207671_10010195 | 3300025914 | Bacteria | 7780 |
| 383 | Ga0207671_10080694 | 3300025914 | Bacteria | 2439 |
| 384 | Ga0207660_10047209 | 3300025917 | Bacteria | 3043 |
| 385 | Ga0207662_10008374 | 3300025918 | Bacteria | 5661 |
| 386 | Ga0207662_10098300 | 3300025918 | Bacteria | 1811 |
| 387 | Ga0207657_10196071 | 3300025919 | Bacteria | 1627 |
| 388 | Ga0207657_10260853 | 3300025919 | Bacteria | 1379 |
| 389 | Ga0207649_10009230 | 3300025920 | Bacteria | 5393 |
| 390 | Ga0207649_10332951 | 3300025920 | Bacteria | 1119 |
| 391 | Ga0207649_10744991 | 3300025920 | Bacteria | 762 |
| 392 | Ga0207652_10092835 | 3300025921 | Bacteria | 2655 |
| 393 | Ga0207681_10004618 | 3300025923 | Bacteria | 8465 |
| 394 | Ga0207681_10035795 | 3300025923 | Bacteria | 3273 |
| 395 | Ga0207681_10259577 | 3300025923 | Bacteria | 1360 |
| 396 | Ga0207681_10348704 | 3300025923 | Bacteria | 1184 |
| 397 | Ga0207694_10025174 | 3300025924 | Bacteria | 4521 |
| 398 | Ga0207694_10105545 | 3300025924 | Bacteria | 2237 |
| 399 | Ga0207694_10178316 | 3300025924 | Bacteria | 1722 |
| 400 | Ga0207694_10203967 | 3300025924 | Bacteria | 1609 |
| 401 | Ga0207650_10003908 | 3300025925 | Bacteria | 10189 |
| 402 | Ga0207650_10055912 | 3300025925 | Bacteria | 2931 |
| 403 | Ga0207650_10110025 | 3300025925 | Bacteria | 2131 |
| 404 | Ga0207650_10392359 | 3300025925 | Bacteria | 1148 |
| 405 | Ga0207650_10421572 | 3300025925 | Bacteria | 1107 |
| 406 | Ga0207659_10000477 | 3300025926 | Bacteria | 24093 |
| 407 | Ga0207659_10032109 | 3300025926 | Bacteria | 3600 |
| 408 | Ga0207659_10092971 | 3300025926 | Bacteria | 2256 |
| 409 | Ga0207659_10204965 | 3300025926 | Bacteria | 1577 |
| 410 | Ga0207687_10064103 | 3300025927 | Bacteria | 2604 |
| 411 | Ga0207687_10246794 | 3300025927 | Bacteria | 1417 |
| 412 | Ga0207687_10420010 | 3300025927 | Bacteria | 1103 |
| 413 | Ga0207644_10002098 | 3300025931 | Bacteria | 12916 |
| 414 | Ga0207644_10006058 | 3300025931 | Bacteria | 7888 |
| 415 | Ga0207644_10012856 | 3300025931 | Bacteria | 5568 |
| 416 | Ga0207644_10017153 | 3300025931 | Bacteria | 4884 |
| 417 | Ga0207644_10028271 | 3300025931 | Bacteria | 3880 |
| 418 | Ga0207644_10164021 | 3300025931 | Bacteria | 1729 |
| 419 | Ga0207644_10310410 | 3300025931 | Bacteria | 1273 |
| 420 | Ga0207690_10059776 | 3300025932 | Bacteria | 2584 |
| 421 | Ga0207706_10000756 | 3300025933 | Bacteria | 33603 |
| 422 | Ga0207706_10004450 | 3300025933 | Bacteria | 13166 |
| 423 | Ga0207706_10051089 | 3300025933 | Bacteria | 3651 |
| 424 | Ga0207706_10427490 | 3300025933 | Bacteria | 1147 |
| 425 | Ga0207706_10512977 | 3300025933 | Bacteria | 1034 |
| 426 | Ga0207706_10954362 | 3300025933 | Bacteria | 722 |
| 427 | Ga0207686_10065322 | 3300025934 | Bacteria | 2320 |
| 428 | Ga0207686_10104121 | 3300025934 | Bacteria | 1900 |
| 429 | Ga0207686_10237298 | 3300025934 | Bacteria | 1325 |
| 430 | Ga0207686_10271432 | 3300025934 | Bacteria | 1248 |
| 431 | Ga0207709_10003694 | 3300025935 | Bacteria | 9012 |
| 432 | Ga0207709_10012740 | 3300025935 | Bacteria | 4635 |
| 433 | Ga0207709_10247401 | 3300025935 | Bacteria | 1300 |
| 434 | Ga0207709_10323691 | 3300025935 | Bacteria | 1155 |
| 435 | Ga0207670_10025777 | 3300025936 | Bacteria | 3696 |
| 436 | Ga0207669_10006650 | 3300025937 | Bacteria | 5299 |
| 437 | Ga0207669_10150979 | 3300025937 | Bacteria | 1627 |
| 438 | Ga0207669_10504645 | 3300025937 | Bacteria | 968 |
| 439 | Ga0207669_11106899 | 3300025937 | Bacteria | 669 |
| 440 | Ga0207704_10027876 | 3300025938 | Bacteria | 3124 |
| 441 | Ga0207704_10085743 | 3300025938 | Bacteria | 2052 |
| 442 | Ga0207704_10128832 | 3300025938 | Bacteria | 1748 |
| 443 | Ga0207704_10154010 | 3300025938 | Bacteria | 1626 |
| 444 | Ga0207704_10214036 | 3300025938 | Bacteria | 1421 |
| 445 | Ga0207665_10274839 | 3300025939 | Bacteria | 1252 |
| 446 | Ga0207691_10003923 | 3300025940 | Bacteria | 14453 |
| 447 | Ga0207691_10005630 | 3300025940 | Bacteria | 12112 |
| 448 | Ga0207691_10017263 | 3300025940 | Bacteria | 6846 |
| 449 | Ga0207691_10086956 | 3300025940 | Bacteria | 2804 |
| 450 | Ga0207691_10111776 | 3300025940 | Bacteria | 2429 |
| 451 | Ga0207691_10181038 | 3300025940 | Bacteria | 1842 |
| 452 | Ga0207691_10183319 | 3300025940 | Bacteria | 1828 |
| 453 | Ga0207691_10353869 | 3300025940 | Bacteria | 1256 |
| 454 | Ga0207711_10021174 | 3300025941 | Bacteria | 5431 |
| 455 | Ga0207711_10087955 | 3300025941 | Bacteria | 2727 |
| 456 | Ga0207711_10173950 | 3300025941 | Bacteria | 1955 |
| 457 | Ga0207711_10187313 | 3300025941 | Bacteria | 1884 |
| 458 | Ga0207711_10398515 | 3300025941 | Bacteria | 1278 |
| 459 | Ga0207711_10624137 | 3300025941 | Bacteria | 1006 |
| 460 | Ga0207689_10006829 | 3300025942 | Bacteria | 10035 |
| 461 | Ga0207689_10012976 | 3300025942 | Bacteria | 7115 |
| 462 | Ga0207689_10015924 | 3300025942 | Bacteria | 6366 |
| 463 | Ga0207689_10170138 | 3300025942 | Bacteria | 1796 |
| 464 | Ga0207689_10290938 | 3300025942 | Bacteria | 1353 |
| 465 | Ga0207689_10512444 | 3300025942 | Bacteria | 1006 |
| 466 | Ga0207661_10109080 | 3300025944 | Bacteria | 2338 |
| 467 | Ga0207661_10465463 | 3300025944 | Bacteria | 1153 |
| 468 | Ga0207661_10744017 | 3300025944 | Bacteria | 902 |
| 469 | Ga0207679_10187645 | 3300025945 | Bacteria | 1716 |
| 470 | Ga0207667_10001779 | 3300025949 | Bacteria | 27124 |
| 471 | Ga0207667_10027622 | 3300025949 | Bacteria | 6174 |
| 472 | Ga0207667_10284225 | 3300025949 | Bacteria | 1690 |
| 473 | Ga0207667_10389035 | 3300025949 | Bacteria | 1420 |
| 474 | Ga0207651_10014724 | 3300025960 | Bacteria | 4525 |
| 475 | Ga0207651_10016116 | 3300025960 | Bacteria | 4366 |
| 476 | Ga0207651_10026134 | 3300025960 | Bacteria | 3641 |
| 477 | Ga0207651_10063782 | 3300025960 | Bacteria | 2575 |
| 478 | Ga0207651_10109427 | 3300025960 | Bacteria | 2070 |
| 479 | Ga0207651_10528183 | 3300025960 | Bacteria | 1023 |
| 480 | Ga0207651_10574223 | 3300025960 | Bacteria | 983 |
| 481 | Ga0207651_10615298 | 3300025960 | Bacteria | 951 |
| 482 | Ga0207712_10011348 | 3300025961 | Bacteria | 5675 |
| 483 | Ga0207712_10066863 | 3300025961 | Bacteria | 2571 |
| 484 | Ga0207712_10096638 | 3300025961 | Bacteria | 2187 |
| 485 | Ga0207712_10208354 | 3300025961 | Bacteria | 1555 |
| 486 | Ga0207712_10798811 | 3300025961 | Bacteria | 829 |
| 487 | Ga0207668_10004912 | 3300025972 | Bacteria | 7862 |
| 488 | Ga0207668_10060300 | 3300025972 | Bacteria | 2662 |
| 489 | Ga0207668_10159802 | 3300025972 | Bacteria | 1754 |
| 490 | Ga0207668_10643016 | 3300025972 | Bacteria | 928 |
| 491 | Ga0207640_10050170 | 3300025981 | Bacteria | 2706 |
| 492 | Ga0207640_10180862 | 3300025981 | Bacteria | 1581 |
| 493 | Ga0207640_10236278 | 3300025981 | Bacteria | 1409 |
| 494 | Ga0207640_10415126 | 3300025981 | Bacteria | 1100 |
| 495 | Ga0207658_10001089 | 3300025986 | Bacteria | 21924 |
| 496 | Ga0207658_10018268 | 3300025986 | Bacteria | 4839 |
| 497 | Ga0207658_10027241 | 3300025986 | Bacteria | 4013 |
| 498 | Ga0207658_10229553 | 3300025986 | Bacteria | 1566 |
| 499 | Ga0207658_10365492 | 3300025986 | Bacteria | 1260 |
| 500 | Ga0207677_10003776 | 3300026023 | Bacteria | 8043 |
| 501 | Ga0207677_10041582 | 3300026023 | Bacteria | 3041 |
| 502 | Ga0207677_10063934 | 3300026023 | Bacteria | 2560 |
| 503 | Ga0207677_10192071 | 3300026023 | Bacteria | 1616 |
| 504 | Ga0207703_10000996 | 3300026035 | Bacteria | 27254 |
| 505 | Ga0207703_10011365 | 3300026035 | Bacteria | 6926 |
| 506 | Ga0207703_10041270 | 3300026035 | Bacteria | 3695 |
| 507 | Ga0207703_10292989 | 3300026035 | Bacteria | 1482 |
| 508 | Ga0207703_10426963 | 3300026035 | Bacteria | 1234 |
| 509 | Ga0207639_10026149 | 3300026041 | Bacteria | 4239 |
| 510 | Ga0207639_10159358 | 3300026041 | Bacteria | 1900 |
| 511 | Ga0207639_10378573 | 3300026041 | Bacteria | 1270 |
| 512 | Ga0207678_10000966 | 3300026067 | Bacteria | 26297 |
| 513 | Ga0207678_10022962 | 3300026067 | Bacteria | 5459 |
| 514 | Ga0207678_10170485 | 3300026067 | Bacteria | 1858 |
| 515 | Ga0207678_10248405 | 3300026067 | Bacteria | 1524 |
| 516 | Ga0207678_10513594 | 3300026067 | Bacteria | 1045 |
| 517 | Ga0207678_10886482 | 3300026067 | Bacteria | 789 |
| 518 | Ga0207708_10012827 | 3300026075 | Bacteria | 6249 |
| 519 | Ga0207708_10084433 | 3300026075 | Bacteria | 2441 |
| 520 | Ga0207708_10796951 | 3300026075 | Bacteria | 813 |
| 521 | Ga0207702_10001447 | 3300026078 | Bacteria | 23592 |
| 522 | Ga0207702_10039270 | 3300026078 | Bacteria | 3965 |
| 523 | Ga0207702_10095359 | 3300026078 | Bacteria | 2614 |
| 524 | Ga0207702_10184339 | 3300026078 | Bacteria | 1924 |
| 525 | Ga0207641_10007488 | 3300026088 | Bacteria | 9086 |
| 526 | Ga0207641_10017054 | 3300026088 | Bacteria | 5942 |
| 527 | Ga0207641_10027717 | 3300026088 | Bacteria | 4680 |
| 528 | Ga0207641_10338895 | 3300026088 | Bacteria | 1430 |
| 529 | Ga0207641_10627346 | 3300026088 | Bacteria | 1054 |
| 530 | Ga0207641_10671194 | 3300026088 | Bacteria | 1019 |
| 531 | Ga0207641_10933529 | 3300026088 | Bacteria | 862 |
| 532 | Ga0207641_11081835 | 3300026088 | Bacteria | 800 |
| 533 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 534 | Ga0207648_10002634 | 3300026089 | Bacteria | 19183 |
| 535 | Ga0207648_10003767 | 3300026089 | Bacteria | 15842 |
| 536 | Ga0207648_10028344 | 3300026089 | Bacteria | 4965 |
| 537 | Ga0207648_10034335 | 3300026089 | Bacteria | 4471 |
| 538 | Ga0207648_10144132 | 3300026089 | Bacteria | 2101 |
| 539 | Ga0207648_10154764 | 3300026089 | Bacteria | 2023 |
| 540 | Ga0207648_10555413 | 3300026089 | Bacteria | 1055 |
| 541 | Ga0207676_10002837 | 3300026095 | Bacteria | 12331 |
| 542 | Ga0207676_10008453 | 3300026095 | Bacteria | 7319 |
| 543 | Ga0207676_10075841 | 3300026095 | Bacteria | 2714 |
| 544 | Ga0207676_10119394 | 3300026095 | Bacteria | 2220 |
| 545 | Ga0207676_10709176 | 3300026095 | Bacteria | 975 |
| 546 | Ga0207676_10778030 | 3300026095 | Bacteria | 932 |
| 547 | Ga0207674_10040240 | 3300026116 | Bacteria | 4844 |
| 548 | Ga0207674_10196958 | 3300026116 | Bacteria | 1964 |
| 549 | Ga0207674_10320406 | 3300026116 | Bacteria | 1499 |
| 550 | Ga0207675_100002744 | 3300026118 | Bacteria | 17315 |
| 551 | Ga0207675_100003062 | 3300026118 | Bacteria | 16396 |
| 552 | Ga0207675_100003340 | 3300026118 | Bacteria | 15701 |
| 553 | Ga0207675_100054366 | 3300026118 | Bacteria | 3735 |
| 554 | Ga0207675_101059939 | 3300026118 | Bacteria | 830 |
| 555 | Ga0207683_10004250 | 3300026121 | Bacteria | 12360 |
| 556 | Ga0207683_10098580 | 3300026121 | Bacteria | 2607 |
| 557 | Ga0207683_10102117 | 3300026121 | Bacteria | 2560 |
| 558 | Ga0207683_10113630 | 3300026121 | Bacteria | 2425 |
| 559 | Ga0207683_10333210 | 3300026121 | Bacteria | 1391 |
| 560 | Ga0207683_10665885 | 3300026121 | Bacteria | 964 |
| 561 | Ga0207683_10706936 | 3300026121 | Bacteria | 934 |
