F482209

General Info

Members Datasets Scaffolds Average Seq Length
820 357 820 147

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11018473|Ga0105249_110184732
Length 148
Sequence MTWRRTLGTLGTVLVLAAGCASRDSAMTEKKPLYDRLGGKPAITAVVDDFIGNVAGDARINKRFADANIPQLKTMLVDQICEATGGPCTYKGQTMKASHKGMKITDAEFNALVEDDLVKSLDKFKVGAQEKNELLSALGGMKGDIVGQ

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 3.78
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10271989 3300005290 Bacteria 913
2 Ga0065715_10187031 3300005293 Bacteria 1439
3 Ga0065715_10759883 3300005293 Bacteria 617
4 Ga0065707_10272951 3300005295 Bacteria 1051
5 Ga0065707_10548314 3300005295 Bacteria 723
6 Ga0070676_10008651 3300005328 Bacteria 5489
7 Ga0070676_10448345 3300005328 Bacteria 907
8 Ga0070683_100137897 3300005329 Bacteria 2311
9 Ga0070690_100003532 3300005330 Bacteria 8566
10 Ga0070690_100161526 3300005330 Unclassified 1535
11 Ga0070690_100374271 3300005330 Unclassified 1040
12 Ga0070690_100986727 3300005330 Bacteria 663
13 Ga0070670_100078873 3300005331 Bacteria 2829
14 Ga0070670_100553005 3300005331 Bacteria 1027
15 Ga0068869_100002612 3300005334 Bacteria 10871
16 Ga0068869_100131693 3300005334 Unclassified 1923
17 Ga0068869_100155924 3300005334 Bacteria 1774
18 Ga0068869_100544173 3300005334 Bacteria 974
19 Ga0070666_10025918 3300005335 Bacteria 3825
20 Ga0070666_10050259 3300005335 Bacteria 2804
21 Ga0070666_10318896 3300005335 Bacteria 1108
22 Ga0070680_100027015 3300005336 Bacteria 4595
23 Ga0070680_100590892 3300005336 Bacteria 953
24 Ga0070682_100045495 3300005337 Bacteria 2721
25 Ga0068868_100011018 3300005338 Bacteria 6571
26 Ga0068868_100029784 3300005338 Bacteria 4182
27 Ga0068868_100136971 3300005338 Bacteria 2007
28 Ga0068868_102403885 3300005338 Bacteria 503
29 Ga0070660_100046404 3300005339 Bacteria 3330
30 Ga0070660_100091461 3300005339 Bacteria 2400
31 Ga0070660_100473312 3300005339 Bacteria 1041
32 Ga0070689_100003591 3300005340 Bacteria 10339
33 Ga0070689_100989120 3300005340 Bacteria 748
34 Ga0070687_100389989 3300005343 Bacteria 910
35 Ga0070661_100020815 3300005344 Bacteria 4680
36 Ga0070661_100057264 3300005344 Bacteria 2856
37 Ga0070692_10004498 3300005345 Bacteria 5832
38 Ga0070692_10157708 3300005345 Bacteria 1297
39 Ga0070668_100331197 3300005347 Bacteria 1284
40 Ga0070668_100431304 3300005347 Unclassified 1130
41 Ga0070669_100038103 3300005353 Bacteria 3489
42 Ga0070675_100009133 3300005354 Bacteria 7700
43 Ga0070671_100012115 3300005355 Bacteria 6939
44 Ga0070671_100019330 3300005355 Bacteria 5543
45 Ga0070671_100054578 3300005355 Bacteria 3322
46 Ga0070671_100691472 3300005355 Unclassified 884
47 Ga0070674_100033971 3300005356 Bacteria 3401
48 Ga0070674_100165213 3300005356 Bacteria 1683
49 Ga0070673_100000900 3300005364 Bacteria 16784
50 Ga0070688_100000350 3300005365 Bacteria 23433
51 Ga0070659_100060128 3300005366 Bacteria 3001
52 Ga0070667_100020095 3300005367 Bacteria 5545
53 Ga0070667_100089778 3300005367 Bacteria 2640
54 Ga0070667_100158125 3300005367 Bacteria 1994
55 Ga0070703_10000289 3300005406 Bacteria 23238
56 Ga0070703_10203181 3300005406 Unclassified 779
57 Ga0070703_10326441 3300005406 Bacteria 648
58 Ga0070703_10574107 3300005406 Archaea 517
59 Ga0070709_11294968 3300005434 Unclassified 588
60 Ga0070714_100044779 3300005435 Bacteria 3747
61 Ga0070713_100034347 3300005436 Bacteria 4072
62 Ga0070710_10001633 3300005437 Bacteria 10599
63 Ga0070710_10339096 3300005437 Bacteria 992
64 Ga0070710_11458157 3300005437 Bacteria 513
65 Ga0070711_100707735 3300005439 Unclassified 848
66 Ga0070705_100000034 3300005440 Bacteria 67768
67 Ga0070705_100007970 3300005440 Bacteria 5235
68 Ga0070705_100046732 3300005440 Bacteria 2498
69 Ga0070705_100457912 3300005440 Unclassified 958
70 Ga0070705_100569721 3300005440 Bacteria 871
71 Ga0070705_100723780 3300005440 Unclassified 784
72 Ga0070705_100987271 3300005440 Bacteria 683
73 Ga0070694_100009137 3300005444 Bacteria 6079
74 Ga0070694_100128891 3300005444 Bacteria 1825
75 Ga0070694_100177232 3300005444 Bacteria 1574
76 Ga0070694_100505200 3300005444 Unclassified 962
77 Ga0070708_100021520 3300005445 Bacteria 5454
78 Ga0070708_100142506 3300005445 Bacteria 2223
79 Ga0070708_100176313 3300005445 Bacteria 1997
80 Ga0070708_100339417 3300005445 Unclassified 1416
81 Ga0070708_100704218 3300005445 Bacteria 950
82 Ga0070708_100750865 3300005445 Bacteria 917
83 Ga0070708_100770521 3300005445 Bacteria 905
84 Ga0070708_100882185 3300005445 Bacteria 840
85 Ga0070708_101102493 3300005445 Unclassified 743
86 Ga0070663_100008867 3300005455 Bacteria 6208
87 Ga0070663_100094251 3300005455 Bacteria 2223
88 Ga0070663_100289110 3300005455 Bacteria 1309
89 Ga0070678_100002700 3300005456 Bacteria 9789
90 Ga0070678_100389684 3300005456 Bacteria 1207
91 Ga0070678_101639771 3300005456 Bacteria 604
92 Ga0070662_100004156 3300005457 Bacteria 9111
93 Ga0070662_100028373 3300005457 Bacteria 3894
94 Ga0070662_100081754 3300005457 Unclassified 2407
95 Ga0070681_10001782 3300005458 Bacteria 19331
96 Ga0070681_10006305 3300005458 Bacteria 11531
97 Ga0068867_100667242 3300005459 Bacteria 914
98 Ga0068867_100719161 3300005459 Bacteria 883
99 Ga0070685_10001662 3300005466 Bacteria 11685
100 Ga0070685_11268393 3300005466 Bacteria 562
101 Ga0070706_100000020 3300005467 Bacteria 165628
102 Ga0070706_100011522 3300005467 Bacteria 8218
103 Ga0070706_100023380 3300005467 Bacteria 5691
104 Ga0070706_100023493 3300005467 Bacteria 5678
105 Ga0070706_100031309 3300005467 Bacteria 4906
106 Ga0070706_100083205 3300005467 Bacteria 2964
107 Ga0070706_100198448 3300005467 Bacteria 1874
108 Ga0070706_100279069 3300005467 Bacteria 1559
109 Ga0070706_100694151 3300005467 Unclassified 944
110 Ga0070706_101474278 3300005467 Bacteria 622
111 Ga0070707_100021881 3300005468 Bacteria 6045
112 Ga0070707_100041931 3300005468 Bacteria 4381
113 Ga0070707_100110320 3300005468 Unclassified 2668
114 Ga0070707_100198402 3300005468 Bacteria 1956
115 Ga0070707_100579577 3300005468 Unclassified 1084
116 Ga0070698_100035528 3300005471 Bacteria 5153
117 Ga0070698_100040630 3300005471 Bacteria 4779
118 Ga0070698_100115433 3300005471 Bacteria 2649
119 Ga0070698_100412736 3300005471 Bacteria 1284
120 Ga0070698_100716581 3300005471 Unclassified 943
121 Ga0070698_101140979 3300005471 Bacteria 728
122 Ga0070698_101448863 3300005471 Unclassified 638
123 Ga0070698_101672469 3300005471 Bacteria 589
124 Ga0070699_100000083 3300005518 Bacteria 89561
125 Ga0070699_100012081 3300005518 Bacteria 7450
126 Ga0070699_100023392 3300005518 Bacteria 5322
127 Ga0070699_100025869 3300005518 Bacteria 5059
128 Ga0070699_100125703 3300005518 Unclassified 2257
129 Ga0070699_100146920 3300005518 Bacteria 2083
130 Ga0070679_100035778 3300005530 Bacteria 4926
131 Ga0070679_100088970 3300005530 Bacteria 3075
132 Ga0070684_100161080 3300005535 Unclassified 2035
133 Ga0070684_101692507 3300005535 Unclassified 597
134 Ga0070697_100004869 3300005536 Bacteria 10301
135 Ga0070697_100052298 3300005536 Bacteria 3319
136 Ga0070697_100082213 3300005536 Unclassified 2654
137 Ga0070697_100580118 3300005536 Bacteria 985
138 Ga0070697_101783810 3300005536 Unclassified 550
139 Ga0068853_100069426 3300005539 Bacteria 3065
140 Ga0068853_100424828 3300005539 Bacteria 1247
141 Ga0068853_100502716 3300005539 Bacteria 1144
142 Ga0070672_100063683 3300005543 Bacteria 2912
143 Ga0070672_100216948 3300005543 Bacteria 1604
144 Ga0070672_101136940 3300005543 Bacteria 695
145 Ga0070686_100026376 3300005544 Bacteria 3508
146 Ga0070686_100092389 3300005544 Bacteria 2027
147 Ga0070686_100530051 3300005544 Unclassified 918
148 Ga0070695_100019523 3300005545 Bacteria 4127
149 Ga0070695_100380461 3300005545 Bacteria 1065
150 Ga0070695_100473895 3300005545 Bacteria 963
151 Ga0070695_100520808 3300005545 Bacteria 922
152 Ga0070696_100000120 3300005546 Bacteria 41117
153 Ga0070696_100011234 3300005546 Bacteria 5995
154 Ga0070696_100125487 3300005546 Bacteria 1862
155 Ga0070696_100139130 3300005546 Bacteria 1772
156 Ga0070696_100368531 3300005546 Bacteria 1116
157 Ga0070693_100001489 3300005547 Bacteria 10550
158 Ga0070693_100009597 3300005547 Bacteria 4817
159 Ga0070693_100236457 3300005547 Bacteria 1204
160 Ga0070693_100447890 3300005547 Bacteria 905
161 Ga0070704_100526117 3300005549 Bacteria 1030
162 Ga0068855_100119375 3300005563 Bacteria 3019
163 Ga0070664_100450594 3300005564 Bacteria 1181
164 Ga0070664_100724119 3300005564 Bacteria 928
165 Ga0068857_100215963 3300005577 Bacteria 1751
166 Ga0068857_101967925 3300005577 Bacteria 573
167 Ga0068854_100012768 3300005578 Bacteria 5500
168 Ga0068854_100019920 3300005578 Bacteria 4529
169 Ga0068854_100143534 3300005578 Bacteria 1834
170 Ga0068854_100713125 3300005578 Bacteria 867
171 Ga0068854_102128963 3300005578 Bacteria 518
172 Ga0068856_100043666 3300005614 Bacteria 4410
173 Ga0068856_100066951 3300005614 Bacteria 3549
174 Ga0068856_100074100 3300005614 Bacteria 3370
175 Ga0068856_101013175 3300005614 Unclassified 849
176 Ga0068856_101648155 3300005614 Bacteria 654
177 Ga0070702_100025104 3300005615 Bacteria 3189
178 Ga0070702_100355852 3300005615 Bacteria 1033
179 Ga0070702_100622013 3300005615 Bacteria 813
180 Ga0070702_100709724 3300005615 Unclassified 767
181 Ga0068852_100030701 3300005616 Bacteria 4427
182 Ga0068852_100055175 3300005616 Bacteria 3428
183 Ga0068852_100640850 3300005616 Bacteria 1069
184 Ga0068852_102014144 3300005616 Unclassified 599
185 Ga0068859_100003361 3300005617 Bacteria 16279
186 Ga0068859_100145752 3300005617 Bacteria 2443
187 Ga0068859_100230541 3300005617 Bacteria 1940
188 Ga0068859_100366813 3300005617 Bacteria 1535
189 Ga0068859_100374627 3300005617 Bacteria 1519
190 Ga0068859_100585635 3300005617 Bacteria 1209
191 Ga0068859_100776220 3300005617 Bacteria 1047
192 Ga0068864_100001097 3300005618 Bacteria 22692
193 Ga0068864_100006922 3300005618 Bacteria 9300
194 Ga0068864_100024876 3300005618 Bacteria 5037
195 Ga0068864_100776178 3300005618 Unclassified 940
196 Ga0068866_10022882 3300005718 Bacteria 2898
197 Ga0068866_10035481 3300005718 Bacteria 2436
198 Ga0068861_100001656 3300005719 Bacteria 14245
199 Ga0068861_100017797 3300005719 Bacteria 5048
200 Ga0068861_100031007 3300005719 Bacteria 3923
201 Ga0068861_100451875 3300005719 Bacteria 1151
202 Ga0068851_10374715 3300005834 Bacteria 833
203 Ga0068870_10142783 3300005840 Unclassified 1402
204 Ga0068863_100033322 3300005841 Bacteria 4907
205 Ga0068863_100192153 3300005841 Bacteria 1962
206 Ga0068858_100003252 3300005842 Bacteria 16188
207 Ga0068858_100007759 3300005842 Bacteria 10361
208 Ga0068858_100024644 3300005842 Bacteria 5604
209 Ga0068858_100158605 3300005842 Bacteria 2130
210 Ga0068858_100275074 3300005842 Bacteria 1603
211 Ga0068860_100043664 3300005843 Bacteria 4275
212 Ga0068860_100046309 3300005843 Bacteria 4147
213 Ga0068860_100056218 3300005843 Bacteria 3742
214 Ga0068860_100430053 3300005843 Bacteria 1310
215 Ga0068860_100623001 3300005843 Bacteria 1085
216 Ga0068860_101908884 3300005843 Bacteria 615
217 Ga0068862_100012492 3300005844 Bacteria 7026
218 Ga0068862_100065547 3300005844 Bacteria 3128
219 Ga0068862_101065943 3300005844 Bacteria 802
220 Ga0081455_10273343 3300005937 Unclassified 1224
221 Ga0081455_10276089 3300005937 Bacteria 1216
222 Ga0081455_10501641 3300005937 Bacteria 815
223 Ga0081540_1002355 3300005983 Bacteria 15443
224 Ga0081540_1302219 3300005983 Bacteria 550
225 Ga0081539_10001260 3300005985 Bacteria 44845
226 Ga0081539_10031253 3300005985 Bacteria 3286
227 Ga0070717_10177798 3300006028 Bacteria 1853
228 Ga0070717_11457696 3300006028 Unclassified 621
229 Ga0075363_100027009 3300006048 Bacteria 2940
230 Ga0070716_100078915 3300006173 Bacteria 1959
231 Ga0070716_100151651 3300006173 Bacteria 1491
232 Ga0070716_100567632 3300006173 Unclassified 849
233 Ga0070712_100880235 3300006175 Bacteria 771
234 Ga0075362_10069674 3300006177 Bacteria 1604
235 Ga0075367_10599672 3300006178 Unclassified 700
236 Ga0075369_10146879 3300006186 Bacteria 1077
237 Ga0075366_10002856 3300006195 Bacteria 8951
238 Ga0075366_10090939 3300006195 Bacteria 1828
239 Ga0075366_10340332 3300006195 Bacteria 920
240 Ga0097621_100026459 3300006237 Bacteria 4551
241 Ga0097621_100042768 3300006237 Bacteria 3650
242 Ga0097621_100421935 3300006237 Unclassified 1197
243 Ga0075370_10020280 3300006353 Bacteria 3631
244 Ga0068871_100012264 3300006358 Bacteria 6312
245 Ga0068871_100058306 3300006358 Bacteria 3143
246 Ga0075428_100121770 3300006844 Bacteria 2840
247 Ga0075430_100045632 3300006846 Bacteria 3702
248 Ga0075431_100032223 3300006847 Bacteria 5400
249 Ga0075431_100097979 3300006847 Bacteria 3027
250 Ga0075431_101060407 3300006847 Unclassified 776
251 Ga0075433_10230781 3300006852 Bacteria 1644
252 Ga0075433_10264583 3300006852 Bacteria 1524
253 Ga0075433_10361551 3300006852 Bacteria 1282
254 Ga0075433_10579151 3300006852 Bacteria 986
255 Ga0075433_11021222 3300006852 Bacteria 720
256 Ga0075433_11440657 3300006852 Bacteria 595
257 Ga0075434_100072407 3300006871 Unclassified 3438
258 Ga0075434_100211414 3300006871 Unclassified 1960
259 Ga0075434_100999130 3300006871 Bacteria 851
260 Ga0075429_100008641 3300006880 Bacteria 8860
261 Ga0075429_101218958 3300006880 Bacteria 657
262 Ga0068865_100234054 3300006881 Bacteria 1442
263 Ga0068865_100252036 3300006881 Bacteria 1394
264 Ga0068865_101329452 3300006881 Bacteria 640
265 Ga0075436_100104552 3300006914 Bacteria 1974
266 Ga0075436_100106662 3300006914 Bacteria 1954
267 Ga0075436_100155410 3300006914 Bacteria 1611
268 Ga0097620_100003360 3300006931 Bacteria 16279
269 Ga0097620_100145763 3300006931 Bacteria 2443
270 Ga0097620_100230535 3300006931 Bacteria 1940
271 Ga0097620_100366796 3300006931 Bacteria 1535
272 Ga0097620_100374679 3300006931 Bacteria 1519
273 Ga0097620_100585648 3300006931 Bacteria 1209
274 Ga0097620_100776202 3300006931 Bacteria 1047
275 Ga0075435_100117204 3300007076 Bacteria 2219
276 Ga0075435_100442774 3300007076 Bacteria 1120
277 Ga0075435_100594608 3300007076 Bacteria 959
278 Ga0111539_10094509 3300009094 Bacteria 3512
279 Ga0111539_11025236 3300009094 Bacteria 959
280 Ga0105245_10030436 3300009098 Bacteria 4773
281 Ga0105245_10065799 3300009098 Bacteria 3279
282 Ga0105245_10067867 3300009098 Bacteria 3230
283 Ga0105245_10071732 3300009098 Bacteria 3146
284 Ga0105245_10081563 3300009098 Bacteria 2958
285 Ga0105247_10336857 3300009101 Unclassified 1057
286 Ga0114129_10036594 3300009147 Bacteria 6930
287 Ga0114129_10133215 3300009147 Bacteria 3412
288 Ga0114129_10535653 3300009147 Bacteria 1525
289 Ga0114129_10687450 3300009147 Bacteria 1316
290 Ga0114129_11657059 3300009147 Unclassified 782
291 Ga0105243_11147194 3300009148 Unclassified 788
292 Ga0105241_10157530 3300009174 Bacteria 1863
293 Ga0105241_10233341 3300009174 Bacteria 1552
294 Ga0105241_10289817 3300009174 Unclassified 1401
295 Ga0105241_10715456 3300009174 Bacteria 915
296 Ga0105242_10059050 3300009176 Bacteria 3146
297 Ga0105242_10390964 3300009176 Bacteria 1295
298 Ga0105248_10023280 3300009177 Bacteria 6879
299 Ga0105248_10046529 3300009177 Bacteria 4863
300 Ga0105248_10145566 3300009177 Bacteria 2674
301 Ga0105248_10460592 3300009177 Bacteria 1433
302 Ga0105248_10533064 3300009177 Bacteria 1324
303 Ga0105248_11150906 3300009177 Unclassified 877
304 Ga0105248_11214156 3300009177 Bacteria 853
305 Ga0105237_10068951 3300009545 Bacteria 3531
306 Ga0105237_10529883 3300009545 Bacteria 1184
307 Ga0105238_10034509 3300009551 Bacteria 5147
308 Ga0105238_10290805 3300009551 Bacteria 1616
309 Ga0105238_10332826 3300009551 Bacteria 1505
310 Ga0105249_10013045 3300009553 Bacteria 7335
311 Ga0105249_10152484 3300009553 Bacteria 2226
312 Ga0105249_10709169 3300009553 Bacteria 1067
313 Ga0105249_10722504 3300009553 Bacteria 1057
314 Ga0105249_11018473 3300009553 Bacteria 897
315 Ga0105239_10096982 3300010375 Bacteria 3258
316 Ga0105239_10259712 3300010375 Bacteria 1952
317 Ga0105246_10167350 3300011119 Bacteria 1680
318 Ga0105246_10795127 3300011119 Unclassified 839
319 Ga0157373_10099647 3300013100 Bacteria 2045
320 Ga0157373_10404552 3300013100 Bacteria 979
321 Ga0157373_10631716 3300013100 Unclassified 781
322 Ga0157371_10525203 3300013102 Bacteria 876
323 Ga0157370_10030127 3300013104 Bacteria 5319
324 Ga0157370_10054530 3300013104 Bacteria 3810
325 Ga0157369_10187861 3300013105 Bacteria 2172
326 Ga0157374_10000720 3300013296 Bacteria 28871
327 Ga0157374_10055848 3300013296 Bacteria 3686
328 Ga0157378_10046168 3300013297 Bacteria 3872
329 Ga0157378_10050114 3300013297 Bacteria 3715
330 Ga0157378_11465656 3300013297 Bacteria 726
331 Ga0163162_10079862 3300013306 Bacteria 3338
332 Ga0163162_10162205 3300013306 Bacteria 2357
333 Ga0163162_10558721 3300013306 Bacteria 1272
334 Ga0163162_10567616 3300013306 Bacteria 1262
335 Ga0157372_10097987 3300013307 Bacteria 3344
336 Ga0157372_10263110 3300013307 Bacteria 2003
337 Ga0157372_10278912 3300013307 Bacteria 1943
338 Ga0157375_10005228 3300013308 Bacteria 11264
339 Ga0157375_10116452 3300013308 Bacteria 2777
340 Ga0157380_10098910 3300014326 Unclassified 2425
341 Ga0157380_10932691 3300014326 Unclassified 897
342 Ga0157380_10976274 3300014326 Bacteria 879
343 Ga0157377_10001260 3300014745 Bacteria 10825
344 Ga0157377_10040974 3300014745 Bacteria 2567
345 Ga0157379_10012192 3300014968 Bacteria 7509
346 Ga0157379_10020789 3300014968 Bacteria 5808
347 Ga0157379_10040876 3300014968 Bacteria 4139
348 Ga0157379_10083915 3300014968 Bacteria 2855
349 Ga0157379_10244992 3300014968 Unclassified 1626
350 Ga0157379_11341927 3300014968 Unclassified 692
351 Ga0157376_10032686 3300014969 Bacteria 4180
352 Ga0157376_10063073 3300014969 Bacteria 3120
353 Ga0157376_10276889 3300014969 Bacteria 1579
354 Ga0157376_10845186 3300014969 Bacteria 930
355 Ga0163161_10005526 3300017792 Bacteria 8757
356 Ga0163161_10613103 3300017792 Unclassified 898
357 Ga0213872_10041931 3300021361 Bacteria 2088
358 Ga0213876_10033283 3300021384 Bacteria 2718
359 Ga0213876_10071393 3300021384 Bacteria 1834
360 Ga0207656_10013567 3300025321 Bacteria 3118
361 Ga0207656_10170656 3300025321 Bacteria 1040
362 Ga0207656_10249789 3300025321 Bacteria 869
363 Ga0207653_10000339 3300025885 Bacteria 24285
364 Ga0207653_10152877 3300025885 Bacteria 850
365 Ga0207653_10184291 3300025885 Bacteria 782
366 Ga0207692_10245838 3300025898 Bacteria 1070
367 Ga0207692_10495984 3300025898 Unclassified 774
368 Ga0207692_10646100 3300025898 Bacteria 683
369 Ga0207642_10007211 3300025899 Bacteria 3744
370 Ga0207642_10039888 3300025899 Unclassified 2044
371 Ga0207688_10021565 3300025901 Bacteria 3521
372 Ga0207680_10000776 3300025903 Bacteria 15088
373 Ga0207680_10308640 3300025903 Unclassified 1104
374 Ga0207680_10316611 3300025903 Bacteria 1090
375 Ga0207680_10332589 3300025903 Bacteria 1064
376 Ga0207685_10076575 3300025905 Bacteria 1372
377 Ga0207699_11328793 3300025906 Bacteria 532
378 Ga0207645_10058373 3300025907 Bacteria 2463
379 Ga0207643_10065920 3300025908 Bacteria 2075
380 Ga0207684_10000215 3300025910 Bacteria 89389
381 Ga0207684_10018374 3300025910 Bacteria 5985
382 Ga0207684_10038127 3300025910 Unclassified 4078
383 Ga0207684_10039192 3300025910 Unclassified 4020
384 Ga0207684_10101280 3300025910 Bacteria 2462
385 Ga0207684_10114491 3300025910 Bacteria 2309
386 Ga0207684_10134031 3300025910 Bacteria 2126
387 Ga0207684_10235438 3300025910 Bacteria 1580
388 Ga0207684_10630297 3300025910 Bacteria 914
389 Ga0207684_10921153 3300025910 Bacteria 734
390 Ga0207654_10044683 3300025911 Bacteria 2518
391 Ga0207654_11438957 3300025911 Bacteria 503
392 Ga0207707_10052439 3300025912 Bacteria 3552
393 Ga0207693_10000485 3300025915 Bacteria 36061
394 Ga0207693_10020276 3300025915 Bacteria 5289
395 Ga0207663_10219095 3300025916 Bacteria 1384
396 Ga0207663_10478210 3300025916 Bacteria 965
397 Ga0207663_10919881 3300025916 Bacteria 700
398 Ga0207660_10114009 3300025917 Bacteria 2038
399 Ga0207660_10506949 3300025917 Bacteria 979
400 Ga0207662_10022083 3300025918 Bacteria 3643
401 Ga0207662_10560617 3300025918 Unclassified 792
402 Ga0207662_11017788 3300025918 Bacteria 588
403 Ga0207657_10003754 3300025919 Bacteria 16143
404 Ga0207657_10208414 3300025919 Bacteria 1570
405 Ga0207649_10034334 3300025920 Bacteria 3038
406 Ga0207649_10059546 3300025920 Bacteria 2397
407 Ga0207649_10214867 3300025920 Bacteria 1366
408 Ga0207652_10365818 3300025921 Bacteria 1302
409 Ga0207646_10020487 3300025922 Bacteria 6126
410 Ga0207646_10031238 3300025922 Bacteria 4823
411 Ga0207646_10045761 3300025922 Bacteria 3927
412 Ga0207646_10075551 3300025922 Unclassified 3010
413 Ga0207646_10094649 3300025922 Bacteria 2675
414 Ga0207646_10600374 3300025922 Bacteria 988
415 Ga0207646_10796117 3300025922 Archaea 842
416 Ga0207646_10963111 3300025922 Unclassified 755
417 Ga0207646_11102820 3300025922 Bacteria 698
418 Ga0207681_10004317 3300025923 Bacteria 8778
419 Ga0207681_10197969 3300025923 Bacteria 1541
420 Ga0207681_11572073 3300025923 Unclassified 551
421 Ga0207694_10202145 3300025924 Bacteria 1617
422 Ga0207694_10226820 3300025924 Bacteria 1525
423 Ga0207650_11816879 3300025925 Bacteria 515
424 Ga0207659_10038033 3300025926 Bacteria 3344
425 Ga0207659_10563910 3300025926 Unclassified 969
426 Ga0207687_10005926 3300025927 Bacteria 8083
427 Ga0207687_10022709 3300025927 Bacteria 4178
428 Ga0207687_10064857 3300025927 Bacteria 2592
429 Ga0207687_10292272 3300025927 Bacteria 1310
430 Ga0207700_10001822 3300025928 Bacteria 12116
431 Ga0207700_10077519 3300025928 Bacteria 2582
432 Ga0207644_10021539 3300025931 Bacteria 4392
433 Ga0207644_10082443 3300025931 Unclassified 2379
434 Ga0207690_10039233 3300025932 Bacteria 3089
435 Ga0207706_10001995 3300025933 Bacteria 19971
436 Ga0207706_10068569 3300025933 Bacteria 3121
437 Ga0207706_10160293 3300025933 Bacteria 1978
438 Ga0207686_10000309 3300025934 Bacteria 35241
439 Ga0207670_10002158 3300025936 Bacteria 10295
440 Ga0207670_10079128 3300025936 Bacteria 2294
441 Ga0207669_10030394 3300025937 Bacteria 3001
442 Ga0207669_10992781 3300025937 Unclassified 705
443 Ga0207704_10094593 3300025938 Bacteria 1973
444 Ga0207704_10507253 3300025938 Unclassified 973
445 Ga0207665_10004200 3300025939 Bacteria 9583
446 Ga0207665_10015247 3300025939 Bacteria 5047
447 Ga0207665_10031433 3300025939 Bacteria 3512
448 Ga0207665_10160126 3300025939 Bacteria 1618
449 Ga0207691_10036442 3300025940 Bacteria 4557
450 Ga0207691_10074448 3300025940 Bacteria 3063
451 Ga0207691_10792312 3300025940 Bacteria 797
452 Ga0207711_10000115 3300025941 Bacteria 83472
453 Ga0207711_10009070 3300025941 Bacteria 8311
454 Ga0207711_10306798 3300025941 Unclassified 1465
455 Ga0207711_10550158 3300025941 Bacteria 1076
456 Ga0207711_10639370 3300025941 Bacteria 992
457 Ga0207689_10000996 3300025942 Bacteria 27158
458 Ga0207689_10022153 3300025942 Bacteria 5343
459 Ga0207689_10145581 3300025942 Bacteria 1952
460 Ga0207689_10499801 3300025942 Bacteria 1019
461 Ga0207661_10025375 3300025944 Bacteria 4504
462 Ga0207661_10728739 3300025944 Bacteria 912