| 562 | Ga0207698_10022610 | 3300026142 | Bacteria | 4374 |
| 563 | Ga0207698_10044988 | 3300026142 | Bacteria | 3322 |
| 564 | Ga0207698_10076294 | 3300026142 | Bacteria | 2682 |
| 565 | Ga0207698_10148841 | 3300026142 | Bacteria | 2029 |
| 566 | Ga0207698_10553626 | 3300026142 | Bacteria | 1128 |
| 567 | Ga0207698_11161424 | 3300026142 | Bacteria | 786 |
| 568 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 569 | Ga0268266_10202271 | 3300028379 | Bacteria | 1818 |
| 570 | Ga0268266_10383588 | 3300028379 | Bacteria | 1326 |
| 571 | Ga0268266_10494379 | 3300028379 | Bacteria | 1167 |
| 572 | Ga0268265_10011082 | 3300028380 | Bacteria | 6092 |
| 573 | Ga0268265_10029539 | 3300028380 | Bacteria | 3936 |
| 574 | Ga0268265_10048060 | 3300028380 | Bacteria | 3201 |
| 575 | Ga0268265_10895161 | 3300028380 | Bacteria | 871 |
| 576 | Ga0268264_10001857 | 3300028381 | Bacteria | 19207 |
| 577 | Ga0268264_10002570 | 3300028381 | Bacteria | 15905 |
| 578 | Ga0268264_10005397 | 3300028381 | Bacteria | 10824 |
| 579 | Ga0268264_10465785 | 3300028381 | Bacteria | 1227 |
| 580 | Ga0268264_10493103 | 3300028381 | Bacteria | 1193 |
| 581 | Ga0307517_10355623 | 3300028786 | Bacteria | 793 |
| 582 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 583 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 584 | Ga0307515_10002971 | 3300028794 | Bacteria | 35983 |
| 585 | Ga0307515_10005461 | 3300028794 | Bacteria | 25733 |
| 586 | Ga0307515_10023160 | 3300028794 | Bacteria | 10900 |
| 587 | Ga0307515_10499075 | 3300028794 | Bacteria | 828 |
| 588 | Ga0307512_10226649 | 3300030522 | Bacteria | 967 |
| 589 | Ga0307513_10008355 | 3300031456 | Bacteria | 13260 |
| 590 | Ga0307513_10329372 | 3300031456 | Bacteria | 1282 |
| 591 | Ga0307509_10229820 | 3300031507 | Bacteria | 1659 |
| 592 | Ga0307509_10626761 | 3300031507 | Bacteria | 746 |
| 593 | Ga0307408_100022119 | 3300031548 | Bacteria | 4315 |
| 594 | Ga0307408_100998114 | 3300031548 | Bacteria | 771 |
| 595 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 596 | Ga0307514_10013831 | 3300031649 | Bacteria | 6687 |
| 597 | Ga0307516_10000326 | 3300031730 | Bacteria | 61941 |
| 598 | Ga0307516_10000897 | 3300031730 | Bacteria | 40914 |
| 599 | Ga0307516_10004009 | 3300031730 | Bacteria | 18468 |
| 600 | Ga0307516_10013751 | 3300031730 | Bacteria | 8596 |
| 601 | Ga0307516_10363926 | 3300031730 | Bacteria | 1110 |
| 602 | Ga0307516_10774532 | 3300031730 | Bacteria | 620 |
| 603 | Ga0307405_10014690 | 3300031731 | Bacteria | 4219 |
| 604 | Ga0307405_10271041 | 3300031731 | Bacteria | 1273 |
| 605 | Ga0307412_10017136 | 3300031911 | Bacteria | 4332 |
| 606 | Ga0307412_10643894 | 3300031911 | Bacteria | 903 |
| 607 | Ga0307409_100002191 | 3300031995 | Bacteria | 10092 |
| 608 | Ga0307416_100002040 | 3300032002 | Bacteria | 11368 |
| 609 | Ga0307415_100012627 | 3300032126 | Bacteria | 4891 |
| 610 | Ga0373926_0096227 | 3300035083 | Bacteria | 1104 |
| 611 | Ga0373928_0006412 | 3300035084 | Bacteria | 2262 |
| 612 | Ga0373944_0073850 | 3300035089 | Bacteria | 1116 |
| 613 | Ga0373951_0035326 | 3300035091 | Bacteria | 1190 |
| 614 | Ga0373923_0121198 | 3300035111 | Bacteria | 1169 |
| 615 | Ga0373943_0088252 | 3300035170 | Bacteria | 1602 |
| 616 | Ga0373931_0109225 | 3300035691 | Bacteria | 1567 |
| 617 | Ga0373931_0267977 | 3300035691 | Bacteria | 1044 |
| 618 | Ga0373927_0039242 | 3300035695 | Bacteria | 3073 |
| 619 | Ga0373933_0044022 | 3300035724 | Bacteria | 2643 |
| 620 | Ga0373947_0377373 | 3300035725 | Bacteria | 954 |
| 621 | Ga0373947_0730224 | 3300035725 | Bacteria | 676 |
| 622 | Ga0373937_0010021 | 3300036401 | Bacteria | 8264 |
| 623 | Ga0373937_0010446 | 3300036401 | Bacteria | 8106 |
| 624 | Ga0373937_0019374 | 3300036401 | Bacteria | 6091 |
| 625 | Ga0373925_0009400 | 3300037068 | Bacteria | 7117 |
| 626 | Ga0395898_0013276 | 3300037466 | Bacteria | 8484 |
| 627 | Ga0395905_0023405 | 3300037471 | Bacteria | 5837 |
| 628 | Ga0395905_0092607 | 3300037471 | Bacteria | 2834 |
| 629 | Ga0395905_0500396 | 3300037471 | Bacteria | 1115 |
| 630 | Ga0395901_0025620 | 3300038443 | Bacteria | 6055 |
| 631 | Ga0436365_0269082 | 3300039437 | Bacteria | 3442 |
| 632 | Ga0436361_0638016 | 3300039447 | Bacteria | 61418 |
| 633 | Ga0436361_1079715 | 3300039447 | Bacteria | 4877 |
| 634 | Ga0451789_1262443 | 3300041443 | Bacteria | 2071 |
| 635 | Ga0451793_0222243 | 3300041452 | Bacteria | 1201 |
| 636 | Ga0451795_0973934 | 3300041456 | Bacteria | 932 |
| 637 | Ga0451798_0696078 | 3300041458 | Bacteria | 2059 |
| 638 | Ga0451798_0943568 | 3300041458 | Bacteria | 661 |
| 639 | Ga0451800_0201523 | 3300041459 | Bacteria | 2889 |
| 640 | Ga0451802_0764781 | 3300041460 | Bacteria | 707 |
| 641 | Ga0451807_0144702 | 3300041486 | Bacteria | 669 |
| 642 | Ga0451807_2247218 | 3300041486 | Bacteria | 1199 |
| 643 | Ga0451833_1413866 | 3300041491 | Bacteria | 1447 |
| 644 | Ga0451837_1331648 | 3300041494 | Bacteria | 1031 |
| 645 | Ga0451839_1398550 | 3300041496 | Bacteria | 1305 |
| 646 | Ga0451839_1477579 | 3300041496 | Bacteria | 994 |
| 647 | Ga0451853_0706420 | 3300041512 | Bacteria | 1172 |
| 648 | Ga0451853_1001559 | 3300041512 | Bacteria | 1296 |
| 649 | Ga0451853_1709673 | 3300041512 | Bacteria | 788 |
| 650 | Ga0439455_0000995 | 3300042012 | Bacteria | 4450 |
| 651 | Ga0450917_001576 | 3300042120 | Bacteria | 1634 |
| 652 | Ga0450888_005436 | 3300042126 | Bacteria | 1359 |
| 653 | Ga0450890_001208 | 3300042127 | Bacteria | 3743 |
| 654 | Ga0450897_016535 | 3300042128 | Bacteria | 761 |
| 655 | Ga0439464_0018264 | 3300042439 | Bacteria | 1907 |
| 656 | Ga0450893_0003848 | 3300042532 | Bacteria | 2378 |
| 657 | Ga0450901_022267 | 3300042533 | Bacteria | 683 |
| 658 | Ga0451577_0008482 | 3300042876 | Bacteria | 10003 |
| 659 | Ga0451577_0011912 | 3300042876 | Bacteria | 8199 |
| 660 | Ga0451577_0015837 | 3300042876 | Bacteria | 6997 |
| 661 | Ga0451577_0031249 | 3300042876 | Bacteria | 4806 |
| 662 | Ga0451577_0210878 | 3300042876 | Bacteria | 1755 |
| 663 | Ga0451577_0416698 | 3300042876 | Bacteria | 1219 |
| 664 | Ga0451577_0586475 | 3300042876 | Bacteria | 1012 |
| 665 | Ga0453683_0099201 | 3300044673 | Bacteria | 1829 |
| 666 | Ga0453684_0137499 | 3300044712 | Bacteria | 2922 |
| 667 | Ga0453684_0157052 | 3300044712 | Bacteria | 2695 |
| 668 | Ga0453684_0314595 | 3300044712 | Bacteria | 1775 |
| 669 | Ga0466960_0111680 | 3300044901 | Bacteria | 1421 |
| 670 | Ga0451576_0015228 | 3300045051 | Bacteria | 8526 |
| 671 | Ga0451576_0019110 | 3300045051 | Bacteria | 7487 |
| 672 | Ga0451576_0039970 | 3300045051 | Bacteria | 4966 |
| 673 | Ga0451576_0179833 | 3300045051 | Bacteria | 2208 |
| 674 | Ga0451576_0223298 | 3300045051 | Bacteria | 1967 |
| 675 | Ga0451576_0457407 | 3300045051 | Bacteria | 1340 |
| 676 | Ga0451576_0659431 | 3300045051 | Bacteria | 1100 |
| 677 | Ga0451576_1115371 | 3300045051 | Bacteria | 825 |
| 678 | Ga0451576_1230914 | 3300045051 | Bacteria | 781 |
| 679 | Ga0466967_1017864 | 3300045976 | Bacteria | 825 |
| 680 | Ga0495603_0195820 | 3300046455 | Bacteria | 1168 |
| 681 | Ga0495629_0025312 | 3300046459 | Bacteria | 4220 |
| 682 | Ga0495629_0238822 | 3300046459 | Bacteria | 1251 |
| 683 | Ga0495638_0174148 | 3300046460 | Bacteria | 1232 |
| 684 | Ga0495580_0099089 | 3300046472 | Bacteria | 2027 |
| 685 | Ga0495580_0180471 | 3300046472 | Bacteria | 1458 |
| 686 | Ga0495582_0150989 | 3300046473 | Bacteria | 1319 |
| 687 | Ga0495662_0288837 | 3300046476 | Bacteria | 807 |
| 688 | Ga0495664_0660250 | 3300046477 | Bacteria | 619 |
| 689 | Ga0495608_0051711 | 3300046511 | Bacteria | 2722 |
| 690 | Ga0495610_0146960 | 3300046512 | Bacteria | 1009 |
| 691 | Ga0495620_0110947 | 3300046515 | Bacteria | 1087 |
| 692 | Ga0495632_0006463 | 3300046519 | Bacteria | 7529 |
| 693 | Ga0495632_0115020 | 3300046519 | Bacteria | 1260 |
| 694 | Ga0495643_0021831 | 3300046522 | Bacteria | 3664 |
| 695 | Ga0495652_0496418 | 3300046529 | Bacteria | 847 |
| 696 | Ga0495640_0579661 | 3300046533 | Bacteria | 679 |
| 697 | Ga0495586_0150238 | 3300046535 | Bacteria | 1310 |
| 698 | Ga0495586_0305057 | 3300046535 | Bacteria | 912 |
| 699 | Ga0495598_0027037 | 3300046537 | Bacteria | 1579 |
| 700 | Ga0495621_0101233 | 3300046539 | Bacteria | 1097 |
| 701 | Ga0495621_0270309 | 3300046539 | Bacteria | 698 |
| 702 | Ga0495597_0000584 | 3300046542 | Bacteria | 30197 |
| 703 | Ga0495645_0126462 | 3300046543 | Bacteria | 1796 |
| 704 | Ga0495645_0245601 | 3300046543 | Bacteria | 1192 |
| 705 | Ga0495625_0001533 | 3300046660 | Bacteria | 27598 |
| 706 | Ga0495625_0208647 | 3300046660 | Bacteria | 1285 |
| 707 | Ga0495635_0251003 | 3300046663 | Bacteria | 1193 |
| 708 | Ga0495599_0288996 | 3300046678 | Bacteria | 992 |
| 709 | Ga0495647_0142634 | 3300046681 | Bacteria | 1022 |
| 710 | Ga0495658_0016429 | 3300046683 | Bacteria | 3810 |
| 711 | Ga0495658_0115438 | 3300046683 | Bacteria | 1618 |
| 712 | Ga0495658_0163292 | 3300046683 | Bacteria | 1375 |
| 713 | Ga0495658_0167940 | 3300046683 | Bacteria | 1356 |
| 714 | Ga0495613_0060723 | 3300046689 | Bacteria | 2768 |
| 715 | Ga0495671_0386898 | 3300046692 | Bacteria | 670 |
| 716 | Ga0495674_0671787 | 3300047319 | Bacteria | 815 |
| 717 | Ga0495680_0145655 | 3300047322 | Bacteria | 1730 |
| 718 | Ga0495681_0153145 | 3300047470 | Bacteria | 966 |
| 719 | Ga0495684_0139402 | 3300047471 | Bacteria | 1819 |
| 720 | Ga0496100_0122492 | 3300048903 | Bacteria | 1821 |
| 721 | Ga0496100_0468249 | 3300048903 | Bacteria | 968 |
| 722 | Ga0496101_0178180 | 3300048904 | Bacteria | 1636 |
| 723 | Ga0496101_0763857 | 3300048904 | Bacteria | 763 |
| 724 | Ga0496102_0089284 | 3300048905 | Bacteria | 2851 |
| 725 | Ga0496104_0300869 | 3300048907 | Bacteria | 1516 |
| 726 | Ga0496104_0393688 | 3300048907 | Bacteria | 1298 |
| 727 | Ga0496104_0490063 | 3300048907 | Bacteria | 1140 |
| 728 | Ga0496105_0465025 | 3300048908 | Bacteria | 997 |
| 729 | Ga0496106_0100627 | 3300048909 | Bacteria | 2242 |
| 730 | Ga0496106_0355947 | 3300048909 | Bacteria | 1176 |
| 731 | Ga0496107_0025360 | 3300048910 | Bacteria | 4198 |
| 732 | Ga0496108_0037095 | 3300048911 | Bacteria | 4059 |
| 733 | Ga0496108_0258500 | 3300048911 | Bacteria | 1515 |
| 734 | Ga0496108_1188953 | 3300048911 | Bacteria | 645 |
| 735 | Ga0496109_0140298 | 3300048912 | Bacteria | 2260 |
| 736 | Ga0496109_0179647 | 3300048912 | Bacteria | 1987 |
| 737 | Ga0496110_0318454 | 3300048913 | Bacteria | 1417 |
| 738 | Ga0496110_1118654 | 3300048913 | Bacteria | 696 |
| 739 | Ga0496111_0016712 | 3300048914 | Bacteria | 5062 |
| 740 | Ga0496112_0059693 | 3300048915 | Bacteria | 3758 |
| 741 | Ga0496112_0698405 | 3300048915 | Bacteria | 942 |
| 742 | Ga0496113_0006211 | 3300048916 | Bacteria | 7549 |
| 743 | Ga0496113_0183866 | 3300048916 | Bacteria | 1657 |