463 Ga0207679_10175790 3300025945 Bacteria 1767
464 Ga0207679_10569649 3300025945 Bacteria 1018
465 Ga0207667_10052553 3300025949 Bacteria 4290
466 Ga0207667_11842851 3300025949 Unclassified 568
467 Ga0207651_10001799 3300025960 Bacteria 9966
468 Ga0207712_10090175 3300025961 Bacteria 2255
469 Ga0207712_10140109 3300025961 Bacteria 1855
470 Ga0207712_10270204 3300025961 Unclassified 1383
471 Ga0207712_10552364 3300025961 Unclassified 991
472 Ga0207668_10104172 3300025972 Bacteria 2114
473 Ga0207668_10616914 3300025972 Unclassified 946
474 Ga0207640_10021812 3300025981 Bacteria 3822
475 Ga0207640_10059072 3300025981 Bacteria 2529
476 Ga0207640_10209591 3300025981 Bacteria 1483
477 Ga0207658_10005849 3300025986 Bacteria 8412
478 Ga0207658_10025475 3300025986 Bacteria 4142
479 Ga0207658_10144705 3300025986 Bacteria 1928
480 Ga0207658_10311547 3300025986 Bacteria 1360
481 Ga0207658_10667447 3300025986 Bacteria 938
482 Ga0207658_11301755 3300025986 Bacteria 665
483 Ga0207677_10000395 3300026023 Bacteria 30050
484 Ga0207677_10000853 3300026023 Bacteria 17454
485 Ga0207677_10033258 3300026023 Bacteria 3324
486 Ga0207703_10009640 3300026035 Bacteria 7581
487 Ga0207703_10012230 3300026035 Bacteria 6693
488 Ga0207703_10089109 3300026035 Bacteria 2591
489 Ga0207703_10105983 3300026035 Bacteria 2390
490 Ga0207703_10304519 3300026035 Bacteria 1455
491 Ga0207703_10465966 3300026035 Bacteria 1182
492 Ga0207703_10708972 3300026035 Bacteria 957
493 Ga0207639_10012372 3300026041 Bacteria 5942
494 Ga0207639_10077253 3300026041 Bacteria 2624
495 Ga0207639_10122024 3300026041 Bacteria 2142
496 Ga0207678_10052391 3300026067 Bacteria 3521
497 Ga0207678_10072541 3300026067 Bacteria 2950
498 Ga0207678_10145091 3300026067 Bacteria 2026
499 Ga0207678_10401726 3300026067 Bacteria 1186
500 Ga0207708_10508749 3300026075 Unclassified 1010
501 Ga0207702_10105738 3300026078 Bacteria 2493
502 Ga0207702_10235550 3300026078 Bacteria 1713
503 Ga0207702_11131591 3300026078 Unclassified 777
504 Ga0207641_10006084 3300026088 Bacteria 10217
505 Ga0207641_10255488 3300026088 Bacteria 1638
506 Ga0207641_11626150 3300026088 Bacteria 648
507 Ga0207648_10003050 3300026089 Bacteria 17707
508 Ga0207648_10059765 3300026089 Bacteria 3324
509 Ga0207648_10692580 3300026089 Bacteria 944
510 Ga0207676_10001026 3300026095 Bacteria 21347
511 Ga0207676_10003408 3300026095 Bacteria 11239
512 Ga0207676_10105115 3300026095 Bacteria 2350
513 Ga0207676_10715247 3300026095 Bacteria 971
514 Ga0207676_11451356 3300026095 Bacteria 682
515 Ga0207674_10009820 3300026116 Bacteria 10898
516 Ga0207674_10172794 3300026116 Bacteria 2114
517 Ga0207674_10846564 3300026116 Bacteria 882
518 Ga0207674_11588714 3300026116 Bacteria 623
519 Ga0207675_100008890 3300026118 Bacteria 9423
520 Ga0207675_100036403 3300026118 Bacteria 4591
521 Ga0207675_100055575 3300026118 Bacteria 3694
522 Ga0207675_100283573 3300026118 Bacteria 1610
523 Ga0207675_100388738 3300026118 Bacteria 1373
524 Ga0207683_10011693 3300026121 Bacteria 7492
525 Ga0207683_10248280 3300026121 Bacteria 1624
526 Ga0207683_11591320 3300026121 Bacteria 603
527 Ga0207698_10029833 3300026142 Bacteria 3912
528 Ga0207698_10047442 3300026142 Bacteria 3254
529 Ga0207698_10112725 3300026142 Bacteria 2283
530 Ga0207698_10462495 3300026142 Unclassified 1227
531 Ga0207428_10056081 3300027907 Bacteria 3131
532 Ga0268266_10003868 3300028379 Bacteria 14601
533 Ga0268265_10163264 3300028380 Unclassified 1895
534 Ga0268265_10698759 3300028380 Bacteria 979
535 Ga0268265_10738886 3300028380 Unclassified 954
536 Ga0268264_10008970 3300028381 Bacteria 8299
537 Ga0268264_10011726 3300028381 Bacteria 7228
538 Ga0268264_10031276 3300028381 Bacteria 4364
539 Ga0268264_10218105 3300028381 Bacteria 1755
540 Ga0268264_10751550 3300028381 Bacteria 971
541 Ga0268264_11042430 3300028381 Bacteria 825
542 Ga0268264_11254368 3300028381 Bacteria 751
543 Ga0307517_10147695 3300028786 Bacteria 1625
544 Ga0307517_10288522 3300028786 Bacteria 929
545 Ga0307515_10814799 3300028794 Archaea 557
546 Ga0265330_10137643 3300031235 Bacteria 1038
547 Ga0265332_10000724 3300031238 Bacteria 20828
548 Ga0265328_10140993 3300031239 Bacteria 904
549 Ga0265329_10030085 3300031242 Bacteria 1771
550 Ga0265339_10096783 3300031249 Bacteria 1540
551 Ga0265331_10000579 3300031250 Bacteria 32817
552 Ga0265331_10263892 3300031250 Bacteria 772
553 Ga0265327_10031469 3300031251 Bacteria 2980
554 Ga0265316_10179750 3300031344 Bacteria 1575
555 Ga0307513_10204672 3300031456 Bacteria 1811
556 Ga0307509_10497035 3300031507 Bacteria 905
557 Ga0307408_100021342 3300031548 Bacteria 4383
558 Ga0307408_100040588 3300031548 Bacteria 3296
559 Ga0265313_10227543 3300031595 Unclassified 767
560 Ga0265314_10009471 3300031711 Bacteria 8215
561 Ga0265342_10059999 3300031712 Bacteria 2245
562 Ga0307516_10513725 3300031730 Bacteria 852
563 Ga0307413_10506758 3300031824 Unclassified 970
564 Ga0307406_10086231 3300031901 Bacteria 2102
565 Ga0307406_10639886 3300031901 Unclassified 881
566 Ga0307407_10785273 3300031903 Unclassified 723
567 Ga0307407_10878439 3300031903 Unclassified 687
568 Ga0307412_10075440 3300031911 Unclassified 2313
569 Ga0307412_10916391 3300031911 Unclassified 769
570 Ga0307412_11489219 3300031911 Unclassified 615
571 Ga0307409_100195672 3300031995 Unclassified 1804
572 Ga0307416_100116610 3300032002 Unclassified 2368
573 Ga0307416_100223850 3300032002 Bacteria 1807
574 Ga0307414_10052479 3300032004 Unclassified 2838
575 Ga0307411_10017221 3300032005 Bacteria 4110
576 Ga0307415_100140415 3300032126 Unclassified 1844
577 Ga0307510_10397439 3300033180 Bacteria 822
578 Ga0373926_0125457 3300035083 Unclassified 970
579 Ga0373928_0058569 3300035084 Bacteria 926
580 Ga0373934_0005290 3300035086 Bacteria 4774
581 Ga0373923_0003535 3300035111 Bacteria 5024
582 Ga0373936_0068007 3300035113 Bacteria 1464
583 Ga0373939_0032447 3300035114 Bacteria 1518
584 Ga0373941_0026364 3300035115 Bacteria 1687
585 Ga0373945_0038227 3300035116 Bacteria 1726
586 Ga0373945_0142184 3300035116 Bacteria 968
587 Ga0373953_0055692 3300035117 Bacteria 1606
588 Ga0373954_0011052 3300035118 Bacteria 3995
589 Ga0373956_0007834 3300035119 Bacteria 4309
590 Ga0373957_0055008 3300035120 Unclassified 1529
591 Ga0373960_0203947 3300035121 Bacteria 700
592 Ga0373943_0023626 3300035170 Bacteria 2859
593 Ga0373943_0099231 3300035170 Unclassified 1520
594 Ga0373946_0259789 3300035171 Unclassified 849
595 Ga0373955_0006516 3300035172 Bacteria 5323
596 Ga0373955_0065131 3300035172 Bacteria 2022
597 Ga0373955_0163856 3300035172 Bacteria 1314
598 Ga0373962_0033626 3300035242 Bacteria 1416
599 Ga0373924_0004316 3300035410 Bacteria 4961
600 Ga0373931_0147572 3300035691 Bacteria 1368
601 Ga0373931_0188382 3300035691 Unclassified 1226
602 Ga0373935_0051920 3300035692 Unclassified 2605
603 Ga0373935_0124028 3300035692 Bacteria 1729
604 Ga0373935_0349087 3300035692 Unclassified 1054
605 Ga0373935_1284530 3300035692 Bacteria 546
606 Ga0373927_0001889 3300035695 Bacteria 15478
607 Ga0373927_0026989 3300035695 Bacteria 3752
608 Ga0373927_0579634 3300035695 Bacteria 741
609 Ga0373933_0867000 3300035724 Bacteria 594
610 Ga0373947_0013481 3300035725 Bacteria 4682
611 Ga0373947_0368404 3300035725 Bacteria 966
612 Ga0373937_0011385 3300036401 Bacteria 7804
613 Ga0373937_0058512 3300036401 Bacteria 3541
614 Ga0373937_0262034 3300036401 Bacteria 1630
615 Ga0373937_0620904 3300036401 Bacteria 1026
616 Ga0373937_0637860 3300036401 Unclassified 1010
617 Ga0373937_0809081 3300036401 Bacteria 885
618 Ga0373937_0837527 3300036401 Unclassified 868
619 Ga0373937_0862837 3300036401 Bacteria 854
620 Ga0373925_0016451 3300037068 Bacteria 5358
621 Ga0373925_0026702 3300037068 Bacteria 4226
622 Ga0373925_0170804 3300037068 Bacteria 1717
623 Ga0373925_0264113 3300037068 Bacteria 1383
624 Ga0436364_0110143 3300037853 Bacteria 631
625 Ga0436365_0772642 3300039437 Bacteria 2060
626 Ga0436365_0982517 3300039437 Bacteria 756
627 Ga0436365_1085891 3300039437 Bacteria 1128
628 Ga0436365_1776998 3300039437 Bacteria 4249
629 Ga0436360_0083715 3300039438 Bacteria 2204
630 Ga0436360_0193744 3300039438 Unclassified 937
631 Ga0436360_0606863 3300039438 Unclassified 798
632 Ga0436361_0437114 3300039447 Bacteria 6633
633 Ga0436363_0187732 3300039450 Bacteria 1724
634 Ga0451807_0168116 3300041486 Bacteria 581
635 Ga0439448_0072660 3300042005 Bacteria 1147
636 Ga0451577_0034258 3300042876 Bacteria 4578
637 Ga0453683_0006140 3300044673 Bacteria 8273
638 Ga0453683_0114672 3300044673 Bacteria 1695
639 Ga0453683_0234265 3300044673 Unclassified 1169
640 Ga0466963_0213949 3300044694 Bacteria 1349
641 Ga0451576_0093427 3300045051 Bacteria 3128
642 Ga0451576_0363406 3300045051 Bacteria 1516
643 Ga0451576_0867349 3300045051 Bacteria 947
644 Ga0466967_0046561 3300045976 Bacteria 3777
645 Ga0495629_0032786 3300046459 Bacteria 3676
646 Ga0495651_0380857 3300046462 Unclassified 925
647 Ga0495653_0761376 3300046463 Unclassified 584
648 Ga0495580_0042011 3300046472 Bacteria 3258
649 Ga0495580_0069770 3300046472 Bacteria 2455
650 Ga0495580_0086219 3300046472 Unclassified 2187
651 Ga0495580_0119473 3300046472 Bacteria 1830
652 Ga0495582_0059191 3300046473 Bacteria 2113
653 Ga0495639_0184572 3300046475 Unclassified 1016
654 Ga0495662_0005009 3300046476 Bacteria 6638
655 Ga0495664_0122682 3300046477 Bacteria 1571
656 Ga0495618_0418964 3300046514 Unclassified 817
657 Ga0495628_0184769 3300046516 Unclassified 1576
658 Ga0495628_0200032 3300046516 Bacteria 1506
659 Ga0495630_0157418 3300046517 Unclassified 1729
660 Ga0495632_0025548 3300046519 Bacteria 3122
661 Ga0495652_0442754 3300046529 Bacteria 911
662 Ga0495665_0035617 3300046531 Bacteria 2658
663 Ga0495665_0404454 3300046531 Bacteria 692
664 Ga0495586_0154120 3300046535 Unclassified 1294
665 Ga0495586_0467055 3300046535 Unclassified 728
666 Ga0495621_0049561 3300046539 Bacteria 1498
667 Ga0495597_0039435 3300046542 Bacteria 2115
668 Ga0495645_0016994 3300046543 Bacteria 5208
669 Ga0495668_0053582 3300046616 Bacteria 2230
670 Ga0495634_0161849 3300046642 Bacteria 1410
671 Ga0495634_0342130 3300046642 Bacteria 897
672 Ga0495625_0013437 3300046660 Bacteria 6580
673 Ga0495635_0031580 3300046663 Bacteria 3675
674 Ga0495659_0128830 3300046664 Unclassified 1002
675 Ga0495588_0144768 3300046674 Unclassified 1256
676 Ga0495623_0054150 3300046679 Bacteria 2532
677 Ga0495646_0667532 3300046680 Unclassified 524
678 Ga0495647_0005451 3300046681 Bacteria 4169
679 Ga0495658_0043035 3300046683 Bacteria 2523
680 Ga0495658_0378779 3300046683 Bacteria 901
681 Ga0495658_0838887 3300046683 Bacteria 588
682 Ga0495669_0503427 3300046684 Bacteria 589
683 Ga0495613_0073718 3300046689 Bacteria 2487
684 Ga0495649_0006206 3300046694 Bacteria 7460
685 Ga0495649_0212366 3300046694 Bacteria 1002
686 Ga0495600_0036077 3300046809 Bacteria 3213
687 Ga0495581_0000877 3300047315 Bacteria 16067
688 Ga0495604_0073448 3300047317 Bacteria 2582
689 Ga0495636_0507265 3300047318 Unclassified 584
690 Ga0495674_0144453 3300047319 Bacteria 1998
691 Ga0495680_0046751 3300047322 Bacteria 3410
692 Ga0495687_000232 3300047443 Bacteria 77572
693 Ga0495684_0088468 3300047471 Bacteria 2347
694 Ga0495684_0428927 3300047471 Bacteria 923
695 Ga0495593_0081830 3300047673 Bacteria 1669
696 Ga0495602_0151409 3300048088 Unclassified 1823
697 Ga0495602_0327593 3300048088 Unclassified 1112
698 Ga0495602_0472996 3300048088 Bacteria 881
699 Ga0495614_0100924 3300048089 Unclassified 1261
700 Ga0496100_0045980 3300048903 Bacteria 2804