| 744 | Ga0496114_0007670 | 3300048917 | Bacteria | 8534 |
| 745 | Ga0496114_0225156 | 3300048917 | Bacteria | 1647 |
| 746 | Ga0501291_004192 | 3300049514 | Bacteria | 1831 |
| 747 | Ga0501292_023759 | 3300049515 | Bacteria | 1003 |
| 748 | Ga0501296_005483 | 3300049519 | Bacteria | 1418 |
| 749 | Ga0501297_007094 | 3300049520 | Bacteria | 1209 |
| 750 | Ga0501298_004484 | 3300049521 | Bacteria | 2203 |
| 751 | Ga0501300_004947 | 3300049523 | Bacteria | 1969 |
| 752 | Ga0501314_005420 | 3300049530 | Bacteria | 1086 |
| 753 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 754 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 755 | Ga0501048_0042937 | 3300049582 | Bacteria | 3236 |
| 756 | Ga0501048_0673799 | 3300049582 | Bacteria | 743 |
| 757 | Ga0501206_003159 | 3300049653 | Bacteria | 2093 |
| 758 | Ga0501207_024199 | 3300049654 | Bacteria | 990 |
| 759 | Ga0501211_009028 | 3300049658 | Bacteria | 974 |
| 760 | Ga0501217_145269 | 3300049661 | Bacteria | 705 |
| 761 | Ga0501222_001642 | 3300049662 | Bacteria | 3107 |
| 762 | Ga0501235_008379 | 3300049669 | Bacteria | 2256 |
| 763 | Ga0501255_010837 | 3300049684 | Bacteria | 1039 |
| 764 | Ga0501257_020153 | 3300049686 | Bacteria | 1564 |
| 765 | Ga0501258_008448 | 3300049687 | Bacteria | 1059 |
| 766 | Ga0501221_002992 | 3300049704 | Bacteria | 2785 |
| 767 | Ga0501225_0011455 | 3300049705 | Bacteria | 2493 |
| 768 | Ga0501262_002721 | 3300049759 | Bacteria | 1995 |
| 769 | Ga0501262_030401 | 3300049759 | Bacteria | 776 |
| 770 | Ga0501267_002045 | 3300049764 | Bacteria | 1783 |
| 771 | Ga0501272_041492 | 3300049769 | Bacteria | 615 |
| 772 | Ga0501280_020979 | 3300049776 | Bacteria | 972 |
| 773 | Ga0501281_04548 | 3300049777 | Bacteria | 973 |
| 774 | Ga0501283_001477 | 3300049779 | Bacteria | 3042 |
| 775 | Ga0501045_0012726 | 3300049824 | Bacteria | 5927 |
| 776 | nmdc:mga03683_375809_c1 | 3300050489 | Bacteria | 676 |
| 777 | nmdc:mga00v17_19912_c1 | 3300050491 | Bacteria | 3837 |
| 778 | nmdc:mga0k408_109524_c1 | 3300050493 | Bacteria | 1632 |
| 779 | nmdc:mga0k408_122481_c1 | 3300050493 | Bacteria | 1541 |
| 780 | nmdc:mga0k408_26432_c1 | 3300050493 | Bacteria | 3291 |
| 781 | nmdc:mga0k408_446561_c1 | 3300050493 | Bacteria | 768 |
| 782 | nmdc:mga0k408_734_c1 | 3300050493 | Bacteria | 16164 |
| 783 | nmdc:mga0k408_7916_c1 | 3300050493 | Bacteria | 2187 |
| 784 | nmdc:mga06z11_209697_c1 | 3300050494 | Bacteria | 1135 |
| 785 | nmdc:mga07m45_10993_c1 | 3300050496 | Bacteria | 4745 |
| 786 | nmdc:mga07m45_208795_c1 | 3300050496 | Bacteria | 1136 |
| 787 | nmdc:mga07m45_215138_c1 | 3300050496 | Bacteria | 1118 |
| 788 | nmdc:mga07m45_53267_c1 | 3300050496 | Bacteria | 2286 |
| 789 | nmdc:mga07m45_67997_c1 | 3300050496 | Bacteria | 2025 |
| 790 | nmdc:mga07m45_7428_c1 | 3300050496 | Bacteria | 5601 |
| 791 | nmdc:mga09592_6537_c1 | 3300050508 | Bacteria | 9494 |
| 792 | nmdc:mga09592_930274_c1 | 3300050508 | Bacteria | 729 |
| 793 | nmdc:mga0qj67_328911_c1 | 3300050509 | Bacteria | 1237 |
| 794 | nmdc:mga0n895_653332_c1 | 3300050512 | Bacteria | 1050 |
| 795 | Ga0495601_0063743 | 3300053077 | Bacteria | 2343 |
| 796 | Ga0495595_0187504 | 3300053084 | Bacteria | 1027 |
| 797 | Ga0495619_0028690 | 3300053085 | Bacteria | 3591 |
| 798 | Ga0495619_0303277 | 3300053085 | Bacteria | 1106 |
| 799 | Ga0500646_0088162 | 3300053090 | Bacteria | 957 |
| 800 | Ga0500651_0107719 | 3300053093 | Bacteria | 1703 |
| 801 | Ga0500628_035543 | 3300053129 | Bacteria | 1108 |
| 802 | Ga0500642_0003464 | 3300053130 | Bacteria | 4773 |
| 803 | Ga0500652_000027 | 3300053131 | Bacteria | 98912 |
| 804 | Ga0500655_032751 | 3300053133 | Bacteria | 1004 |
| 805 | Ga0500577_0147047 | 3300053142 | Bacteria | 997 |
| 806 | Ga0500604_0011664 | 3300053151 | Bacteria | 2364 |
| 807 | Ga0500622_0000221 | 3300053156 | Bacteria | 59833 |
| 808 | Ga0500645_018285 | 3300053730 | Bacteria | 2190 |
| 809 | Ga0500587_001055 | 3300053739 | Bacteria | 3758 |
| 810 | Ga0501082_0139543 | 3300060353 | Bacteria | 2104 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031730 | Ga0307516_10004009 | Ga0307516_1000400911 | 160 |
| 2 | 3300042128 | Ga0450897_016535 | Ga0450897_016535_247_744 | 165 |
| 3 | iso_pu_bacteria | 2643221544 | 2643745691 | 173 |
| 4 | iso_pu_bacteria | 2643221646 | 2644257649 | 173 |
| 5 | iso_pu_bacteria | 2738541337 | 2739058631 | 173 |
| 6 | 3300044712 | Ga0453684_0157052 | Ga0453684_0157052_463_990 | 174 |
| 7 | 3300005262 | Ga0065165_1000401 | Ga0065165_100040130 | 175 |
| 8 | 3300021361 | Ga0213872_10025664 | Ga0213872_100256644 | 175 |
| 9 | 3300039447 | Ga0436361_1079715 | Ga0436361_1079715_3510_4040 | 175 |
| 10 | 3300046511 | Ga0495608_0051711 | Ga0495608_0051711_2177_2704 | 175 |
| 11 | 3300025230 | Ga0209563_100005 | Ga0209563_100005719 | 176 |
| 12 | 3300028794 | Ga0307515_10499075 | Ga0307515_104990752 | 176 |
| 13 | 3300042876 | Ga0451577_0031249 | Ga0451577_0031249_3771_4304 | 176 |
| 14 | 3300045051 | Ga0451576_0179833 | Ga0451576_0179833_1544_2077 | 176 |
| 15 | 3300045051 | Ga0451576_0223298 | Ga0451576_0223298_827_1360 | 176 |
| 16 | 3300045051 | Ga0451576_1115371 | Ga0451576_1115371_269_802 | 176 |
| 17 | iso_pu_bacteria | 2643221644 | 2644246337 | 176 |
| 18 | 3300005364 | Ga0070673_101063927 | Ga0070673_1010639271 | 177 |
| 19 | 3300028794 | Ga0307515_10000188 | Ga0307515_1000018871 | 177 |
| 20 | 3300042120 | Ga0450917_001576 | Ga0450917_001576_172_711 | 177 |
| 21 | 3300042126 | Ga0450888_005436 | Ga0450888_005436_331_870 | 177 |
| 22 | 3300042127 | Ga0450890_001208 | Ga0450890_001208_2993_3532 | 177 |
| 23 | 3300042532 | Ga0450893_0003848 | Ga0450893_0003848_481_1020 | 177 |
| 24 | 3300042533 | Ga0450901_022267 | Ga0450901_022267_126_665 | 177 |
| 25 | 3300042876 | Ga0451577_0015837 | Ga0451577_0015837_2818_3354 | 177 |
| 26 | 3300042876 | Ga0451577_0586475 | Ga0451577_0586475_357_893 | 177 |
| 27 | 3300044673 | Ga0453683_0099201 | Ga0453683_0099201_466_1002 | 177 |
| 28 | 3300044712 | Ga0453684_0314595 | Ga0453684_0314595_1163_1699 | 177 |
| 29 | 3300045051 | Ga0451576_0015228 | Ga0451576_0015228_1498_2034 | 177 |
| 30 | 3300045051 | Ga0451576_0457407 | Ga0451576_0457407_130_669 | 177 |
| 31 | 3300046477 | Ga0495664_0660250 | Ga0495664_0660250_70_609 | 177 |
| 32 | 3300049514 | Ga0501291_004192 | Ga0501291_004192_122_658 | 177 |
| 33 | 3300049519 | Ga0501296_005483 | Ga0501296_005483_548_1084 | 177 |
| 34 | 3300049520 | Ga0501297_007094 | Ga0501297_007094_452_988 | 177 |
| 35 | 3300049521 | Ga0501298_004484 | Ga0501298_004484_969_1505 | 177 |
| 36 | 3300049523 | Ga0501300_004947 | Ga0501300_004947_190_726 | 177 |
| 37 | 3300049530 | Ga0501314_005420 | Ga0501314_005420_414_950 | 177 |
| 38 | 3300049653 | Ga0501206_003159 | Ga0501206_003159_676_1212 | 177 |
| 39 | 3300049658 | Ga0501211_009028 | Ga0501211_009028_99_635 | 177 |
| 40 | 3300049661 | Ga0501217_145269 | Ga0501217_145269_58_594 | 177 |
| 41 | 3300049662 | Ga0501222_001642 | Ga0501222_001642_2020_2556 | 177 |
| 42 | 3300049669 | Ga0501235_008379 | Ga0501235_008379_237_773 | 177 |
| 43 | 3300049684 | Ga0501255_010837 | Ga0501255_010837_318_854 | 177 |
| 44 | 3300049687 | Ga0501258_008448 | Ga0501258_008448_29_565 | 177 |
| 45 | 3300049704 | Ga0501221_002992 | Ga0501221_002992_1630_2166 | 177 |
| 46 | 3300049705 | Ga0501225_0011455 | Ga0501225_0011455_1135_1671 | 177 |
| 47 | 3300049759 | Ga0501262_002721 | Ga0501262_002721_757_1293 | 177 |
| 48 | 3300049764 | Ga0501267_002045 | Ga0501267_002045_51_587 | 177 |
| 49 | 3300049769 | Ga0501272_041492 | Ga0501272_041492_28_564 | 177 |
| 50 | 3300049776 | Ga0501280_020979 | Ga0501280_020979_314_850 | 177 |
| 51 | 3300049779 | Ga0501283_001477 | Ga0501283_001477_1689_2225 | 177 |
| 52 | 3300050508 | nmdc:mga09592_6537_c1 | nmdc:mga09592_6537_c1_8859_9395 | 177 |
| 53 | 3300050509 | nmdc:mga0qj67_328911_c1 | nmdc:mga0qj67_328911_c1_526_1062 | 177 |
| 54 | 3300005347 | Ga0070668_100262673 | Ga0070668_1002626733 | 178 |
| 55 | 3300005356 | Ga0070674_100242835 | Ga0070674_1002428352 | 178 |
| 56 | 3300005441 | Ga0070700_100018609 | Ga0070700_1000186094 | 178 |
| 57 | 3300005456 | Ga0070678_100076132 | Ga0070678_1000761324 | 178 |
| 58 | 3300005459 | Ga0068867_100002447 | Ga0068867_1000024475 | 178 |
| 59 | 3300005543 | Ga0070672_100454295 | Ga0070672_1004542953 | 178 |
| 60 | 3300005548 | Ga0070665_100368145 | Ga0070665_1003681452 | 178 |
| 61 | 3300005616 | Ga0068852_101374956 | Ga0068852_1013749561 | 178 |
| 62 | 3300005617 | Ga0068859_100973853 | Ga0068859_1009738532 | 178 |
| 63 | 3300005718 | Ga0068866_10009144 | Ga0068866_100091445 | 178 |
| 64 | 3300005719 | Ga0068861_100004823 | Ga0068861_1000048235 | 178 |
| 65 | 3300005834 | Ga0068851_10564886 | Ga0068851_105648861 | 178 |
| 66 | 3300005841 | Ga0068863_100174157 | Ga0068863_1001741574 | 178 |
| 67 | 3300005842 | Ga0068858_100088224 | Ga0068858_1000882244 | 178 |
| 68 | 3300005843 | Ga0068860_100011586 | Ga0068860_1000115865 | 178 |
| 69 | 3300005843 | Ga0068860_100545984 | Ga0068860_1005459842 | 178 |
| 70 | 3300005844 | Ga0068862_100032693 | Ga0068862_1000326933 | 178 |
| 71 | 3300005844 | Ga0068862_100100314 | Ga0068862_1001003144 | 178 |
| 72 | 3300006195 | Ga0075366_10289739 | Ga0075366_102897392 | 178 |
| 73 | 3300006358 | Ga0068871_100803377 | Ga0068871_1008033772 | 178 |
| 74 | 3300006881 | Ga0068865_100016331 | Ga0068865_1000163312 | 178 |
| 75 | 3300006931 | Ga0097620_100134911 | Ga0097620_1001349114 | 178 |
| 76 | 3300006931 | Ga0097620_100973874 | Ga0097620_1009738742 | 178 |
| 77 | 3300009093 | Ga0105240_10056490 | Ga0105240_100564904 | 178 |
| 78 | 3300009148 | Ga0105243_10027205 | Ga0105243_100272054 | 178 |
| 79 | 3300009148 | Ga0105243_10075641 | Ga0105243_100756412 | 178 |
| 80 | 3300009545 | Ga0105237_10001461 | Ga0105237_1000146112 | 178 |
| 81 | 3300009551 | Ga0105238_10041551 | Ga0105238_100415513 | 178 |
| 82 | 3300009553 | Ga0105249_10005956 | Ga0105249_100059564 | 178 |
| 83 | 3300010375 | Ga0105239_10000798 | Ga0105239_1000079840 | 178 |
| 84 | 3300013297 | Ga0157378_10026414 | Ga0157378_100264142 | 178 |
| 85 | 3300013306 | Ga0163162_10002995 | Ga0163162_1000299515 | 178 |
| 86 | 3300014326 | Ga0157380_10038429 | Ga0157380_100384295 | 178 |
| 87 | 3300014968 | Ga0157379_10287151 | Ga0157379_102871512 | 178 |
| 88 | 3300014968 | Ga0157379_10301319 | Ga0157379_103013192 | 178 |
| 89 | 3300025273 | Ga0209673_1030482 | Ga0209673_10304822 | 178 |
| 90 | 3300025299 | Ga0209256_1061866 | Ga0209256_10618661 | 178 |
| 91 | 3300025899 | Ga0207642_10011641 | Ga0207642_100116415 | 178 |
| 92 | 3300025913 | Ga0207695_10042429 | Ga0207695_100424294 | 178 |
| 93 | 3300025914 | Ga0207671_10010195 | Ga0207671_100101956 | 178 |
| 94 | 3300025923 | Ga0207681_10035795 | Ga0207681_100357953 | 178 |
| 95 | 3300025924 | Ga0207694_10025174 | Ga0207694_100251745 | 178 |
| 96 | 3300025925 | Ga0207650_10421572 | Ga0207650_104215722 | 178 |
| 97 | 3300025935 | Ga0207709_10012740 | Ga0207709_100127406 | 178 |
| 98 | 3300025935 | Ga0207709_10323691 | Ga0207709_103236912 | 178 |
| 99 | 3300025938 | Ga0207704_10214036 | Ga0207704_102140362 | 178 |
| 100 | 3300025940 | Ga0207691_10111776 | Ga0207691_101117762 | 178 |
| 101 | 3300025942 | Ga0207689_10290938 | Ga0207689_102909382 | 178 |
| 102 | 3300025961 | Ga0207712_10208354 | Ga0207712_102083541 | 178 |
| 103 | 3300025986 | Ga0207658_10365492 | Ga0207658_103654923 | 178 |
| 104 | 3300026035 | Ga0207703_10426963 | Ga0207703_104269633 | 178 |
| 105 | 3300026041 | Ga0207639_10026149 | Ga0207639_100261492 | 178 |
| 106 | 3300026075 | Ga0207708_10084433 | Ga0207708_100844332 | 178 |
| 107 | 3300026088 | Ga0207641_10627346 | Ga0207641_106273462 | 178 |
| 108 | 3300026088 | Ga0207641_11081835 | Ga0207641_110818352 | 178 |
| 109 | 3300026089 | Ga0207648_10002634 | Ga0207648_1000263411 | 178 |
| 110 | 3300026118 | Ga0207675_100003062 | Ga0207675_1000030626 | 178 |
| 111 | 3300026142 | Ga0207698_11161424 | Ga0207698_111614242 | 178 |
| 112 | 3300028379 | Ga0268266_10494379 | Ga0268266_104943792 | 178 |
| 113 | 3300028380 | Ga0268265_10048060 | Ga0268265_100480604 | 178 |
| 114 | 3300028381 | Ga0268264_10002570 | Ga0268264_100025705 | 178 |
| 115 | 3300028381 | Ga0268264_10465785 | Ga0268264_104657852 | 178 |
| 116 | 3300031730 | Ga0307516_10363926 | Ga0307516_103639263 | 178 |
| 117 | 3300035083 | Ga0373926_0096227 | Ga0373926_0096227_247_786 | 178 |
| 118 | 3300035695 | Ga0373927_0039242 | Ga0373927_0039242_132_671 | 178 |
| 119 | 3300036401 | Ga0373937_0019374 | Ga0373937_0019374_249_788 | 178 |
| 120 | 3300042012 | Ga0439455_0000995 | Ga0439455_0000995_3528_4070 | 178 |
| 121 | 3300042876 | Ga0451577_0008482 | Ga0451577_0008482_5583_6122 | 178 |
| 122 | 3300042876 | Ga0451577_0210878 | Ga0451577_0210878_804_1343 | 178 |
| 123 | 3300045051 | Ga0451576_0019110 | Ga0451576_0019110_3306_3845 | 178 |
| 124 | 3300045051 | Ga0451576_0039970 | Ga0451576_0039970_1004_1543 | 178 |
| 125 | 3300045051 | Ga0451576_0659431 | Ga0451576_0659431_109_651 | 178 |
| 126 | 3300046692 | Ga0495671_0386898 | Ga0495671_0386898_58_597 | 178 |
| 127 | 3300049582 | Ga0501048_0673799 | Ga0501048_0673799_188_727 | 178 |
| 128 | 3300050493 | nmdc:mga0k408_446561_c1 | nmdc:mga0k408_446561_c1_148_687 | 178 |
| 129 | 3300005336 | Ga0070680_100071875 | Ga0070680_1000718755 | 179 |
| 130 | 3300005458 | Ga0070681_10309642 | Ga0070681_103096423 | 179 |
| 131 | 3300005530 | Ga0070679_100006907 | Ga0070679_1000069076 | 179 |
| 132 | 3300005563 | Ga0068855_100438043 | Ga0068855_1004380432 | 179 |
| 133 | 3300005616 | Ga0068852_100046534 | Ga0068852_1000465342 | 179 |
| 134 | 3300025912 | Ga0207707_10217021 | Ga0207707_102170212 | 179 |
| 135 | 3300025917 | Ga0207660_10047209 | Ga0207660_100472092 | 179 |
| 136 | 3300025921 | Ga0207652_10092835 | Ga0207652_100928353 | 179 |
| 137 | 3300025949 | Ga0207667_10027622 | Ga0207667_100276223 | 179 |
| 138 | 3300026142 | Ga0207698_10022610 | Ga0207698_100226104 | 179 |
| 139 | 3300031730 | Ga0307516_10774532 | Ga0307516_107745321 | 179 |
| 140 | 3300031911 | Ga0307412_10017136 | Ga0307412_100171362 | 179 |
| 141 | 3300046542 | Ga0495597_0000584 | Ga0495597_0000584_2246_2848 | 179 |
| 142 | 3300050489 | nmdc:mga03683_375809_c1 | nmdc:mga03683_375809_c1_79_621 | 179 |
| 143 | 3300050496 | nmdc:mga07m45_10993_c1 | nmdc:mga07m45_10993_c1_3260_3802 | 179 |
| 144 | iso_pu_bacteria | 2585428057 | 2587728881 | 179 |
| 145 | iso_pu_bacteria | 2585428058 | 2587736482 | 179 |
| 146 | 3300005364 | Ga0070673_100461506 | Ga0070673_1004615062 | 180 |
| 147 | 3300005366 | Ga0070659_100690844 | Ga0070659_1006908442 | 180 |
| 148 | 3300005455 | Ga0070663_100263123 | Ga0070663_1002631233 | 180 |
| 149 | 3300005467 | Ga0070706_100272323 | Ga0070706_1002723233 | 180 |
| 150 | 3300005834 | Ga0068851_10085227 | Ga0068851_100852272 | 180 |
| 151 | 3300005843 | Ga0068860_100827891 | Ga0068860_1008278912 | 180 |
| 152 | 3300014968 | Ga0157379_10099388 | Ga0157379_100993882 | 180 |
| 153 | 3300025907 | Ga0207645_10032134 | Ga0207645_100321345 | 180 |
| 154 | 3300025960 | Ga0207651_10615298 | Ga0207651_106152982 | 180 |
| 155 | 3300025981 | Ga0207640_10236278 | Ga0207640_102362782 | 180 |
| 156 | 3300026035 | Ga0207703_10292989 | Ga0207703_102929892 | 180 |
| 157 | 3300026067 | Ga0207678_10248405 | Ga0207678_102484052 | 180 |
| 158 | 3300026078 | Ga0207702_10095359 | Ga0207702_100953592 | 180 |
| 159 | 3300026089 | Ga0207648_10154764 | Ga0207648_101547643 | 180 |
| 160 | 3300031507 | Ga0307509_10229820 | Ga0307509_102298203 | 180 |
| 161 | 3300031507 | Ga0307509_10626761 | Ga0307509_106267611 | 180 |
| 162 | 3300031548 | Ga0307408_100998114 | Ga0307408_1009981141 | 180 |
| 163 | 3300031731 | Ga0307405_10271041 | Ga0307405_102710412 | 180 |
| 164 | 3300031911 | Ga0307412_10643894 | Ga0307412_106438941 | 180 |
| 165 | 3300049515 | Ga0501292_023759 | Ga0501292_023759_221_766 | 180 |
| 166 | 3300049654 | Ga0501207_024199 | Ga0501207_024199_347_892 | 180 |
| 167 | 3300049686 | Ga0501257_020153 | Ga0501257_020153_606_1151 | 180 |
| 168 | 3300049759 | Ga0501262_030401 | Ga0501262_030401_160_705 | 180 |
| 169 | 3300049777 | Ga0501281_04548 | Ga0501281_04548_30_575 | 180 |
| 170 | iso_pu_bacteria | 2643221592 | 2643970510 | 180 |
| 171 | iso_pu_bacteria | 2643221625 | 2644142753 | 180 |
| 172 | iso_pu_bacteria | 2643221648 | 2644272686 | 180 |
| 173 | 3300005356 | Ga0070674_101088983 | Ga0070674_1010889831 | 181 |
| 174 | 3300013306 | Ga0163162_10281661 | Ga0163162_102816613 | 181 |
| 175 | 3300021361 | Ga0213872_10000124 | Ga0213872_1000012414 | 181 |
| 176 | 3300031730 | Ga0307516_10000326 | Ga0307516_100003269 | 181 |
| 177 | 3300039447 | Ga0436361_0638016 | Ga0436361_0638016_1416_1973 | 181 |
| 178 | 3300041460 | Ga0451802_0764781 | Ga0451802_0764781_71_637 | 181 |
| 179 | 3300041486 | Ga0451807_0144702 | Ga0451807_0144702_62_628 | 181 |
| 180 | 3300042876 | Ga0451577_0416698 | Ga0451577_0416698_227_778 | 181 |
| 181 | 3300044712 | Ga0453684_0137499 | Ga0453684_0137499_450_1001 | 181 |
| 182 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_88245_88793 | 181 |
| 183 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_111427_111975 | 181 |
| 184 | 3300049582 | Ga0501048_0042937 | Ga0501048_0042937_1916_2464 | 181 |
| 185 | 3300049824 | Ga0501045_0012726 | Ga0501045_0012726_1942_2490 | 181 |
| 186 | 3300060353 | Ga0501082_0139543 | Ga0501082_0139543_1293_1841 | 181 |
| 187 | iso_pu_bacteria | 2585428062 | 2587758584 | 181 |
| 188 | 3300002773 | JGI25152J39213_1002732 | JGI25152J39213_10027323 | 182 |
| 189 | 3300003215 | JGI25153J46596_10010114 | JGI25153J46596_100101145 | 182 |
| 190 | 3300003322 | rootL2_10208104 | rootL2_102081042 | 182 |
| 191 | 3300003771 | Ga0055526_1002081 | Ga0055526_10020814 | 182 |
| 192 | 3300006051 | Ga0075364_10036027 | Ga0075364_100360273 | 182 |
| 193 | 3300006178 | Ga0075367_10133581 | Ga0075367_101335812 | 182 |
| 194 | 3300006195 | Ga0075366_10004769 | Ga0075366_100047695 | 182 |
| 195 | 3300006195 | Ga0075366_10170492 | Ga0075366_101704922 | 182 |
| 196 | 3300006353 | Ga0075370_10228152 | Ga0075370_102281522 | 182 |
| 197 | 3300009098 | Ga0105245_11584974 | Ga0105245_115849741 | 182 |
| 198 | 3300025245 | Ga0207425_1000135 | Ga0207425_100013537 | 182 |
| 199 | 3300025258 | Ga0209129_1000043 | Ga0209129_1000043245 | 182 |
| 200 | 3300025273 | Ga0209673_1024511 | Ga0209673_10245113 | 182 |
| 201 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014352 | 182 |
| 202 | 3300025297 | Ga0209758_1000492 | Ga0209758_100049229 | 182 |
| 203 | 3300025297 | Ga0209758_1005135 | Ga0209758_100513510 | 182 |
| 204 | 3300025304 | Ga0209257_1047791 | Ga0209257_10477912 | 182 |
| 205 | 3300028786 | Ga0307517_10355623 | Ga0307517_103556232 | 182 |
| 206 | 3300028794 | Ga0307515_10000708 | Ga0307515_1000070852 | 182 |
| 207 | 3300028794 | Ga0307515_10002971 | Ga0307515_1000297130 | 182 |
| 208 | 3300030522 | Ga0307512_10226649 | Ga0307512_102266492 | 182 |
| 209 | 3300031616 | Ga0307508_10000169 | Ga0307508_1000016932 | 182 |
| 210 | 3300041443 | Ga0451789_1262443 | Ga0451789_1262443_1056_1607 | 182 |
| 211 | 3300041452 | Ga0451793_0222243 | Ga0451793_0222243_413_964 | 182 |
| 212 | 3300041458 | Ga0451798_0696078 | Ga0451798_0696078_1217_1768 | 182 |
| 213 | 3300041459 | Ga0451800_0201523 | Ga0451800_0201523_1669_2220 | 182 |
| 214 | 3300041496 | Ga0451839_1477579 | Ga0451839_1477579_147_698 | 182 |
| 215 | 3300041512 | Ga0451853_0706420 | Ga0451853_0706420_330_881 | 182 |
| 216 | 3300044901 | Ga0466960_0111680 | Ga0466960_0111680_195_743 | 182 |
| 217 | 3300046460 | Ga0495638_0174148 | Ga0495638_0174148_118_669 | 182 |
| 218 | 3300046515 | Ga0495620_0110947 | Ga0495620_0110947_522_1073 | 182 |
| 219 | 3300046519 | Ga0495632_0006463 | Ga0495632_0006463_5420_5971 | 182 |
| 220 | 3300046660 | Ga0495625_0208647 | Ga0495625_0208647_106_657 | 182 |
| 221 | 3300050491 | nmdc:mga00v17_19912_c1 | nmdc:mga00v17_19912_c1_1640_2197 | 182 |
| 222 | 3300050493 | nmdc:mga0k408_26432_c1 | nmdc:mga0k408_26432_c1_540_1091 | 182 |
| 223 | 3300050494 | nmdc:mga06z11_209697_c1 | nmdc:mga06z11_209697_c1_278_829 | 182 |
| 224 | 3300050496 | nmdc:mga07m45_208795_c1 | nmdc:mga07m45_208795_c1_499_1050 | 182 |
| 225 | 3300053093 | Ga0500651_0107719 | Ga0500651_0107719_796_1347 | 182 |
| 226 | 3300053129 | Ga0500628_035543 | Ga0500628_035543_221_772 | 182 |
| 227 | 3300053130 | Ga0500642_0003464 | Ga0500642_0003464_2567_3118 | 182 |
| 228 | 3300053131 | Ga0500652_000027 | Ga0500652_000027_90548_91099 | 182 |
| 229 | 3300053133 | Ga0500655_032751 | Ga0500655_032751_189_740 | 182 |
| 230 | 3300053142 | Ga0500577_0147047 | Ga0500577_0147047_149_700 | 182 |
| 231 | 3300053151 | Ga0500604_0011664 | Ga0500604_0011664_963_1514 | 182 |
| 232 | 3300053156 | Ga0500622_0000221 | Ga0500622_0000221_54013_54564 | 182 |
| 233 | 3300005262 | Ga0065165_1007960 | Ga0065165_10079602 | 183 |
| 234 | 3300005355 | Ga0070671_100029968 | Ga0070671_1000299685 | 183 |
| 235 | 3300005364 | Ga0070673_100360276 | Ga0070673_1003602762 | 183 |
| 236 | 3300025273 | Ga0209673_1006841 | Ga0209673_10068415 | 183 |
| 237 | 3300025298 | Ga0209050_1000493 | Ga0209050_100049338 | 183 |
| 238 | 3300025303 | Ga0209051_1019596 | Ga0209051_10195963 | 183 |
| 239 | 3300025923 | Ga0207681_10259577 | Ga0207681_102595772 | 183 |
| 240 | 3300025960 | Ga0207651_10574223 | Ga0207651_105742232 | 183 |
| 241 | 3300037471 | Ga0395905_0092607 | Ga0395905_0092607_1824_2378 | 183 |
| 242 | 3300053730 | Ga0500645_018285 | Ga0500645_018285_1557_2111 | 183 |
| 243 | 3300003775 | Ga0055524_1000423 | Ga0055524_10004238 | 184 |