701 Ga0496101_0018557 3300048904 Bacteria 4732
702 Ga0496101_0063364 3300048904 Bacteria 2691
703 Ga0496102_0083058 3300048905 Bacteria 2955
704 Ga0496102_0152982 3300048905 Bacteria 2168
705 Ga0496103_0931315 3300048906 Bacteria 543
706 Ga0496104_0012262 3300048907 Bacteria 7703
707 Ga0496104_0562939 3300048907 Bacteria 1050
708 Ga0496104_0918328 3300048907 Bacteria 780
709 Ga0496105_0022388 3300048908 Bacteria 5118
710 Ga0496105_0120301 3300048908 Bacteria 2166
711 Ga0496106_0021541 3300048909 Bacteria 4786
712 Ga0496106_0075683 3300048909 Bacteria 2579
713 Ga0496107_0017834 3300048910 Bacteria 4996
714 Ga0496108_0256473 3300048911 Bacteria 1521
715 Ga0496108_0386257 3300048911 Bacteria 1222
716 Ga0496108_0720491 3300048911 Bacteria 864
717 Ga0496109_0065871 3300048912 Bacteria 3316
718 Ga0496109_1664240 3300048912 Unclassified 572
719 Ga0496110_0092451 3300048913 Bacteria 2707
720 Ga0496110_0900889 3300048913 Unclassified 790
721 Ga0496111_0039985 3300048914 Bacteria 3364
722 Ga0496112_0001102 3300048915 Bacteria 20017
723 Ga0496112_0431452 3300048915 Bacteria 1256
724 Ga0496113_0892249 3300048916 Bacteria 703
725 Ga0496114_0024703 3300048917 Bacteria 4906
726 Ga0496114_0071403 3300048917 Bacteria 2918
727 Ga0496114_0251246 3300048917 Bacteria 1556
728 Ga0496115_0046876 3300048918 Bacteria 3456
729 Ga0496115_0046886 3300048918 Bacteria 3456
730 Ga0501033_0548204 3300049570 Unclassified 797
731 Ga0501036_0118777 3300049572 Bacteria 2233
732 Ga0501036_0804463 3300049572 Unclassified 774
733 Ga0501038_0505239 3300049574 Bacteria 924
734 Ga0501039_0160978 3300049575 Bacteria 1764
735 Ga0501039_0761733 3300049575 Unclassified 756
736 Ga0501040_0049789 3300049576 Bacteria 2865
737 Ga0501040_0135556 3300049576 Bacteria 1733
738 Ga0501040_0350364 3300049576 Unclassified 1058
739 Ga0501041_0101154 3300049577 Bacteria 1784
740 Ga0501041_0468026 3300049577 Bacteria 801
741 Ga0501046_0135428 3300049580 Bacteria 1866
742 Ga0501046_0227787 3300049580 Bacteria 1378
743 Ga0501048_0211977 3300049582 Unclassified 1374
744 Ga0501048_0296533 3300049582 Unclassified 1150
745 Ga0501067_0072746 3300049583 Bacteria 1904
746 Ga0501068_0401232 3300049584 Bacteria 884
747 Ga0501071_0167014 3300049587 Unclassified 1647
748 Ga0501072_0041079 3300049588 Bacteria 3632
749 Ga0501072_0244134 3300049588 Bacteria 1430
750 Ga0501072_0266706 3300049588 Bacteria 1363
751 Ga0501074_0156011 3300049590 Bacteria 1631
752 Ga0501075_0082967 3300049591 Bacteria 2428
753 Ga0501075_0140037 3300049591 Bacteria 1843
754 Ga0501075_0159059 3300049591 Bacteria 1723
755 Ga0501075_0551404 3300049591 Unclassified 880
756 Ga0501076_0166490 3300049592 Bacteria 1797
757 Ga0501076_0178126 3300049592 Unclassified 1733
758 Ga0501076_0301783 3300049592 Bacteria 1313
759 Ga0501077_0435501 3300049593 Bacteria 839
760 Ga0501079_0084474 3300049741 Bacteria 2456
761 Ga0501079_0288108 3300049741 Bacteria 1284
762 Ga0501080_1649433 3300049742 Bacteria 542
763 Ga0501081_0124703 3300049743 Bacteria 1837
764 Ga0501081_0396478 3300049743 Unclassified 1021
765 Ga0501045_0176583 3300049824 Bacteria 1591
766 Ga0501045_0486093 3300049824 Unclassified 917
767 nmdc:mga03683_193709_c1 3300050489 Bacteria 931
768 nmdc:mga03n38_421521_c1 3300050490 Bacteria 738
769 nmdc:mga0yw44_155009_c1 3300050492 Bacteria 1496
770 nmdc:mga0k408_3029_c1 3300050493 Bacteria 8914
771 nmdc:mga0k408_370375_c1 3300050493 Bacteria 854
772 nmdc:mga0k408_37632_c1 3300050493 Bacteria 2778
773 nmdc:mga0k408_930598_c1 3300050493 Bacteria 504
774 nmdc:mga06z11_153135_c1 3300050494 Bacteria 1312
775 nmdc:mga07m45_10065_c1 3300050496 Bacteria 4925
776 nmdc:mga07m45_366662_c1 3300050496 Bacteria 837
777 nmdc:mga05p37_1367126_c1 3300050507 Bacteria 716
778 nmdc:mga05p37_1884308_c1 3300050507 Bacteria 572
779 nmdc:mga05p37_404_c1 3300050507 Bacteria 46806
780 nmdc:mga05p37_42208_c1 3300050507 Bacteria 5603
781 nmdc:mga05p37_474149_c1 3300050507 Bacteria 1443
782 nmdc:mga09592_314777_c1 3300050508 Bacteria 1356
783 nmdc:mga09592_360798_c1 3300050508 Unclassified 1257
784 nmdc:mga0qj67_19003_c1 3300050509 Bacteria 5245
785 nmdc:mga06r32_380617_c1 3300050510 Bacteria 1394
786 nmdc:mga06r32_56858_c1 3300050510 Bacteria 3756
787 nmdc:mga06r32_62517_c1 3300050510 Bacteria 3587
788 nmdc:mga08y16_77615_c1 3300050511 Bacteria 3463
789 nmdc:mga0n895_212330_c1 3300050512 Bacteria 1965
790 nmdc:mga0n895_219346_c1 3300050512 Bacteria 1931
791 nmdc:mga0n895_2201087_c1 3300050512 Bacteria 507
792 nmdc:mga0n895_30835_c1 3300050512 Bacteria 5128
793 nmdc:mga0n895_523544_c1 3300050512 Bacteria 1193
794 nmdc:mga0rr50_126638_c1 3300050513 Bacteria 2040
795 nmdc:mga0rr50_1525996_c1 3300050513 Bacteria 565
796 nmdc:mga0rr50_520615_c1 3300050513 Bacteria 1012
797 nmdc:mga08x19_105703_c1 3300050514 Bacteria 1872
798 nmdc:mga08x19_222529_c1 3300050514 Bacteria 1297
799 nmdc:mga08x19_284896_c1 3300050514 Unclassified 1145
800 nmdc:mga0a205_1096938_c1 3300050515 Bacteria 643
801 nmdc:mga0a205_11923_c1 3300050515 Bacteria 8025
802 nmdc:mga0a205_132161_c1 3300050515 Bacteria 1385
803 nmdc:mga0a205_185238_c1 3300050515 Bacteria 1975
804 nmdc:mga0a205_786130_c1 3300050515 Bacteria 800
805 nmdc:mga0sz30_208236_c1 3300050516 Bacteria 869
806 Ga0495601_0180580 3300053077 Bacteria 1380
807 Ga0495601_0483443 3300053077 Unclassified 800
808 Ga0495612_0089439 3300053078 Unclassified 1302
809 Ga0495619_0022063 3300053085 Bacteria 4070
810 Ga0495619_0194382 3300053085 Unclassified 1404
811 Ga0500651_0284674 3300053093 Bacteria 952
812 Ga0500641_0012985 3300053096 Bacteria 3054
813 Ga0500658_0003354 3300053134 Bacteria 6071
814 Ga0500604_0241694 3300053151 Bacteria 624
815 Ga0500611_029221 3300053727 Bacteria 1126
816 Ga0501084_1113384 3300054114 Bacteria 663
817 Ga0501082_0240424 3300060353 Unclassified 1576
818 Ga0501082_0449791 3300060353 Unclassified 1125
819 Ga0530510_0020947 3300061734 Bacteria 4649
820 Ga0530510_0466904 3300061734 Bacteria 955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_11150906 Ga0105248_111509061 120
2 3300014326 Ga0157380_10932691 Ga0157380_109326911 120
3 3300014968 Ga0157379_11341927 Ga0157379_113419272 120
4 3300005467 Ga0070706_100031309 Ga0070706_1000313092 122
5 3300013100 Ga0157373_10631716 Ga0157373_106317162 124
6 3300044673 Ga0453683_0114672 Ga0453683_0114672_422_886 127
7 3300005467 Ga0070706_101474278 Ga0070706_1014742781 128
8 3300050490 nmdc:mga03n38_421521_c1 nmdc:mga03n38_421521_c1_17_436 131
9 3300006177 Ga0075362_10069674 Ga0075362_100696742 132
10 3300041486 Ga0451807_0168116 Ga0451807_0168116_67_519 132
11 3300046539 Ga0495621_0049561 Ga0495621_0049561_441_893 132
12 3300046664 Ga0495659_0128830 Ga0495659_0128830_218_670 132
13 3300046674 Ga0495588_0144768 Ga0495588_0144768_273_689 132
14 3300046684 Ga0495669_0503427 Ga0495669_0503427_93_545 132
15 3300050507 nmdc:mga05p37_1367126_c1 nmdc:mga05p37_1367126_c1_231_638 132
16 3300005331 Ga0070670_100553005 Ga0070670_1005530052 133
17 3300005466 Ga0070685_11268393 Ga0070685_112683931 133
18 3300005577 Ga0068857_101967925 Ga0068857_1019679252 133
19 3300006852 Ga0075433_10579151 Ga0075433_105791511 133
20 3300009094 Ga0111539_10094509 Ga0111539_100945096 133
21 3300009177 Ga0105248_11214156 Ga0105248_112141561 133
22 3300009553 Ga0105249_10709169 Ga0105249_107091692 133
23 3300013297 Ga0157378_11465656 Ga0157378_114656561 133
24 3300025925 Ga0207650_11816879 Ga0207650_118168791 133
25 3300026116 Ga0207674_10846564 Ga0207674_108465641 133
26 3300027907 Ga0207428_10056081 Ga0207428_100560811 133
27 3300050511 nmdc:mga08y16_77615_c1 nmdc:mga08y16_77615_c1_594_1013 133
28 3300050515 nmdc:mga0a205_132161_c1 nmdc:mga0a205_132161_c1_930_1349 133
29 3300053077 Ga0495601_0483443 Ga0495601_0483443_210_644 133
30 3300005340 Ga0070689_100989120 Ga0070689_1009891202 134
31 3300005434 Ga0070709_11294968 Ga0070709_112949681 134
32 3300005440 Ga0070705_100723780 Ga0070705_1007237801 134
33 3300005471 Ga0070698_100716581 Ga0070698_1007165812 134
34 3300005617 Ga0068859_100585635 Ga0068859_1005856352 134
35 3300006173 Ga0070716_100567632 Ga0070716_1005676321 134
36 3300006880 Ga0075429_101218958 Ga0075429_1012189582 134
37 3300006931 Ga0097620_100585648 Ga0097620_1005856482 134
38 3300007076 Ga0075435_100117204 Ga0075435_1001172042 134
39 3300021384 Ga0213876_10071393 Ga0213876_100713932 134
40 3300025906 Ga0207699_11328793 Ga0207699_113287931 134
41 3300025916 Ga0207663_10919881 Ga0207663_109198812 134
42 3300025936 Ga0207670_10079128 Ga0207670_100791282 134
43 3300028786 Ga0307517_10147695 Ga0307517_101476952 134
44 3300031456 Ga0307513_10204672 Ga0307513_102046722 134
45 3300031730 Ga0307516_10513725 Ga0307516_105137252 134
46 3300035692 Ga0373935_0124028 Ga0373935_0124028_629_1057 134
47 3300036401 Ga0373937_0620904 Ga0373937_0620904_182_610 134
48 3300037068 Ga0373925_0016451 Ga0373925_0016451_1812_2240 134
49 3300039437 Ga0436365_1776998 Ga0436365_1776998_1441_1863 134
50 3300044694 Ga0466963_0213949 Ga0466963_0213949_518_943 134
51 3300045976 Ga0466967_0046561 Ga0466967_0046561_1536_1961 134
52 3300046529 Ga0495652_0442754 Ga0495652_0442754_118_546 134
53 3300046642 Ga0495634_0342130 Ga0495634_0342130_273_701 134
54 3300046683 Ga0495658_0378779 Ga0495658_0378779_448_876 134
55 3300046689 Ga0495613_0073718 Ga0495613_0073718_1776_2204 134
56 3300047471 Ga0495684_0428927 Ga0495684_0428927_294_722 134
57 3300050512 nmdc:mga0n895_219346_c1 nmdc:mga0n895_219346_c1_609_1037 134
58 3300050512 nmdc:mga0n895_2201087_c1 nmdc:mga0n895_2201087_c1_57_497 134
59 3300050512 nmdc:mga0n895_30835_c1 nmdc:mga0n895_30835_c1_4643_5107 134
60 3300050513 nmdc:mga0rr50_1525996_c1 nmdc:mga0rr50_1525996_c1_59_499 134
61 3300050513 nmdc:mga0rr50_520615_c1 nmdc:mga0rr50_520615_c1_296_760 134
62 3300050514 nmdc:mga08x19_105703_c1 nmdc:mga08x19_105703_c1_547_1011 134
63 3300050515 nmdc:mga0a205_786130_c1 nmdc:mga0a205_786130_c1_12_452 134
64 3300005937 Ga0081455_10276089 Ga0081455_102760891 135
65 3300005983 Ga0081540_1002355 Ga0081540_10023555 135
66 3300005983 Ga0081540_1302219 Ga0081540_13022191 135
67 3300005985 Ga0081539_10001260 Ga0081539_100012609 135
68 3300009147 Ga0114129_10687450 Ga0114129_106874502 135
69 3300021361 Ga0213872_10041931 Ga0213872_100419312 135
70 3300025922 Ga0207646_11102820 Ga0207646_111028201 135
71 3300035692 Ga0373935_0051920 Ga0373935_0051920_223_684 135
72 3300035695 Ga0373927_0001889 Ga0373927_0001889_1229_1690 135
73 3300037853 Ga0436364_0110143 Ga0436364_0110143_29_454 135
74 3300039447 Ga0436361_0437114 Ga0436361_0437114_4849_5307 135
75 3300046472 Ga0495580_0086219 Ga0495580_0086219_631_1092 135
76 3300053096 Ga0500641_0012985 Ga0500641_0012985_1898_2323 135
77 3300053151 Ga0500604_0241694 Ga0500604_0241694_71_496 135
78 3300005549 Ga0070704_100526117 Ga0070704_1005261172 136
79 3300005617 Ga0068859_100776220 Ga0068859_1007762201 136
80 3300005937 Ga0081455_10501641 Ga0081455_105016412 136
81 3300006931 Ga0097620_100776202 Ga0097620_1007762022 136
82 3300021384 Ga0213876_10033283 Ga0213876_100332833 136
83 3300036401 Ga0373937_0837527 Ga0373937_0837527_224_646 136
84 3300037068 Ga0373925_0264113 Ga0373925_0264113_896_1324 136
85 3300039437 Ga0436365_1085891 Ga0436365_1085891_322_825 136
86 3300046519 Ga0495632_0025548 Ga0495632_0025548_376_804 136
87 3300046542 Ga0495597_0039435 Ga0495597_0039435_78_506 136
88 3300046660 Ga0495625_0013437 Ga0495625_0013437_510_938 136
89 3300046694 Ga0495649_0006206 Ga0495649_0006206_4693_5121 136
90 3300046694 Ga0495649_0212366 Ga0495649_0212366_409_837 136
91 3300047443 Ga0495687_000232 Ga0495687_000232_68563_68991 136
92 3300049572 Ga0501036_0118777 Ga0501036_0118777_882_1310 136
93 3300049574 Ga0501038_0505239 Ga0501038_0505239_80_508 136
94 3300049577 Ga0501041_0101154 Ga0501041_0101154_319_747 136
95 3300049580 Ga0501046_0227787 Ga0501046_0227787_103_531 136
96 3300049582 Ga0501048_0296533 Ga0501048_0296533_415_843 136
97 3300049587 Ga0501071_0167014 Ga0501071_0167014_998_1426 136
98 3300049588 Ga0501072_0244134 Ga0501072_0244134_409_837 136
99 3300049591 Ga0501075_0140037 Ga0501075_0140037_29_457 136
100 3300049591 Ga0501075_0159059 Ga0501075_0159059_1278_1706 136
101 3300049592 Ga0501076_0301783 Ga0501076_0301783_115_543 136
102 3300049593 Ga0501077_0435501 Ga0501077_0435501_365_793 136
103 3300049742 Ga0501080_1649433 Ga0501080_1649433_13_441 136
104 3300049743 Ga0501081_0124703 Ga0501081_0124703_177_605 136
105 3300049824 Ga0501045_0176583 Ga0501045_0176583_556_984 136
106 3300050493 nmdc:mga0k408_37632_c1 nmdc:mga0k408_37632_c1_1449_1877 136
107 3300050496 nmdc:mga07m45_366662_c1 nmdc:mga07m45_366662_c1_280_708 136
108 3300050515 nmdc:mga0a205_1096938_c1 nmdc:mga0a205_1096938_c1_30_458 136
109 3300053093 Ga0500651_0284674 Ga0500651_0284674_412_840 136
110 3300053134 Ga0500658_0003354 Ga0500658_0003354_4068_4496 136
111 3300054114 Ga0501084_1113384 Ga0501084_1113384_214_642 136
112 3300060353 Ga0501082_0449791 Ga0501082_0449791_482_910 136
113 3300061734 Ga0530510_0020947 Ga0530510_0020947_2505_2933 136
114 3300006178 Ga0075367_10599672 Ga0075367_105996722 137
115 3300048088 Ga0495602_0472996 Ga0495602_0472996_260_706 137
116 3300005328 Ga0070676_10008651 Ga0070676_100086514 138
117 3300005330 Ga0070690_100986727 Ga0070690_1009867271 138
118 3300005334 Ga0068869_100002612 Ga0068869_1000026128 138
119 3300005335 Ga0070666_10318896 Ga0070666_103188961 138
120 3300005338 Ga0068868_100011018 Ga0068868_1000110182 138
121 3300005339 Ga0070660_100046404 Ga0070660_1000464044 138
122 3300005339 Ga0070660_100473312 Ga0070660_1004733122 138
123 3300005343 Ga0070687_100389989 Ga0070687_1003899891 138
124 3300005344 Ga0070661_100057264 Ga0070661_1000572642 138
125 3300005353 Ga0070669_100038103 Ga0070669_1000381034 138
126 3300005354 Ga0070675_100009133 Ga0070675_1000091339 138
127 3300005355 Ga0070671_100012115 Ga0070671_1000121156 138
128 3300005366 Ga0070659_100060128 Ga0070659_1000601282 138
129 3300005367 Ga0070667_100020095 Ga0070667_1000200957 138
130 3300005367 Ga0070667_100158125 Ga0070667_1001581253 138
131 3300005440 Ga0070705_100569721 Ga0070705_1005697211 138
132 3300005455 Ga0070663_100008867 Ga0070663_1000088672 138
133 3300005456 Ga0070678_100389684 Ga0070678_1003896842 138
134 3300005457 Ga0070662_100004156 Ga0070662_1000041564 138
135 3300005459 Ga0068867_100667242 Ga0068867_1006672422 138
136 3300005539 Ga0068853_100069426 Ga0068853_1000694262 138
137 3300005543 Ga0070672_101136940 Ga0070672_1011369402 138
138 3300005545 Ga0070695_100380461 Ga0070695_1003804612 138
139 3300005547 Ga0070693_100236457 Ga0070693_1002364572 138
140 3300005563 Ga0068855_100119375 Ga0068855_1001193753 138
141 3300005564 Ga0070664_100450594 Ga0070664_1004505942 138
142 3300005578 Ga0068854_100143534 Ga0068854_1001435342 138
143 3300005614 Ga0068856_100074100 Ga0068856_1000741004 138
144 3300005615 Ga0070702_100622013 Ga0070702_1006220132 138
145 3300005616 Ga0068852_100055175 Ga0068852_1000551752 138
146 3300005616 Ga0068852_100640850 Ga0068852_1006408502 138
147 3300005617 Ga0068859_100145752 Ga0068859_1001457522 138
148 3300005618 Ga0068864_100024876 Ga0068864_1000248764 138
149 3300005719 Ga0068861_100001656 Ga0068861_1000016568 138
150 3300005834 Ga0068851_10374715 Ga0068851_103747152 138
151 3300005842 Ga0068858_100007759 Ga0068858_1000077599 138
152 3300005842 Ga0068858_100024644 Ga0068858_1000246443 138
153 3300005843 Ga0068860_100046309 Ga0068860_1000463094 138
154 3300005843 Ga0068860_100430053 Ga0068860_1004300533 138
155 3300006237 Ga0097621_100042768 Ga0097621_1000427684 138
156 3300006358 Ga0068871_100012264 Ga0068871_1000122646 138
157 3300006871 Ga0075434_100999130 Ga0075434_1009991302 138
158 3300006881 Ga0068865_101329452 Ga0068865_1013294521 138
159 3300006931 Ga0097620_100145763 Ga0097620_1001457632 138
160 3300009098 Ga0105245_10067867 Ga0105245_100678674 138
161 3300009174 Ga0105241_10233341 Ga0105241_102333413 138
162 3300009177 Ga0105248_10046529 Ga0105248_100465295 138
163 3300009177 Ga0105248_10533064 Ga0105248_105330641 138
164 3300009551 Ga0105238_10290805 Ga0105238_102908052 138
165 3300009553 Ga0105249_10722504 Ga0105249_107225042 138
166 3300010375 Ga0105239_10096982 Ga0105239_100969822 138
167 3300013102 Ga0157371_10525203 Ga0157371_105252031 138
168 3300013105 Ga0157369_10187861 Ga0157369_101878612 138
169 3300013296 Ga0157374_10055848 Ga0157374_100558481 138
170 3300013306 Ga0163162_10558721 Ga0163162_105587212 138
171 3300013307 Ga0157372_10097987 Ga0157372_100979872 138
172 3300013308 Ga0157375_10116452 Ga0157375_101164524 138
173 3300014745 Ga0157377_10001260 Ga0157377_100012605 138
174 3300014968 Ga0157379_10020789 Ga0157379_100207894 138
175 3300014968 Ga0157379_10040876 Ga0157379_100408764 138
176 3300014969 Ga0157376_10276889 Ga0157376_102768892 138
177 3300017792 Ga0163161_10005526 Ga0163161_100055265 138
178 3300025321 Ga0207656_10013567 Ga0207656_100135672 138
179 3300025321 Ga0207656_10249789 Ga0207656_102497892 138
180 3300025901 Ga0207688_10021565 Ga0207688_100215654 138
181 3300025903 Ga0207680_10332589 Ga0207680_103325892 138
182 3300025907 Ga0207645_10058373 Ga0207645_100583732 138
183 3300025911 Ga0207654_11438957 Ga0207654_114389571 138
184 3300025918 Ga0207662_10022083 Ga0207662_100220834 138
185 3300025918 Ga0207662_11017788 Ga0207662_110177881 138
186 3300025919 Ga0207657_10208414 Ga0207657_102084142 138
187 3300025920 Ga0207649_10034334 Ga0207649_100343342 138
188 3300025922 Ga0207646_10600374 Ga0207646_106003742 138
189 3300025923 Ga0207681_10004317 Ga0207681_100043175 138
190 3300025923 Ga0207681_11572073 Ga0207681_115720731 138
191 3300025924 Ga0207694_10202145 Ga0207694_102021452 138
192 3300025926 Ga0207659_10038033 Ga0207659_100380333 138
193 3300025927 Ga0207687_10064857 Ga0207687_100648574 138
194 3300025932 Ga0207690_10039233 Ga0207690_100392334 138
195 3300025933 Ga0207706_10001995 Ga0207706_100019952 138
196 3300025940 Ga0207691_10036442 Ga0207691_100364426 138
197 3300025941 Ga0207711_10009070 Ga0207711_100090703 138
198 3300025941 Ga0207711_10550158 Ga0207711_105501582 138
199 3300025942 Ga0207689_10000996 Ga0207689_100009962 138
200 3300025944 Ga0207661_10728739 Ga0207661_107287392 138
201 3300025945 Ga0207679_10569649 Ga0207679_105696492 138
202 3300025949 Ga0207667_10052553 Ga0207667_100525533 138
203 3300025972 Ga0207668_10104172 Ga0207668_101041723 138
204 3300025981 Ga0207640_10021812 Ga0207640_100218123 138
205 3300025986 Ga0207658_10025475 Ga0207658_100254752 138
206 3300026023 Ga0207677_10000853 Ga0207677_100008534 138
207 3300026035 Ga0207703_10009640 Ga0207703_100096402 138
208 3300026035 Ga0207703_10105983 Ga0207703_101059833 138
209 3300026041 Ga0207639_10012372 Ga0207639_100123724 138
210 3300026041 Ga0207639_10122024 Ga0207639_101220243 138
211 3300026067 Ga0207678_10052391 Ga0207678_100523914 138
212 3300026078 Ga0207702_10235550 Ga0207702_102355502 138
213 3300026089 Ga0207648_10692580 Ga0207648_106925802 138
214 3300026095 Ga0207676_10003408 Ga0207676_1000340810 138
215 3300026118 Ga0207675_100055575 Ga0207675_1000555752 138
216 3300026121 Ga0207683_10248280 Ga0207683_102482802 138
217 3300026142 Ga0207698_10029833 Ga0207698_100298335 138
218 3300026142 Ga0207698_10047442 Ga0207698_100474422 138
219 3300028381 Ga0268264_10011726 Ga0268264_100117262 138
220 3300028381 Ga0268264_10218105 Ga0268264_102181053 138
221 3300035084 Ga0373928_0058569 Ga0373928_0058569_468_902 138
222 3300035114 Ga0373939_0032447 Ga0373939_0032447_941_1375 138
223 3300035115 Ga0373941_0026364 Ga0373941_0026364_542_976 138
224 3300035121 Ga0373960_0203947 Ga0373960_0203947_197_631 138
225 3300035242 Ga0373962_0033626 Ga0373962_0033626_218_652 138
226 3300035691 Ga0373931_0147572 Ga0373931_0147572_916_1350 138
227 3300039437 Ga0436365_0772642 Ga0436365_0772642_980_1414 138
228 3300039450 Ga0436363_0187732 Ga0436363_0187732_955_1389 138
229 3300045051 Ga0451576_0093427 Ga0451576_0093427_208_642 138
230 3300045051 Ga0451576_0867349 Ga0451576_0867349_453_887 138
231 3300048904 Ga0496101_0018557 Ga0496101_0018557_18_452 138
232 3300048905 Ga0496102_0152982 Ga0496102_0152982_573_1007 138
233 3300048907 Ga0496104_0562939 Ga0496104_0562939_157_591 138
234 3300048908 Ga0496105_0120301 Ga0496105_0120301_1150_1584 138
235 3300048909 Ga0496106_0021541 Ga0496106_0021541_3750_4184 138
236 3300048910 Ga0496107_0017834 Ga0496107_0017834_2128_2562 138
237 3300048911 Ga0496108_0386257 Ga0496108_0386257_248_682 138
238 3300048912 Ga0496109_0065871 Ga0496109_0065871_513_947 138
239 3300048912 Ga0496109_1664240 Ga0496109_1664240_32_466 138
240 3300048913 Ga0496110_0092451 Ga0496110_0092451_1099_1533 138
241 3300048914 Ga0496111_0039985 Ga0496111_0039985_1054_1488 138
242 3300048915 Ga0496112_0431452 Ga0496112_0431452_321_755 138
243 3300048916 Ga0496113_0892249 Ga0496113_0892249_256_690 138
244 3300048917 Ga0496114_0024703 Ga0496114_0024703_2444_2878 138
245 3300048918 Ga0496115_0046876 Ga0496115_0046876_1805_2239 138
246 3300050512 nmdc:mga0n895_523544_c1 nmdc:mga0n895_523544_c1_480_914 138
247 3300005293 Ga0065715_10187031 Ga0065715_101870312 139
248 3300005406 Ga0070703_10000289 Ga0070703_100002894 139
249 3300005406 Ga0070703_10203181 Ga0070703_102031811 139
250 3300005440 Ga0070705_100000034 Ga0070705_10000003411 139
251 3300005444 Ga0070694_100128891 Ga0070694_1001288912 139
252 3300005444 Ga0070694_100505200 Ga0070694_1005052001 139
253 3300005445 Ga0070708_100021520 Ga0070708_1000215203 139
254 3300005467 Ga0070706_100000020 Ga0070706_10000002082 139
255 3300005467 Ga0070706_100694151 Ga0070706_1006941512 139
256 3300005471 Ga0070698_100412736 Ga0070698_1004127362 139
257 3300005518 Ga0070699_100000083 Ga0070699_10000008326 139
258 3300005536 Ga0070697_100580118 Ga0070697_1005801182 139
259 3300005545 Ga0070695_100019523 Ga0070695_1000195232 139
260 3300005546 Ga0070696_100000120 Ga0070696_1000001209 139
261 3300005546 Ga0070696_100011234 Ga0070696_1000112345 139
262 3300005547 Ga0070693_100001489 Ga0070693_1000014893 139
263 3300005719 Ga0068861_100031007 Ga0068861_1000310072 139
264 3300005937 Ga0081455_10273343 Ga0081455_102733431 139
265 3300006048 Ga0075363_100027009 Ga0075363_1000270092 139
266 3300006844 Ga0075428_100121770 Ga0075428_1001217702 139
267 3300006846 Ga0075430_100045632 Ga0075430_1000456327 139
268 3300006847 Ga0075431_100097979 Ga0075431_1000979792 139
269 3300006852 Ga0075433_10264583 Ga0075433_102645832 139
270 3300006852 Ga0075433_11440657 Ga0075433_114406572 139
271 3300006871 Ga0075434_100072407 Ga0075434_1000724072 139
272 3300006880 Ga0075429_100008641 Ga0075429_1000086419 139
273 3300006914 Ga0075436_100155410 Ga0075436_1001554102 139
274 3300007076 Ga0075435_100594608 Ga0075435_1005946082 139
275 3300009147 Ga0114129_10036594 Ga0114129_100365949 139
276 3300009147 Ga0114129_10535653 Ga0114129_105356532 139
277 3300009148 Ga0105243_11147194 Ga0105243_111471941 139
278 3300009553 Ga0105249_10152484 Ga0105249_101524842 139
279 3300025885 Ga0207653_10000339 Ga0207653_100003395 139
280 3300025910 Ga0207684_10000215 Ga0207684_1000021582 139