| 244 | 3300005328 | Ga0070676_10002580 | Ga0070676_100025805 | 184 |
| 245 | 3300005333 | Ga0070677_10060494 | Ga0070677_100604943 | 184 |
| 246 | 3300005334 | Ga0068869_100011581 | Ga0068869_1000115815 | 184 |
| 247 | 3300005354 | Ga0070675_100193125 | Ga0070675_1001931252 | 184 |
| 248 | 3300005440 | Ga0070705_100486477 | Ga0070705_1004864772 | 184 |
| 249 | 3300005459 | Ga0068867_100004433 | Ga0068867_1000044339 | 184 |
| 250 | 3300005543 | Ga0070672_100004909 | Ga0070672_1000049093 | 184 |
| 251 | 3300005577 | Ga0068857_100030013 | Ga0068857_1000300136 | 184 |
| 252 | 3300005840 | Ga0068870_10171292 | Ga0068870_101712922 | 184 |
| 253 | 3300006195 | Ga0075366_10195127 | Ga0075366_101951272 | 184 |
| 254 | 3300006195 | Ga0075366_10227101 | Ga0075366_102271012 | 184 |
| 255 | 3300006353 | Ga0075370_10183503 | Ga0075370_101835032 | 184 |
| 256 | 3300006881 | Ga0068865_100292425 | Ga0068865_1002924252 | 184 |
| 257 | 3300006946 | Ga0079104_1000219 | Ga0079104_100021929 | 184 |
| 258 | 3300009098 | Ga0105245_10669515 | Ga0105245_106695153 | 184 |
| 259 | 3300009148 | Ga0105243_10471184 | Ga0105243_104711843 | 184 |
| 260 | 3300011119 | Ga0105246_10137453 | Ga0105246_101374533 | 184 |
| 261 | 3300013297 | Ga0157378_10464780 | Ga0157378_104647803 | 184 |
| 262 | 3300025263 | Ga0209565_1011977 | Ga0209565_10119773 | 184 |
| 263 | 3300025291 | Ga0209675_1007084 | Ga0209675_10070842 | 184 |
| 264 | 3300025299 | Ga0209256_1000092 | Ga0209256_100009230 | 184 |
| 265 | 3300025907 | Ga0207645_10001485 | Ga0207645_1000148514 | 184 |
| 266 | 3300025908 | Ga0207643_10043348 | Ga0207643_100433483 | 184 |
| 267 | 3300025927 | Ga0207687_10420010 | Ga0207687_104200102 | 184 |
| 268 | 3300025931 | Ga0207644_10028271 | Ga0207644_100282715 | 184 |
| 269 | 3300025938 | Ga0207704_10128832 | Ga0207704_101288323 | 184 |
| 270 | 3300025940 | Ga0207691_10003923 | Ga0207691_100039236 | 184 |
| 271 | 3300025942 | Ga0207689_10012976 | Ga0207689_100129765 | 184 |
| 272 | 3300025972 | Ga0207668_10643016 | Ga0207668_106430162 | 184 |
| 273 | 3300026089 | Ga0207648_10003767 | Ga0207648_100037676 | 184 |
| 274 | 3300026116 | Ga0207674_10040240 | Ga0207674_100402403 | 184 |
| 275 | 3300027111 | Ga0209281_1000074 | Ga0209281_100007452 | 184 |
| 276 | 3300028794 | Ga0307515_10023160 | Ga0307515_100231607 | 184 |
| 277 | 3300031456 | Ga0307513_10008355 | Ga0307513_100083558 | 184 |
| 278 | 3300031456 | Ga0307513_10329372 | Ga0307513_103293722 | 184 |
| 279 | 3300031649 | Ga0307514_10013831 | Ga0307514_100138316 | 184 |
| 280 | 3300031730 | Ga0307516_10013751 | Ga0307516_100137514 | 184 |
| 281 | 3300041456 | Ga0451795_0973934 | Ga0451795_0973934_249_806 | 184 |
| 282 | 3300041486 | Ga0451807_2247218 | Ga0451807_2247218_456_1013 | 184 |
| 283 | 3300041491 | Ga0451833_1413866 | Ga0451833_1413866_455_1012 | 184 |
| 284 | 3300041494 | Ga0451837_1331648 | Ga0451837_1331648_374_931 | 184 |
| 285 | 3300046512 | Ga0495610_0146960 | Ga0495610_0146960_289_846 | 184 |
| 286 | 3300046519 | Ga0495632_0115020 | Ga0495632_0115020_679_1236 | 184 |
| 287 | 3300046522 | Ga0495643_0021831 | Ga0495643_0021831_2156_2713 | 184 |
| 288 | 3300046660 | Ga0495625_0001533 | Ga0495625_0001533_19523_20080 | 184 |
| 289 | 3300048917 | Ga0496114_0007670 | Ga0496114_0007670_3410_3967 | 184 |
| 290 | 3300050493 | nmdc:mga0k408_109524_c1 | nmdc:mga0k408_109524_c1_848_1408 | 184 |
| 291 | 3300050493 | nmdc:mga0k408_122481_c1 | nmdc:mga0k408_122481_c1_16_573 | 184 |
| 292 | 3300050493 | nmdc:mga0k408_734_c1 | nmdc:mga0k408_734_c1_13975_14532 | 184 |
| 293 | 3300050496 | nmdc:mga07m45_215138_c1 | nmdc:mga07m45_215138_c1_277_834 | 184 |
| 294 | 3300050496 | nmdc:mga07m45_53267_c1 | nmdc:mga07m45_53267_c1_749_1306 | 184 |
| 295 | 3300053090 | Ga0500646_0088162 | Ga0500646_0088162_34_591 | 184 |
| 296 | 3300053739 | Ga0500587_001055 | Ga0500587_001055_2732_3289 | 184 |
| 297 | 3300003791 | Ga0055530_10007972 | Ga0055530_100079728 | 185 |
| 298 | 3300003792 | Ga0055540_1000015 | Ga0055540_100001562 | 185 |
| 299 | 3300005329 | Ga0070683_100001824 | Ga0070683_1000018244 | 185 |
| 300 | 3300005334 | Ga0068869_100008068 | Ga0068869_1000080686 | 185 |
| 301 | 3300005335 | Ga0070666_10242463 | Ga0070666_102424633 | 185 |
| 302 | 3300005339 | Ga0070660_100288036 | Ga0070660_1002880361 | 185 |
| 303 | 3300005344 | Ga0070661_100010088 | Ga0070661_1000100884 | 185 |
| 304 | 3300005347 | Ga0070668_100024278 | Ga0070668_1000242782 | 185 |
| 305 | 3300005354 | Ga0070675_100000285 | Ga0070675_10000028535 | 185 |
| 306 | 3300005366 | Ga0070659_100014835 | Ga0070659_1000148356 | 185 |
| 307 | 3300005366 | Ga0070659_100181536 | Ga0070659_1001815363 | 185 |
| 308 | 3300005367 | Ga0070667_100028108 | Ga0070667_1000281083 | 185 |
| 309 | 3300005455 | Ga0070663_100004332 | Ga0070663_1000043328 | 185 |
| 310 | 3300005456 | Ga0070678_100267740 | Ga0070678_1002677402 | 185 |
| 311 | 3300005457 | Ga0070662_100020504 | Ga0070662_1000205044 | 185 |
| 312 | 3300005458 | Ga0070681_10146961 | Ga0070681_101469612 | 185 |
| 313 | 3300005539 | Ga0068853_100256719 | Ga0068853_1002567193 | 185 |
| 314 | 3300005543 | Ga0070672_100272432 | Ga0070672_1002724323 | 185 |
| 315 | 3300005544 | Ga0070686_100136845 | Ga0070686_1001368452 | 185 |
| 316 | 3300005546 | Ga0070696_101111257 | Ga0070696_1011112571 | 185 |
| 317 | 3300005547 | Ga0070693_100014753 | Ga0070693_1000147533 | 185 |
| 318 | 3300005563 | Ga0068855_100719572 | Ga0068855_1007195722 | 185 |
| 319 | 3300005564 | Ga0070664_100204419 | Ga0070664_1002044193 | 185 |
| 320 | 3300005614 | Ga0068856_100071622 | Ga0068856_1000716224 | 185 |
| 321 | 3300005614 | Ga0068856_100474074 | Ga0068856_1004740742 | 185 |
| 322 | 3300005617 | Ga0068859_101944004 | Ga0068859_1019440041 | 185 |
| 323 | 3300005618 | Ga0068864_100023050 | Ga0068864_1000230502 | 185 |
| 324 | 3300005618 | Ga0068864_101392331 | Ga0068864_1013923311 | 185 |
| 325 | 3300005719 | Ga0068861_100003647 | Ga0068861_1000036478 | 185 |
| 326 | 3300005834 | Ga0068851_10021056 | Ga0068851_100210562 | 185 |
| 327 | 3300005834 | Ga0068851_10326552 | Ga0068851_103265522 | 185 |
| 328 | 3300005841 | Ga0068863_100089393 | Ga0068863_1000893934 | 185 |
| 329 | 3300005843 | Ga0068860_100039326 | Ga0068860_1000393267 | 185 |
| 330 | 3300005843 | Ga0068860_101248688 | Ga0068860_1012486882 | 185 |
| 331 | 3300005844 | Ga0068862_100506607 | Ga0068862_1005066072 | 185 |
| 332 | 3300006237 | Ga0097621_100010996 | Ga0097621_1000109966 | 185 |
| 333 | 3300006871 | Ga0075434_100499961 | Ga0075434_1004999613 | 185 |
| 334 | 3300006931 | Ga0097620_101943922 | Ga0097620_1019439221 | 185 |
| 335 | 3300009098 | Ga0105245_10241285 | Ga0105245_102412852 | 185 |
| 336 | 3300009176 | Ga0105242_11086935 | Ga0105242_110869352 | 185 |
| 337 | 3300009177 | Ga0105248_10085019 | Ga0105248_100850195 | 185 |
| 338 | 3300009177 | Ga0105248_10177050 | Ga0105248_101770502 | 185 |
| 339 | 3300009551 | Ga0105238_10276361 | Ga0105238_102763612 | 185 |
| 340 | 3300009553 | Ga0105249_10174875 | Ga0105249_101748752 | 185 |
| 341 | 3300010375 | Ga0105239_10260323 | Ga0105239_102603233 | 185 |
| 342 | 3300012508 | Ga0157315_1002653 | Ga0157315_10026531 | 185 |
| 343 | 3300013100 | Ga0157373_10261401 | Ga0157373_102614012 | 185 |
| 344 | 3300013102 | Ga0157371_10171560 | Ga0157371_101715601 | 185 |
| 345 | 3300013104 | Ga0157370_10737177 | Ga0157370_107371772 | 185 |
| 346 | 3300013105 | Ga0157369_10200535 | Ga0157369_102005352 | 185 |
| 347 | 3300013296 | Ga0157374_10034608 | Ga0157374_100346085 | 185 |
| 348 | 3300013306 | Ga0163162_10034726 | Ga0163162_100347266 | 185 |
| 349 | 3300013307 | Ga0157372_10021809 | Ga0157372_100218094 | 185 |
| 350 | 3300013307 | Ga0157372_10056661 | Ga0157372_100566614 | 185 |
| 351 | 3300013308 | Ga0157375_10028630 | Ga0157375_100286302 | 185 |
| 352 | 3300014326 | Ga0157380_10211694 | Ga0157380_102116943 | 185 |
| 353 | 3300014745 | Ga0157377_10017418 | Ga0157377_100174182 | 185 |
| 354 | 3300014968 | Ga0157379_10008098 | Ga0157379_100080986 | 185 |
| 355 | 3300014968 | Ga0157379_10111157 | Ga0157379_101111573 | 185 |
| 356 | 3300014968 | Ga0157379_11144933 | Ga0157379_111449332 | 185 |
| 357 | 3300014969 | Ga0157376_10016516 | Ga0157376_100165162 | 185 |
| 358 | 3300017792 | Ga0163161_10023239 | Ga0163161_100232395 | 185 |
| 359 | 3300020082 | Ga0206353_11541288 | Ga0206353_115412881 | 185 |
| 360 | 3300021377 | Ga0213874_10066794 | Ga0213874_100667942 | 185 |
| 361 | 3300021384 | Ga0213876_10033899 | Ga0213876_100338993 | 185 |
| 362 | 3300025298 | Ga0209050_1000543 | Ga0209050_100054363 | 185 |
| 363 | 3300025303 | Ga0209051_1000020 | Ga0209051_1000020310 | 185 |
| 364 | 3300025304 | Ga0209257_1000189 | Ga0209257_100018944 | 185 |
| 365 | 3300025315 | Ga0207697_10059751 | Ga0207697_100597512 | 185 |
| 366 | 3300025321 | Ga0207656_10170497 | Ga0207656_101704972 | 185 |
| 367 | 3300025903 | Ga0207680_10153557 | Ga0207680_101535573 | 185 |
| 368 | 3300025907 | Ga0207645_10040758 | Ga0207645_100407584 | 185 |
| 369 | 3300025919 | Ga0207657_10260853 | Ga0207657_102608532 | 185 |
| 370 | 3300025920 | Ga0207649_10009230 | Ga0207649_100092303 | 185 |
| 371 | 3300025924 | Ga0207694_10178316 | Ga0207694_101783161 | 185 |
| 372 | 3300025926 | Ga0207659_10092971 | Ga0207659_100929712 | 185 |
| 373 | 3300025927 | Ga0207687_10246794 | Ga0207687_102467943 | 185 |
| 374 | 3300025933 | Ga0207706_10000756 | Ga0207706_100007566 | 185 |
| 375 | 3300025938 | Ga0207704_10154010 | Ga0207704_101540102 | 185 |
| 376 | 3300025940 | Ga0207691_10017263 | Ga0207691_100172636 | 185 |
| 377 | 3300025941 | Ga0207711_10173950 | Ga0207711_101739503 | 185 |
| 378 | 3300025941 | Ga0207711_10624137 | Ga0207711_106241372 | 185 |
| 379 | 3300025942 | Ga0207689_10006829 | Ga0207689_100068295 | 185 |
| 380 | 3300025949 | Ga0207667_10389035 | Ga0207667_103890352 | 185 |
| 381 | 3300025961 | Ga0207712_10066863 | Ga0207712_100668633 | 185 |
| 382 | 3300025972 | Ga0207668_10060300 | Ga0207668_100603004 | 185 |
| 383 | 3300025986 | Ga0207658_10027241 | Ga0207658_100272412 | 185 |
| 384 | 3300025986 | Ga0207658_10229553 | Ga0207658_102295532 | 185 |
| 385 | 3300026023 | Ga0207677_10041582 | Ga0207677_100415824 | 185 |
| 386 | 3300026035 | Ga0207703_10041270 | Ga0207703_100412702 | 185 |
| 387 | 3300026041 | Ga0207639_10378573 | Ga0207639_103785733 | 185 |
| 388 | 3300026067 | Ga0207678_10000966 | Ga0207678_100009666 | 185 |
| 389 | 3300026067 | Ga0207678_10022962 | Ga0207678_100229625 | 185 |
| 390 | 3300026078 | Ga0207702_10184339 | Ga0207702_101843393 | 185 |
| 391 | 3300026088 | Ga0207641_10671194 | Ga0207641_106711942 | 185 |
| 392 | 3300026088 | Ga0207641_10933529 | Ga0207641_109335292 | 185 |
| 393 | 3300026095 | Ga0207676_10119394 | Ga0207676_101193942 | 185 |
| 394 | 3300026095 | Ga0207676_10778030 | Ga0207676_107780302 | 185 |