281 3300025910 Ga0207684_10921153 Ga0207684_109211531 139
282 3300025939 Ga0207665_10160126 Ga0207665_101601263 139
283 3300025961 Ga0207712_10090175 Ga0207712_100901752 139
284 3300026118 Ga0207675_100036403 Ga0207675_1000364033 139
285 3300044673 Ga0453683_0234265 Ga0453683_0234265_495_974 139
286 3300046531 Ga0495665_0404454 Ga0495665_0404454_143_562 139
287 3300049570 Ga0501033_0548204 Ga0501033_0548204_37_477 139
288 3300049576 Ga0501040_0049789 Ga0501040_0049789_83_523 139
289 3300049591 Ga0501075_0082967 Ga0501075_0082967_33_473 139
290 3300049741 Ga0501079_0084474 Ga0501079_0084474_658_1098 139
291 3300049743 Ga0501081_0396478 Ga0501081_0396478_30_470 139
292 3300049824 Ga0501045_0486093 Ga0501045_0486093_51_491 139
293 3300050492 nmdc:mga0yw44_155009_c1 nmdc:mga0yw44_155009_c1_200_643 139
294 3300050507 nmdc:mga05p37_404_c1 nmdc:mga05p37_404_c1_41115_41594 139
295 3300050507 nmdc:mga05p37_42208_c1 nmdc:mga05p37_42208_c1_209_646 139
296 3300050508 nmdc:mga09592_314777_c1 nmdc:mga09592_314777_c1_248_685 139
297 3300050510 nmdc:mga06r32_56858_c1 nmdc:mga06r32_56858_c1_2625_3062 139
298 3300050515 nmdc:mga0a205_11923_c1 nmdc:mga0a205_11923_c1_2414_2875 139
299 3300005406 Ga0070703_10574107 Ga0070703_105741071 140
300 3300005440 Ga0070705_100007970 Ga0070705_1000079703 140
301 3300005471 Ga0070698_101448863 Ga0070698_1014488631 140
302 3300005844 Ga0068862_101065943 Ga0068862_1010659431 140
303 3300006847 Ga0075431_100032223 Ga0075431_1000322232 140
304 3300006847 Ga0075431_101060407 Ga0075431_1010604071 140
305 3300009094 Ga0111539_11025236 Ga0111539_110252362 140
306 3300009147 Ga0114129_10133215 Ga0114129_101332151 140
307 3300009147 Ga0114129_11657059 Ga0114129_116570591 140
308 3300025923 Ga0207681_10197969 Ga0207681_101979691 140
309 3300028380 Ga0268265_10738886 Ga0268265_107388861 140
310 3300031250 Ga0265331_10263892 Ga0265331_102638921 140
311 3300031548 Ga0307408_100021342 Ga0307408_1000213425 140
312 3300031911 Ga0307412_11489219 Ga0307412_114892191 140
313 3300035725 Ga0373947_0368404 Ga0373947_0368404_254_697 140
314 3300036401 Ga0373937_0809081 Ga0373937_0809081_133_576 140
315 3300039437 Ga0436365_0982517 Ga0436365_0982517_252_698 140
316 3300046472 Ga0495580_0119473 Ga0495580_0119473_964_1407 140
317 3300047318 Ga0495636_0507265 Ga0495636_0507265_43_486 140
318 3300049575 Ga0501039_0761733 Ga0501039_0761733_251_691 140
319 3300050507 nmdc:mga05p37_1884308_c1 nmdc:mga05p37_1884308_c1_50_490 140
320 3300050507 nmdc:mga05p37_474149_c1 nmdc:mga05p37_474149_c1_825_1268 140
321 3300050508 nmdc:mga09592_360798_c1 nmdc:mga09592_360798_c1_516_959 140
322 3300050514 nmdc:mga08x19_222529_c1 nmdc:mga08x19_222529_c1_527_970 140
323 3300050515 nmdc:mga0a205_185238_c1 nmdc:mga0a205_185238_c1_889_1332 140
324 3300005295 Ga0065707_10272951 Ga0065707_102729511 141
325 3300005295 Ga0065707_10548314 Ga0065707_105483141 141
326 3300005330 Ga0070690_100161526 Ga0070690_1001615262 141
327 3300005334 Ga0068869_100155924 Ga0068869_1001559243 141
328 3300005338 Ga0068868_102403885 Ga0068868_1024038851 141
329 3300005345 Ga0070692_10157708 Ga0070692_101577082 141
330 3300005347 Ga0070668_100431304 Ga0070668_1004313042 141
331 3300005355 Ga0070671_100691472 Ga0070671_1006914721 141
332 3300005356 Ga0070674_100165213 Ga0070674_1001652133 141
333 3300005440 Ga0070705_100457912 Ga0070705_1004579122 141
334 3300005440 Ga0070705_100987271 Ga0070705_1009872711 141
335 3300005444 Ga0070694_100177232 Ga0070694_1001772322 141
336 3300005445 Ga0070708_100176313 Ga0070708_1001763132 141
337 3300005445 Ga0070708_100339417 Ga0070708_1003394172 141
338 3300005445 Ga0070708_100882185 Ga0070708_1008821851 141
339 3300005445 Ga0070708_101102493 Ga0070708_1011024931 141
340 3300005456 Ga0070678_101639771 Ga0070678_1016397711 141
341 3300005459 Ga0068867_100719161 Ga0068867_1007191612 141
342 3300005467 Ga0070706_100023493 Ga0070706_1000234932 141
343 3300005467 Ga0070706_100083205 Ga0070706_1000832051 141
344 3300005467 Ga0070706_100279069 Ga0070706_1002790691 141
345 3300005468 Ga0070707_100198402 Ga0070707_1001984022 141
346 3300005468 Ga0070707_100579577 Ga0070707_1005795771 141
347 3300005471 Ga0070698_100035528 Ga0070698_1000355287 141
348 3300005471 Ga0070698_100040630 Ga0070698_1000406305 141
349 3300005471 Ga0070698_101140979 Ga0070698_1011409792 141
350 3300005471 Ga0070698_101672469 Ga0070698_1016724691 141
351 3300005518 Ga0070699_100023392 Ga0070699_1000233928 141
352 3300005518 Ga0070699_100025869 Ga0070699_1000258695 141
353 3300005536 Ga0070697_100004869 Ga0070697_10000486911 141
354 3300005536 Ga0070697_100082213 Ga0070697_1000822132 141
355 3300005543 Ga0070672_100063683 Ga0070672_1000636832 141
356 3300005544 Ga0070686_100092389 Ga0070686_1000923891 141
357 3300005544 Ga0070686_100530051 Ga0070686_1005300511 141
358 3300005578 Ga0068854_100713125 Ga0068854_1007131252 141
359 3300005615 Ga0070702_100709724 Ga0070702_1007097241 141
360 3300005616 Ga0068852_102014144 Ga0068852_1020141441 141
361 3300005617 Ga0068859_100230541 Ga0068859_1002305411 141
362 3300005617 Ga0068859_100366813 Ga0068859_1003668132 141
363 3300005617 Ga0068859_100374627 Ga0068859_1003746272 141
364 3300005618 Ga0068864_100006922 Ga0068864_1000069225 141
365 3300005618 Ga0068864_100776178 Ga0068864_1007761782 141
366 3300005718 Ga0068866_10022882 Ga0068866_100228826 141
367 3300005719 Ga0068861_100017797 Ga0068861_1000177976 141
368 3300005719 Ga0068861_100451875 Ga0068861_1004518752 141
369 3300005841 Ga0068863_100192153 Ga0068863_1001921532 141
370 3300005842 Ga0068858_100158605 Ga0068858_1001586052 141
371 3300005842 Ga0068858_100275074 Ga0068858_1002750742 141
372 3300005843 Ga0068860_100043664 Ga0068860_1000436642 141
373 3300005843 Ga0068860_100623001 Ga0068860_1006230013 141
374 3300005843 Ga0068860_101908884 Ga0068860_1019088842 141
375 3300005844 Ga0068862_100012492 Ga0068862_1000124923 141
376 3300005844 Ga0068862_100065547 Ga0068862_1000655471 141
377 3300006186 Ga0075369_10146879 Ga0075369_101468791 141
378 3300006195 Ga0075366_10002856 Ga0075366_100028567 141
379 3300006195 Ga0075366_10090939 Ga0075366_100909392 141
380 3300006195 Ga0075366_10340332 Ga0075366_103403322 141
381 3300006353 Ga0075370_10020280 Ga0075370_100202804 141
382 3300006881 Ga0068865_100234054 Ga0068865_1002340541 141
383 3300006914 Ga0075436_100106662 Ga0075436_1001066623 141
384 3300006931 Ga0097620_100230535 Ga0097620_1002305351 141
385 3300006931 Ga0097620_100366796 Ga0097620_1003667962 141
386 3300006931 Ga0097620_100374679 Ga0097620_1003746792 141
387 3300009098 Ga0105245_10081563 Ga0105245_100815632 141
388 3300009101 Ga0105247_10336857 Ga0105247_103368571 141
389 3300009174 Ga0105241_10715456 Ga0105241_107154562 141
390 3300009176 Ga0105242_10390964 Ga0105242_103909643 141
391 3300009551 Ga0105238_10332826 Ga0105238_103328262 141
392 3300009553 Ga0105249_10013045 Ga0105249_100130458 141
393 3300009553 Ga0105249_11018473 Ga0105249_110184732 141
394 3300011119 Ga0105246_10167350 Ga0105246_101673501 141
395 3300013306 Ga0163162_10162205 Ga0163162_101622053 141
396 3300013306 Ga0163162_10567616 Ga0163162_105676162 141
397 3300014326 Ga0157380_10098910 Ga0157380_100989104 141
398 3300014326 Ga0157380_10976274 Ga0157380_109762741 141
399 3300014968 Ga0157379_10244992 Ga0157379_102449922 141
400 3300014969 Ga0157376_10845186 Ga0157376_108451861 141
401 3300025885 Ga0207653_10184291 Ga0207653_101842911 141
402 3300025899 Ga0207642_10039888 Ga0207642_100398884 141
403 3300025910 Ga0207684_10018374 Ga0207684_100183747 141
404 3300025910 Ga0207684_10038127 Ga0207684_100381274 141
405 3300025910 Ga0207684_10039192 Ga0207684_100391922 141
406 3300025910 Ga0207684_10101280 Ga0207684_101012802 141
407 3300025910 Ga0207684_10114491 Ga0207684_101144911 141
408 3300025922 Ga0207646_10045761 Ga0207646_100457613 141
409 3300025922 Ga0207646_10075551 Ga0207646_100755511 141
410 3300025922 Ga0207646_10796117 Ga0207646_107961172 141
411 3300025924 Ga0207694_10226820 Ga0207694_102268202 141
412 3300025927 Ga0207687_10292272 Ga0207687_102922722 141
413 3300025931 Ga0207644_10021539 Ga0207644_100215392 141
414 3300025937 Ga0207669_10992781 Ga0207669_109927812 141
415 3300025938 Ga0207704_10094593 Ga0207704_100945931 141
416 3300025940 Ga0207691_10074448 Ga0207691_100744485 141
417 3300025941 Ga0207711_10639370 Ga0207711_106393701 141
418 3300025942 Ga0207689_10499801 Ga0207689_104998013 141
419 3300025961 Ga0207712_10140109 Ga0207712_101401093 141
420 3300025961 Ga0207712_10270204 Ga0207712_102702043 141
421 3300025961 Ga0207712_10552364 Ga0207712_105523642 141
422 3300025972 Ga0207668_10616914 Ga0207668_106169142 141
423 3300025986 Ga0207658_10311547 Ga0207658_103115472 141
424 3300025986 Ga0207658_10667447 Ga0207658_106674471 141
425 3300025986 Ga0207658_11301755 Ga0207658_113017552 141
426 3300026035 Ga0207703_10089109 Ga0207703_100891094 141
427 3300026035 Ga0207703_10304519 Ga0207703_103045191 141
428 3300026035 Ga0207703_10465966 Ga0207703_104659661 141
429 3300026035 Ga0207703_10708972 Ga0207703_107089721 141
430 3300026067 Ga0207678_10401726 Ga0207678_104017262 141
431 3300026075 Ga0207708_10508749 Ga0207708_105087492 141
432 3300026088 Ga0207641_10255488 Ga0207641_102554881 141
433 3300026088 Ga0207641_11626150 Ga0207641_116261501 141
434 3300026089 Ga0207648_10003050 Ga0207648_100030506 141
435 3300026095 Ga0207676_10105115 Ga0207676_101051152 141
436 3300026095 Ga0207676_10715247 Ga0207676_107152472 141
437 3300026095 Ga0207676_11451356 Ga0207676_114513561 141
438 3300026116 Ga0207674_11588714 Ga0207674_115887142 141
439 3300026118 Ga0207675_100008890 Ga0207675_1000088906 141
440 3300026118 Ga0207675_100283573 Ga0207675_1002835732 141
441 3300026118 Ga0207675_100388738 Ga0207675_1003887382 141
442 3300026121 Ga0207683_11591320 Ga0207683_115913201 141
443 3300026142 Ga0207698_10462495 Ga0207698_104624952 141
444 3300028380 Ga0268265_10163264 Ga0268265_101632641 141
445 3300028380 Ga0268265_10698759 Ga0268265_106987592 141
446 3300028381 Ga0268264_10751550 Ga0268264_107515502 141
447 3300028381 Ga0268264_11042430 Ga0268264_110424301 141
448 3300028381 Ga0268264_11254368 Ga0268264_112543682 141
449 3300028786 Ga0307517_10288522 Ga0307517_102885222 141
450 3300028794 Ga0307515_10814799 Ga0307515_108147992 141
451 3300031235 Ga0265330_10137643 Ga0265330_101376433 141
452 3300031238 Ga0265332_10000724 Ga0265332_1000072420 141
453 3300031239 Ga0265328_10140993 Ga0265328_101409931 141
454 3300031242 Ga0265329_10030085 Ga0265329_100300853 141
455 3300031249 Ga0265339_10096783 Ga0265339_100967833 141
456 3300031250 Ga0265331_10000579 Ga0265331_1000057911 141
457 3300031251 Ga0265327_10031469 Ga0265327_100314693 141
458 3300031344 Ga0265316_10179750 Ga0265316_101797503 141
459 3300031507 Ga0307509_10497035 Ga0307509_104970351 141
460 3300031595 Ga0265313_10227543 Ga0265313_102275432 141
461 3300031711 Ga0265314_10009471 Ga0265314_100094719 141
462 3300031712 Ga0265342_10059999 Ga0265342_100599993 141
463 3300033180 Ga0307510_10397439 Ga0307510_103974392 141
464 3300035116 Ga0373945_0142184 Ga0373945_0142184_171_611 141
465 3300035172 Ga0373955_0163856 Ga0373955_0163856_776_1216 141
466 3300035695 Ga0373927_0579634 Ga0373927_0579634_61_501 141
467 3300036401 Ga0373937_0058512 Ga0373937_0058512_180_620 141
468 3300036401 Ga0373937_0862837 Ga0373937_0862837_89_529 141
469 3300039438 Ga0436360_0193744 Ga0436360_0193744_40_483 141
470 3300039438 Ga0436360_0606863 Ga0436360_0606863_250_690 141