| 395 | 3300026116 | Ga0207674_10320406 | Ga0207674_103204061 | 185 |
| 396 | 3300026118 | Ga0207675_100002744 | Ga0207675_10000274412 | 185 |
| 397 | 3300026121 | Ga0207683_10333210 | Ga0207683_103332102 | 185 |
| 398 | 3300026142 | Ga0207698_10076294 | Ga0207698_100762943 | 185 |
| 399 | 3300026142 | Ga0207698_10553626 | Ga0207698_105536262 | 185 |
| 400 | 3300028380 | Ga0268265_10895161 | Ga0268265_108951611 | 185 |
| 401 | 3300028381 | Ga0268264_10005397 | Ga0268264_100053977 | 185 |
| 402 | 3300035084 | Ga0373928_0006412 | Ga0373928_0006412_1349_1909 | 185 |
| 403 | 3300035091 | Ga0373951_0035326 | Ga0373951_0035326_230_790 | 185 |
| 404 | 3300035691 | Ga0373931_0267977 | Ga0373931_0267977_377_937 | 185 |
| 405 | 3300039437 | Ga0436365_0269082 | Ga0436365_0269082_1078_1638 | 185 |
| 406 | 3300045051 | Ga0451576_1230914 | Ga0451576_1230914_200_760 | 185 |
| 407 | 3300048903 | Ga0496100_0122492 | Ga0496100_0122492_1220_1780 | 185 |
| 408 | 3300048904 | Ga0496101_0178180 | Ga0496101_0178180_842_1402 | 185 |
| 409 | 3300048904 | Ga0496101_0763857 | Ga0496101_0763857_129_689 | 185 |
| 410 | 3300048905 | Ga0496102_0089284 | Ga0496102_0089284_168_728 | 185 |
| 411 | 3300048907 | Ga0496104_0300869 | Ga0496104_0300869_429_989 | 185 |
| 412 | 3300048908 | Ga0496105_0465025 | Ga0496105_0465025_268_828 | 185 |
| 413 | 3300048910 | Ga0496107_0025360 | Ga0496107_0025360_1721_2281 | 185 |
| 414 | 3300048912 | Ga0496109_0140298 | Ga0496109_0140298_43_603 | 185 |
| 415 | 3300048913 | Ga0496110_0318454 | Ga0496110_0318454_188_748 | 185 |
| 416 | 3300048914 | Ga0496111_0016712 | Ga0496111_0016712_493_1053 | 185 |
| 417 | 3300048915 | Ga0496112_0059693 | Ga0496112_0059693_440_1000 | 185 |
| 418 | 3300048915 | Ga0496112_0698405 | Ga0496112_0698405_37_597 | 185 |
| 419 | 3300048916 | Ga0496113_0006211 | Ga0496113_0006211_5529_6089 | 185 |
| 420 | 3300048916 | Ga0496113_0183866 | Ga0496113_0183866_776_1336 | 185 |
| 421 | 3300048917 | Ga0496114_0225156 | Ga0496114_0225156_825_1385 | 185 |
| 422 | 3300050512 | nmdc:mga0n895_653332_c1 | nmdc:mga0n895_653332_c1_230_790 | 185 |
| 423 | 3300005327 | Ga0070658_10530030 | Ga0070658_105300301 | 186 |
| 424 | 3300005331 | Ga0070670_100024587 | Ga0070670_1000245873 | 186 |
| 425 | 3300005331 | Ga0070670_100113628 | Ga0070670_1001136283 | 186 |
| 426 | 3300005331 | Ga0070670_100305123 | Ga0070670_1003051233 | 186 |
| 427 | 3300005331 | Ga0070670_100560868 | Ga0070670_1005608681 | 186 |
| 428 | 3300005331 | Ga0070670_100642537 | Ga0070670_1006425372 | 186 |
| 429 | 3300005331 | Ga0070670_101109637 | Ga0070670_1011096371 | 186 |
| 430 | 3300005333 | Ga0070677_10024507 | Ga0070677_100245072 | 186 |
| 431 | 3300005333 | Ga0070677_10172898 | Ga0070677_101728982 | 186 |
| 432 | 3300005334 | Ga0068869_100168532 | Ga0068869_1001685321 | 186 |
| 433 | 3300005335 | Ga0070666_10000785 | Ga0070666_1000078518 | 186 |
| 434 | 3300005335 | Ga0070666_10030100 | Ga0070666_100301003 | 186 |
| 435 | 3300005335 | Ga0070666_10479421 | Ga0070666_104794212 | 186 |
| 436 | 3300005338 | Ga0068868_100007918 | Ga0068868_1000079182 | 186 |
| 437 | 3300005338 | Ga0068868_100095787 | Ga0068868_1000957872 | 186 |
| 438 | 3300005338 | Ga0068868_100533879 | Ga0068868_1005338791 | 186 |
| 439 | 3300005338 | Ga0068868_100557441 | Ga0068868_1005574413 | 186 |
| 440 | 3300005339 | Ga0070660_100437523 | Ga0070660_1004375231 | 186 |
| 441 | 3300005343 | Ga0070687_100035933 | Ga0070687_1000359334 | 186 |
| 442 | 3300005343 | Ga0070687_100036816 | Ga0070687_1000368163 | 186 |
| 443 | 3300005344 | Ga0070661_100044171 | Ga0070661_1000441712 | 186 |
| 444 | 3300005344 | Ga0070661_100607515 | Ga0070661_1006075152 | 186 |
| 445 | 3300005347 | Ga0070668_100020742 | Ga0070668_1000207423 | 186 |
| 446 | 3300005353 | Ga0070669_100018661 | Ga0070669_1000186617 | 186 |
| 447 | 3300005354 | Ga0070675_100012138 | Ga0070675_1000121383 | 186 |
| 448 | 3300005354 | Ga0070675_100045165 | Ga0070675_1000451655 | 186 |
| 449 | 3300005354 | Ga0070675_100053552 | Ga0070675_1000535522 | 186 |
| 450 | 3300005354 | Ga0070675_100226883 | Ga0070675_1002268832 | 186 |
| 451 | 3300005354 | Ga0070675_100496180 | Ga0070675_1004961801 | 186 |
| 452 | 3300005355 | Ga0070671_100002193 | Ga0070671_1000021933 | 186 |
| 453 | 3300005355 | Ga0070671_100083482 | Ga0070671_1000834822 | 186 |
| 454 | 3300005355 | Ga0070671_100371872 | Ga0070671_1003718722 | 186 |
| 455 | 3300005356 | Ga0070674_100016028 | Ga0070674_1000160286 | 186 |
| 456 | 3300005364 | Ga0070673_100001009 | Ga0070673_1000010096 | 186 |
| 457 | 3300005364 | Ga0070673_100013002 | Ga0070673_1000130025 | 186 |
| 458 | 3300005364 | Ga0070673_100058983 | Ga0070673_1000589834 | 186 |
| 459 | 3300005364 | Ga0070673_100118743 | Ga0070673_1001187431 | 186 |
| 460 | 3300005364 | Ga0070673_100370306 | Ga0070673_1003703063 | 186 |
| 461 | 3300005364 | Ga0070673_100374965 | Ga0070673_1003749652 | 186 |
| 462 | 3300005365 | Ga0070688_100036467 | Ga0070688_1000364673 | 186 |
| 463 | 3300005367 | Ga0070667_100002773 | Ga0070667_1000027737 | 186 |
| 464 | 3300005367 | Ga0070667_100003684 | Ga0070667_1000036849 | 186 |
| 465 | 3300005367 | Ga0070667_100212319 | Ga0070667_1002123192 | 186 |
| 466 | 3300005441 | Ga0070700_100372175 | Ga0070700_1003721752 | 186 |
| 467 | 3300005455 | Ga0070663_100482505 | Ga0070663_1004825052 | 186 |
| 468 | 3300005456 | Ga0070678_100013525 | Ga0070678_1000135255 | 186 |
| 469 | 3300005456 | Ga0070678_100156891 | Ga0070678_1001568912 | 186 |
| 470 | 3300005456 | Ga0070678_100346254 | Ga0070678_1003462542 | 186 |
| 471 | 3300005457 | Ga0070662_100009041 | Ga0070662_1000090413 | 186 |
| 472 | 3300005457 | Ga0070662_100069801 | Ga0070662_1000698014 | 186 |
| 473 | 3300005457 | Ga0070662_100249004 | Ga0070662_1002490043 | 186 |
| 474 | 3300005459 | Ga0068867_100007433 | Ga0068867_1000074334 | 186 |
| 475 | 3300005459 | Ga0068867_100039871 | Ga0068867_1000398713 | 186 |
| 476 | 3300005459 | Ga0068867_100124950 | Ga0068867_1001249502 | 186 |
| 477 | 3300005459 | Ga0068867_100224474 | Ga0068867_1002244743 | 186 |
| 478 | 3300005459 | Ga0068867_100299742 | Ga0068867_1002997421 | 186 |
| 479 | 3300005466 | Ga0070685_10657770 | Ga0070685_106577701 | 186 |
| 480 | 3300005539 | Ga0068853_100246714 | Ga0068853_1002467143 | 186 |
| 481 | 3300005543 | Ga0070672_100001055 | Ga0070672_10000105516 | 186 |
| 482 | 3300005543 | Ga0070672_100005119 | Ga0070672_1000051195 | 186 |
| 483 | 3300005543 | Ga0070672_100135152 | Ga0070672_1001351522 | 186 |
| 484 | 3300005543 | Ga0070672_100360518 | Ga0070672_1003605183 | 186 |
| 485 | 3300005543 | Ga0070672_100367637 | Ga0070672_1003676372 | 186 |
| 486 | 3300005547 | Ga0070693_100040019 | Ga0070693_1000400194 | 186 |
| 487 | 3300005548 | Ga0070665_100457227 | Ga0070665_1004572272 | 186 |
| 488 | 3300005564 | Ga0070664_100228694 | Ga0070664_1002286942 | 186 |
| 489 | 3300005578 | Ga0068854_100103094 | Ga0068854_1001030942 | 186 |
| 490 | 3300005578 | Ga0068854_100231854 | Ga0068854_1002318542 | 186 |
| 491 | 3300005616 | Ga0068852_100005860 | Ga0068852_1000058608 | 186 |
| 492 | 3300005616 | Ga0068852_100059785 | Ga0068852_1000597852 | 186 |
| 493 | 3300005616 | Ga0068852_100353942 | Ga0068852_1003539422 | 186 |
| 494 | 3300005617 | Ga0068859_100006127 | Ga0068859_10000612711 | 186 |
| 495 | 3300005617 | Ga0068859_100443281 | Ga0068859_1004432812 | 186 |
| 496 | 3300005618 | Ga0068864_100008087 | Ga0068864_1000080875 | 186 |
| 497 | 3300005618 | Ga0068864_100016853 | Ga0068864_1000168532 | 186 |
| 498 | 3300005618 | Ga0068864_100506024 | Ga0068864_1005060242 | 186 |
| 499 | 3300005718 | Ga0068866_10009815 | Ga0068866_100098155 | 186 |
| 500 | 3300005718 | Ga0068866_10271590 | Ga0068866_102715902 | 186 |
| 501 | 3300005719 | Ga0068861_100194135 | Ga0068861_1001941352 | 186 |
| 502 | 3300005834 | Ga0068851_10059184 | Ga0068851_100591843 | 186 |
| 503 | 3300005834 | Ga0068851_10101746 | Ga0068851_101017461 | 186 |
| 504 | 3300005834 | Ga0068851_10276550 | Ga0068851_102765503 | 186 |
| 505 | 3300005841 | Ga0068863_100003799 | Ga0068863_1000037998 | 186 |
| 506 | 3300005841 | Ga0068863_100004935 | Ga0068863_1000049355 | 186 |
| 507 | 3300005841 | Ga0068863_100106230 | Ga0068863_1001062304 | 186 |
| 508 | 3300005842 | Ga0068858_100002240 | Ga0068858_10000224015 | 186 |
| 509 | 3300005842 | Ga0068858_100018725 | Ga0068858_1000187254 | 186 |
| 510 | 3300005843 | Ga0068860_100000445 | Ga0068860_10000044514 | 186 |
| 511 | 3300005844 | Ga0068862_100007883 | Ga0068862_1000078835 | 186 |
| 512 | 3300006163 | Ga0070715_10295230 | Ga0070715_102952301 | 186 |
| 513 | 3300006237 | Ga0097621_100011620 | Ga0097621_1000116205 | 186 |
| 514 | 3300006237 | Ga0097621_100018005 | Ga0097621_1000180057 | 186 |
| 515 | 3300006358 | Ga0068871_100019544 | Ga0068871_1000195445 | 186 |
| 516 | 3300006358 | Ga0068871_100030326 | Ga0068871_1000303265 | 186 |
| 517 | 3300006358 | Ga0068871_100165884 | Ga0068871_1001658843 | 186 |
| 518 | 3300006358 | Ga0068871_100308898 | Ga0068871_1003088983 | 186 |
| 519 | 3300006881 | Ga0068865_100043762 | Ga0068865_1000437624 | 186 |
| 520 | 3300006881 | Ga0068865_100186818 | Ga0068865_1001868182 | 186 |
| 521 | 3300006931 | Ga0097620_100006126 | Ga0097620_10000612611 | 186 |
| 522 | 3300006931 | Ga0097620_100443297 | Ga0097620_1004432972 | 186 |
| 523 | 3300009098 | Ga0105245_10468442 | Ga0105245_104684422 | 186 |
| 524 | 3300009101 | Ga0105247_10075644 | Ga0105247_100756444 | 186 |
| 525 | 3300009148 | Ga0105243_10005579 | Ga0105243_100055795 | 186 |
| 526 | 3300009148 | Ga0105243_10076482 | Ga0105243_100764824 | 186 |
| 527 | 3300009148 | Ga0105243_10359554 | Ga0105243_103595542 | 186 |
| 528 | 3300009176 | Ga0105242_10108564 | Ga0105242_101085642 | 186 |
| 529 | 3300009176 | Ga0105242_10223305 | Ga0105242_102233052 | 186 |
| 530 | 3300009176 | Ga0105242_10276735 | Ga0105242_102767353 | 186 |
| 531 | 3300009176 | Ga0105242_10820157 | Ga0105242_108201572 | 186 |
| 532 | 3300009177 | Ga0105248_10004957 | Ga0105248_100049572 | 186 |
| 533 | 3300009177 | Ga0105248_10094534 | Ga0105248_100945342 | 186 |
| 534 | 3300009177 | Ga0105248_10102774 | Ga0105248_101027744 | 186 |
| 535 | 3300009177 | Ga0105248_10129449 | Ga0105248_101294494 | 186 |
| 536 | 3300009177 | Ga0105248_10143573 | Ga0105248_101435732 | 186 |
| 537 | 3300009177 | Ga0105248_10171731 | Ga0105248_101717314 | 186 |
| 538 | 3300009177 | Ga0105248_11089692 | Ga0105248_110896922 | 186 |
| 539 | 3300009553 | Ga0105249_10095215 | Ga0105249_100952155 | 186 |
| 540 | 3300009553 | Ga0105249_10209339 | Ga0105249_102093393 | 186 |
| 541 | 3300009553 | Ga0105249_11431945 | Ga0105249_114319452 | 186 |
| 542 | 3300011119 | Ga0105246_10427767 | Ga0105246_104277672 | 186 |
| 543 | 3300011119 | Ga0105246_10448240 | Ga0105246_104482401 | 186 |