471 3300042876 Ga0451577_0034258 Ga0451577_0034258_196_639 141
472 3300044673 Ga0453683_0006140 Ga0453683_0006140_3261_3704 141
473 3300046616 Ga0495668_0053582 Ga0495668_0053582_308_751 141
474 3300046683 Ga0495658_0838887 Ga0495658_0838887_37_477 141
475 3300049572 Ga0501036_0804463 Ga0501036_0804463_205_654 141
476 3300049576 Ga0501040_0350364 Ga0501040_0350364_51_491 141
477 3300049583 Ga0501067_0072746 Ga0501067_0072746_574_1011 141
478 3300049584 Ga0501068_0401232 Ga0501068_0401232_116_553 141
479 3300049588 Ga0501072_0266706 Ga0501072_0266706_40_480 141
480 3300049592 Ga0501076_0166490 Ga0501076_0166490_1202_1642 141
481 3300050493 nmdc:mga0k408_3029_c1 nmdc:mga0k408_3029_c1_7268_7711 141
482 3300050493 nmdc:mga0k408_930598_c1 nmdc:mga0k408_930598_c1_28_471 141
483 3300050494 nmdc:mga06z11_153135_c1 nmdc:mga06z11_153135_c1_418_861 141
484 3300050496 nmdc:mga07m45_10065_c1 nmdc:mga07m45_10065_c1_692_1135 141
485 3300050510 nmdc:mga06r32_380617_c1 nmdc:mga06r32_380617_c1_555_1004 141
486 3300050512 nmdc:mga0n895_212330_c1 nmdc:mga0n895_212330_c1_1159_1605 141
487 3300050516 nmdc:mga0sz30_208236_c1 nmdc:mga0sz30_208236_c1_366_809 141
488 3300053085 Ga0495619_0022063 Ga0495619_0022063_2624_3064 141
489 3300005293 Ga0065715_10759883 Ga0065715_107598831 142
490 3300005328 Ga0070676_10448345 Ga0070676_104483451 142
491 3300005329 Ga0070683_100137897 Ga0070683_1001378973 142
492 3300005330 Ga0070690_100374271 Ga0070690_1003742712 142
493 3300005334 Ga0068869_100131693 Ga0068869_1001316933 142
494 3300005335 Ga0070666_10050259 Ga0070666_100502593 142
495 3300005336 Ga0070680_100027015 Ga0070680_1000270155 142
496 3300005337 Ga0070682_100045495 Ga0070682_1000454953 142
497 3300005338 Ga0068868_100029784 Ga0068868_1000297844 142
498 3300005339 Ga0070660_100091461 Ga0070660_1000914612 142
499 3300005344 Ga0070661_100020815 Ga0070661_1000208155 142
500 3300005345 Ga0070692_10004498 Ga0070692_100044982 142
501 3300005347 Ga0070668_100331197 Ga0070668_1003311971 142
502 3300005355 Ga0070671_100054578 Ga0070671_1000545783 142
503 3300005356 Ga0070674_100033971 Ga0070674_1000339712 142
504 3300005367 Ga0070667_100089778 Ga0070667_1000897783 142
505 3300005406 Ga0070703_10326441 Ga0070703_103264411 142
506 3300005435 Ga0070714_100044779 Ga0070714_1000447791 142
507 3300005437 Ga0070710_10339096 Ga0070710_103390962 142
508 3300005440 Ga0070705_100046732 Ga0070705_1000467321 142
509 3300005444 Ga0070694_100009137 Ga0070694_1000091376 142
510 3300005445 Ga0070708_100142506 Ga0070708_1001425063 142
511 3300005455 Ga0070663_100094251 Ga0070663_1000942513 142
512 3300005456 Ga0070678_100002700 Ga0070678_10000270010 142
513 3300005457 Ga0070662_100028373 Ga0070662_1000283732 142
514 3300005457 Ga0070662_100081754 Ga0070662_1000817542 142
515 3300005467 Ga0070706_100011522 Ga0070706_1000115228 142
516 3300005471 Ga0070698_100115433 Ga0070698_1001154333 142
517 3300005518 Ga0070699_100012081 Ga0070699_1000120815 142
518 3300005535 Ga0070684_100161080 Ga0070684_1001610803 142
519 3300005536 Ga0070697_101783810 Ga0070697_1017838101 142
520 3300005539 Ga0068853_100502716 Ga0068853_1005027162 142
521 3300005545 Ga0070695_100473895 Ga0070695_1004738952 142
522 3300005546 Ga0070696_100139130 Ga0070696_1001391303 142
523 3300005546 Ga0070696_100368531 Ga0070696_1003685311 142
524 3300005547 Ga0070693_100009597 Ga0070693_1000095972 142
525 3300005547 Ga0070693_100447890 Ga0070693_1004478902 142
526 3300005578 Ga0068854_100012768 Ga0068854_1000127685 142
527 3300005578 Ga0068854_100019920 Ga0068854_1000199205 142
528 3300005614 Ga0068856_101013175 Ga0068856_1010131751 142
529 3300005615 Ga0070702_100025104 Ga0070702_1000251043 142
530 3300005615 Ga0070702_100355852 Ga0070702_1003558522 142
531 3300005616 Ga0068852_100030701 Ga0068852_1000307015 142
532 3300005718 Ga0068866_10035481 Ga0068866_100354813 142
533 3300005843 Ga0068860_100056218 Ga0068860_1000562184 142
534 3300006173 Ga0070716_100151651 Ga0070716_1001516513 142
535 3300006175 Ga0070712_100880235 Ga0070712_1008802352 142
536 3300006237 Ga0097621_100421935 Ga0097621_1004219352 142
537 3300006358 Ga0068871_100058306 Ga0068871_1000583064 142
538 3300006852 Ga0075433_11021222 Ga0075433_110212222 142
539 3300006881 Ga0068865_100252036 Ga0068865_1002520362 142
540 3300009098 Ga0105245_10065799 Ga0105245_100657993 142
541 3300009098 Ga0105245_10071732 Ga0105245_100717324 142
542 3300009174 Ga0105241_10157530 Ga0105241_101575302 142
543 3300009174 Ga0105241_10289817 Ga0105241_102898172 142
544 3300009176 Ga0105242_10059050 Ga0105242_100590504 142
545 3300009177 Ga0105248_10145566 Ga0105248_101455662 142
546 3300009177 Ga0105248_10460592 Ga0105248_104605922 142
547 3300009545 Ga0105237_10068951 Ga0105237_100689514 142
548 3300009545 Ga0105237_10529883 Ga0105237_105298832 142
549 3300009551 Ga0105238_10034509 Ga0105238_100345092 142
550 3300010375 Ga0105239_10259712 Ga0105239_102597122 142
551 3300013100 Ga0157373_10404552 Ga0157373_104045522 142
552 3300013104 Ga0157370_10030127 Ga0157370_100301272 142
553 3300013297 Ga0157378_10046168 Ga0157378_100461684 142
554 3300013306 Ga0163162_10079862 Ga0163162_100798623 142
555 3300013307 Ga0157372_10263110 Ga0157372_102631101 142
556 3300014969 Ga0157376_10063073 Ga0157376_100630731 142
557 3300025321 Ga0207656_10170656 Ga0207656_101706561 142
558 3300025885 Ga0207653_10152877 Ga0207653_101528771 142
559 3300025898 Ga0207692_10245838 Ga0207692_102458382 142
560 3300025899 Ga0207642_10007211 Ga0207642_100072115 142
561 3300025903 Ga0207680_10308640 Ga0207680_103086402 142
562 3300025903 Ga0207680_10316611 Ga0207680_103166111 142
563 3300025910 Ga0207684_10630297 Ga0207684_106302971 142
564 3300025911 Ga0207654_10044683 Ga0207654_100446833 142
565 3300025915 Ga0207693_10020276 Ga0207693_100202765 142
566 3300025916 Ga0207663_10478210 Ga0207663_104782101 142
567 3300025917 Ga0207660_10114009 Ga0207660_101140092 142
568 3300025919 Ga0207657_10003754 Ga0207657_1000375411 142
569 3300025920 Ga0207649_10214867 Ga0207649_102148673 142
570 3300025922 Ga0207646_10094649 Ga0207646_100946491 142
571 3300025927 Ga0207687_10022709 Ga0207687_100227095 142
572 3300025928 Ga0207700_10077519 Ga0207700_100775193 142
573 3300025931 Ga0207644_10082443 Ga0207644_100824432 142
574 3300025933 Ga0207706_10068569 Ga0207706_100685692 142
575 3300025933 Ga0207706_10160293 Ga0207706_101602932 142
576 3300025934 Ga0207686_10000309 Ga0207686_1000030931 142
577 3300025937 Ga0207669_10030394 Ga0207669_100303944 142
578 3300025938 Ga0207704_10507253 Ga0207704_105072532 142
579 3300025939 Ga0207665_10015247 Ga0207665_100152475 142
580 3300025939 Ga0207665_10031433 Ga0207665_100314334 142
581 3300025941 Ga0207711_10306798 Ga0207711_103067982 142
582 3300025942 Ga0207689_10022153 Ga0207689_100221534 142
583 3300025942 Ga0207689_10145581 Ga0207689_101455813 142
584 3300025944 Ga0207661_10025375 Ga0207661_100253754 142
585 3300025945 Ga0207679_10175790 Ga0207679_101757902 142
586 3300025949 Ga0207667_11842851 Ga0207667_118428511 142
587 3300025981 Ga0207640_10059072 Ga0207640_100590723 142
588 3300025981 Ga0207640_10209591 Ga0207640_102095911 142
589 3300025986 Ga0207658_10144705 Ga0207658_101447052 142
590 3300026023 Ga0207677_10033258 Ga0207677_100332582 142
591 3300026067 Ga0207678_10072541 Ga0207678_100725412 142
592 3300026078 Ga0207702_11131591 Ga0207702_111315911 142
593 3300026089 Ga0207648_10059765 Ga0207648_100597652 142
594 3300026116 Ga0207674_10009820 Ga0207674_100098202 142
595 3300026121 Ga0207683_10011693 Ga0207683_100116934 142
596 3300026142 Ga0207698_10112725 Ga0207698_101127253 142
597 3300028381 Ga0268264_10031276 Ga0268264_100312762 142
598 3300035083 Ga0373926_0125457 Ga0373926_0125457_139_585 142
599 3300035118 Ga0373954_0011052 Ga0373954_0011052_2503_2949 142
600 3300035170 Ga0373943_0099231 Ga0373943_0099231_1057_1503 142
601 3300035171 Ga0373946_0259789 Ga0373946_0259789_230_676 142
602 3300035172 Ga0373955_0065131 Ga0373955_0065131_762_1208 142
603 3300035725 Ga0373947_0013481 Ga0373947_0013481_1340_1786 142
604 3300036401 Ga0373937_0637860 Ga0373937_0637860_21_467 142
605 3300037068 Ga0373925_0026702 Ga0373925_0026702_1327_1773 142
606 3300039438 Ga0436360_0083715 Ga0436360_0083715_1719_2156 142
607 3300042005 Ga0439448_0072660 Ga0439448_0072660_53_499 142
608 3300046459 Ga0495629_0032786 Ga0495629_0032786_2731_3177 142
609 3300046462 Ga0495651_0380857 Ga0495651_0380857_465_911 142
610 3300046463 Ga0495653_0761376 Ga0495653_0761376_66_512 142
611 3300046472 Ga0495580_0042011 Ga0495580_0042011_1034_1480 142
612 3300046473 Ga0495582_0059191 Ga0495582_0059191_1650_2096 142
613 3300046475 Ga0495639_0184572 Ga0495639_0184572_185_631 142
614 3300046476 Ga0495662_0005009 Ga0495662_0005009_5524_5970 142
615 3300046514 Ga0495618_0418964 Ga0495618_0418964_149_595 142
616 3300046516 Ga0495628_0184769 Ga0495628_0184769_725_1171 142
617 3300046517 Ga0495630_0157418 Ga0495630_0157418_351_797 142
618 3300046531 Ga0495665_0035617 Ga0495665_0035617_945_1391 142
619 3300046535 Ga0495586_0154120 Ga0495586_0154120_506_952 142
620 3300046543 Ga0495645_0016994 Ga0495645_0016994_1888_2334 142
621 3300046642 Ga0495634_0161849 Ga0495634_0161849_389_835 142
622 3300046663 Ga0495635_0031580 Ga0495635_0031580_1158_1604 142
623 3300046681 Ga0495647_0005451 Ga0495647_0005451_980_1426 142
624 3300046683 Ga0495658_0043035 Ga0495658_0043035_1506_1952 142
625 3300046809 Ga0495600_0036077 Ga0495600_0036077_1741_2187 142
626 3300047315 Ga0495581_0000877 Ga0495581_0000877_5233_5679 142
627 3300047322 Ga0495680_0046751 Ga0495680_0046751_1825_2271 142
628 3300047471 Ga0495684_0088468 Ga0495684_0088468_676_1122 142
629 3300047673 Ga0495593_0081830 Ga0495593_0081830_772_1218 142
630 3300048089 Ga0495614_0100924 Ga0495614_0100924_142_588 142
631 3300048905 Ga0496102_0083058 Ga0496102_0083058_59_505 142
632 3300048906 Ga0496103_0931315 Ga0496103_0931315_16_462 142
633 3300049577 Ga0501041_0468026 Ga0501041_0468026_311_760 142
634 3300049591 Ga0501075_0551404 Ga0501075_0551404_398_844 142
635 3300050513 nmdc:mga0rr50_126638_c1 nmdc:mga0rr50_126638_c1_517_966 142
636 3300053077 Ga0495601_0180580 Ga0495601_0180580_68_514 142
637 3300053085 Ga0495619_0194382 Ga0495619_0194382_463_909 142
638 3300060353 Ga0501082_0240424 Ga0501082_0240424_36_482 142
639 3300005330 Ga0070690_100003532 Ga0070690_1000035325 143
640 3300005331 Ga0070670_100078873 Ga0070670_1000788732 143
641 3300005334 Ga0068869_100544173 Ga0068869_1005441731 143
642 3300005335 Ga0070666_10025918 Ga0070666_100259184 143
643 3300005336 Ga0070680_100590892 Ga0070680_1005908921 143
644 3300005338 Ga0068868_100136971 Ga0068868_1001369712 143
645 3300005340 Ga0070689_100003591 Ga0070689_1000035917 143
646 3300005355 Ga0070671_100019330 Ga0070671_1000193302 143
647 3300005364 Ga0070673_100000900 Ga0070673_10000090013 143
648 3300005365 Ga0070688_100000350 Ga0070688_10000035017 143
649 3300005436 Ga0070713_100034347 Ga0070713_1000343473 143
650 3300005437 Ga0070710_10001633 Ga0070710_100016332 143
651 3300005437 Ga0070710_11458157 Ga0070710_114581571 143
652 3300005439 Ga0070711_100707735 Ga0070711_1007077351 143
653 3300005445 Ga0070708_100704218 Ga0070708_1007042181 143
654 3300005445 Ga0070708_100750865 Ga0070708_1007508652 143
655 3300005445 Ga0070708_100770521 Ga0070708_1007705212 143
656 3300005455 Ga0070663_100289110 Ga0070663_1002891102 143
657 3300005458 Ga0070681_10006305 Ga0070681_100063058 143
658 3300005466 Ga0070685_10001662 Ga0070685_100016622 143
659 3300005467 Ga0070706_100198448 Ga0070706_1001984482 143
660 3300005468 Ga0070707_100021881 Ga0070707_1000218813 143
661 3300005468 Ga0070707_100110320 Ga0070707_1001103203 143
662 3300005518 Ga0070699_100125703 Ga0070699_1001257032 143
663 3300005518 Ga0070699_100146920 Ga0070699_1001469202 143
664 3300005530 Ga0070679_100035778 Ga0070679_1000357781 143
665 3300005535 Ga0070684_101692507 Ga0070684_1016925071 143
666 3300005539 Ga0068853_100424828 Ga0068853_1004248281 143
667 3300005543 Ga0070672_100216948 Ga0070672_1002169482 143
668 3300005544 Ga0070686_100026376 Ga0070686_1000263762 143
669 3300005564 Ga0070664_100724119 Ga0070664_1007241191 143
670 3300005577 Ga0068857_100215963 Ga0068857_1002159632 143
671 3300005578 Ga0068854_102128963 Ga0068854_1021289631 143
672 3300005614 Ga0068856_100043666 Ga0068856_1000436664 143
673 3300005614 Ga0068856_100066951 Ga0068856_1000669513 143
674 3300005614 Ga0068856_101648155 Ga0068856_1016481551 143
675 3300005617 Ga0068859_100003361 Ga0068859_1000033615 143
676 3300005618 Ga0068864_100001097 Ga0068864_1000010978 143
677 3300005840 Ga0068870_10142783 Ga0068870_101427833 143
678 3300005841 Ga0068863_100033322 Ga0068863_1000333223 143
679 3300005842 Ga0068858_100003252 Ga0068858_1000032524 143
680 3300005985 Ga0081539_10031253 Ga0081539_100312534 143
681 3300006028 Ga0070717_10177798 Ga0070717_101777982 143
682 3300006028 Ga0070717_11457696 Ga0070717_114576961 143
683 3300006173 Ga0070716_100078915 Ga0070716_1000789152 143
684 3300006237 Ga0097621_100026459 Ga0097621_1000264594 143
685 3300006852 Ga0075433_10230781 Ga0075433_102307812 143
686 3300006871 Ga0075434_100211414 Ga0075434_1002114142 143
687 3300006914 Ga0075436_100104552 Ga0075436_1001045523 143
688 3300006931 Ga0097620_100003360 Ga0097620_1000033605 143
689 3300009098 Ga0105245_10030436 Ga0105245_100304364 143
690 3300009177 Ga0105248_10023280 Ga0105248_100232804 143
691 3300011119 Ga0105246_10795127 Ga0105246_107951271 143
692 3300013100 Ga0157373_10099647 Ga0157373_100996472 143
693 3300013104 Ga0157370_10054530 Ga0157370_100545304 143
694 3300013296 Ga0157374_10000720 Ga0157374_1000072019 143
695 3300013297 Ga0157378_10050114 Ga0157378_100501144 143
696 3300013307 Ga0157372_10278912 Ga0157372_102789122 143
697 3300013308 Ga0157375_10005228 Ga0157375_100052283 143
698 3300014745 Ga0157377_10040974 Ga0157377_100409742 143
699 3300014968 Ga0157379_10012192 Ga0157379_100121924 143
700 3300014968 Ga0157379_10083915 Ga0157379_100839153 143
701 3300014969 Ga0157376_10032686 Ga0157376_100326862 143
702 3300017792 Ga0163161_10613103 Ga0163161_106131031 143
703 3300025898 Ga0207692_10495984 Ga0207692_104959841 143
704 3300025903 Ga0207680_10000776 Ga0207680_100007764 143
705 3300025905 Ga0207685_10076575 Ga0207685_100765752 143
706 3300025908 Ga0207643_10065920 Ga0207643_100659203 143
707 3300025910 Ga0207684_10235438 Ga0207684_102354382 143
708 3300025912 Ga0207707_10052439 Ga0207707_100524394 143
709 3300025915 Ga0207693_10000485 Ga0207693_1000048537 143
710 3300025916 Ga0207663_10219095 Ga0207663_102190951 143
711 3300025917 Ga0207660_10506949 Ga0207660_105069492 143
712 3300025918 Ga0207662_10560617 Ga0207662_105606171 143
713 3300025920 Ga0207649_10059546 Ga0207649_100595462 143
714 3300025921 Ga0207652_10365818 Ga0207652_103658182 143
715 3300025922 Ga0207646_10020487 Ga0207646_100204874 143
716 3300025922 Ga0207646_10963111 Ga0207646_109631112 143
717 3300025926 Ga0207659_10563910 Ga0207659_105639101 143
718 3300025927 Ga0207687_10005926 Ga0207687_100059262 143
719 3300025928 Ga0207700_10001822 Ga0207700_1000182210 143
720 3300025936 Ga0207670_10002158 Ga0207670_100021584 143
721 3300025939 Ga0207665_10004200 Ga0207665_100042009 143
722 3300025940 Ga0207691_10792312 Ga0207691_107923122 143
723 3300025941 Ga0207711_10000115 Ga0207711_1000011524 143
724 3300025960 Ga0207651_10001799 Ga0207651_100017997 143
725 3300025986 Ga0207658_10005849 Ga0207658_100058493 143
726 3300026023 Ga0207677_10000395 Ga0207677_1000039522 143
727 3300026035 Ga0207703_10012230 Ga0207703_100122306 143
728 3300026041 Ga0207639_10077253 Ga0207639_100772532 143
729 3300026067 Ga0207678_10145091 Ga0207678_101450913 143
730 3300026078 Ga0207702_10105738 Ga0207702_101057382 143
731 3300026088 Ga0207641_10006084 Ga0207641_100060843 143
732 3300026095 Ga0207676_10001026 Ga0207676_1000102618 143
733 3300026116 Ga0207674_10172794 Ga0207674_101727943 143
734 3300028379 Ga0268266_10003868 Ga0268266_100038683 143
735 3300028381 Ga0268264_10008970 Ga0268264_100089706 143
736 3300031548 Ga0307408_100040588 Ga0307408_1000405883 143
737 3300031824 Ga0307413_10506758 Ga0307413_105067581 143
738 3300031901 Ga0307406_10086231 Ga0307406_100862312 143
739 3300031901 Ga0307406_10639886 Ga0307406_106398861 143
740 3300031903 Ga0307407_10785273 Ga0307407_107852731 143
741 3300031903 Ga0307407_10878439 Ga0307407_108784391 143
742 3300031911 Ga0307412_10075440 Ga0307412_100754401 143
743 3300031911 Ga0307412_10916391 Ga0307412_109163911 143
744 3300031995 Ga0307409_100195672 Ga0307409_1001956722 143
745 3300032002 Ga0307416_100116610 Ga0307416_1001166102 143
746 3300032002 Ga0307416_100223850 Ga0307416_1002238501 143
747 3300032004 Ga0307414_10052479 Ga0307414_100524793 143
748 3300032005 Ga0307411_10017221 Ga0307411_100172212 143
749 3300032126 Ga0307415_100140415 Ga0307415_1001404152 143
750 3300035086 Ga0373934_0005290 Ga0373934_0005290_989_1441 143
751 3300035111 Ga0373923_0003535 Ga0373923_0003535_826_1278 143
752 3300035113 Ga0373936_0068007 Ga0373936_0068007_944_1396 143
753 3300035116 Ga0373945_0038227 Ga0373945_0038227_247_699 143
754 3300035117 Ga0373953_0055692 Ga0373953_0055692_973_1425 143
755 3300035119 Ga0373956_0007834 Ga0373956_0007834_2892_3344 143
756 3300035120 Ga0373957_0055008 Ga0373957_0055008_33_485 143
757 3300035170 Ga0373943_0023626 Ga0373943_0023626_1311_1763 143
758 3300035172 Ga0373955_0006516 Ga0373955_0006516_889_1341 143
759 3300035410 Ga0373924_0004316 Ga0373924_0004316_987_1439 143
760 3300035691 Ga0373931_0188382 Ga0373931_0188382_579_1031 143
761 3300035692 Ga0373935_0349087 Ga0373935_0349087_337_789 143
762 3300035692 Ga0373935_1284530 Ga0373935_1284530_26_478 143
763 3300035695 Ga0373927_0026989 Ga0373927_0026989_1772_2224 143
764 3300035724 Ga0373933_0867000 Ga0373933_0867000_19_471 143
765 3300036401 Ga0373937_0011385 Ga0373937_0011385_1355_1807 143
766 3300036401 Ga0373937_0262034 Ga0373937_0262034_929_1381 143
767 3300046472 Ga0495580_0069770 Ga0495580_0069770_1176_1628 143
768 3300046477 Ga0495664_0122682 Ga0495664_0122682_1047_1499 143
769 3300046516 Ga0495628_0200032 Ga0495628_0200032_876_1328 143
770 3300046535 Ga0495586_0467055 Ga0495586_0467055_254_706 143
771 3300046679 Ga0495623_0054150 Ga0495623_0054150_1921_2373 143
772 3300046680 Ga0495646_0667532 Ga0495646_0667532_15_467 143
773 3300047317 Ga0495604_0073448 Ga0495604_0073448_1782_2234 143
774 3300047319 Ga0495674_0144453 Ga0495674_0144453_137_589 143
775 3300048088 Ga0495602_0151409 Ga0495602_0151409_473_925 143
776 3300048088 Ga0495602_0327593 Ga0495602_0327593_147_599 143
777 3300048903 Ga0496100_0045980 Ga0496100_0045980_660_1112 143
778 3300048904 Ga0496101_0063364 Ga0496101_0063364_646_1098 143
779 3300048907 Ga0496104_0012262 Ga0496104_0012262_2669_3121 143
780 3300048908 Ga0496105_0022388 Ga0496105_0022388_3981_4433 143
781 3300048909 Ga0496106_0075683 Ga0496106_0075683_1900_2352 143
782 3300048911 Ga0496108_0256473 Ga0496108_0256473_251_703 143
783 3300048913 Ga0496110_0900889 Ga0496110_0900889_97_549 143
784 3300048915 Ga0496112_0001102 Ga0496112_0001102_18088_18540 143
785 3300048917 Ga0496114_0071403 Ga0496114_0071403_505_957 143
786 3300048918 Ga0496115_0046886 Ga0496115_0046886_149_601 143
787 3300049575 Ga0501039_0160978 Ga0501039_0160978_311_763 143
788 3300049576 Ga0501040_0135556 Ga0501040_0135556_1214_1666 143
789 3300049580 Ga0501046_0135428 Ga0501046_0135428_269_721 143
790 3300049582 Ga0501048_0211977 Ga0501048_0211977_653_1105 143
791 3300049588 Ga0501072_0041079 Ga0501072_0041079_1447_1899 143
792 3300049590 Ga0501074_0156011 Ga0501074_0156011_979_1431 143
793 3300049592 Ga0501076_0178126 Ga0501076_0178126_388_840 143
794 3300049741 Ga0501079_0288108 Ga0501079_0288108_645_1097 143
795 3300050489 nmdc:mga03683_193709_c1 nmdc:mga03683_193709_c1_65_514 143
796 3300050493 nmdc:mga0k408_370375_c1 nmdc:mga0k408_370375_c1_115_564 143
797 3300050514 nmdc:mga08x19_284896_c1 nmdc:mga08x19_284896_c1_422_874 143
798 3300053078 Ga0495612_0089439 Ga0495612_0089439_375_827 143
799 3300061734 Ga0530510_0466904 Ga0530510_0466904_222_674 143
800 3300025898 Ga0207692_10646100 Ga0207692_106461001 144
801 3300037068 Ga0373925_0170804 Ga0373925_0170804_370_861 144
802 3300045051 Ga0451576_0363406 Ga0451576_0363406_240_680 146
803 3300050509 nmdc:mga0qj67_19003_c1 nmdc:mga0qj67_19003_c1_4488_4931 146
804 3300050510 nmdc:mga06r32_62517_c1 nmdc:mga06r32_62517_c1_3130_3573 146
805 3300005458 Ga0070681_10001782 Ga0070681_100017822 149
806 3300005467 Ga0070706_100023380 Ga0070706_1000233803 149
807 3300005468 Ga0070707_100041931 Ga0070707_1000419313 149
808 3300005530 Ga0070679_100088970 Ga0070679_1000889703 149
809 3300005536 Ga0070697_100052298 Ga0070697_1000522983 149
810 3300005545 Ga0070695_100520808 Ga0070695_1005208082 149
811 3300005546 Ga0070696_100125487 Ga0070696_1001254872 149
812 3300006852 Ga0075433_10361551 Ga0075433_103615512 149
813 3300007076 Ga0075435_100442774 Ga0075435_1004427742 149
814 3300025910 Ga0207684_10134031 Ga0207684_101340311 149
815 3300025922 Ga0207646_10031238 Ga0207646_100312383 149
816 3300053727 Ga0500611_029221 Ga0500611_029221_72_557 149
817 3300005290 Ga0065712_10271989 Ga0065712_102719892 165
818 3300048907 Ga0496104_0918328 Ga0496104_0918328_68_565 165
819 3300048911 Ga0496108_0720491 Ga0496108_0720491_306_803 165
820 3300048917 Ga0496114_0251246 Ga0496114_0251246_251_748 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

32

146

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s56-assembly2.cif.gz_B "crystal structure of ""truncated"" hemoglobin n (hbn) from mycobacterium tuberculosis, soaked with xe atoms" 0.9764 33 148
2gkn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant 0.9761 32 147
1idr-assembly1.cif.gz_A crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis 0.9751 33 147
2gkm-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant 0.9738 32 146
2gkn-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant 0.9736 32 146
ID Description Score Start End Superfamily
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9593 32 148 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9572 33 148 1.10.490.10
1uvxA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.952 33 146 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9514 32 148 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9493 33 148 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A356RAY6-F1-model_v4 Group 1 truncated hemoglobin 1 32 146 GO:0005344
GO:0019825
GO:0020037
GO:0046872
AF-A0A535PEK7-F1-model_v4 Group 1 truncated hemoglobin 0.9978 32 146 GO:0005344
GO:0019825
GO:0020037
GO:0046872
AF-A0A375CCR9-F1-model_v4 deleted 0.9954 42 148
AF-A0A1W9IZ32-F1-model_v4 Cytochrome P460 domain-containing protein 0.9906 29 148 GO:0019825
GO:0020037
GO:0046872
AF-A0A7W1AJE8-F1-model_v4 Group 1 truncated hemoglobin 0.9905 29 147 GO:0005344
GO:0019825
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.47 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map