| 544 | 3300013102 | Ga0157371_10116977 | Ga0157371_101169772 | 186 |
| 545 | 3300013102 | Ga0157371_10376636 | Ga0157371_103766363 | 186 |
| 546 | 3300013296 | Ga0157374_10998650 | Ga0157374_109986501 | 186 |
| 547 | 3300013297 | Ga0157378_10446469 | Ga0157378_104464692 | 186 |
| 548 | 3300013297 | Ga0157378_10661106 | Ga0157378_106611062 | 186 |
| 549 | 3300013306 | Ga0163162_10018246 | Ga0163162_100182468 | 186 |
| 550 | 3300013306 | Ga0163162_10530677 | Ga0163162_105306772 | 186 |
| 551 | 3300013308 | Ga0157375_10011447 | Ga0157375_100114475 | 186 |
| 552 | 3300013308 | Ga0157375_10022022 | Ga0157375_100220222 | 186 |
| 553 | 3300013308 | Ga0157375_10073701 | Ga0157375_100737014 | 186 |
| 554 | 3300013308 | Ga0157375_10694567 | Ga0157375_106945673 | 186 |
| 555 | 3300013308 | Ga0157375_10905174 | Ga0157375_109051743 | 186 |
| 556 | 3300014325 | Ga0163163_10045264 | Ga0163163_100452642 | 186 |
| 557 | 3300014325 | Ga0163163_10397389 | Ga0163163_103973892 | 186 |
| 558 | 3300014325 | Ga0163163_10461235 | Ga0163163_104612352 | 186 |
| 559 | 3300014325 | Ga0163163_10656366 | Ga0163163_106563663 | 186 |
| 560 | 3300014326 | Ga0157380_10011565 | Ga0157380_100115658 | 186 |
| 561 | 3300014326 | Ga0157380_10145152 | Ga0157380_101451522 | 186 |
| 562 | 3300014326 | Ga0157380_10452633 | Ga0157380_104526332 | 186 |
| 563 | 3300014745 | Ga0157377_10000038 | Ga0157377_1000003860 | 186 |
| 564 | 3300014745 | Ga0157377_10270645 | Ga0157377_102706453 | 186 |
| 565 | 3300014968 | Ga0157379_10076979 | Ga0157379_100769794 | 186 |
| 566 | 3300014968 | Ga0157379_10124316 | Ga0157379_101243163 | 186 |
| 567 | 3300014969 | Ga0157376_10034451 | Ga0157376_100344512 | 186 |
| 568 | 3300014969 | Ga0157376_10336084 | Ga0157376_103360842 | 186 |
| 569 | 3300017792 | Ga0163161_10011344 | Ga0163161_100113442 | 186 |
| 570 | 3300017792 | Ga0163161_10156286 | Ga0163161_101562863 | 186 |
| 571 | 3300025315 | Ga0207697_10029600 | Ga0207697_100296002 | 186 |
| 572 | 3300025315 | Ga0207697_10054283 | Ga0207697_100542833 | 186 |
| 573 | 3300025315 | Ga0207697_10168221 | Ga0207697_101682212 | 186 |
| 574 | 3300025321 | Ga0207656_10036966 | Ga0207656_100369662 | 186 |
| 575 | 3300025321 | Ga0207656_10050341 | Ga0207656_100503413 | 186 |
| 576 | 3300025893 | Ga0207682_10001133 | Ga0207682_1000113311 | 186 |
| 577 | 3300025893 | Ga0207682_10127067 | Ga0207682_101270672 | 186 |
| 578 | 3300025893 | Ga0207682_10203306 | Ga0207682_102033062 | 186 |
| 579 | 3300025899 | Ga0207642_10038390 | Ga0207642_100383903 | 186 |
| 580 | 3300025899 | Ga0207642_10472945 | Ga0207642_104729452 | 186 |
| 581 | 3300025901 | Ga0207688_10209477 | Ga0207688_102094772 | 186 |
| 582 | 3300025903 | Ga0207680_10300438 | Ga0207680_103004383 | 186 |
| 583 | 3300025903 | Ga0207680_10331701 | Ga0207680_103317012 | 186 |
| 584 | 3300025907 | Ga0207645_10003455 | Ga0207645_100034557 | 186 |
| 585 | 3300025907 | Ga0207645_10086286 | Ga0207645_100862863 | 186 |
| 586 | 3300025907 | Ga0207645_10167509 | Ga0207645_101675092 | 186 |
| 587 | 3300025907 | Ga0207645_10431195 | Ga0207645_104311952 | 186 |
| 588 | 3300025908 | Ga0207643_10143132 | Ga0207643_101431323 | 186 |
| 589 | 3300025908 | Ga0207643_10485155 | Ga0207643_104851551 | 186 |
| 590 | 3300025909 | Ga0207705_10035148 | Ga0207705_100351482 | 186 |
| 591 | 3300025918 | Ga0207662_10008374 | Ga0207662_100083743 | 186 |
| 592 | 3300025918 | Ga0207662_10098300 | Ga0207662_100983002 | 186 |
| 593 | 3300025919 | Ga0207657_10196071 | Ga0207657_101960712 | 186 |
| 594 | 3300025920 | Ga0207649_10332951 | Ga0207649_103329513 | 186 |
| 595 | 3300025920 | Ga0207649_10744991 | Ga0207649_107449912 | 186 |
| 596 | 3300025923 | Ga0207681_10004618 | Ga0207681_100046188 | 186 |
| 597 | 3300025923 | Ga0207681_10348704 | Ga0207681_103487042 | 186 |
| 598 | 3300025925 | Ga0207650_10003908 | Ga0207650_100039083 | 186 |
| 599 | 3300025925 | Ga0207650_10055912 | Ga0207650_100559122 | 186 |
| 600 | 3300025925 | Ga0207650_10110025 | Ga0207650_101100252 | 186 |
| 601 | 3300025925 | Ga0207650_10392359 | Ga0207650_103923592 | 186 |
| 602 | 3300025926 | Ga0207659_10000477 | Ga0207659_1000047726 | 186 |
| 603 | 3300025926 | Ga0207659_10032109 | Ga0207659_100321095 | 186 |
| 604 | 3300025926 | Ga0207659_10204965 | Ga0207659_102049652 | 186 |
| 605 | 3300025927 | Ga0207687_10064103 | Ga0207687_100641034 | 186 |
| 606 | 3300025931 | Ga0207644_10002098 | Ga0207644_100020985 | 186 |
| 607 | 3300025931 | Ga0207644_10006058 | Ga0207644_100060585 | 186 |
| 608 | 3300025931 | Ga0207644_10012856 | Ga0207644_100128565 | 186 |
| 609 | 3300025931 | Ga0207644_10017153 | Ga0207644_100171533 | 186 |
| 610 | 3300025931 | Ga0207644_10164021 | Ga0207644_101640212 | 186 |
| 611 | 3300025931 | Ga0207644_10310410 | Ga0207644_103104102 | 186 |
| 612 | 3300025933 | Ga0207706_10004450 | Ga0207706_1000445014 | 186 |
| 613 | 3300025933 | Ga0207706_10051089 | Ga0207706_100510892 | 186 |
| 614 | 3300025933 | Ga0207706_10427490 | Ga0207706_104274902 | 186 |
| 615 | 3300025933 | Ga0207706_10512977 | Ga0207706_105129772 | 186 |
| 616 | 3300025933 | Ga0207706_10954362 | Ga0207706_109543621 | 186 |
| 617 | 3300025934 | Ga0207686_10065322 | Ga0207686_100653223 | 186 |
| 618 | 3300025934 | Ga0207686_10104121 | Ga0207686_101041213 | 186 |
| 619 | 3300025934 | Ga0207686_10237298 | Ga0207686_102372982 | 186 |
| 620 | 3300025934 | Ga0207686_10271432 | Ga0207686_102714323 | 186 |
| 621 | 3300025935 | Ga0207709_10003694 | Ga0207709_100036946 | 186 |
| 622 | 3300025935 | Ga0207709_10247401 | Ga0207709_102474013 | 186 |
| 623 | 3300025936 | Ga0207670_10025777 | Ga0207670_100257775 | 186 |
| 624 | 3300025937 | Ga0207669_10006650 | Ga0207669_100066507 | 186 |
| 625 | 3300025937 | Ga0207669_10150979 | Ga0207669_101509792 | 186 |
| 626 | 3300025937 | Ga0207669_10504645 | Ga0207669_105046452 | 186 |
| 627 | 3300025937 | Ga0207669_11106899 | Ga0207669_111068991 | 186 |
| 628 | 3300025938 | Ga0207704_10027876 | Ga0207704_100278763 | 186 |
| 629 | 3300025938 | Ga0207704_10085743 | Ga0207704_100857433 | 186 |
| 630 | 3300025939 | Ga0207665_10274839 | Ga0207665_102748392 | 186 |
| 631 | 3300025940 | Ga0207691_10005630 | Ga0207691_100056308 | 186 |
| 632 | 3300025940 | Ga0207691_10086956 | Ga0207691_100869564 | 186 |
| 633 | 3300025940 | Ga0207691_10181038 | Ga0207691_101810382 | 186 |
| 634 | 3300025940 | Ga0207691_10183319 | Ga0207691_101833192 | 186 |
| 635 | 3300025940 | Ga0207691_10353869 | Ga0207691_103538692 | 186 |
| 636 | 3300025941 | Ga0207711_10021174 | Ga0207711_100211745 | 186 |
| 637 | 3300025941 | Ga0207711_10087955 | Ga0207711_100879552 | 186 |
| 638 | 3300025941 | Ga0207711_10187313 | Ga0207711_101873132 | 186 |
| 639 | 3300025941 | Ga0207711_10398515 | Ga0207711_103985153 | 186 |
| 640 | 3300025942 | Ga0207689_10015924 | Ga0207689_100159245 | 186 |
| 641 | 3300025942 | Ga0207689_10170138 | Ga0207689_101701383 | 186 |
| 642 | 3300025942 | Ga0207689_10512444 | Ga0207689_105124442 | 186 |
| 643 | 3300025944 | Ga0207661_10109080 | Ga0207661_101090802 | 186 |
| 644 | 3300025944 | Ga0207661_10744017 | Ga0207661_107440172 | 186 |
| 645 | 3300025945 | Ga0207679_10187645 | Ga0207679_101876452 | 186 |
| 646 | 3300025960 | Ga0207651_10014724 | Ga0207651_100147245 | 186 |
| 647 | 3300025960 | Ga0207651_10016116 | Ga0207651_100161163 | 186 |
| 648 | 3300025960 | Ga0207651_10063782 | Ga0207651_100637823 | 186 |
| 649 | 3300025960 | Ga0207651_10109427 | Ga0207651_101094274 | 186 |
| 650 | 3300025960 | Ga0207651_10528183 | Ga0207651_105281831 | 186 |
| 651 | 3300025961 | Ga0207712_10011348 | Ga0207712_100113487 | 186 |
| 652 | 3300025961 | Ga0207712_10096638 | Ga0207712_100966383 | 186 |
| 653 | 3300025961 | Ga0207712_10798811 | Ga0207712_107988111 | 186 |
| 654 | 3300025972 | Ga0207668_10004912 | Ga0207668_100049127 | 186 |
| 655 | 3300025972 | Ga0207668_10159802 | Ga0207668_101598023 | 186 |
| 656 | 3300025981 | Ga0207640_10180862 | Ga0207640_101808622 | 186 |
| 657 | 3300025981 | Ga0207640_10415126 | Ga0207640_104151262 | 186 |
| 658 | 3300025986 | Ga0207658_10001089 | Ga0207658_1000108918 | 186 |
| 659 | 3300025986 | Ga0207658_10018268 | Ga0207658_100182685 | 186 |
| 660 | 3300026023 | Ga0207677_10003776 | Ga0207677_100037762 | 186 |
| 661 | 3300026023 | Ga0207677_10063934 | Ga0207677_100639343 | 186 |
| 662 | 3300026023 | Ga0207677_10192071 | Ga0207677_101920712 | 186 |
| 663 | 3300026035 | Ga0207703_10000996 | Ga0207703_1000099618 | 186 |
| 664 | 3300026035 | Ga0207703_10011365 | Ga0207703_100113652 | 186 |
| 665 | 3300026067 | Ga0207678_10170485 | Ga0207678_101704852 | 186 |
| 666 | 3300026067 | Ga0207678_10513594 | Ga0207678_105135942 | 186 |
| 667 | 3300026067 | Ga0207678_10886482 | Ga0207678_108864822 | 186 |
| 668 | 3300026075 | Ga0207708_10012827 | Ga0207708_100128275 | 186 |
| 669 | 3300026075 | Ga0207708_10796951 | Ga0207708_107969512 | 186 |
| 670 | 3300026088 | Ga0207641_10007488 | Ga0207641_100074885 | 186 |
| 671 | 3300026088 | Ga0207641_10017054 | Ga0207641_100170542 | 186 |
| 672 | 3300026088 | Ga0207641_10027717 | Ga0207641_100277171 | 186 |
| 673 | 3300026088 | Ga0207641_10338895 | Ga0207641_103388952 | 186 |
| 674 | 3300026089 | Ga0207648_10000118 | Ga0207648_1000011860 | 186 |
| 675 | 3300026089 | Ga0207648_10028344 | Ga0207648_100283445 | 186 |
| 676 | 3300026089 | Ga0207648_10034335 | Ga0207648_100343353 | 186 |
| 677 | 3300026089 | Ga0207648_10144132 | Ga0207648_101441322 | 186 |
| 678 | 3300026089 | Ga0207648_10555413 | Ga0207648_105554132 | 186 |
| 679 | 3300026095 | Ga0207676_10002837 | Ga0207676_100028379 | 186 |
| 680 | 3300026095 | Ga0207676_10008453 | Ga0207676_100084535 | 186 |
| 681 | 3300026095 | Ga0207676_10075841 | Ga0207676_100758412 | 186 |
| 682 | 3300026095 | Ga0207676_10709176 | Ga0207676_107091762 | 186 |
| 683 | 3300026118 | Ga0207675_100003340 | Ga0207675_10000334011 | 186 |
| 684 | 3300026118 | Ga0207675_100054366 | Ga0207675_1000543663 | 186 |
| 685 | 3300026118 | Ga0207675_101059939 | Ga0207675_1010599392 | 186 |
| 686 | 3300026121 | Ga0207683_10004250 | Ga0207683_100042505 | 186 |
| 687 | 3300026121 | Ga0207683_10098580 | Ga0207683_100985802 | 186 |
| 688 | 3300026121 | Ga0207683_10102117 | Ga0207683_101021173 | 186 |
| 689 | 3300026121 | Ga0207683_10113630 | Ga0207683_101136302 | 186 |
| 690 | 3300026121 | Ga0207683_10665885 | Ga0207683_106658852 | 186 |
| 691 | 3300026121 | Ga0207683_10706936 | Ga0207683_107069362 | 186 |
| 692 | 3300026142 | Ga0207698_10044988 | Ga0207698_100449883 | 186 |
| 693 | 3300026142 | Ga0207698_10148841 | Ga0207698_101488413 | 186 |
| 694 | 3300028379 | Ga0268266_10202271 | Ga0268266_102022712 | 186 |
| 695 | 3300028379 | Ga0268266_10383588 | Ga0268266_103835883 | 186 |
| 696 | 3300028380 | Ga0268265_10011082 | Ga0268265_100110822 | 186 |
| 697 | 3300028380 | Ga0268265_10029539 | Ga0268265_100295393 | 186 |
| 698 | 3300028381 | Ga0268264_10001857 | Ga0268264_100018572 | 186 |
| 699 | 3300028381 | Ga0268264_10493103 | Ga0268264_104931032 | 186 |
| 700 | 3300031548 | Ga0307408_100022119 | Ga0307408_1000221192 | 186 |
| 701 | 3300031731 | Ga0307405_10014690 | Ga0307405_100146904 | 186 |
| 702 | 3300031995 | Ga0307409_100002191 | Ga0307409_1000021915 | 186 |
| 703 | 3300032002 | Ga0307416_100002040 | Ga0307416_1000020409 | 186 |
| 704 | 3300032126 | Ga0307415_100012627 | Ga0307415_1000126272 | 186 |
| 705 | 3300035089 | Ga0373944_0073850 | Ga0373944_0073850_117_680 | 186 |
| 706 | 3300035111 | Ga0373923_0121198 | Ga0373923_0121198_247_810 | 186 |
| 707 | 3300035170 | Ga0373943_0088252 | Ga0373943_0088252_39_602 | 186 |
| 708 | 3300035724 | Ga0373933_0044022 | Ga0373933_0044022_1393_1956 | 186 |
| 709 | 3300035725 | Ga0373947_0377373 | Ga0373947_0377373_32_595 | 186 |
| 710 | 3300035725 | Ga0373947_0730224 | Ga0373947_0730224_98_661 | 186 |
| 711 | 3300036401 | Ga0373937_0010021 | Ga0373937_0010021_5905_6468 | 186 |
| 712 | 3300036401 | Ga0373937_0010446 | Ga0373937_0010446_7355_7918 | 186 |
| 713 | 3300037068 | Ga0373925_0009400 | Ga0373925_0009400_6171_6734 | 186 |
| 714 | 3300041458 | Ga0451798_0943568 | Ga0451798_0943568_39_614 | 186 |
| 715 | 3300041496 | Ga0451839_1398550 | Ga0451839_1398550_651_1214 | 186 |
| 716 | 3300041512 | Ga0451853_1001559 | Ga0451853_1001559_218_781 | 186 |
| 717 | 3300041512 | Ga0451853_1709673 | Ga0451853_1709673_68_640 | 186 |
| 718 | 3300042439 | Ga0439464_0018264 | Ga0439464_0018264_61_624 | 186 |
| 719 | 3300042876 | Ga0451577_0011912 | Ga0451577_0011912_5394_5957 | 186 |
| 720 | 3300046455 | Ga0495603_0195820 | Ga0495603_0195820_103_666 | 186 |
| 721 | 3300046459 | Ga0495629_0025312 | Ga0495629_0025312_1728_2291 | 186 |
| 722 | 3300046459 | Ga0495629_0238822 | Ga0495629_0238822_223_786 | 186 |
| 723 | 3300046472 | Ga0495580_0099089 | Ga0495580_0099089_252_815 | 186 |
| 724 | 3300046472 | Ga0495580_0180471 | Ga0495580_0180471_144_707 | 186 |
| 725 | 3300046473 | Ga0495582_0150989 | Ga0495582_0150989_513_1076 | 186 |
| 726 | 3300046476 | Ga0495662_0288837 | Ga0495662_0288837_163_726 | 186 |
| 727 | 3300046529 | Ga0495652_0496418 | Ga0495652_0496418_126_689 | 186 |
| 728 | 3300046533 | Ga0495640_0579661 | Ga0495640_0579661_20_583 | 186 |
| 729 | 3300046535 | Ga0495586_0150238 | Ga0495586_0150238_327_890 | 186 |
| 730 | 3300046535 | Ga0495586_0305057 | Ga0495586_0305057_331_894 | 186 |
| 731 | 3300046537 | Ga0495598_0027037 | Ga0495598_0027037_519_1082 | 186 |
| 732 | 3300046539 | Ga0495621_0101233 | Ga0495621_0101233_433_996 | 186 |
| 733 | 3300046539 | Ga0495621_0270309 | Ga0495621_0270309_113_676 | 186 |
| 734 | 3300046543 | Ga0495645_0126462 | Ga0495645_0126462_354_917 | 186 |
| 735 | 3300046543 | Ga0495645_0245601 | Ga0495645_0245601_618_1181 | 186 |
| 736 | 3300046663 | Ga0495635_0251003 | Ga0495635_0251003_368_931 | 186 |
| 737 | 3300046678 | Ga0495599_0288996 | Ga0495599_0288996_341_904 | 186 |
| 738 | 3300046681 | Ga0495647_0142634 | Ga0495647_0142634_280_843 | 186 |
| 739 | 3300046683 | Ga0495658_0016429 | Ga0495658_0016429_3096_3659 | 186 |
| 740 | 3300046683 | Ga0495658_0115438 | Ga0495658_0115438_227_790 | 186 |
| 741 | 3300046683 | Ga0495658_0163292 | Ga0495658_0163292_380_943 | 186 |
| 742 | 3300046683 | Ga0495658_0167940 | Ga0495658_0167940_32_595 | 186 |
| 743 | 3300046689 | Ga0495613_0060723 | Ga0495613_0060723_1862_2425 | 186 |
| 744 | 3300047319 | Ga0495674_0671787 | Ga0495674_0671787_184_747 | 186 |
| 745 | 3300047322 | Ga0495680_0145655 | Ga0495680_0145655_150_713 | 186 |
| 746 | 3300047470 | Ga0495681_0153145 | Ga0495681_0153145_143_706 | 186 |
| 747 | 3300047471 | Ga0495684_0139402 | Ga0495684_0139402_917_1480 | 186 |
| 748 | 3300048903 | Ga0496100_0468249 | Ga0496100_0468249_270_833 | 186 |
| 749 | 3300048907 | Ga0496104_0393688 | Ga0496104_0393688_144_707 | 186 |
| 750 | 3300048907 | Ga0496104_0490063 | Ga0496104_0490063_405_968 | 186 |
| 751 | 3300048909 | Ga0496106_0355947 | Ga0496106_0355947_81_644 | 186 |
| 752 | 3300048911 | Ga0496108_0037095 | Ga0496108_0037095_330_893 | 186 |
| 753 | 3300048911 | Ga0496108_1188953 | Ga0496108_1188953_17_580 | 186 |
| 754 | 3300048912 | Ga0496109_0179647 | Ga0496109_0179647_428_991 | 186 |
| 755 | 3300048913 | Ga0496110_1118654 | Ga0496110_1118654_73_636 | 186 |
| 756 | 3300050508 | nmdc:mga09592_930274_c1 | nmdc:mga09592_930274_c1_128_691 | 186 |
| 757 | 3300053077 | Ga0495601_0063743 | Ga0495601_0063743_893_1456 | 186 |
| 758 | 3300053084 | Ga0495595_0187504 | Ga0495595_0187504_439_1002 | 186 |
| 759 | 3300053085 | Ga0495619_0028690 | Ga0495619_0028690_1520_2083 | 186 |
| 760 | 3300053085 | Ga0495619_0303277 | Ga0495619_0303277_204_767 | 186 |
| 761 | 3300006353 | Ga0075370_10005206 | Ga0075370_100052062 | 187 |
| 762 | 3300037471 | Ga0395905_0023405 | Ga0395905_0023405_4181_4747 | 187 |
| 763 | 3300045976 | Ga0466967_1017864 | Ga0466967_1017864_55_621 | 187 |
| 764 | 3300050496 | nmdc:mga07m45_7428_c1 | nmdc:mga07m45_7428_c1_1318_1887 | 187 |
| 765 | 3300005614 | Ga0068856_100030381 | Ga0068856_1000303815 | 188 |
| 766 | 3300009551 | Ga0105238_10247603 | Ga0105238_102476033 | 188 |
| 767 | 3300025924 | Ga0207694_10105545 | Ga0207694_101055453 | 188 |
| 768 | 3300026078 | Ga0207702_10039270 | Ga0207702_100392702 | 188 |
| 769 | 3300028794 | Ga0307515_10005461 | Ga0307515_100054616 | 188 |
| 770 | 3300031730 | Ga0307516_10000897 | Ga0307516_100008974 | 188 |
| 771 | 3300037466 | Ga0395898_0013276 | Ga0395898_0013276_3686_4255 | 189 |
| 772 | 3300002705 | JGI25156J39149_1001030 | JGI25156J39149_100103013 | 190 |
| 773 | 3300002738 | JGI25154J39366_1002784 | JGI25154J39366_10027846 | 190 |
| 774 | 3300002741 | JGI25157J39369_1000021 | JGI25157J39369_1000021129 | 190 |
| 775 | 3300003752 | Ga0055539_1000608 | Ga0055539_10006083 | 190 |
| 776 | 3300003752 | Ga0055539_1004575 | Ga0055539_10045753 | 190 |
| 777 | 3300003756 | Ga0055533_1000033 | Ga0055533_100003326 | 190 |
| 778 | 3300005327 | Ga0070658_10679370 | Ga0070658_106793701 | 190 |
| 779 | 3300005364 | Ga0070673_100045390 | Ga0070673_1000453903 | 190 |
| 780 | 3300005366 | Ga0070659_100077876 | Ga0070659_1000778762 | 190 |
| 781 | 3300005366 | Ga0070659_100135626 | Ga0070659_1001356263 | 190 |
| 782 | 3300005539 | Ga0068853_100560765 | Ga0068853_1005607652 | 190 |
| 783 | 3300005563 | Ga0068855_100112152 | Ga0068855_1001121522 | 190 |
| 784 | 3300005563 | Ga0068855_100260848 | Ga0068855_1002608482 | 190 |
| 785 | 3300005577 | Ga0068857_100174232 | Ga0068857_1001742323 | 190 |
| 786 | 3300005577 | Ga0068857_100616099 | Ga0068857_1006160992 | 190 |
| 787 | 3300005578 | Ga0068854_100013259 | Ga0068854_1000132594 | 190 |
| 788 | 3300005614 | Ga0068856_100000887 | Ga0068856_10000088726 | 190 |
| 789 | 3300006195 | Ga0075366_10053926 | Ga0075366_100539262 | 190 |
| 790 | 3300009545 | Ga0105237_10136973 | Ga0105237_101369732 | 190 |
| 791 | 3300009551 | Ga0105238_10080234 | Ga0105238_100802342 | 190 |
| 792 | 3300013307 | Ga0157372_10456279 | Ga0157372_104562793 | 190 |
| 793 | 3300025226 | Ga0209674_100064 | Ga0209674_100064223 | 190 |
| 794 | 3300025230 | Ga0209563_100126 | Ga0209563_10012682 | 190 |
| 795 | 3300025242 | Ga0209258_100905 | Ga0209258_10090511 | 190 |
| 796 | 3300025246 | Ga0209646_1000060 | Ga0209646_100006027 | 190 |
| 797 | 3300025250 | Ga0209026_1000049 | Ga0209026_100004925 | 190 |
| 798 | 3300025253 | Ga0209677_100099 | Ga0209677_10009988 | 190 |
| 799 | 3300025253 | Ga0209677_100229 | Ga0209677_10022940 | 190 |
| 800 | 3300025256 | Ga0209759_1000069 | Ga0209759_100006925 | 190 |
| 801 | 3300025256 | Ga0209759_1001738 | Ga0209759_100173813 | 190 |
| 802 | 3300025909 | Ga0207705_10254922 | Ga0207705_102549222 | 190 |
| 803 | 3300025914 | Ga0207671_10080694 | Ga0207671_100806944 | 190 |
| 804 | 3300025924 | Ga0207694_10203967 | Ga0207694_102039672 | 190 |
| 805 | 3300025932 | Ga0207690_10059776 | Ga0207690_100597762 | 190 |
| 806 | 3300025944 | Ga0207661_10465463 | Ga0207661_104654632 | 190 |
| 807 | 3300025949 | Ga0207667_10001779 | Ga0207667_1000177916 | 190 |
| 808 | 3300025949 | Ga0207667_10284225 | Ga0207667_102842252 | 190 |
| 809 | 3300025960 | Ga0207651_10026134 | Ga0207651_100261343 | 190 |
| 810 | 3300025981 | Ga0207640_10050170 | Ga0207640_100501704 | 190 |
| 811 | 3300026041 | Ga0207639_10159358 | Ga0207639_101593582 | 190 |
| 812 | 3300026078 | Ga0207702_10001447 | Ga0207702_100014473 | 190 |
| 813 | 3300026116 | Ga0207674_10196958 | Ga0207674_101969582 | 190 |
| 814 | 3300035691 | Ga0373931_0109225 | Ga0373931_0109225_884_1456 | 190 |
| 815 | 3300037471 | Ga0395905_0500396 | Ga0395905_0500396_209_781 | 190 |
| 816 | 3300038443 | Ga0395901_0025620 | Ga0395901_0025620_5049_5621 | 190 |
| 817 | 3300048909 | Ga0496106_0100627 | Ga0496106_0100627_456_1031 | 190 |
| 818 | 3300048911 | Ga0496108_0258500 | Ga0496108_0258500_532_1158 | 190 |
| 819 | 3300050493 | nmdc:mga0k408_7916_c1 | nmdc:mga0k408_7916_c1_136_708 | 190 |
| 820 | 3300050496 | nmdc:mga07m45_67997_c1 | nmdc:mga07m45_67997_c1_339_911 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oga-assembly1.cif.gz_B | 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 | 0.8605 | 43 | 149 |
| 4v14-assembly1.cif.gz_A | structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae | 0.856 | 43 | 148 |
| 5isy-assembly1.cif.gz_A | crystal structure of nudix family protein with nad | 0.8535 | 7 | 149 |
| 4v14-assembly2.cif.gz_B | structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae | 0.8523 | 45 | 148 |
| 5isy-assembly1.cif.gz_C | crystal structure of nudix family protein with nad | 0.8521 | 7 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q19427_210_368_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8839 | 45 | 146 | 3.90.79.10 |
| af_P53164_221_376_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8812 | 45 | 146 | 3.90.79.10 |
| af_P9WIX5_169_312_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8725 | 43 | 146 | 3.90.79.10 |
| af_I1MUA9_246_385_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8644 | 43 | 145 | 3.90.79.10 |
| 4v14B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8523 | 45 | 148 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847VK60-F1-model_v4 | NUDIX domain-containing protein | 1 | 43 | 174 |
|
| AF-A0A3N5FKE5-F1-model_v4 | NUDIX hydrolase | 0.9807 | 79 | 175 |
GO:0016787
|
| AF-A0A2R5EL96-F1-model_v4 | Nudix hydrolase domain-containing protein | 0.9765 | 46 | 167 |
GO:0016787
|
| AF-A0A318GX15-F1-model_v4 | Nudix hydrolase family protein | 0.9688 | 2 | 175 |
GO:0005829
GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
| AF-A4BTP3-F1-model_v4 | Pyrophosphatase, MutT/nudix family protein | 0.9672 | 46 | 168 |
GO:0005777
GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar