F482209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 820 | 357 | 820 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_11018473|Ga0105249_110184732 |
| Length | 148 |
| Sequence | MTWRRTLGTLGTVLVLAAGCASRDSAMTEKKPLYDRLGGKPAITAVVDDFIGNVAGDARINKRFADANIPQLKTMLVDQICEATGGPCTYKGQTMKASHKGMKITDAEFNALVEDDLVKSLDKFKVGAQEKNELLSALGGMKGDIVGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 354 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.93 |
| Nodule | 0 |
| Rhizoplane | 3.78 |
| Rhizosphere | 91.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10271989 | 3300005290 | Bacteria | 913 |
| 2 | Ga0065715_10187031 | 3300005293 | Bacteria | 1439 |
| 3 | Ga0065715_10759883 | 3300005293 | Bacteria | 617 |
| 4 | Ga0065707_10272951 | 3300005295 | Bacteria | 1051 |
| 5 | Ga0065707_10548314 | 3300005295 | Bacteria | 723 |
| 6 | Ga0070676_10008651 | 3300005328 | Bacteria | 5489 |
| 7 | Ga0070676_10448345 | 3300005328 | Bacteria | 907 |
| 8 | Ga0070683_100137897 | 3300005329 | Bacteria | 2311 |
| 9 | Ga0070690_100003532 | 3300005330 | Bacteria | 8566 |
| 10 | Ga0070690_100161526 | 3300005330 | Unclassified | 1535 |
| 11 | Ga0070690_100374271 | 3300005330 | Unclassified | 1040 |
| 12 | Ga0070690_100986727 | 3300005330 | Bacteria | 663 |
| 13 | Ga0070670_100078873 | 3300005331 | Bacteria | 2829 |
| 14 | Ga0070670_100553005 | 3300005331 | Bacteria | 1027 |
| 15 | Ga0068869_100002612 | 3300005334 | Bacteria | 10871 |
| 16 | Ga0068869_100131693 | 3300005334 | Unclassified | 1923 |
| 17 | Ga0068869_100155924 | 3300005334 | Bacteria | 1774 |
| 18 | Ga0068869_100544173 | 3300005334 | Bacteria | 974 |
| 19 | Ga0070666_10025918 | 3300005335 | Bacteria | 3825 |
| 20 | Ga0070666_10050259 | 3300005335 | Bacteria | 2804 |
| 21 | Ga0070666_10318896 | 3300005335 | Bacteria | 1108 |
| 22 | Ga0070680_100027015 | 3300005336 | Bacteria | 4595 |
| 23 | Ga0070680_100590892 | 3300005336 | Bacteria | 953 |
| 24 | Ga0070682_100045495 | 3300005337 | Bacteria | 2721 |
| 25 | Ga0068868_100011018 | 3300005338 | Bacteria | 6571 |
| 26 | Ga0068868_100029784 | 3300005338 | Bacteria | 4182 |
| 27 | Ga0068868_100136971 | 3300005338 | Bacteria | 2007 |
| 28 | Ga0068868_102403885 | 3300005338 | Bacteria | 503 |
| 29 | Ga0070660_100046404 | 3300005339 | Bacteria | 3330 |
| 30 | Ga0070660_100091461 | 3300005339 | Bacteria | 2400 |
| 31 | Ga0070660_100473312 | 3300005339 | Bacteria | 1041 |
| 32 | Ga0070689_100003591 | 3300005340 | Bacteria | 10339 |
| 33 | Ga0070689_100989120 | 3300005340 | Bacteria | 748 |
| 34 | Ga0070687_100389989 | 3300005343 | Bacteria | 910 |
| 35 | Ga0070661_100020815 | 3300005344 | Bacteria | 4680 |
| 36 | Ga0070661_100057264 | 3300005344 | Bacteria | 2856 |
| 37 | Ga0070692_10004498 | 3300005345 | Bacteria | 5832 |
| 38 | Ga0070692_10157708 | 3300005345 | Bacteria | 1297 |
| 39 | Ga0070668_100331197 | 3300005347 | Bacteria | 1284 |
| 40 | Ga0070668_100431304 | 3300005347 | Unclassified | 1130 |
| 41 | Ga0070669_100038103 | 3300005353 | Bacteria | 3489 |
| 42 | Ga0070675_100009133 | 3300005354 | Bacteria | 7700 |
| 43 | Ga0070671_100012115 | 3300005355 | Bacteria | 6939 |
| 44 | Ga0070671_100019330 | 3300005355 | Bacteria | 5543 |
| 45 | Ga0070671_100054578 | 3300005355 | Bacteria | 3322 |
| 46 | Ga0070671_100691472 | 3300005355 | Unclassified | 884 |
| 47 | Ga0070674_100033971 | 3300005356 | Bacteria | 3401 |
| 48 | Ga0070674_100165213 | 3300005356 | Bacteria | 1683 |
| 49 | Ga0070673_100000900 | 3300005364 | Bacteria | 16784 |
| 50 | Ga0070688_100000350 | 3300005365 | Bacteria | 23433 |
| 51 | Ga0070659_100060128 | 3300005366 | Bacteria | 3001 |
| 52 | Ga0070667_100020095 | 3300005367 | Bacteria | 5545 |
| 53 | Ga0070667_100089778 | 3300005367 | Bacteria | 2640 |
| 54 | Ga0070667_100158125 | 3300005367 | Bacteria | 1994 |
| 55 | Ga0070703_10000289 | 3300005406 | Bacteria | 23238 |
| 56 | Ga0070703_10203181 | 3300005406 | Unclassified | 779 |
| 57 | Ga0070703_10326441 | 3300005406 | Bacteria | 648 |
| 58 | Ga0070703_10574107 | 3300005406 | Archaea | 517 |
| 59 | Ga0070709_11294968 | 3300005434 | Unclassified | 588 |
| 60 | Ga0070714_100044779 | 3300005435 | Bacteria | 3747 |
| 61 | Ga0070713_100034347 | 3300005436 | Bacteria | 4072 |
| 62 | Ga0070710_10001633 | 3300005437 | Bacteria | 10599 |
| 63 | Ga0070710_10339096 | 3300005437 | Bacteria | 992 |
| 64 | Ga0070710_11458157 | 3300005437 | Bacteria | 513 |
| 65 | Ga0070711_100707735 | 3300005439 | Unclassified | 848 |
| 66 | Ga0070705_100000034 | 3300005440 | Bacteria | 67768 |
| 67 | Ga0070705_100007970 | 3300005440 | Bacteria | 5235 |
| 68 | Ga0070705_100046732 | 3300005440 | Bacteria | 2498 |
| 69 | Ga0070705_100457912 | 3300005440 | Unclassified | 958 |
| 70 | Ga0070705_100569721 | 3300005440 | Bacteria | 871 |
| 71 | Ga0070705_100723780 | 3300005440 | Unclassified | 784 |
| 72 | Ga0070705_100987271 | 3300005440 | Bacteria | 683 |
| 73 | Ga0070694_100009137 | 3300005444 | Bacteria | 6079 |
| 74 | Ga0070694_100128891 | 3300005444 | Bacteria | 1825 |
| 75 | Ga0070694_100177232 | 3300005444 | Bacteria | 1574 |
| 76 | Ga0070694_100505200 | 3300005444 | Unclassified | 962 |
| 77 | Ga0070708_100021520 | 3300005445 | Bacteria | 5454 |
| 78 | Ga0070708_100142506 | 3300005445 | Bacteria | 2223 |
| 79 | Ga0070708_100176313 | 3300005445 | Bacteria | 1997 |
| 80 | Ga0070708_100339417 | 3300005445 | Unclassified | 1416 |
| 81 | Ga0070708_100704218 | 3300005445 | Bacteria | 950 |
| 82 | Ga0070708_100750865 | 3300005445 | Bacteria | 917 |
| 83 | Ga0070708_100770521 | 3300005445 | Bacteria | 905 |
| 84 | Ga0070708_100882185 | 3300005445 | Bacteria | 840 |
| 85 | Ga0070708_101102493 | 3300005445 | Unclassified | 743 |
| 86 | Ga0070663_100008867 | 3300005455 | Bacteria | 6208 |
| 87 | Ga0070663_100094251 | 3300005455 | Bacteria | 2223 |
| 88 | Ga0070663_100289110 | 3300005455 | Bacteria | 1309 |
| 89 | Ga0070678_100002700 | 3300005456 | Bacteria | 9789 |
| 90 | Ga0070678_100389684 | 3300005456 | Bacteria | 1207 |
| 91 | Ga0070678_101639771 | 3300005456 | Bacteria | 604 |
| 92 | Ga0070662_100004156 | 3300005457 | Bacteria | 9111 |
| 93 | Ga0070662_100028373 | 3300005457 | Bacteria | 3894 |
| 94 | Ga0070662_100081754 | 3300005457 | Unclassified | 2407 |
| 95 | Ga0070681_10001782 | 3300005458 | Bacteria | 19331 |
| 96 | Ga0070681_10006305 | 3300005458 | Bacteria | 11531 |
| 97 | Ga0068867_100667242 | 3300005459 | Bacteria | 914 |
| 98 | Ga0068867_100719161 | 3300005459 | Bacteria | 883 |
| 99 | Ga0070685_10001662 | 3300005466 | Bacteria | 11685 |
| 100 | Ga0070685_11268393 | 3300005466 | Bacteria | 562 |
| 101 | Ga0070706_100000020 | 3300005467 | Bacteria | 165628 |
| 102 | Ga0070706_100011522 | 3300005467 | Bacteria | 8218 |
| 103 | Ga0070706_100023380 | 3300005467 | Bacteria | 5691 |
| 104 | Ga0070706_100023493 | 3300005467 | Bacteria | 5678 |
| 105 | Ga0070706_100031309 | 3300005467 | Bacteria | 4906 |
| 106 | Ga0070706_100083205 | 3300005467 | Bacteria | 2964 |
| 107 | Ga0070706_100198448 | 3300005467 | Bacteria | 1874 |
| 108 | Ga0070706_100279069 | 3300005467 | Bacteria | 1559 |
| 109 | Ga0070706_100694151 | 3300005467 | Unclassified | 944 |
| 110 | Ga0070706_101474278 | 3300005467 | Bacteria | 622 |
| 111 | Ga0070707_100021881 | 3300005468 | Bacteria | 6045 |
| 112 | Ga0070707_100041931 | 3300005468 | Bacteria | 4381 |
| 113 | Ga0070707_100110320 | 3300005468 | Unclassified | 2668 |
| 114 | Ga0070707_100198402 | 3300005468 | Bacteria | 1956 |
| 115 | Ga0070707_100579577 | 3300005468 | Unclassified | 1084 |
| 116 | Ga0070698_100035528 | 3300005471 | Bacteria | 5153 |
| 117 | Ga0070698_100040630 | 3300005471 | Bacteria | 4779 |
| 118 | Ga0070698_100115433 | 3300005471 | Bacteria | 2649 |
| 119 | Ga0070698_100412736 | 3300005471 | Bacteria | 1284 |
| 120 | Ga0070698_100716581 | 3300005471 | Unclassified | 943 |
| 121 | Ga0070698_101140979 | 3300005471 | Bacteria | 728 |
| 122 | Ga0070698_101448863 | 3300005471 | Unclassified | 638 |
| 123 | Ga0070698_101672469 | 3300005471 | Bacteria | 589 |
| 124 | Ga0070699_100000083 | 3300005518 | Bacteria | 89561 |
| 125 | Ga0070699_100012081 | 3300005518 | Bacteria | 7450 |
| 126 | Ga0070699_100023392 | 3300005518 | Bacteria | 5322 |
| 127 | Ga0070699_100025869 | 3300005518 | Bacteria | 5059 |
| 128 | Ga0070699_100125703 | 3300005518 | Unclassified | 2257 |
| 129 | Ga0070699_100146920 | 3300005518 | Bacteria | 2083 |
| 130 | Ga0070679_100035778 | 3300005530 | Bacteria | 4926 |
| 131 | Ga0070679_100088970 | 3300005530 | Bacteria | 3075 |
| 132 | Ga0070684_100161080 | 3300005535 | Unclassified | 2035 |
| 133 | Ga0070684_101692507 | 3300005535 | Unclassified | 597 |
| 134 | Ga0070697_100004869 | 3300005536 | Bacteria | 10301 |
| 135 | Ga0070697_100052298 | 3300005536 | Bacteria | 3319 |
| 136 | Ga0070697_100082213 | 3300005536 | Unclassified | 2654 |
| 137 | Ga0070697_100580118 | 3300005536 | Bacteria | 985 |
| 138 | Ga0070697_101783810 | 3300005536 | Unclassified | 550 |
| 139 | Ga0068853_100069426 | 3300005539 | Bacteria | 3065 |
| 140 | Ga0068853_100424828 | 3300005539 | Bacteria | 1247 |
| 141 | Ga0068853_100502716 | 3300005539 | Bacteria | 1144 |
| 142 | Ga0070672_100063683 | 3300005543 | Bacteria | 2912 |
| 143 | Ga0070672_100216948 | 3300005543 | Bacteria | 1604 |
| 144 | Ga0070672_101136940 | 3300005543 | Bacteria | 695 |
| 145 | Ga0070686_100026376 | 3300005544 | Bacteria | 3508 |
| 146 | Ga0070686_100092389 | 3300005544 | Bacteria | 2027 |
| 147 | Ga0070686_100530051 | 3300005544 | Unclassified | 918 |
| 148 | Ga0070695_100019523 | 3300005545 | Bacteria | 4127 |
| 149 | Ga0070695_100380461 | 3300005545 | Bacteria | 1065 |
| 150 | Ga0070695_100473895 | 3300005545 | Bacteria | 963 |
| 151 | Ga0070695_100520808 | 3300005545 | Bacteria | 922 |
| 152 | Ga0070696_100000120 | 3300005546 | Bacteria | 41117 |
| 153 | Ga0070696_100011234 | 3300005546 | Bacteria | 5995 |
| 154 | Ga0070696_100125487 | 3300005546 | Bacteria | 1862 |
| 155 | Ga0070696_100139130 | 3300005546 | Bacteria | 1772 |
| 156 | Ga0070696_100368531 | 3300005546 | Bacteria | 1116 |
| 157 | Ga0070693_100001489 | 3300005547 | Bacteria | 10550 |
| 158 | Ga0070693_100009597 | 3300005547 | Bacteria | 4817 |
| 159 | Ga0070693_100236457 | 3300005547 | Bacteria | 1204 |
| 160 | Ga0070693_100447890 | 3300005547 | Bacteria | 905 |
| 161 | Ga0070704_100526117 | 3300005549 | Bacteria | 1030 |
| 162 | Ga0068855_100119375 | 3300005563 | Bacteria | 3019 |
| 163 | Ga0070664_100450594 | 3300005564 | Bacteria | 1181 |
| 164 | Ga0070664_100724119 | 3300005564 | Bacteria | 928 |
| 165 | Ga0068857_100215963 | 3300005577 | Bacteria | 1751 |
| 166 | Ga0068857_101967925 | 3300005577 | Bacteria | 573 |
| 167 | Ga0068854_100012768 | 3300005578 | Bacteria | 5500 |
| 168 | Ga0068854_100019920 | 3300005578 | Bacteria | 4529 |
| 169 | Ga0068854_100143534 | 3300005578 | Bacteria | 1834 |
| 170 | Ga0068854_100713125 | 3300005578 | Bacteria | 867 |
| 171 | Ga0068854_102128963 | 3300005578 | Bacteria | 518 |
| 172 | Ga0068856_100043666 | 3300005614 | Bacteria | 4410 |
| 173 | Ga0068856_100066951 | 3300005614 | Bacteria | 3549 |
| 174 | Ga0068856_100074100 | 3300005614 | Bacteria | 3370 |
| 175 | Ga0068856_101013175 | 3300005614 | Unclassified | 849 |
| 176 | Ga0068856_101648155 | 3300005614 | Bacteria | 654 |
| 177 | Ga0070702_100025104 | 3300005615 | Bacteria | 3189 |
| 178 | Ga0070702_100355852 | 3300005615 | Bacteria | 1033 |
| 179 | Ga0070702_100622013 | 3300005615 | Bacteria | 813 |
| 180 | Ga0070702_100709724 | 3300005615 | Unclassified | 767 |
| 181 | Ga0068852_100030701 | 3300005616 | Bacteria | 4427 |
| 182 | Ga0068852_100055175 | 3300005616 | Bacteria | 3428 |
| 183 | Ga0068852_100640850 | 3300005616 | Bacteria | 1069 |
| 184 | Ga0068852_102014144 | 3300005616 | Unclassified | 599 |
| 185 | Ga0068859_100003361 | 3300005617 | Bacteria | 16279 |
| 186 | Ga0068859_100145752 | 3300005617 | Bacteria | 2443 |
| 187 | Ga0068859_100230541 | 3300005617 | Bacteria | 1940 |
| 188 | Ga0068859_100366813 | 3300005617 | Bacteria | 1535 |
| 189 | Ga0068859_100374627 | 3300005617 | Bacteria | 1519 |
| 190 | Ga0068859_100585635 | 3300005617 | Bacteria | 1209 |
| 191 | Ga0068859_100776220 | 3300005617 | Bacteria | 1047 |
| 192 | Ga0068864_100001097 | 3300005618 | Bacteria | 22692 |
| 193 | Ga0068864_100006922 | 3300005618 | Bacteria | 9300 |
| 194 | Ga0068864_100024876 | 3300005618 | Bacteria | 5037 |
| 195 | Ga0068864_100776178 | 3300005618 | Unclassified | 940 |
| 196 | Ga0068866_10022882 | 3300005718 | Bacteria | 2898 |
| 197 | Ga0068866_10035481 | 3300005718 | Bacteria | 2436 |
| 198 | Ga0068861_100001656 | 3300005719 | Bacteria | 14245 |
| 199 | Ga0068861_100017797 | 3300005719 | Bacteria | 5048 |
| 200 | Ga0068861_100031007 | 3300005719 | Bacteria | 3923 |
| 201 | Ga0068861_100451875 | 3300005719 | Bacteria | 1151 |
| 202 | Ga0068851_10374715 | 3300005834 | Bacteria | 833 |
| 203 | Ga0068870_10142783 | 3300005840 | Unclassified | 1402 |
| 204 | Ga0068863_100033322 | 3300005841 | Bacteria | 4907 |
| 205 | Ga0068863_100192153 | 3300005841 | Bacteria | 1962 |
| 206 | Ga0068858_100003252 | 3300005842 | Bacteria | 16188 |
| 207 | Ga0068858_100007759 | 3300005842 | Bacteria | 10361 |
| 208 | Ga0068858_100024644 | 3300005842 | Bacteria | 5604 |
| 209 | Ga0068858_100158605 | 3300005842 | Bacteria | 2130 |
| 210 | Ga0068858_100275074 | 3300005842 | Bacteria | 1603 |
| 211 | Ga0068860_100043664 | 3300005843 | Bacteria | 4275 |
| 212 | Ga0068860_100046309 | 3300005843 | Bacteria | 4147 |
| 213 | Ga0068860_100056218 | 3300005843 | Bacteria | 3742 |
| 214 | Ga0068860_100430053 | 3300005843 | Bacteria | 1310 |
| 215 | Ga0068860_100623001 | 3300005843 | Bacteria | 1085 |
| 216 | Ga0068860_101908884 | 3300005843 | Bacteria | 615 |
| 217 | Ga0068862_100012492 | 3300005844 | Bacteria | 7026 |
| 218 | Ga0068862_100065547 | 3300005844 | Bacteria | 3128 |
| 219 | Ga0068862_101065943 | 3300005844 | Bacteria | 802 |
| 220 | Ga0081455_10273343 | 3300005937 | Unclassified | 1224 |
| 221 | Ga0081455_10276089 | 3300005937 | Bacteria | 1216 |
| 222 | Ga0081455_10501641 | 3300005937 | Bacteria | 815 |
| 223 | Ga0081540_1002355 | 3300005983 | Bacteria | 15443 |
| 224 | Ga0081540_1302219 | 3300005983 | Bacteria | 550 |
| 225 | Ga0081539_10001260 | 3300005985 | Bacteria | 44845 |
| 226 | Ga0081539_10031253 | 3300005985 | Bacteria | 3286 |
| 227 | Ga0070717_10177798 | 3300006028 | Bacteria | 1853 |
| 228 | Ga0070717_11457696 | 3300006028 | Unclassified | 621 |
| 229 | Ga0075363_100027009 | 3300006048 | Bacteria | 2940 |
| 230 | Ga0070716_100078915 | 3300006173 | Bacteria | 1959 |
| 231 | Ga0070716_100151651 | 3300006173 | Bacteria | 1491 |
| 232 | Ga0070716_100567632 | 3300006173 | Unclassified | 849 |
| 233 | Ga0070712_100880235 | 3300006175 | Bacteria | 771 |
| 234 | Ga0075362_10069674 | 3300006177 | Bacteria | 1604 |
| 235 | Ga0075367_10599672 | 3300006178 | Unclassified | 700 |
| 236 | Ga0075369_10146879 | 3300006186 | Bacteria | 1077 |
| 237 | Ga0075366_10002856 | 3300006195 | Bacteria | 8951 |
| 238 | Ga0075366_10090939 | 3300006195 | Bacteria | 1828 |
| 239 | Ga0075366_10340332 | 3300006195 | Bacteria | 920 |
| 240 | Ga0097621_100026459 | 3300006237 | Bacteria | 4551 |
| 241 | Ga0097621_100042768 | 3300006237 | Bacteria | 3650 |
| 242 | Ga0097621_100421935 | 3300006237 | Unclassified | 1197 |
| 243 | Ga0075370_10020280 | 3300006353 | Bacteria | 3631 |
| 244 | Ga0068871_100012264 | 3300006358 | Bacteria | 6312 |
| 245 | Ga0068871_100058306 | 3300006358 | Bacteria | 3143 |
| 246 | Ga0075428_100121770 | 3300006844 | Bacteria | 2840 |
| 247 | Ga0075430_100045632 | 3300006846 | Bacteria | 3702 |
| 248 | Ga0075431_100032223 | 3300006847 | Bacteria | 5400 |
| 249 | Ga0075431_100097979 | 3300006847 | Bacteria | 3027 |
| 250 | Ga0075431_101060407 | 3300006847 | Unclassified | 776 |
| 251 | Ga0075433_10230781 | 3300006852 | Bacteria | 1644 |
| 252 | Ga0075433_10264583 | 3300006852 | Bacteria | 1524 |
| 253 | Ga0075433_10361551 | 3300006852 | Bacteria | 1282 |
| 254 | Ga0075433_10579151 | 3300006852 | Bacteria | 986 |
| 255 | Ga0075433_11021222 | 3300006852 | Bacteria | 720 |
| 256 | Ga0075433_11440657 | 3300006852 | Bacteria | 595 |
| 257 | Ga0075434_100072407 | 3300006871 | Unclassified | 3438 |
| 258 | Ga0075434_100211414 | 3300006871 | Unclassified | 1960 |
| 259 | Ga0075434_100999130 | 3300006871 | Bacteria | 851 |
| 260 | Ga0075429_100008641 | 3300006880 | Bacteria | 8860 |
| 261 | Ga0075429_101218958 | 3300006880 | Bacteria | 657 |
| 262 | Ga0068865_100234054 | 3300006881 | Bacteria | 1442 |
| 263 | Ga0068865_100252036 | 3300006881 | Bacteria | 1394 |
| 264 | Ga0068865_101329452 | 3300006881 | Bacteria | 640 |
| 265 | Ga0075436_100104552 | 3300006914 | Bacteria | 1974 |
| 266 | Ga0075436_100106662 | 3300006914 | Bacteria | 1954 |
| 267 | Ga0075436_100155410 | 3300006914 | Bacteria | 1611 |
| 268 | Ga0097620_100003360 | 3300006931 | Bacteria | 16279 |
| 269 | Ga0097620_100145763 | 3300006931 | Bacteria | 2443 |
| 270 | Ga0097620_100230535 | 3300006931 | Bacteria | 1940 |
| 271 | Ga0097620_100366796 | 3300006931 | Bacteria | 1535 |
| 272 | Ga0097620_100374679 | 3300006931 | Bacteria | 1519 |
| 273 | Ga0097620_100585648 | 3300006931 | Bacteria | 1209 |
| 274 | Ga0097620_100776202 | 3300006931 | Bacteria | 1047 |
| 275 | Ga0075435_100117204 | 3300007076 | Bacteria | 2219 |
| 276 | Ga0075435_100442774 | 3300007076 | Bacteria | 1120 |
| 277 | Ga0075435_100594608 | 3300007076 | Bacteria | 959 |
| 278 | Ga0111539_10094509 | 3300009094 | Bacteria | 3512 |
| 279 | Ga0111539_11025236 | 3300009094 | Bacteria | 959 |
| 280 | Ga0105245_10030436 | 3300009098 | Bacteria | 4773 |
| 281 | Ga0105245_10065799 | 3300009098 | Bacteria | 3279 |
| 282 | Ga0105245_10067867 | 3300009098 | Bacteria | 3230 |
| 283 | Ga0105245_10071732 | 3300009098 | Bacteria | 3146 |
| 284 | Ga0105245_10081563 | 3300009098 | Bacteria | 2958 |
| 285 | Ga0105247_10336857 | 3300009101 | Unclassified | 1057 |
| 286 | Ga0114129_10036594 | 3300009147 | Bacteria | 6930 |
| 287 | Ga0114129_10133215 | 3300009147 | Bacteria | 3412 |
| 288 | Ga0114129_10535653 | 3300009147 | Bacteria | 1525 |
| 289 | Ga0114129_10687450 | 3300009147 | Bacteria | 1316 |
| 290 | Ga0114129_11657059 | 3300009147 | Unclassified | 782 |
| 291 | Ga0105243_11147194 | 3300009148 | Unclassified | 788 |
| 292 | Ga0105241_10157530 | 3300009174 | Bacteria | 1863 |
| 293 | Ga0105241_10233341 | 3300009174 | Bacteria | 1552 |
| 294 | Ga0105241_10289817 | 3300009174 | Unclassified | 1401 |
| 295 | Ga0105241_10715456 | 3300009174 | Bacteria | 915 |
| 296 | Ga0105242_10059050 | 3300009176 | Bacteria | 3146 |
| 297 | Ga0105242_10390964 | 3300009176 | Bacteria | 1295 |
| 298 | Ga0105248_10023280 | 3300009177 | Bacteria | 6879 |
| 299 | Ga0105248_10046529 | 3300009177 | Bacteria | 4863 |
| 300 | Ga0105248_10145566 | 3300009177 | Bacteria | 2674 |
| 301 | Ga0105248_10460592 | 3300009177 | Bacteria | 1433 |
| 302 | Ga0105248_10533064 | 3300009177 | Bacteria | 1324 |
| 303 | Ga0105248_11150906 | 3300009177 | Unclassified | 877 |
| 304 | Ga0105248_11214156 | 3300009177 | Bacteria | 853 |
| 305 | Ga0105237_10068951 | 3300009545 | Bacteria | 3531 |
| 306 | Ga0105237_10529883 | 3300009545 | Bacteria | 1184 |
| 307 | Ga0105238_10034509 | 3300009551 | Bacteria | 5147 |
| 308 | Ga0105238_10290805 | 3300009551 | Bacteria | 1616 |
| 309 | Ga0105238_10332826 | 3300009551 | Bacteria | 1505 |
| 310 | Ga0105249_10013045 | 3300009553 | Bacteria | 7335 |
| 311 | Ga0105249_10152484 | 3300009553 | Bacteria | 2226 |
| 312 | Ga0105249_10709169 | 3300009553 | Bacteria | 1067 |
| 313 | Ga0105249_10722504 | 3300009553 | Bacteria | 1057 |
| 314 | Ga0105249_11018473 | 3300009553 | Bacteria | 897 |
| 315 | Ga0105239_10096982 | 3300010375 | Bacteria | 3258 |
| 316 | Ga0105239_10259712 | 3300010375 | Bacteria | 1952 |
| 317 | Ga0105246_10167350 | 3300011119 | Bacteria | 1680 |
| 318 | Ga0105246_10795127 | 3300011119 | Unclassified | 839 |
| 319 | Ga0157373_10099647 | 3300013100 | Bacteria | 2045 |
| 320 | Ga0157373_10404552 | 3300013100 | Bacteria | 979 |
| 321 | Ga0157373_10631716 | 3300013100 | Unclassified | 781 |
| 322 | Ga0157371_10525203 | 3300013102 | Bacteria | 876 |
| 323 | Ga0157370_10030127 | 3300013104 | Bacteria | 5319 |
| 324 | Ga0157370_10054530 | 3300013104 | Bacteria | 3810 |
| 325 | Ga0157369_10187861 | 3300013105 | Bacteria | 2172 |
| 326 | Ga0157374_10000720 | 3300013296 | Bacteria | 28871 |
| 327 | Ga0157374_10055848 | 3300013296 | Bacteria | 3686 |
| 328 | Ga0157378_10046168 | 3300013297 | Bacteria | 3872 |
| 329 | Ga0157378_10050114 | 3300013297 | Bacteria | 3715 |
| 330 | Ga0157378_11465656 | 3300013297 | Bacteria | 726 |
| 331 | Ga0163162_10079862 | 3300013306 | Bacteria | 3338 |
| 332 | Ga0163162_10162205 | 3300013306 | Bacteria | 2357 |
| 333 | Ga0163162_10558721 | 3300013306 | Bacteria | 1272 |
| 334 | Ga0163162_10567616 | 3300013306 | Bacteria | 1262 |
| 335 | Ga0157372_10097987 | 3300013307 | Bacteria | 3344 |
| 336 | Ga0157372_10263110 | 3300013307 | Bacteria | 2003 |
| 337 | Ga0157372_10278912 | 3300013307 | Bacteria | 1943 |
| 338 | Ga0157375_10005228 | 3300013308 | Bacteria | 11264 |
| 339 | Ga0157375_10116452 | 3300013308 | Bacteria | 2777 |
| 340 | Ga0157380_10098910 | 3300014326 | Unclassified | 2425 |
| 341 | Ga0157380_10932691 | 3300014326 | Unclassified | 897 |
| 342 | Ga0157380_10976274 | 3300014326 | Bacteria | 879 |
| 343 | Ga0157377_10001260 | 3300014745 | Bacteria | 10825 |
| 344 | Ga0157377_10040974 | 3300014745 | Bacteria | 2567 |
| 345 | Ga0157379_10012192 | 3300014968 | Bacteria | 7509 |
| 346 | Ga0157379_10020789 | 3300014968 | Bacteria | 5808 |
| 347 | Ga0157379_10040876 | 3300014968 | Bacteria | 4139 |
| 348 | Ga0157379_10083915 | 3300014968 | Bacteria | 2855 |
| 349 | Ga0157379_10244992 | 3300014968 | Unclassified | 1626 |
| 350 | Ga0157379_11341927 | 3300014968 | Unclassified | 692 |
| 351 | Ga0157376_10032686 | 3300014969 | Bacteria | 4180 |
| 352 | Ga0157376_10063073 | 3300014969 | Bacteria | 3120 |
| 353 | Ga0157376_10276889 | 3300014969 | Bacteria | 1579 |
| 354 | Ga0157376_10845186 | 3300014969 | Bacteria | 930 |
| 355 | Ga0163161_10005526 | 3300017792 | Bacteria | 8757 |
| 356 | Ga0163161_10613103 | 3300017792 | Unclassified | 898 |
| 357 | Ga0213872_10041931 | 3300021361 | Bacteria | 2088 |
| 358 | Ga0213876_10033283 | 3300021384 | Bacteria | 2718 |
| 359 | Ga0213876_10071393 | 3300021384 | Bacteria | 1834 |
| 360 | Ga0207656_10013567 | 3300025321 | Bacteria | 3118 |
| 361 | Ga0207656_10170656 | 3300025321 | Bacteria | 1040 |
| 362 | Ga0207656_10249789 | 3300025321 | Bacteria | 869 |
| 363 | Ga0207653_10000339 | 3300025885 | Bacteria | 24285 |
| 364 | Ga0207653_10152877 | 3300025885 | Bacteria | 850 |
| 365 | Ga0207653_10184291 | 3300025885 | Bacteria | 782 |
| 366 | Ga0207692_10245838 | 3300025898 | Bacteria | 1070 |
| 367 | Ga0207692_10495984 | 3300025898 | Unclassified | 774 |
| 368 | Ga0207692_10646100 | 3300025898 | Bacteria | 683 |
| 369 | Ga0207642_10007211 | 3300025899 | Bacteria | 3744 |
| 370 | Ga0207642_10039888 | 3300025899 | Unclassified | 2044 |
| 371 | Ga0207688_10021565 | 3300025901 | Bacteria | 3521 |
| 372 | Ga0207680_10000776 | 3300025903 | Bacteria | 15088 |
| 373 | Ga0207680_10308640 | 3300025903 | Unclassified | 1104 |
| 374 | Ga0207680_10316611 | 3300025903 | Bacteria | 1090 |
| 375 | Ga0207680_10332589 | 3300025903 | Bacteria | 1064 |
| 376 | Ga0207685_10076575 | 3300025905 | Bacteria | 1372 |
| 377 | Ga0207699_11328793 | 3300025906 | Bacteria | 532 |
| 378 | Ga0207645_10058373 | 3300025907 | Bacteria | 2463 |
| 379 | Ga0207643_10065920 | 3300025908 | Bacteria | 2075 |
| 380 | Ga0207684_10000215 | 3300025910 | Bacteria | 89389 |
| 381 | Ga0207684_10018374 | 3300025910 | Bacteria | 5985 |
| 382 | Ga0207684_10038127 | 3300025910 | Unclassified | 4078 |
| 383 | Ga0207684_10039192 | 3300025910 | Unclassified | 4020 |
| 384 | Ga0207684_10101280 | 3300025910 | Bacteria | 2462 |
| 385 | Ga0207684_10114491 | 3300025910 | Bacteria | 2309 |
| 386 | Ga0207684_10134031 | 3300025910 | Bacteria | 2126 |
| 387 | Ga0207684_10235438 | 3300025910 | Bacteria | 1580 |
| 388 | Ga0207684_10630297 | 3300025910 | Bacteria | 914 |
| 389 | Ga0207684_10921153 | 3300025910 | Bacteria | 734 |
| 390 | Ga0207654_10044683 | 3300025911 | Bacteria | 2518 |
| 391 | Ga0207654_11438957 | 3300025911 | Bacteria | 503 |
| 392 | Ga0207707_10052439 | 3300025912 | Bacteria | 3552 |
| 393 | Ga0207693_10000485 | 3300025915 | Bacteria | 36061 |
| 394 | Ga0207693_10020276 | 3300025915 | Bacteria | 5289 |
| 395 | Ga0207663_10219095 | 3300025916 | Bacteria | 1384 |
| 396 | Ga0207663_10478210 | 3300025916 | Bacteria | 965 |
| 397 | Ga0207663_10919881 | 3300025916 | Bacteria | 700 |
| 398 | Ga0207660_10114009 | 3300025917 | Bacteria | 2038 |
| 399 | Ga0207660_10506949 | 3300025917 | Bacteria | 979 |
| 400 | Ga0207662_10022083 | 3300025918 | Bacteria | 3643 |
| 401 | Ga0207662_10560617 | 3300025918 | Unclassified | 792 |
| 402 | Ga0207662_11017788 | 3300025918 | Bacteria | 588 |
| 403 | Ga0207657_10003754 | 3300025919 | Bacteria | 16143 |
| 404 | Ga0207657_10208414 | 3300025919 | Bacteria | 1570 |
| 405 | Ga0207649_10034334 | 3300025920 | Bacteria | 3038 |
| 406 | Ga0207649_10059546 | 3300025920 | Bacteria | 2397 |
| 407 | Ga0207649_10214867 | 3300025920 | Bacteria | 1366 |
| 408 | Ga0207652_10365818 | 3300025921 | Bacteria | 1302 |
| 409 | Ga0207646_10020487 | 3300025922 | Bacteria | 6126 |
| 410 | Ga0207646_10031238 | 3300025922 | Bacteria | 4823 |
| 411 | Ga0207646_10045761 | 3300025922 | Bacteria | 3927 |
| 412 | Ga0207646_10075551 | 3300025922 | Unclassified | 3010 |
| 413 | Ga0207646_10094649 | 3300025922 | Bacteria | 2675 |
| 414 | Ga0207646_10600374 | 3300025922 | Bacteria | 988 |
| 415 | Ga0207646_10796117 | 3300025922 | Archaea | 842 |
| 416 | Ga0207646_10963111 | 3300025922 | Unclassified | 755 |
| 417 | Ga0207646_11102820 | 3300025922 | Bacteria | 698 |
| 418 | Ga0207681_10004317 | 3300025923 | Bacteria | 8778 |
| 419 | Ga0207681_10197969 | 3300025923 | Bacteria | 1541 |
| 420 | Ga0207681_11572073 | 3300025923 | Unclassified | 551 |
| 421 | Ga0207694_10202145 | 3300025924 | Bacteria | 1617 |
| 422 | Ga0207694_10226820 | 3300025924 | Bacteria | 1525 |
| 423 | Ga0207650_11816879 | 3300025925 | Bacteria | 515 |
| 424 | Ga0207659_10038033 | 3300025926 | Bacteria | 3344 |
| 425 | Ga0207659_10563910 | 3300025926 | Unclassified | 969 |
| 426 | Ga0207687_10005926 | 3300025927 | Bacteria | 8083 |
| 427 | Ga0207687_10022709 | 3300025927 | Bacteria | 4178 |
| 428 | Ga0207687_10064857 | 3300025927 | Bacteria | 2592 |
| 429 | Ga0207687_10292272 | 3300025927 | Bacteria | 1310 |
| 430 | Ga0207700_10001822 | 3300025928 | Bacteria | 12116 |
| 431 | Ga0207700_10077519 | 3300025928 | Bacteria | 2582 |
| 432 | Ga0207644_10021539 | 3300025931 | Bacteria | 4392 |
| 433 | Ga0207644_10082443 | 3300025931 | Unclassified | 2379 |
| 434 | Ga0207690_10039233 | 3300025932 | Bacteria | 3089 |
| 435 | Ga0207706_10001995 | 3300025933 | Bacteria | 19971 |
| 436 | Ga0207706_10068569 | 3300025933 | Bacteria | 3121 |
| 437 | Ga0207706_10160293 | 3300025933 | Bacteria | 1978 |
| 438 | Ga0207686_10000309 | 3300025934 | Bacteria | 35241 |
| 439 | Ga0207670_10002158 | 3300025936 | Bacteria | 10295 |
| 440 | Ga0207670_10079128 | 3300025936 | Bacteria | 2294 |
| 441 | Ga0207669_10030394 | 3300025937 | Bacteria | 3001 |
| 442 | Ga0207669_10992781 | 3300025937 | Unclassified | 705 |
| 443 | Ga0207704_10094593 | 3300025938 | Bacteria | 1973 |
| 444 | Ga0207704_10507253 | 3300025938 | Unclassified | 973 |
| 445 | Ga0207665_10004200 | 3300025939 | Bacteria | 9583 |
| 446 | Ga0207665_10015247 | 3300025939 | Bacteria | 5047 |
| 447 | Ga0207665_10031433 | 3300025939 | Bacteria | 3512 |
| 448 | Ga0207665_10160126 | 3300025939 | Bacteria | 1618 |
| 449 | Ga0207691_10036442 | 3300025940 | Bacteria | 4557 |
| 450 | Ga0207691_10074448 | 3300025940 | Bacteria | 3063 |
| 451 | Ga0207691_10792312 | 3300025940 | Bacteria | 797 |
| 452 | Ga0207711_10000115 | 3300025941 | Bacteria | 83472 |
| 453 | Ga0207711_10009070 | 3300025941 | Bacteria | 8311 |
| 454 | Ga0207711_10306798 | 3300025941 | Unclassified | 1465 |
| 455 | Ga0207711_10550158 | 3300025941 | Bacteria | 1076 |
| 456 | Ga0207711_10639370 | 3300025941 | Bacteria | 992 |
| 457 | Ga0207689_10000996 | 3300025942 | Bacteria | 27158 |
| 458 | Ga0207689_10022153 | 3300025942 | Bacteria | 5343 |
| 459 | Ga0207689_10145581 | 3300025942 | Bacteria | 1952 |
| 460 | Ga0207689_10499801 | 3300025942 | Bacteria | 1019 |
| 461 | Ga0207661_10025375 | 3300025944 | Bacteria | 4504 |
| 462 | Ga0207661_10728739 | 3300025944 | Bacteria | 912 |
| 463 | Ga0207679_10175790 | 3300025945 | Bacteria | 1767 |
| 464 | Ga0207679_10569649 | 3300025945 | Bacteria | 1018 |
| 465 | Ga0207667_10052553 | 3300025949 | Bacteria | 4290 |
| 466 | Ga0207667_11842851 | 3300025949 | Unclassified | 568 |
| 467 | Ga0207651_10001799 | 3300025960 | Bacteria | 9966 |
| 468 | Ga0207712_10090175 | 3300025961 | Bacteria | 2255 |
| 469 | Ga0207712_10140109 | 3300025961 | Bacteria | 1855 |
| 470 | Ga0207712_10270204 | 3300025961 | Unclassified | 1383 |
| 471 | Ga0207712_10552364 | 3300025961 | Unclassified | 991 |
| 472 | Ga0207668_10104172 | 3300025972 | Bacteria | 2114 |
| 473 | Ga0207668_10616914 | 3300025972 | Unclassified | 946 |
| 474 | Ga0207640_10021812 | 3300025981 | Bacteria | 3822 |
| 475 | Ga0207640_10059072 | 3300025981 | Bacteria | 2529 |
| 476 | Ga0207640_10209591 | 3300025981 | Bacteria | 1483 |
| 477 | Ga0207658_10005849 | 3300025986 | Bacteria | 8412 |
| 478 | Ga0207658_10025475 | 3300025986 | Bacteria | 4142 |
| 479 | Ga0207658_10144705 | 3300025986 | Bacteria | 1928 |
| 480 | Ga0207658_10311547 | 3300025986 | Bacteria | 1360 |
| 481 | Ga0207658_10667447 | 3300025986 | Bacteria | 938 |
| 482 | Ga0207658_11301755 | 3300025986 | Bacteria | 665 |
| 483 | Ga0207677_10000395 | 3300026023 | Bacteria | 30050 |
| 484 | Ga0207677_10000853 | 3300026023 | Bacteria | 17454 |
| 485 | Ga0207677_10033258 | 3300026023 | Bacteria | 3324 |
| 486 | Ga0207703_10009640 | 3300026035 | Bacteria | 7581 |
| 487 | Ga0207703_10012230 | 3300026035 | Bacteria | 6693 |
| 488 | Ga0207703_10089109 | 3300026035 | Bacteria | 2591 |
| 489 | Ga0207703_10105983 | 3300026035 | Bacteria | 2390 |
| 490 | Ga0207703_10304519 | 3300026035 | Bacteria | 1455 |
| 491 | Ga0207703_10465966 | 3300026035 | Bacteria | 1182 |
| 492 | Ga0207703_10708972 | 3300026035 | Bacteria | 957 |
| 493 | Ga0207639_10012372 | 3300026041 | Bacteria | 5942 |
| 494 | Ga0207639_10077253 | 3300026041 | Bacteria | 2624 |
| 495 | Ga0207639_10122024 | 3300026041 | Bacteria | 2142 |
| 496 | Ga0207678_10052391 | 3300026067 | Bacteria | 3521 |
| 497 | Ga0207678_10072541 | 3300026067 | Bacteria | 2950 |
| 498 | Ga0207678_10145091 | 3300026067 | Bacteria | 2026 |
| 499 | Ga0207678_10401726 | 3300026067 | Bacteria | 1186 |
| 500 | Ga0207708_10508749 | 3300026075 | Unclassified | 1010 |
| 501 | Ga0207702_10105738 | 3300026078 | Bacteria | 2493 |
| 502 | Ga0207702_10235550 | 3300026078 | Bacteria | 1713 |
| 503 | Ga0207702_11131591 | 3300026078 | Unclassified | 777 |
| 504 | Ga0207641_10006084 | 3300026088 | Bacteria | 10217 |
| 505 | Ga0207641_10255488 | 3300026088 | Bacteria | 1638 |
| 506 | Ga0207641_11626150 | 3300026088 | Bacteria | 648 |
| 507 | Ga0207648_10003050 | 3300026089 | Bacteria | 17707 |
| 508 | Ga0207648_10059765 | 3300026089 | Bacteria | 3324 |
| 509 | Ga0207648_10692580 | 3300026089 | Bacteria | 944 |
| 510 | Ga0207676_10001026 | 3300026095 | Bacteria | 21347 |
| 511 | Ga0207676_10003408 | 3300026095 | Bacteria | 11239 |
| 512 | Ga0207676_10105115 | 3300026095 | Bacteria | 2350 |
| 513 | Ga0207676_10715247 | 3300026095 | Bacteria | 971 |
| 514 | Ga0207676_11451356 | 3300026095 | Bacteria | 682 |
| 515 | Ga0207674_10009820 | 3300026116 | Bacteria | 10898 |
| 516 | Ga0207674_10172794 | 3300026116 | Bacteria | 2114 |
| 517 | Ga0207674_10846564 | 3300026116 | Bacteria | 882 |
| 518 | Ga0207674_11588714 | 3300026116 | Bacteria | 623 |
| 519 | Ga0207675_100008890 | 3300026118 | Bacteria | 9423 |
| 520 | Ga0207675_100036403 | 3300026118 | Bacteria | 4591 |
| 521 | Ga0207675_100055575 | 3300026118 | Bacteria | 3694 |
| 522 | Ga0207675_100283573 | 3300026118 | Bacteria | 1610 |
| 523 | Ga0207675_100388738 | 3300026118 | Bacteria | 1373 |
| 524 | Ga0207683_10011693 | 3300026121 | Bacteria | 7492 |
| 525 | Ga0207683_10248280 | 3300026121 | Bacteria | 1624 |
| 526 | Ga0207683_11591320 | 3300026121 | Bacteria | 603 |
| 527 | Ga0207698_10029833 | 3300026142 | Bacteria | 3912 |
| 528 | Ga0207698_10047442 | 3300026142 | Bacteria | 3254 |
| 529 | Ga0207698_10112725 | 3300026142 | Bacteria | 2283 |
| 530 | Ga0207698_10462495 | 3300026142 | Unclassified | 1227 |
| 531 | Ga0207428_10056081 | 3300027907 | Bacteria | 3131 |
| 532 | Ga0268266_10003868 | 3300028379 | Bacteria | 14601 |
| 533 | Ga0268265_10163264 | 3300028380 | Unclassified | 1895 |
| 534 | Ga0268265_10698759 | 3300028380 | Bacteria | 979 |
| 535 | Ga0268265_10738886 | 3300028380 | Unclassified | 954 |
| 536 | Ga0268264_10008970 | 3300028381 | Bacteria | 8299 |
| 537 | Ga0268264_10011726 | 3300028381 | Bacteria | 7228 |
| 538 | Ga0268264_10031276 | 3300028381 | Bacteria | 4364 |
| 539 | Ga0268264_10218105 | 3300028381 | Bacteria | 1755 |
| 540 | Ga0268264_10751550 | 3300028381 | Bacteria | 971 |
| 541 | Ga0268264_11042430 | 3300028381 | Bacteria | 825 |
| 542 | Ga0268264_11254368 | 3300028381 | Bacteria | 751 |
| 543 | Ga0307517_10147695 | 3300028786 | Bacteria | 1625 |
| 544 | Ga0307517_10288522 | 3300028786 | Bacteria | 929 |
| 545 | Ga0307515_10814799 | 3300028794 | Archaea | 557 |
| 546 | Ga0265330_10137643 | 3300031235 | Bacteria | 1038 |
| 547 | Ga0265332_10000724 | 3300031238 | Bacteria | 20828 |
| 548 | Ga0265328_10140993 | 3300031239 | Bacteria | 904 |
| 549 | Ga0265329_10030085 | 3300031242 | Bacteria | 1771 |
| 550 | Ga0265339_10096783 | 3300031249 | Bacteria | 1540 |
| 551 | Ga0265331_10000579 | 3300031250 | Bacteria | 32817 |
| 552 | Ga0265331_10263892 | 3300031250 | Bacteria | 772 |
| 553 | Ga0265327_10031469 | 3300031251 | Bacteria | 2980 |
| 554 | Ga0265316_10179750 | 3300031344 | Bacteria | 1575 |
| 555 | Ga0307513_10204672 | 3300031456 | Bacteria | 1811 |
| 556 | Ga0307509_10497035 | 3300031507 | Bacteria | 905 |
| 557 | Ga0307408_100021342 | 3300031548 | Bacteria | 4383 |
| 558 | Ga0307408_100040588 | 3300031548 | Bacteria | 3296 |
| 559 | Ga0265313_10227543 | 3300031595 | Unclassified | 767 |
| 560 | Ga0265314_10009471 | 3300031711 | Bacteria | 8215 |
| 561 | Ga0265342_10059999 | 3300031712 | Bacteria | 2245 |
| 562 | Ga0307516_10513725 | 3300031730 | Bacteria | 852 |
| 563 | Ga0307413_10506758 | 3300031824 | Unclassified | 970 |
| 564 | Ga0307406_10086231 | 3300031901 | Bacteria | 2102 |
| 565 | Ga0307406_10639886 | 3300031901 | Unclassified | 881 |
| 566 | Ga0307407_10785273 | 3300031903 | Unclassified | 723 |
| 567 | Ga0307407_10878439 | 3300031903 | Unclassified | 687 |
| 568 | Ga0307412_10075440 | 3300031911 | Unclassified | 2313 |
| 569 | Ga0307412_10916391 | 3300031911 | Unclassified | 769 |
| 570 | Ga0307412_11489219 | 3300031911 | Unclassified | 615 |
| 571 | Ga0307409_100195672 | 3300031995 | Unclassified | 1804 |
| 572 | Ga0307416_100116610 | 3300032002 | Unclassified | 2368 |
| 573 | Ga0307416_100223850 | 3300032002 | Bacteria | 1807 |
| 574 | Ga0307414_10052479 | 3300032004 | Unclassified | 2838 |
| 575 | Ga0307411_10017221 | 3300032005 | Bacteria | 4110 |
| 576 | Ga0307415_100140415 | 3300032126 | Unclassified | 1844 |
| 577 | Ga0307510_10397439 | 3300033180 | Bacteria | 822 |
| 578 | Ga0373926_0125457 | 3300035083 | Unclassified | 970 |
| 579 | Ga0373928_0058569 | 3300035084 | Bacteria | 926 |
| 580 | Ga0373934_0005290 | 3300035086 | Bacteria | 4774 |
| 581 | Ga0373923_0003535 | 3300035111 | Bacteria | 5024 |
| 582 | Ga0373936_0068007 | 3300035113 | Bacteria | 1464 |
| 583 | Ga0373939_0032447 | 3300035114 | Bacteria | 1518 |
| 584 | Ga0373941_0026364 | 3300035115 | Bacteria | 1687 |
| 585 | Ga0373945_0038227 | 3300035116 | Bacteria | 1726 |
| 586 | Ga0373945_0142184 | 3300035116 | Bacteria | 968 |
| 587 | Ga0373953_0055692 | 3300035117 | Bacteria | 1606 |
| 588 | Ga0373954_0011052 | 3300035118 | Bacteria | 3995 |
| 589 | Ga0373956_0007834 | 3300035119 | Bacteria | 4309 |
| 590 | Ga0373957_0055008 | 3300035120 | Unclassified | 1529 |
| 591 | Ga0373960_0203947 | 3300035121 | Bacteria | 700 |
| 592 | Ga0373943_0023626 | 3300035170 | Bacteria | 2859 |
| 593 | Ga0373943_0099231 | 3300035170 | Unclassified | 1520 |
| 594 | Ga0373946_0259789 | 3300035171 | Unclassified | 849 |
| 595 | Ga0373955_0006516 | 3300035172 | Bacteria | 5323 |
| 596 | Ga0373955_0065131 | 3300035172 | Bacteria | 2022 |
| 597 | Ga0373955_0163856 | 3300035172 | Bacteria | 1314 |
| 598 | Ga0373962_0033626 | 3300035242 | Bacteria | 1416 |
| 599 | Ga0373924_0004316 | 3300035410 | Bacteria | 4961 |
| 600 | Ga0373931_0147572 | 3300035691 | Bacteria | 1368 |
| 601 | Ga0373931_0188382 | 3300035691 | Unclassified | 1226 |
| 602 | Ga0373935_0051920 | 3300035692 | Unclassified | 2605 |
| 603 | Ga0373935_0124028 | 3300035692 | Bacteria | 1729 |
| 604 | Ga0373935_0349087 | 3300035692 | Unclassified | 1054 |
| 605 | Ga0373935_1284530 | 3300035692 | Bacteria | 546 |
| 606 | Ga0373927_0001889 | 3300035695 | Bacteria | 15478 |
| 607 | Ga0373927_0026989 | 3300035695 | Bacteria | 3752 |
| 608 | Ga0373927_0579634 | 3300035695 | Bacteria | 741 |
| 609 | Ga0373933_0867000 | 3300035724 | Bacteria | 594 |
| 610 | Ga0373947_0013481 | 3300035725 | Bacteria | 4682 |
| 611 | Ga0373947_0368404 | 3300035725 | Bacteria | 966 |
| 612 | Ga0373937_0011385 | 3300036401 | Bacteria | 7804 |
| 613 | Ga0373937_0058512 | 3300036401 | Bacteria | 3541 |
| 614 | Ga0373937_0262034 | 3300036401 | Bacteria | 1630 |
| 615 | Ga0373937_0620904 | 3300036401 | Bacteria | 1026 |
| 616 | Ga0373937_0637860 | 3300036401 | Unclassified | 1010 |
| 617 | Ga0373937_0809081 | 3300036401 | Bacteria | 885 |
| 618 | Ga0373937_0837527 | 3300036401 | Unclassified | 868 |
| 619 | Ga0373937_0862837 | 3300036401 | Bacteria | 854 |
| 620 | Ga0373925_0016451 | 3300037068 | Bacteria | 5358 |
| 621 | Ga0373925_0026702 | 3300037068 | Bacteria | 4226 |
| 622 | Ga0373925_0170804 | 3300037068 | Bacteria | 1717 |
| 623 | Ga0373925_0264113 | 3300037068 | Bacteria | 1383 |
| 624 | Ga0436364_0110143 | 3300037853 | Bacteria | 631 |
| 625 | Ga0436365_0772642 | 3300039437 | Bacteria | 2060 |
| 626 | Ga0436365_0982517 | 3300039437 | Bacteria | 756 |
| 627 | Ga0436365_1085891 | 3300039437 | Bacteria | 1128 |
| 628 | Ga0436365_1776998 | 3300039437 | Bacteria | 4249 |
| 629 | Ga0436360_0083715 | 3300039438 | Bacteria | 2204 |
| 630 | Ga0436360_0193744 | 3300039438 | Unclassified | 937 |
| 631 | Ga0436360_0606863 | 3300039438 | Unclassified | 798 |
| 632 | Ga0436361_0437114 | 3300039447 | Bacteria | 6633 |
| 633 | Ga0436363_0187732 | 3300039450 | Bacteria | 1724 |
| 634 | Ga0451807_0168116 | 3300041486 | Bacteria | 581 |
| 635 | Ga0439448_0072660 | 3300042005 | Bacteria | 1147 |
| 636 | Ga0451577_0034258 | 3300042876 | Bacteria | 4578 |
| 637 | Ga0453683_0006140 | 3300044673 | Bacteria | 8273 |
| 638 | Ga0453683_0114672 | 3300044673 | Bacteria | 1695 |
| 639 | Ga0453683_0234265 | 3300044673 | Unclassified | 1169 |
| 640 | Ga0466963_0213949 | 3300044694 | Bacteria | 1349 |
| 641 | Ga0451576_0093427 | 3300045051 | Bacteria | 3128 |
| 642 | Ga0451576_0363406 | 3300045051 | Bacteria | 1516 |
| 643 | Ga0451576_0867349 | 3300045051 | Bacteria | 947 |
| 644 | Ga0466967_0046561 | 3300045976 | Bacteria | 3777 |
| 645 | Ga0495629_0032786 | 3300046459 | Bacteria | 3676 |
| 646 | Ga0495651_0380857 | 3300046462 | Unclassified | 925 |
| 647 | Ga0495653_0761376 | 3300046463 | Unclassified | 584 |
| 648 | Ga0495580_0042011 | 3300046472 | Bacteria | 3258 |
| 649 | Ga0495580_0069770 | 3300046472 | Bacteria | 2455 |
| 650 | Ga0495580_0086219 | 3300046472 | Unclassified | 2187 |
| 651 | Ga0495580_0119473 | 3300046472 | Bacteria | 1830 |
| 652 | Ga0495582_0059191 | 3300046473 | Bacteria | 2113 |
| 653 | Ga0495639_0184572 | 3300046475 | Unclassified | 1016 |
| 654 | Ga0495662_0005009 | 3300046476 | Bacteria | 6638 |
| 655 | Ga0495664_0122682 | 3300046477 | Bacteria | 1571 |
| 656 | Ga0495618_0418964 | 3300046514 | Unclassified | 817 |
| 657 | Ga0495628_0184769 | 3300046516 | Unclassified | 1576 |
| 658 | Ga0495628_0200032 | 3300046516 | Bacteria | 1506 |
| 659 | Ga0495630_0157418 | 3300046517 | Unclassified | 1729 |
| 660 | Ga0495632_0025548 | 3300046519 | Bacteria | 3122 |
| 661 | Ga0495652_0442754 | 3300046529 | Bacteria | 911 |
| 662 | Ga0495665_0035617 | 3300046531 | Bacteria | 2658 |
| 663 | Ga0495665_0404454 | 3300046531 | Bacteria | 692 |
| 664 | Ga0495586_0154120 | 3300046535 | Unclassified | 1294 |
| 665 | Ga0495586_0467055 | 3300046535 | Unclassified | 728 |
| 666 | Ga0495621_0049561 | 3300046539 | Bacteria | 1498 |
| 667 | Ga0495597_0039435 | 3300046542 | Bacteria | 2115 |
| 668 | Ga0495645_0016994 | 3300046543 | Bacteria | 5208 |
| 669 | Ga0495668_0053582 | 3300046616 | Bacteria | 2230 |
| 670 | Ga0495634_0161849 | 3300046642 | Bacteria | 1410 |
| 671 | Ga0495634_0342130 | 3300046642 | Bacteria | 897 |
| 672 | Ga0495625_0013437 | 3300046660 | Bacteria | 6580 |
| 673 | Ga0495635_0031580 | 3300046663 | Bacteria | 3675 |
| 674 | Ga0495659_0128830 | 3300046664 | Unclassified | 1002 |
| 675 | Ga0495588_0144768 | 3300046674 | Unclassified | 1256 |
| 676 | Ga0495623_0054150 | 3300046679 | Bacteria | 2532 |
| 677 | Ga0495646_0667532 | 3300046680 | Unclassified | 524 |
| 678 | Ga0495647_0005451 | 3300046681 | Bacteria | 4169 |
| 679 | Ga0495658_0043035 | 3300046683 | Bacteria | 2523 |
| 680 | Ga0495658_0378779 | 3300046683 | Bacteria | 901 |
| 681 | Ga0495658_0838887 | 3300046683 | Bacteria | 588 |
| 682 | Ga0495669_0503427 | 3300046684 | Bacteria | 589 |
| 683 | Ga0495613_0073718 | 3300046689 | Bacteria | 2487 |
| 684 | Ga0495649_0006206 | 3300046694 | Bacteria | 7460 |
| 685 | Ga0495649_0212366 | 3300046694 | Bacteria | 1002 |
| 686 | Ga0495600_0036077 | 3300046809 | Bacteria | 3213 |
| 687 | Ga0495581_0000877 | 3300047315 | Bacteria | 16067 |
| 688 | Ga0495604_0073448 | 3300047317 | Bacteria | 2582 |
| 689 | Ga0495636_0507265 | 3300047318 | Unclassified | 584 |
| 690 | Ga0495674_0144453 | 3300047319 | Bacteria | 1998 |
| 691 | Ga0495680_0046751 | 3300047322 | Bacteria | 3410 |
| 692 | Ga0495687_000232 | 3300047443 | Bacteria | 77572 |
| 693 | Ga0495684_0088468 | 3300047471 | Bacteria | 2347 |
| 694 | Ga0495684_0428927 | 3300047471 | Bacteria | 923 |
| 695 | Ga0495593_0081830 | 3300047673 | Bacteria | 1669 |
| 696 | Ga0495602_0151409 | 3300048088 | Unclassified | 1823 |
| 697 | Ga0495602_0327593 | 3300048088 | Unclassified | 1112 |
| 698 | Ga0495602_0472996 | 3300048088 | Bacteria | 881 |
| 699 | Ga0495614_0100924 | 3300048089 | Unclassified | 1261 |
| 700 | Ga0496100_0045980 | 3300048903 | Bacteria | 2804 |
| 701 | Ga0496101_0018557 | 3300048904 | Bacteria | 4732 |
| 702 | Ga0496101_0063364 | 3300048904 | Bacteria | 2691 |
| 703 | Ga0496102_0083058 | 3300048905 | Bacteria | 2955 |
| 704 | Ga0496102_0152982 | 3300048905 | Bacteria | 2168 |
| 705 | Ga0496103_0931315 | 3300048906 | Bacteria | 543 |
| 706 | Ga0496104_0012262 | 3300048907 | Bacteria | 7703 |
| 707 | Ga0496104_0562939 | 3300048907 | Bacteria | 1050 |
| 708 | Ga0496104_0918328 | 3300048907 | Bacteria | 780 |
| 709 | Ga0496105_0022388 | 3300048908 | Bacteria | 5118 |
| 710 | Ga0496105_0120301 | 3300048908 | Bacteria | 2166 |
| 711 | Ga0496106_0021541 | 3300048909 | Bacteria | 4786 |
| 712 | Ga0496106_0075683 | 3300048909 | Bacteria | 2579 |
| 713 | Ga0496107_0017834 | 3300048910 | Bacteria | 4996 |
| 714 | Ga0496108_0256473 | 3300048911 | Bacteria | 1521 |
| 715 | Ga0496108_0386257 | 3300048911 | Bacteria | 1222 |
| 716 | Ga0496108_0720491 | 3300048911 | Bacteria | 864 |
| 717 | Ga0496109_0065871 | 3300048912 | Bacteria | 3316 |
| 718 | Ga0496109_1664240 | 3300048912 | Unclassified | 572 |
| 719 | Ga0496110_0092451 | 3300048913 | Bacteria | 2707 |
| 720 | Ga0496110_0900889 | 3300048913 | Unclassified | 790 |
| 721 | Ga0496111_0039985 | 3300048914 | Bacteria | 3364 |
| 722 | Ga0496112_0001102 | 3300048915 | Bacteria | 20017 |
| 723 | Ga0496112_0431452 | 3300048915 | Bacteria | 1256 |
| 724 | Ga0496113_0892249 | 3300048916 | Bacteria | 703 |
| 725 | Ga0496114_0024703 | 3300048917 | Bacteria | 4906 |
| 726 | Ga0496114_0071403 | 3300048917 | Bacteria | 2918 |
| 727 | Ga0496114_0251246 | 3300048917 | Bacteria | 1556 |
| 728 | Ga0496115_0046876 | 3300048918 | Bacteria | 3456 |
| 729 | Ga0496115_0046886 | 3300048918 | Bacteria | 3456 |
| 730 | Ga0501033_0548204 | 3300049570 | Unclassified | 797 |
| 731 | Ga0501036_0118777 | 3300049572 | Bacteria | 2233 |
| 732 | Ga0501036_0804463 | 3300049572 | Unclassified | 774 |
| 733 | Ga0501038_0505239 | 3300049574 | Bacteria | 924 |
| 734 | Ga0501039_0160978 | 3300049575 | Bacteria | 1764 |
| 735 | Ga0501039_0761733 | 3300049575 | Unclassified | 756 |
| 736 | Ga0501040_0049789 | 3300049576 | Bacteria | 2865 |
| 737 | Ga0501040_0135556 | 3300049576 | Bacteria | 1733 |
| 738 | Ga0501040_0350364 | 3300049576 | Unclassified | 1058 |
| 739 | Ga0501041_0101154 | 3300049577 | Bacteria | 1784 |
| 740 | Ga0501041_0468026 | 3300049577 | Bacteria | 801 |
| 741 | Ga0501046_0135428 | 3300049580 | Bacteria | 1866 |
| 742 | Ga0501046_0227787 | 3300049580 | Bacteria | 1378 |
| 743 | Ga0501048_0211977 | 3300049582 | Unclassified | 1374 |
| 744 | Ga0501048_0296533 | 3300049582 | Unclassified | 1150 |
| 745 | Ga0501067_0072746 | 3300049583 | Bacteria | 1904 |
| 746 | Ga0501068_0401232 | 3300049584 | Bacteria | 884 |
| 747 | Ga0501071_0167014 | 3300049587 | Unclassified | 1647 |
| 748 | Ga0501072_0041079 | 3300049588 | Bacteria | 3632 |
| 749 | Ga0501072_0244134 | 3300049588 | Bacteria | 1430 |
| 750 | Ga0501072_0266706 | 3300049588 | Bacteria | 1363 |
| 751 | Ga0501074_0156011 | 3300049590 | Bacteria | 1631 |
| 752 | Ga0501075_0082967 | 3300049591 | Bacteria | 2428 |
| 753 | Ga0501075_0140037 | 3300049591 | Bacteria | 1843 |
| 754 | Ga0501075_0159059 | 3300049591 | Bacteria | 1723 |
| 755 | Ga0501075_0551404 | 3300049591 | Unclassified | 880 |
| 756 | Ga0501076_0166490 | 3300049592 | Bacteria | 1797 |
| 757 | Ga0501076_0178126 | 3300049592 | Unclassified | 1733 |
| 758 | Ga0501076_0301783 | 3300049592 | Bacteria | 1313 |
| 759 | Ga0501077_0435501 | 3300049593 | Bacteria | 839 |
| 760 | Ga0501079_0084474 | 3300049741 | Bacteria | 2456 |
| 761 | Ga0501079_0288108 | 3300049741 | Bacteria | 1284 |
| 762 | Ga0501080_1649433 | 3300049742 | Bacteria | 542 |
| 763 | Ga0501081_0124703 | 3300049743 | Bacteria | 1837 |
| 764 | Ga0501081_0396478 | 3300049743 | Unclassified | 1021 |
| 765 | Ga0501045_0176583 | 3300049824 | Bacteria | 1591 |
| 766 | Ga0501045_0486093 | 3300049824 | Unclassified | 917 |
| 767 | nmdc:mga03683_193709_c1 | 3300050489 | Bacteria | 931 |
| 768 | nmdc:mga03n38_421521_c1 | 3300050490 | Bacteria | 738 |
| 769 | nmdc:mga0yw44_155009_c1 | 3300050492 | Bacteria | 1496 |
| 770 | nmdc:mga0k408_3029_c1 | 3300050493 | Bacteria | 8914 |
| 771 | nmdc:mga0k408_370375_c1 | 3300050493 | Bacteria | 854 |
| 772 | nmdc:mga0k408_37632_c1 | 3300050493 | Bacteria | 2778 |
| 773 | nmdc:mga0k408_930598_c1 | 3300050493 | Bacteria | 504 |
| 774 | nmdc:mga06z11_153135_c1 | 3300050494 | Bacteria | 1312 |
| 775 | nmdc:mga07m45_10065_c1 | 3300050496 | Bacteria | 4925 |
| 776 | nmdc:mga07m45_366662_c1 | 3300050496 | Bacteria | 837 |
| 777 | nmdc:mga05p37_1367126_c1 | 3300050507 | Bacteria | 716 |
| 778 | nmdc:mga05p37_1884308_c1 | 3300050507 | Bacteria | 572 |
| 779 | nmdc:mga05p37_404_c1 | 3300050507 | Bacteria | 46806 |
| 780 | nmdc:mga05p37_42208_c1 | 3300050507 | Bacteria | 5603 |
| 781 | nmdc:mga05p37_474149_c1 | 3300050507 | Bacteria | 1443 |
| 782 | nmdc:mga09592_314777_c1 | 3300050508 | Bacteria | 1356 |
| 783 | nmdc:mga09592_360798_c1 | 3300050508 | Unclassified | 1257 |
| 784 | nmdc:mga0qj67_19003_c1 | 3300050509 | Bacteria | 5245 |
| 785 | nmdc:mga06r32_380617_c1 | 3300050510 | Bacteria | 1394 |
| 786 | nmdc:mga06r32_56858_c1 | 3300050510 | Bacteria | 3756 |
| 787 | nmdc:mga06r32_62517_c1 | 3300050510 | Bacteria | 3587 |
| 788 | nmdc:mga08y16_77615_c1 | 3300050511 | Bacteria | 3463 |
| 789 | nmdc:mga0n895_212330_c1 | 3300050512 | Bacteria | 1965 |
| 790 | nmdc:mga0n895_219346_c1 | 3300050512 | Bacteria | 1931 |
| 791 | nmdc:mga0n895_2201087_c1 | 3300050512 | Bacteria | 507 |
| 792 | nmdc:mga0n895_30835_c1 | 3300050512 | Bacteria | 5128 |
| 793 | nmdc:mga0n895_523544_c1 | 3300050512 | Bacteria | 1193 |
| 794 | nmdc:mga0rr50_126638_c1 | 3300050513 | Bacteria | 2040 |
| 795 | nmdc:mga0rr50_1525996_c1 | 3300050513 | Bacteria | 565 |
| 796 | nmdc:mga0rr50_520615_c1 | 3300050513 | Bacteria | 1012 |
| 797 | nmdc:mga08x19_105703_c1 | 3300050514 | Bacteria | 1872 |
| 798 | nmdc:mga08x19_222529_c1 | 3300050514 | Bacteria | 1297 |
| 799 | nmdc:mga08x19_284896_c1 | 3300050514 | Unclassified | 1145 |
| 800 | nmdc:mga0a205_1096938_c1 | 3300050515 | Bacteria | 643 |
| 801 | nmdc:mga0a205_11923_c1 | 3300050515 | Bacteria | 8025 |
| 802 | nmdc:mga0a205_132161_c1 | 3300050515 | Bacteria | 1385 |
| 803 | nmdc:mga0a205_185238_c1 | 3300050515 | Bacteria | 1975 |
| 804 | nmdc:mga0a205_786130_c1 | 3300050515 | Bacteria | 800 |
| 805 | nmdc:mga0sz30_208236_c1 | 3300050516 | Bacteria | 869 |
| 806 | Ga0495601_0180580 | 3300053077 | Bacteria | 1380 |
| 807 | Ga0495601_0483443 | 3300053077 | Unclassified | 800 |
| 808 | Ga0495612_0089439 | 3300053078 | Unclassified | 1302 |
| 809 | Ga0495619_0022063 | 3300053085 | Bacteria | 4070 |
| 810 | Ga0495619_0194382 | 3300053085 | Unclassified | 1404 |
| 811 | Ga0500651_0284674 | 3300053093 | Bacteria | 952 |
| 812 | Ga0500641_0012985 | 3300053096 | Bacteria | 3054 |
| 813 | Ga0500658_0003354 | 3300053134 | Bacteria | 6071 |
| 814 | Ga0500604_0241694 | 3300053151 | Bacteria | 624 |
| 815 | Ga0500611_029221 | 3300053727 | Bacteria | 1126 |
| 816 | Ga0501084_1113384 | 3300054114 | Bacteria | 663 |
| 817 | Ga0501082_0240424 | 3300060353 | Unclassified | 1576 |
| 818 | Ga0501082_0449791 | 3300060353 | Unclassified | 1125 |
| 819 | Ga0530510_0020947 | 3300061734 | Bacteria | 4649 |
| 820 | Ga0530510_0466904 | 3300061734 | Bacteria | 955 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_11150906 | Ga0105248_111509061 | 120 |
| 2 | 3300014326 | Ga0157380_10932691 | Ga0157380_109326911 | 120 |
| 3 | 3300014968 | Ga0157379_11341927 | Ga0157379_113419272 | 120 |
| 4 | 3300005467 | Ga0070706_100031309 | Ga0070706_1000313092 | 122 |
| 5 | 3300013100 | Ga0157373_10631716 | Ga0157373_106317162 | 124 |
| 6 | 3300044673 | Ga0453683_0114672 | Ga0453683_0114672_422_886 | 127 |
| 7 | 3300005467 | Ga0070706_101474278 | Ga0070706_1014742781 | 128 |
| 8 | 3300050490 | nmdc:mga03n38_421521_c1 | nmdc:mga03n38_421521_c1_17_436 | 131 |
| 9 | 3300006177 | Ga0075362_10069674 | Ga0075362_100696742 | 132 |
| 10 | 3300041486 | Ga0451807_0168116 | Ga0451807_0168116_67_519 | 132 |
| 11 | 3300046539 | Ga0495621_0049561 | Ga0495621_0049561_441_893 | 132 |
| 12 | 3300046664 | Ga0495659_0128830 | Ga0495659_0128830_218_670 | 132 |
| 13 | 3300046674 | Ga0495588_0144768 | Ga0495588_0144768_273_689 | 132 |
| 14 | 3300046684 | Ga0495669_0503427 | Ga0495669_0503427_93_545 | 132 |
| 15 | 3300050507 | nmdc:mga05p37_1367126_c1 | nmdc:mga05p37_1367126_c1_231_638 | 132 |
| 16 | 3300005331 | Ga0070670_100553005 | Ga0070670_1005530052 | 133 |
| 17 | 3300005466 | Ga0070685_11268393 | Ga0070685_112683931 | 133 |
| 18 | 3300005577 | Ga0068857_101967925 | Ga0068857_1019679252 | 133 |
| 19 | 3300006852 | Ga0075433_10579151 | Ga0075433_105791511 | 133 |
| 20 | 3300009094 | Ga0111539_10094509 | Ga0111539_100945096 | 133 |
| 21 | 3300009177 | Ga0105248_11214156 | Ga0105248_112141561 | 133 |
| 22 | 3300009553 | Ga0105249_10709169 | Ga0105249_107091692 | 133 |
| 23 | 3300013297 | Ga0157378_11465656 | Ga0157378_114656561 | 133 |
| 24 | 3300025925 | Ga0207650_11816879 | Ga0207650_118168791 | 133 |
| 25 | 3300026116 | Ga0207674_10846564 | Ga0207674_108465641 | 133 |
| 26 | 3300027907 | Ga0207428_10056081 | Ga0207428_100560811 | 133 |
| 27 | 3300050511 | nmdc:mga08y16_77615_c1 | nmdc:mga08y16_77615_c1_594_1013 | 133 |
| 28 | 3300050515 | nmdc:mga0a205_132161_c1 | nmdc:mga0a205_132161_c1_930_1349 | 133 |
| 29 | 3300053077 | Ga0495601_0483443 | Ga0495601_0483443_210_644 | 133 |
| 30 | 3300005340 | Ga0070689_100989120 | Ga0070689_1009891202 | 134 |
| 31 | 3300005434 | Ga0070709_11294968 | Ga0070709_112949681 | 134 |
| 32 | 3300005440 | Ga0070705_100723780 | Ga0070705_1007237801 | 134 |
| 33 | 3300005471 | Ga0070698_100716581 | Ga0070698_1007165812 | 134 |
| 34 | 3300005617 | Ga0068859_100585635 | Ga0068859_1005856352 | 134 |
| 35 | 3300006173 | Ga0070716_100567632 | Ga0070716_1005676321 | 134 |
| 36 | 3300006880 | Ga0075429_101218958 | Ga0075429_1012189582 | 134 |
| 37 | 3300006931 | Ga0097620_100585648 | Ga0097620_1005856482 | 134 |
| 38 | 3300007076 | Ga0075435_100117204 | Ga0075435_1001172042 | 134 |
| 39 | 3300021384 | Ga0213876_10071393 | Ga0213876_100713932 | 134 |
| 40 | 3300025906 | Ga0207699_11328793 | Ga0207699_113287931 | 134 |
| 41 | 3300025916 | Ga0207663_10919881 | Ga0207663_109198812 | 134 |
| 42 | 3300025936 | Ga0207670_10079128 | Ga0207670_100791282 | 134 |
| 43 | 3300028786 | Ga0307517_10147695 | Ga0307517_101476952 | 134 |
| 44 | 3300031456 | Ga0307513_10204672 | Ga0307513_102046722 | 134 |
| 45 | 3300031730 | Ga0307516_10513725 | Ga0307516_105137252 | 134 |
| 46 | 3300035692 | Ga0373935_0124028 | Ga0373935_0124028_629_1057 | 134 |
| 47 | 3300036401 | Ga0373937_0620904 | Ga0373937_0620904_182_610 | 134 |
| 48 | 3300037068 | Ga0373925_0016451 | Ga0373925_0016451_1812_2240 | 134 |
| 49 | 3300039437 | Ga0436365_1776998 | Ga0436365_1776998_1441_1863 | 134 |
| 50 | 3300044694 | Ga0466963_0213949 | Ga0466963_0213949_518_943 | 134 |
| 51 | 3300045976 | Ga0466967_0046561 | Ga0466967_0046561_1536_1961 | 134 |
| 52 | 3300046529 | Ga0495652_0442754 | Ga0495652_0442754_118_546 | 134 |
| 53 | 3300046642 | Ga0495634_0342130 | Ga0495634_0342130_273_701 | 134 |
| 54 | 3300046683 | Ga0495658_0378779 | Ga0495658_0378779_448_876 | 134 |
| 55 | 3300046689 | Ga0495613_0073718 | Ga0495613_0073718_1776_2204 | 134 |
| 56 | 3300047471 | Ga0495684_0428927 | Ga0495684_0428927_294_722 | 134 |
| 57 | 3300050512 | nmdc:mga0n895_219346_c1 | nmdc:mga0n895_219346_c1_609_1037 | 134 |
| 58 | 3300050512 | nmdc:mga0n895_2201087_c1 | nmdc:mga0n895_2201087_c1_57_497 | 134 |
| 59 | 3300050512 | nmdc:mga0n895_30835_c1 | nmdc:mga0n895_30835_c1_4643_5107 | 134 |
| 60 | 3300050513 | nmdc:mga0rr50_1525996_c1 | nmdc:mga0rr50_1525996_c1_59_499 | 134 |
| 61 | 3300050513 | nmdc:mga0rr50_520615_c1 | nmdc:mga0rr50_520615_c1_296_760 | 134 |
| 62 | 3300050514 | nmdc:mga08x19_105703_c1 | nmdc:mga08x19_105703_c1_547_1011 | 134 |
| 63 | 3300050515 | nmdc:mga0a205_786130_c1 | nmdc:mga0a205_786130_c1_12_452 | 134 |
| 64 | 3300005937 | Ga0081455_10276089 | Ga0081455_102760891 | 135 |
| 65 | 3300005983 | Ga0081540_1002355 | Ga0081540_10023555 | 135 |
| 66 | 3300005983 | Ga0081540_1302219 | Ga0081540_13022191 | 135 |
| 67 | 3300005985 | Ga0081539_10001260 | Ga0081539_100012609 | 135 |
| 68 | 3300009147 | Ga0114129_10687450 | Ga0114129_106874502 | 135 |
| 69 | 3300021361 | Ga0213872_10041931 | Ga0213872_100419312 | 135 |
| 70 | 3300025922 | Ga0207646_11102820 | Ga0207646_111028201 | 135 |
| 71 | 3300035692 | Ga0373935_0051920 | Ga0373935_0051920_223_684 | 135 |
| 72 | 3300035695 | Ga0373927_0001889 | Ga0373927_0001889_1229_1690 | 135 |
| 73 | 3300037853 | Ga0436364_0110143 | Ga0436364_0110143_29_454 | 135 |
| 74 | 3300039447 | Ga0436361_0437114 | Ga0436361_0437114_4849_5307 | 135 |
| 75 | 3300046472 | Ga0495580_0086219 | Ga0495580_0086219_631_1092 | 135 |
| 76 | 3300053096 | Ga0500641_0012985 | Ga0500641_0012985_1898_2323 | 135 |
| 77 | 3300053151 | Ga0500604_0241694 | Ga0500604_0241694_71_496 | 135 |
| 78 | 3300005549 | Ga0070704_100526117 | Ga0070704_1005261172 | 136 |
| 79 | 3300005617 | Ga0068859_100776220 | Ga0068859_1007762201 | 136 |
| 80 | 3300005937 | Ga0081455_10501641 | Ga0081455_105016412 | 136 |
| 81 | 3300006931 | Ga0097620_100776202 | Ga0097620_1007762022 | 136 |
| 82 | 3300021384 | Ga0213876_10033283 | Ga0213876_100332833 | 136 |
| 83 | 3300036401 | Ga0373937_0837527 | Ga0373937_0837527_224_646 | 136 |
| 84 | 3300037068 | Ga0373925_0264113 | Ga0373925_0264113_896_1324 | 136 |
| 85 | 3300039437 | Ga0436365_1085891 | Ga0436365_1085891_322_825 | 136 |
| 86 | 3300046519 | Ga0495632_0025548 | Ga0495632_0025548_376_804 | 136 |
| 87 | 3300046542 | Ga0495597_0039435 | Ga0495597_0039435_78_506 | 136 |
| 88 | 3300046660 | Ga0495625_0013437 | Ga0495625_0013437_510_938 | 136 |
| 89 | 3300046694 | Ga0495649_0006206 | Ga0495649_0006206_4693_5121 | 136 |
| 90 | 3300046694 | Ga0495649_0212366 | Ga0495649_0212366_409_837 | 136 |
| 91 | 3300047443 | Ga0495687_000232 | Ga0495687_000232_68563_68991 | 136 |
| 92 | 3300049572 | Ga0501036_0118777 | Ga0501036_0118777_882_1310 | 136 |
| 93 | 3300049574 | Ga0501038_0505239 | Ga0501038_0505239_80_508 | 136 |
| 94 | 3300049577 | Ga0501041_0101154 | Ga0501041_0101154_319_747 | 136 |
| 95 | 3300049580 | Ga0501046_0227787 | Ga0501046_0227787_103_531 | 136 |
| 96 | 3300049582 | Ga0501048_0296533 | Ga0501048_0296533_415_843 | 136 |
| 97 | 3300049587 | Ga0501071_0167014 | Ga0501071_0167014_998_1426 | 136 |
| 98 | 3300049588 | Ga0501072_0244134 | Ga0501072_0244134_409_837 | 136 |
| 99 | 3300049591 | Ga0501075_0140037 | Ga0501075_0140037_29_457 | 136 |
| 100 | 3300049591 | Ga0501075_0159059 | Ga0501075_0159059_1278_1706 | 136 |
| 101 | 3300049592 | Ga0501076_0301783 | Ga0501076_0301783_115_543 | 136 |
| 102 | 3300049593 | Ga0501077_0435501 | Ga0501077_0435501_365_793 | 136 |
| 103 | 3300049742 | Ga0501080_1649433 | Ga0501080_1649433_13_441 | 136 |
| 104 | 3300049743 | Ga0501081_0124703 | Ga0501081_0124703_177_605 | 136 |
| 105 | 3300049824 | Ga0501045_0176583 | Ga0501045_0176583_556_984 | 136 |
| 106 | 3300050493 | nmdc:mga0k408_37632_c1 | nmdc:mga0k408_37632_c1_1449_1877 | 136 |
| 107 | 3300050496 | nmdc:mga07m45_366662_c1 | nmdc:mga07m45_366662_c1_280_708 | 136 |
| 108 | 3300050515 | nmdc:mga0a205_1096938_c1 | nmdc:mga0a205_1096938_c1_30_458 | 136 |
| 109 | 3300053093 | Ga0500651_0284674 | Ga0500651_0284674_412_840 | 136 |
| 110 | 3300053134 | Ga0500658_0003354 | Ga0500658_0003354_4068_4496 | 136 |
| 111 | 3300054114 | Ga0501084_1113384 | Ga0501084_1113384_214_642 | 136 |
| 112 | 3300060353 | Ga0501082_0449791 | Ga0501082_0449791_482_910 | 136 |
| 113 | 3300061734 | Ga0530510_0020947 | Ga0530510_0020947_2505_2933 | 136 |
| 114 | 3300006178 | Ga0075367_10599672 | Ga0075367_105996722 | 137 |
| 115 | 3300048088 | Ga0495602_0472996 | Ga0495602_0472996_260_706 | 137 |
| 116 | 3300005328 | Ga0070676_10008651 | Ga0070676_100086514 | 138 |
| 117 | 3300005330 | Ga0070690_100986727 | Ga0070690_1009867271 | 138 |
| 118 | 3300005334 | Ga0068869_100002612 | Ga0068869_1000026128 | 138 |
| 119 | 3300005335 | Ga0070666_10318896 | Ga0070666_103188961 | 138 |
| 120 | 3300005338 | Ga0068868_100011018 | Ga0068868_1000110182 | 138 |
| 121 | 3300005339 | Ga0070660_100046404 | Ga0070660_1000464044 | 138 |
| 122 | 3300005339 | Ga0070660_100473312 | Ga0070660_1004733122 | 138 |
| 123 | 3300005343 | Ga0070687_100389989 | Ga0070687_1003899891 | 138 |
| 124 | 3300005344 | Ga0070661_100057264 | Ga0070661_1000572642 | 138 |
| 125 | 3300005353 | Ga0070669_100038103 | Ga0070669_1000381034 | 138 |
| 126 | 3300005354 | Ga0070675_100009133 | Ga0070675_1000091339 | 138 |
| 127 | 3300005355 | Ga0070671_100012115 | Ga0070671_1000121156 | 138 |
| 128 | 3300005366 | Ga0070659_100060128 | Ga0070659_1000601282 | 138 |
| 129 | 3300005367 | Ga0070667_100020095 | Ga0070667_1000200957 | 138 |
| 130 | 3300005367 | Ga0070667_100158125 | Ga0070667_1001581253 | 138 |
| 131 | 3300005440 | Ga0070705_100569721 | Ga0070705_1005697211 | 138 |
| 132 | 3300005455 | Ga0070663_100008867 | Ga0070663_1000088672 | 138 |
| 133 | 3300005456 | Ga0070678_100389684 | Ga0070678_1003896842 | 138 |
| 134 | 3300005457 | Ga0070662_100004156 | Ga0070662_1000041564 | 138 |
| 135 | 3300005459 | Ga0068867_100667242 | Ga0068867_1006672422 | 138 |
| 136 | 3300005539 | Ga0068853_100069426 | Ga0068853_1000694262 | 138 |
| 137 | 3300005543 | Ga0070672_101136940 | Ga0070672_1011369402 | 138 |
| 138 | 3300005545 | Ga0070695_100380461 | Ga0070695_1003804612 | 138 |
| 139 | 3300005547 | Ga0070693_100236457 | Ga0070693_1002364572 | 138 |
| 140 | 3300005563 | Ga0068855_100119375 | Ga0068855_1001193753 | 138 |
| 141 | 3300005564 | Ga0070664_100450594 | Ga0070664_1004505942 | 138 |
| 142 | 3300005578 | Ga0068854_100143534 | Ga0068854_1001435342 | 138 |
| 143 | 3300005614 | Ga0068856_100074100 | Ga0068856_1000741004 | 138 |
| 144 | 3300005615 | Ga0070702_100622013 | Ga0070702_1006220132 | 138 |
| 145 | 3300005616 | Ga0068852_100055175 | Ga0068852_1000551752 | 138 |
| 146 | 3300005616 | Ga0068852_100640850 | Ga0068852_1006408502 | 138 |
| 147 | 3300005617 | Ga0068859_100145752 | Ga0068859_1001457522 | 138 |
| 148 | 3300005618 | Ga0068864_100024876 | Ga0068864_1000248764 | 138 |
| 149 | 3300005719 | Ga0068861_100001656 | Ga0068861_1000016568 | 138 |
| 150 | 3300005834 | Ga0068851_10374715 | Ga0068851_103747152 | 138 |
| 151 | 3300005842 | Ga0068858_100007759 | Ga0068858_1000077599 | 138 |
| 152 | 3300005842 | Ga0068858_100024644 | Ga0068858_1000246443 | 138 |
| 153 | 3300005843 | Ga0068860_100046309 | Ga0068860_1000463094 | 138 |
| 154 | 3300005843 | Ga0068860_100430053 | Ga0068860_1004300533 | 138 |
| 155 | 3300006237 | Ga0097621_100042768 | Ga0097621_1000427684 | 138 |
| 156 | 3300006358 | Ga0068871_100012264 | Ga0068871_1000122646 | 138 |
| 157 | 3300006871 | Ga0075434_100999130 | Ga0075434_1009991302 | 138 |
| 158 | 3300006881 | Ga0068865_101329452 | Ga0068865_1013294521 | 138 |
| 159 | 3300006931 | Ga0097620_100145763 | Ga0097620_1001457632 | 138 |
| 160 | 3300009098 | Ga0105245_10067867 | Ga0105245_100678674 | 138 |
| 161 | 3300009174 | Ga0105241_10233341 | Ga0105241_102333413 | 138 |
| 162 | 3300009177 | Ga0105248_10046529 | Ga0105248_100465295 | 138 |
| 163 | 3300009177 | Ga0105248_10533064 | Ga0105248_105330641 | 138 |
| 164 | 3300009551 | Ga0105238_10290805 | Ga0105238_102908052 | 138 |
| 165 | 3300009553 | Ga0105249_10722504 | Ga0105249_107225042 | 138 |
| 166 | 3300010375 | Ga0105239_10096982 | Ga0105239_100969822 | 138 |
| 167 | 3300013102 | Ga0157371_10525203 | Ga0157371_105252031 | 138 |
| 168 | 3300013105 | Ga0157369_10187861 | Ga0157369_101878612 | 138 |
| 169 | 3300013296 | Ga0157374_10055848 | Ga0157374_100558481 | 138 |
| 170 | 3300013306 | Ga0163162_10558721 | Ga0163162_105587212 | 138 |
| 171 | 3300013307 | Ga0157372_10097987 | Ga0157372_100979872 | 138 |
| 172 | 3300013308 | Ga0157375_10116452 | Ga0157375_101164524 | 138 |
| 173 | 3300014745 | Ga0157377_10001260 | Ga0157377_100012605 | 138 |
| 174 | 3300014968 | Ga0157379_10020789 | Ga0157379_100207894 | 138 |
| 175 | 3300014968 | Ga0157379_10040876 | Ga0157379_100408764 | 138 |
| 176 | 3300014969 | Ga0157376_10276889 | Ga0157376_102768892 | 138 |
| 177 | 3300017792 | Ga0163161_10005526 | Ga0163161_100055265 | 138 |
| 178 | 3300025321 | Ga0207656_10013567 | Ga0207656_100135672 | 138 |
| 179 | 3300025321 | Ga0207656_10249789 | Ga0207656_102497892 | 138 |
| 180 | 3300025901 | Ga0207688_10021565 | Ga0207688_100215654 | 138 |
| 181 | 3300025903 | Ga0207680_10332589 | Ga0207680_103325892 | 138 |
| 182 | 3300025907 | Ga0207645_10058373 | Ga0207645_100583732 | 138 |
| 183 | 3300025911 | Ga0207654_11438957 | Ga0207654_114389571 | 138 |
| 184 | 3300025918 | Ga0207662_10022083 | Ga0207662_100220834 | 138 |
| 185 | 3300025918 | Ga0207662_11017788 | Ga0207662_110177881 | 138 |
| 186 | 3300025919 | Ga0207657_10208414 | Ga0207657_102084142 | 138 |
| 187 | 3300025920 | Ga0207649_10034334 | Ga0207649_100343342 | 138 |
| 188 | 3300025922 | Ga0207646_10600374 | Ga0207646_106003742 | 138 |
| 189 | 3300025923 | Ga0207681_10004317 | Ga0207681_100043175 | 138 |
| 190 | 3300025923 | Ga0207681_11572073 | Ga0207681_115720731 | 138 |
| 191 | 3300025924 | Ga0207694_10202145 | Ga0207694_102021452 | 138 |
| 192 | 3300025926 | Ga0207659_10038033 | Ga0207659_100380333 | 138 |
| 193 | 3300025927 | Ga0207687_10064857 | Ga0207687_100648574 | 138 |
| 194 | 3300025932 | Ga0207690_10039233 | Ga0207690_100392334 | 138 |
| 195 | 3300025933 | Ga0207706_10001995 | Ga0207706_100019952 | 138 |
| 196 | 3300025940 | Ga0207691_10036442 | Ga0207691_100364426 | 138 |
| 197 | 3300025941 | Ga0207711_10009070 | Ga0207711_100090703 | 138 |
| 198 | 3300025941 | Ga0207711_10550158 | Ga0207711_105501582 | 138 |
| 199 | 3300025942 | Ga0207689_10000996 | Ga0207689_100009962 | 138 |
| 200 | 3300025944 | Ga0207661_10728739 | Ga0207661_107287392 | 138 |
| 201 | 3300025945 | Ga0207679_10569649 | Ga0207679_105696492 | 138 |
| 202 | 3300025949 | Ga0207667_10052553 | Ga0207667_100525533 | 138 |
| 203 | 3300025972 | Ga0207668_10104172 | Ga0207668_101041723 | 138 |
| 204 | 3300025981 | Ga0207640_10021812 | Ga0207640_100218123 | 138 |
| 205 | 3300025986 | Ga0207658_10025475 | Ga0207658_100254752 | 138 |
| 206 | 3300026023 | Ga0207677_10000853 | Ga0207677_100008534 | 138 |
| 207 | 3300026035 | Ga0207703_10009640 | Ga0207703_100096402 | 138 |
| 208 | 3300026035 | Ga0207703_10105983 | Ga0207703_101059833 | 138 |
| 209 | 3300026041 | Ga0207639_10012372 | Ga0207639_100123724 | 138 |
| 210 | 3300026041 | Ga0207639_10122024 | Ga0207639_101220243 | 138 |
| 211 | 3300026067 | Ga0207678_10052391 | Ga0207678_100523914 | 138 |
| 212 | 3300026078 | Ga0207702_10235550 | Ga0207702_102355502 | 138 |
| 213 | 3300026089 | Ga0207648_10692580 | Ga0207648_106925802 | 138 |
| 214 | 3300026095 | Ga0207676_10003408 | Ga0207676_1000340810 | 138 |
| 215 | 3300026118 | Ga0207675_100055575 | Ga0207675_1000555752 | 138 |
| 216 | 3300026121 | Ga0207683_10248280 | Ga0207683_102482802 | 138 |
| 217 | 3300026142 | Ga0207698_10029833 | Ga0207698_100298335 | 138 |
| 218 | 3300026142 | Ga0207698_10047442 | Ga0207698_100474422 | 138 |
| 219 | 3300028381 | Ga0268264_10011726 | Ga0268264_100117262 | 138 |
| 220 | 3300028381 | Ga0268264_10218105 | Ga0268264_102181053 | 138 |
| 221 | 3300035084 | Ga0373928_0058569 | Ga0373928_0058569_468_902 | 138 |
| 222 | 3300035114 | Ga0373939_0032447 | Ga0373939_0032447_941_1375 | 138 |
| 223 | 3300035115 | Ga0373941_0026364 | Ga0373941_0026364_542_976 | 138 |
| 224 | 3300035121 | Ga0373960_0203947 | Ga0373960_0203947_197_631 | 138 |
| 225 | 3300035242 | Ga0373962_0033626 | Ga0373962_0033626_218_652 | 138 |
| 226 | 3300035691 | Ga0373931_0147572 | Ga0373931_0147572_916_1350 | 138 |
| 227 | 3300039437 | Ga0436365_0772642 | Ga0436365_0772642_980_1414 | 138 |
| 228 | 3300039450 | Ga0436363_0187732 | Ga0436363_0187732_955_1389 | 138 |
| 229 | 3300045051 | Ga0451576_0093427 | Ga0451576_0093427_208_642 | 138 |
| 230 | 3300045051 | Ga0451576_0867349 | Ga0451576_0867349_453_887 | 138 |
| 231 | 3300048904 | Ga0496101_0018557 | Ga0496101_0018557_18_452 | 138 |
| 232 | 3300048905 | Ga0496102_0152982 | Ga0496102_0152982_573_1007 | 138 |
| 233 | 3300048907 | Ga0496104_0562939 | Ga0496104_0562939_157_591 | 138 |
| 234 | 3300048908 | Ga0496105_0120301 | Ga0496105_0120301_1150_1584 | 138 |
| 235 | 3300048909 | Ga0496106_0021541 | Ga0496106_0021541_3750_4184 | 138 |
| 236 | 3300048910 | Ga0496107_0017834 | Ga0496107_0017834_2128_2562 | 138 |
| 237 | 3300048911 | Ga0496108_0386257 | Ga0496108_0386257_248_682 | 138 |
| 238 | 3300048912 | Ga0496109_0065871 | Ga0496109_0065871_513_947 | 138 |
| 239 | 3300048912 | Ga0496109_1664240 | Ga0496109_1664240_32_466 | 138 |
| 240 | 3300048913 | Ga0496110_0092451 | Ga0496110_0092451_1099_1533 | 138 |
| 241 | 3300048914 | Ga0496111_0039985 | Ga0496111_0039985_1054_1488 | 138 |
| 242 | 3300048915 | Ga0496112_0431452 | Ga0496112_0431452_321_755 | 138 |
| 243 | 3300048916 | Ga0496113_0892249 | Ga0496113_0892249_256_690 | 138 |
| 244 | 3300048917 | Ga0496114_0024703 | Ga0496114_0024703_2444_2878 | 138 |
| 245 | 3300048918 | Ga0496115_0046876 | Ga0496115_0046876_1805_2239 | 138 |
| 246 | 3300050512 | nmdc:mga0n895_523544_c1 | nmdc:mga0n895_523544_c1_480_914 | 138 |
| 247 | 3300005293 | Ga0065715_10187031 | Ga0065715_101870312 | 139 |
| 248 | 3300005406 | Ga0070703_10000289 | Ga0070703_100002894 | 139 |
| 249 | 3300005406 | Ga0070703_10203181 | Ga0070703_102031811 | 139 |
| 250 | 3300005440 | Ga0070705_100000034 | Ga0070705_10000003411 | 139 |
| 251 | 3300005444 | Ga0070694_100128891 | Ga0070694_1001288912 | 139 |
| 252 | 3300005444 | Ga0070694_100505200 | Ga0070694_1005052001 | 139 |
| 253 | 3300005445 | Ga0070708_100021520 | Ga0070708_1000215203 | 139 |
| 254 | 3300005467 | Ga0070706_100000020 | Ga0070706_10000002082 | 139 |
| 255 | 3300005467 | Ga0070706_100694151 | Ga0070706_1006941512 | 139 |
| 256 | 3300005471 | Ga0070698_100412736 | Ga0070698_1004127362 | 139 |
| 257 | 3300005518 | Ga0070699_100000083 | Ga0070699_10000008326 | 139 |
| 258 | 3300005536 | Ga0070697_100580118 | Ga0070697_1005801182 | 139 |
| 259 | 3300005545 | Ga0070695_100019523 | Ga0070695_1000195232 | 139 |
| 260 | 3300005546 | Ga0070696_100000120 | Ga0070696_1000001209 | 139 |
| 261 | 3300005546 | Ga0070696_100011234 | Ga0070696_1000112345 | 139 |
| 262 | 3300005547 | Ga0070693_100001489 | Ga0070693_1000014893 | 139 |
| 263 | 3300005719 | Ga0068861_100031007 | Ga0068861_1000310072 | 139 |
| 264 | 3300005937 | Ga0081455_10273343 | Ga0081455_102733431 | 139 |
| 265 | 3300006048 | Ga0075363_100027009 | Ga0075363_1000270092 | 139 |
| 266 | 3300006844 | Ga0075428_100121770 | Ga0075428_1001217702 | 139 |
| 267 | 3300006846 | Ga0075430_100045632 | Ga0075430_1000456327 | 139 |
| 268 | 3300006847 | Ga0075431_100097979 | Ga0075431_1000979792 | 139 |
| 269 | 3300006852 | Ga0075433_10264583 | Ga0075433_102645832 | 139 |
| 270 | 3300006852 | Ga0075433_11440657 | Ga0075433_114406572 | 139 |
| 271 | 3300006871 | Ga0075434_100072407 | Ga0075434_1000724072 | 139 |
| 272 | 3300006880 | Ga0075429_100008641 | Ga0075429_1000086419 | 139 |
| 273 | 3300006914 | Ga0075436_100155410 | Ga0075436_1001554102 | 139 |
| 274 | 3300007076 | Ga0075435_100594608 | Ga0075435_1005946082 | 139 |
| 275 | 3300009147 | Ga0114129_10036594 | Ga0114129_100365949 | 139 |
| 276 | 3300009147 | Ga0114129_10535653 | Ga0114129_105356532 | 139 |
| 277 | 3300009148 | Ga0105243_11147194 | Ga0105243_111471941 | 139 |
| 278 | 3300009553 | Ga0105249_10152484 | Ga0105249_101524842 | 139 |
| 279 | 3300025885 | Ga0207653_10000339 | Ga0207653_100003395 | 139 |
| 280 | 3300025910 | Ga0207684_10000215 | Ga0207684_1000021582 | 139 |
| 281 | 3300025910 | Ga0207684_10921153 | Ga0207684_109211531 | 139 |
| 282 | 3300025939 | Ga0207665_10160126 | Ga0207665_101601263 | 139 |
| 283 | 3300025961 | Ga0207712_10090175 | Ga0207712_100901752 | 139 |
| 284 | 3300026118 | Ga0207675_100036403 | Ga0207675_1000364033 | 139 |
| 285 | 3300044673 | Ga0453683_0234265 | Ga0453683_0234265_495_974 | 139 |
| 286 | 3300046531 | Ga0495665_0404454 | Ga0495665_0404454_143_562 | 139 |
| 287 | 3300049570 | Ga0501033_0548204 | Ga0501033_0548204_37_477 | 139 |
| 288 | 3300049576 | Ga0501040_0049789 | Ga0501040_0049789_83_523 | 139 |
| 289 | 3300049591 | Ga0501075_0082967 | Ga0501075_0082967_33_473 | 139 |
| 290 | 3300049741 | Ga0501079_0084474 | Ga0501079_0084474_658_1098 | 139 |
| 291 | 3300049743 | Ga0501081_0396478 | Ga0501081_0396478_30_470 | 139 |
| 292 | 3300049824 | Ga0501045_0486093 | Ga0501045_0486093_51_491 | 139 |
| 293 | 3300050492 | nmdc:mga0yw44_155009_c1 | nmdc:mga0yw44_155009_c1_200_643 | 139 |
| 294 | 3300050507 | nmdc:mga05p37_404_c1 | nmdc:mga05p37_404_c1_41115_41594 | 139 |
| 295 | 3300050507 | nmdc:mga05p37_42208_c1 | nmdc:mga05p37_42208_c1_209_646 | 139 |
| 296 | 3300050508 | nmdc:mga09592_314777_c1 | nmdc:mga09592_314777_c1_248_685 | 139 |
| 297 | 3300050510 | nmdc:mga06r32_56858_c1 | nmdc:mga06r32_56858_c1_2625_3062 | 139 |
| 298 | 3300050515 | nmdc:mga0a205_11923_c1 | nmdc:mga0a205_11923_c1_2414_2875 | 139 |
| 299 | 3300005406 | Ga0070703_10574107 | Ga0070703_105741071 | 140 |
| 300 | 3300005440 | Ga0070705_100007970 | Ga0070705_1000079703 | 140 |
| 301 | 3300005471 | Ga0070698_101448863 | Ga0070698_1014488631 | 140 |
| 302 | 3300005844 | Ga0068862_101065943 | Ga0068862_1010659431 | 140 |
| 303 | 3300006847 | Ga0075431_100032223 | Ga0075431_1000322232 | 140 |
| 304 | 3300006847 | Ga0075431_101060407 | Ga0075431_1010604071 | 140 |
| 305 | 3300009094 | Ga0111539_11025236 | Ga0111539_110252362 | 140 |
| 306 | 3300009147 | Ga0114129_10133215 | Ga0114129_101332151 | 140 |
| 307 | 3300009147 | Ga0114129_11657059 | Ga0114129_116570591 | 140 |
| 308 | 3300025923 | Ga0207681_10197969 | Ga0207681_101979691 | 140 |
| 309 | 3300028380 | Ga0268265_10738886 | Ga0268265_107388861 | 140 |
| 310 | 3300031250 | Ga0265331_10263892 | Ga0265331_102638921 | 140 |
| 311 | 3300031548 | Ga0307408_100021342 | Ga0307408_1000213425 | 140 |
| 312 | 3300031911 | Ga0307412_11489219 | Ga0307412_114892191 | 140 |
| 313 | 3300035725 | Ga0373947_0368404 | Ga0373947_0368404_254_697 | 140 |
| 314 | 3300036401 | Ga0373937_0809081 | Ga0373937_0809081_133_576 | 140 |
| 315 | 3300039437 | Ga0436365_0982517 | Ga0436365_0982517_252_698 | 140 |
| 316 | 3300046472 | Ga0495580_0119473 | Ga0495580_0119473_964_1407 | 140 |
| 317 | 3300047318 | Ga0495636_0507265 | Ga0495636_0507265_43_486 | 140 |
| 318 | 3300049575 | Ga0501039_0761733 | Ga0501039_0761733_251_691 | 140 |
| 319 | 3300050507 | nmdc:mga05p37_1884308_c1 | nmdc:mga05p37_1884308_c1_50_490 | 140 |
| 320 | 3300050507 | nmdc:mga05p37_474149_c1 | nmdc:mga05p37_474149_c1_825_1268 | 140 |
| 321 | 3300050508 | nmdc:mga09592_360798_c1 | nmdc:mga09592_360798_c1_516_959 | 140 |
| 322 | 3300050514 | nmdc:mga08x19_222529_c1 | nmdc:mga08x19_222529_c1_527_970 | 140 |
| 323 | 3300050515 | nmdc:mga0a205_185238_c1 | nmdc:mga0a205_185238_c1_889_1332 | 140 |
| 324 | 3300005295 | Ga0065707_10272951 | Ga0065707_102729511 | 141 |
| 325 | 3300005295 | Ga0065707_10548314 | Ga0065707_105483141 | 141 |
| 326 | 3300005330 | Ga0070690_100161526 | Ga0070690_1001615262 | 141 |
| 327 | 3300005334 | Ga0068869_100155924 | Ga0068869_1001559243 | 141 |
| 328 | 3300005338 | Ga0068868_102403885 | Ga0068868_1024038851 | 141 |
| 329 | 3300005345 | Ga0070692_10157708 | Ga0070692_101577082 | 141 |
| 330 | 3300005347 | Ga0070668_100431304 | Ga0070668_1004313042 | 141 |
| 331 | 3300005355 | Ga0070671_100691472 | Ga0070671_1006914721 | 141 |
| 332 | 3300005356 | Ga0070674_100165213 | Ga0070674_1001652133 | 141 |
| 333 | 3300005440 | Ga0070705_100457912 | Ga0070705_1004579122 | 141 |
| 334 | 3300005440 | Ga0070705_100987271 | Ga0070705_1009872711 | 141 |
| 335 | 3300005444 | Ga0070694_100177232 | Ga0070694_1001772322 | 141 |
| 336 | 3300005445 | Ga0070708_100176313 | Ga0070708_1001763132 | 141 |
| 337 | 3300005445 | Ga0070708_100339417 | Ga0070708_1003394172 | 141 |
| 338 | 3300005445 | Ga0070708_100882185 | Ga0070708_1008821851 | 141 |
| 339 | 3300005445 | Ga0070708_101102493 | Ga0070708_1011024931 | 141 |
| 340 | 3300005456 | Ga0070678_101639771 | Ga0070678_1016397711 | 141 |
| 341 | 3300005459 | Ga0068867_100719161 | Ga0068867_1007191612 | 141 |
| 342 | 3300005467 | Ga0070706_100023493 | Ga0070706_1000234932 | 141 |
| 343 | 3300005467 | Ga0070706_100083205 | Ga0070706_1000832051 | 141 |
| 344 | 3300005467 | Ga0070706_100279069 | Ga0070706_1002790691 | 141 |
| 345 | 3300005468 | Ga0070707_100198402 | Ga0070707_1001984022 | 141 |
| 346 | 3300005468 | Ga0070707_100579577 | Ga0070707_1005795771 | 141 |
| 347 | 3300005471 | Ga0070698_100035528 | Ga0070698_1000355287 | 141 |
| 348 | 3300005471 | Ga0070698_100040630 | Ga0070698_1000406305 | 141 |
| 349 | 3300005471 | Ga0070698_101140979 | Ga0070698_1011409792 | 141 |
| 350 | 3300005471 | Ga0070698_101672469 | Ga0070698_1016724691 | 141 |
| 351 | 3300005518 | Ga0070699_100023392 | Ga0070699_1000233928 | 141 |
| 352 | 3300005518 | Ga0070699_100025869 | Ga0070699_1000258695 | 141 |
| 353 | 3300005536 | Ga0070697_100004869 | Ga0070697_10000486911 | 141 |
| 354 | 3300005536 | Ga0070697_100082213 | Ga0070697_1000822132 | 141 |
| 355 | 3300005543 | Ga0070672_100063683 | Ga0070672_1000636832 | 141 |
| 356 | 3300005544 | Ga0070686_100092389 | Ga0070686_1000923891 | 141 |
| 357 | 3300005544 | Ga0070686_100530051 | Ga0070686_1005300511 | 141 |
| 358 | 3300005578 | Ga0068854_100713125 | Ga0068854_1007131252 | 141 |
| 359 | 3300005615 | Ga0070702_100709724 | Ga0070702_1007097241 | 141 |
| 360 | 3300005616 | Ga0068852_102014144 | Ga0068852_1020141441 | 141 |
| 361 | 3300005617 | Ga0068859_100230541 | Ga0068859_1002305411 | 141 |
| 362 | 3300005617 | Ga0068859_100366813 | Ga0068859_1003668132 | 141 |
| 363 | 3300005617 | Ga0068859_100374627 | Ga0068859_1003746272 | 141 |
| 364 | 3300005618 | Ga0068864_100006922 | Ga0068864_1000069225 | 141 |
| 365 | 3300005618 | Ga0068864_100776178 | Ga0068864_1007761782 | 141 |
| 366 | 3300005718 | Ga0068866_10022882 | Ga0068866_100228826 | 141 |
| 367 | 3300005719 | Ga0068861_100017797 | Ga0068861_1000177976 | 141 |
| 368 | 3300005719 | Ga0068861_100451875 | Ga0068861_1004518752 | 141 |
| 369 | 3300005841 | Ga0068863_100192153 | Ga0068863_1001921532 | 141 |
| 370 | 3300005842 | Ga0068858_100158605 | Ga0068858_1001586052 | 141 |
| 371 | 3300005842 | Ga0068858_100275074 | Ga0068858_1002750742 | 141 |
| 372 | 3300005843 | Ga0068860_100043664 | Ga0068860_1000436642 | 141 |
| 373 | 3300005843 | Ga0068860_100623001 | Ga0068860_1006230013 | 141 |
| 374 | 3300005843 | Ga0068860_101908884 | Ga0068860_1019088842 | 141 |
| 375 | 3300005844 | Ga0068862_100012492 | Ga0068862_1000124923 | 141 |
| 376 | 3300005844 | Ga0068862_100065547 | Ga0068862_1000655471 | 141 |
| 377 | 3300006186 | Ga0075369_10146879 | Ga0075369_101468791 | 141 |
| 378 | 3300006195 | Ga0075366_10002856 | Ga0075366_100028567 | 141 |
| 379 | 3300006195 | Ga0075366_10090939 | Ga0075366_100909392 | 141 |
| 380 | 3300006195 | Ga0075366_10340332 | Ga0075366_103403322 | 141 |
| 381 | 3300006353 | Ga0075370_10020280 | Ga0075370_100202804 | 141 |
| 382 | 3300006881 | Ga0068865_100234054 | Ga0068865_1002340541 | 141 |
| 383 | 3300006914 | Ga0075436_100106662 | Ga0075436_1001066623 | 141 |
| 384 | 3300006931 | Ga0097620_100230535 | Ga0097620_1002305351 | 141 |
| 385 | 3300006931 | Ga0097620_100366796 | Ga0097620_1003667962 | 141 |
| 386 | 3300006931 | Ga0097620_100374679 | Ga0097620_1003746792 | 141 |
| 387 | 3300009098 | Ga0105245_10081563 | Ga0105245_100815632 | 141 |
| 388 | 3300009101 | Ga0105247_10336857 | Ga0105247_103368571 | 141 |
| 389 | 3300009174 | Ga0105241_10715456 | Ga0105241_107154562 | 141 |
| 390 | 3300009176 | Ga0105242_10390964 | Ga0105242_103909643 | 141 |
| 391 | 3300009551 | Ga0105238_10332826 | Ga0105238_103328262 | 141 |
| 392 | 3300009553 | Ga0105249_10013045 | Ga0105249_100130458 | 141 |
| 393 | 3300009553 | Ga0105249_11018473 | Ga0105249_110184732 | 141 |
| 394 | 3300011119 | Ga0105246_10167350 | Ga0105246_101673501 | 141 |
| 395 | 3300013306 | Ga0163162_10162205 | Ga0163162_101622053 | 141 |
| 396 | 3300013306 | Ga0163162_10567616 | Ga0163162_105676162 | 141 |
| 397 | 3300014326 | Ga0157380_10098910 | Ga0157380_100989104 | 141 |
| 398 | 3300014326 | Ga0157380_10976274 | Ga0157380_109762741 | 141 |
| 399 | 3300014968 | Ga0157379_10244992 | Ga0157379_102449922 | 141 |
| 400 | 3300014969 | Ga0157376_10845186 | Ga0157376_108451861 | 141 |
| 401 | 3300025885 | Ga0207653_10184291 | Ga0207653_101842911 | 141 |
| 402 | 3300025899 | Ga0207642_10039888 | Ga0207642_100398884 | 141 |
| 403 | 3300025910 | Ga0207684_10018374 | Ga0207684_100183747 | 141 |
| 404 | 3300025910 | Ga0207684_10038127 | Ga0207684_100381274 | 141 |
| 405 | 3300025910 | Ga0207684_10039192 | Ga0207684_100391922 | 141 |
| 406 | 3300025910 | Ga0207684_10101280 | Ga0207684_101012802 | 141 |
| 407 | 3300025910 | Ga0207684_10114491 | Ga0207684_101144911 | 141 |
| 408 | 3300025922 | Ga0207646_10045761 | Ga0207646_100457613 | 141 |
| 409 | 3300025922 | Ga0207646_10075551 | Ga0207646_100755511 | 141 |
| 410 | 3300025922 | Ga0207646_10796117 | Ga0207646_107961172 | 141 |
| 411 | 3300025924 | Ga0207694_10226820 | Ga0207694_102268202 | 141 |
| 412 | 3300025927 | Ga0207687_10292272 | Ga0207687_102922722 | 141 |
| 413 | 3300025931 | Ga0207644_10021539 | Ga0207644_100215392 | 141 |
| 414 | 3300025937 | Ga0207669_10992781 | Ga0207669_109927812 | 141 |
| 415 | 3300025938 | Ga0207704_10094593 | Ga0207704_100945931 | 141 |
| 416 | 3300025940 | Ga0207691_10074448 | Ga0207691_100744485 | 141 |
| 417 | 3300025941 | Ga0207711_10639370 | Ga0207711_106393701 | 141 |
| 418 | 3300025942 | Ga0207689_10499801 | Ga0207689_104998013 | 141 |
| 419 | 3300025961 | Ga0207712_10140109 | Ga0207712_101401093 | 141 |
| 420 | 3300025961 | Ga0207712_10270204 | Ga0207712_102702043 | 141 |
| 421 | 3300025961 | Ga0207712_10552364 | Ga0207712_105523642 | 141 |
| 422 | 3300025972 | Ga0207668_10616914 | Ga0207668_106169142 | 141 |
| 423 | 3300025986 | Ga0207658_10311547 | Ga0207658_103115472 | 141 |
| 424 | 3300025986 | Ga0207658_10667447 | Ga0207658_106674471 | 141 |
| 425 | 3300025986 | Ga0207658_11301755 | Ga0207658_113017552 | 141 |
| 426 | 3300026035 | Ga0207703_10089109 | Ga0207703_100891094 | 141 |
| 427 | 3300026035 | Ga0207703_10304519 | Ga0207703_103045191 | 141 |
| 428 | 3300026035 | Ga0207703_10465966 | Ga0207703_104659661 | 141 |
| 429 | 3300026035 | Ga0207703_10708972 | Ga0207703_107089721 | 141 |
| 430 | 3300026067 | Ga0207678_10401726 | Ga0207678_104017262 | 141 |
| 431 | 3300026075 | Ga0207708_10508749 | Ga0207708_105087492 | 141 |
| 432 | 3300026088 | Ga0207641_10255488 | Ga0207641_102554881 | 141 |
| 433 | 3300026088 | Ga0207641_11626150 | Ga0207641_116261501 | 141 |
| 434 | 3300026089 | Ga0207648_10003050 | Ga0207648_100030506 | 141 |
| 435 | 3300026095 | Ga0207676_10105115 | Ga0207676_101051152 | 141 |
| 436 | 3300026095 | Ga0207676_10715247 | Ga0207676_107152472 | 141 |
| 437 | 3300026095 | Ga0207676_11451356 | Ga0207676_114513561 | 141 |
| 438 | 3300026116 | Ga0207674_11588714 | Ga0207674_115887142 | 141 |
| 439 | 3300026118 | Ga0207675_100008890 | Ga0207675_1000088906 | 141 |
| 440 | 3300026118 | Ga0207675_100283573 | Ga0207675_1002835732 | 141 |
| 441 | 3300026118 | Ga0207675_100388738 | Ga0207675_1003887382 | 141 |
| 442 | 3300026121 | Ga0207683_11591320 | Ga0207683_115913201 | 141 |
| 443 | 3300026142 | Ga0207698_10462495 | Ga0207698_104624952 | 141 |
| 444 | 3300028380 | Ga0268265_10163264 | Ga0268265_101632641 | 141 |
| 445 | 3300028380 | Ga0268265_10698759 | Ga0268265_106987592 | 141 |
| 446 | 3300028381 | Ga0268264_10751550 | Ga0268264_107515502 | 141 |
| 447 | 3300028381 | Ga0268264_11042430 | Ga0268264_110424301 | 141 |
| 448 | 3300028381 | Ga0268264_11254368 | Ga0268264_112543682 | 141 |
| 449 | 3300028786 | Ga0307517_10288522 | Ga0307517_102885222 | 141 |
| 450 | 3300028794 | Ga0307515_10814799 | Ga0307515_108147992 | 141 |
| 451 | 3300031235 | Ga0265330_10137643 | Ga0265330_101376433 | 141 |
| 452 | 3300031238 | Ga0265332_10000724 | Ga0265332_1000072420 | 141 |
| 453 | 3300031239 | Ga0265328_10140993 | Ga0265328_101409931 | 141 |
| 454 | 3300031242 | Ga0265329_10030085 | Ga0265329_100300853 | 141 |
| 455 | 3300031249 | Ga0265339_10096783 | Ga0265339_100967833 | 141 |
| 456 | 3300031250 | Ga0265331_10000579 | Ga0265331_1000057911 | 141 |
| 457 | 3300031251 | Ga0265327_10031469 | Ga0265327_100314693 | 141 |
| 458 | 3300031344 | Ga0265316_10179750 | Ga0265316_101797503 | 141 |
| 459 | 3300031507 | Ga0307509_10497035 | Ga0307509_104970351 | 141 |
| 460 | 3300031595 | Ga0265313_10227543 | Ga0265313_102275432 | 141 |
| 461 | 3300031711 | Ga0265314_10009471 | Ga0265314_100094719 | 141 |
| 462 | 3300031712 | Ga0265342_10059999 | Ga0265342_100599993 | 141 |
| 463 | 3300033180 | Ga0307510_10397439 | Ga0307510_103974392 | 141 |
| 464 | 3300035116 | Ga0373945_0142184 | Ga0373945_0142184_171_611 | 141 |
| 465 | 3300035172 | Ga0373955_0163856 | Ga0373955_0163856_776_1216 | 141 |
| 466 | 3300035695 | Ga0373927_0579634 | Ga0373927_0579634_61_501 | 141 |
| 467 | 3300036401 | Ga0373937_0058512 | Ga0373937_0058512_180_620 | 141 |
| 468 | 3300036401 | Ga0373937_0862837 | Ga0373937_0862837_89_529 | 141 |
| 469 | 3300039438 | Ga0436360_0193744 | Ga0436360_0193744_40_483 | 141 |
| 470 | 3300039438 | Ga0436360_0606863 | Ga0436360_0606863_250_690 | 141 |
| 471 | 3300042876 | Ga0451577_0034258 | Ga0451577_0034258_196_639 | 141 |
| 472 | 3300044673 | Ga0453683_0006140 | Ga0453683_0006140_3261_3704 | 141 |
| 473 | 3300046616 | Ga0495668_0053582 | Ga0495668_0053582_308_751 | 141 |
| 474 | 3300046683 | Ga0495658_0838887 | Ga0495658_0838887_37_477 | 141 |
| 475 | 3300049572 | Ga0501036_0804463 | Ga0501036_0804463_205_654 | 141 |
| 476 | 3300049576 | Ga0501040_0350364 | Ga0501040_0350364_51_491 | 141 |
| 477 | 3300049583 | Ga0501067_0072746 | Ga0501067_0072746_574_1011 | 141 |
| 478 | 3300049584 | Ga0501068_0401232 | Ga0501068_0401232_116_553 | 141 |
| 479 | 3300049588 | Ga0501072_0266706 | Ga0501072_0266706_40_480 | 141 |
| 480 | 3300049592 | Ga0501076_0166490 | Ga0501076_0166490_1202_1642 | 141 |
| 481 | 3300050493 | nmdc:mga0k408_3029_c1 | nmdc:mga0k408_3029_c1_7268_7711 | 141 |
| 482 | 3300050493 | nmdc:mga0k408_930598_c1 | nmdc:mga0k408_930598_c1_28_471 | 141 |
| 483 | 3300050494 | nmdc:mga06z11_153135_c1 | nmdc:mga06z11_153135_c1_418_861 | 141 |
| 484 | 3300050496 | nmdc:mga07m45_10065_c1 | nmdc:mga07m45_10065_c1_692_1135 | 141 |
| 485 | 3300050510 | nmdc:mga06r32_380617_c1 | nmdc:mga06r32_380617_c1_555_1004 | 141 |
| 486 | 3300050512 | nmdc:mga0n895_212330_c1 | nmdc:mga0n895_212330_c1_1159_1605 | 141 |
| 487 | 3300050516 | nmdc:mga0sz30_208236_c1 | nmdc:mga0sz30_208236_c1_366_809 | 141 |
| 488 | 3300053085 | Ga0495619_0022063 | Ga0495619_0022063_2624_3064 | 141 |
| 489 | 3300005293 | Ga0065715_10759883 | Ga0065715_107598831 | 142 |
| 490 | 3300005328 | Ga0070676_10448345 | Ga0070676_104483451 | 142 |
| 491 | 3300005329 | Ga0070683_100137897 | Ga0070683_1001378973 | 142 |
| 492 | 3300005330 | Ga0070690_100374271 | Ga0070690_1003742712 | 142 |
| 493 | 3300005334 | Ga0068869_100131693 | Ga0068869_1001316933 | 142 |
| 494 | 3300005335 | Ga0070666_10050259 | Ga0070666_100502593 | 142 |
| 495 | 3300005336 | Ga0070680_100027015 | Ga0070680_1000270155 | 142 |
| 496 | 3300005337 | Ga0070682_100045495 | Ga0070682_1000454953 | 142 |
| 497 | 3300005338 | Ga0068868_100029784 | Ga0068868_1000297844 | 142 |
| 498 | 3300005339 | Ga0070660_100091461 | Ga0070660_1000914612 | 142 |
| 499 | 3300005344 | Ga0070661_100020815 | Ga0070661_1000208155 | 142 |
| 500 | 3300005345 | Ga0070692_10004498 | Ga0070692_100044982 | 142 |
| 501 | 3300005347 | Ga0070668_100331197 | Ga0070668_1003311971 | 142 |
| 502 | 3300005355 | Ga0070671_100054578 | Ga0070671_1000545783 | 142 |
| 503 | 3300005356 | Ga0070674_100033971 | Ga0070674_1000339712 | 142 |
| 504 | 3300005367 | Ga0070667_100089778 | Ga0070667_1000897783 | 142 |
| 505 | 3300005406 | Ga0070703_10326441 | Ga0070703_103264411 | 142 |
| 506 | 3300005435 | Ga0070714_100044779 | Ga0070714_1000447791 | 142 |
| 507 | 3300005437 | Ga0070710_10339096 | Ga0070710_103390962 | 142 |
| 508 | 3300005440 | Ga0070705_100046732 | Ga0070705_1000467321 | 142 |
| 509 | 3300005444 | Ga0070694_100009137 | Ga0070694_1000091376 | 142 |
| 510 | 3300005445 | Ga0070708_100142506 | Ga0070708_1001425063 | 142 |
| 511 | 3300005455 | Ga0070663_100094251 | Ga0070663_1000942513 | 142 |
| 512 | 3300005456 | Ga0070678_100002700 | Ga0070678_10000270010 | 142 |
| 513 | 3300005457 | Ga0070662_100028373 | Ga0070662_1000283732 | 142 |
| 514 | 3300005457 | Ga0070662_100081754 | Ga0070662_1000817542 | 142 |
| 515 | 3300005467 | Ga0070706_100011522 | Ga0070706_1000115228 | 142 |
| 516 | 3300005471 | Ga0070698_100115433 | Ga0070698_1001154333 | 142 |
| 517 | 3300005518 | Ga0070699_100012081 | Ga0070699_1000120815 | 142 |
| 518 | 3300005535 | Ga0070684_100161080 | Ga0070684_1001610803 | 142 |
| 519 | 3300005536 | Ga0070697_101783810 | Ga0070697_1017838101 | 142 |
| 520 | 3300005539 | Ga0068853_100502716 | Ga0068853_1005027162 | 142 |
| 521 | 3300005545 | Ga0070695_100473895 | Ga0070695_1004738952 | 142 |
| 522 | 3300005546 | Ga0070696_100139130 | Ga0070696_1001391303 | 142 |
| 523 | 3300005546 | Ga0070696_100368531 | Ga0070696_1003685311 | 142 |
| 524 | 3300005547 | Ga0070693_100009597 | Ga0070693_1000095972 | 142 |
| 525 | 3300005547 | Ga0070693_100447890 | Ga0070693_1004478902 | 142 |
| 526 | 3300005578 | Ga0068854_100012768 | Ga0068854_1000127685 | 142 |
| 527 | 3300005578 | Ga0068854_100019920 | Ga0068854_1000199205 | 142 |
| 528 | 3300005614 | Ga0068856_101013175 | Ga0068856_1010131751 | 142 |
| 529 | 3300005615 | Ga0070702_100025104 | Ga0070702_1000251043 | 142 |
| 530 | 3300005615 | Ga0070702_100355852 | Ga0070702_1003558522 | 142 |
| 531 | 3300005616 | Ga0068852_100030701 | Ga0068852_1000307015 | 142 |
| 532 | 3300005718 | Ga0068866_10035481 | Ga0068866_100354813 | 142 |
| 533 | 3300005843 | Ga0068860_100056218 | Ga0068860_1000562184 | 142 |
| 534 | 3300006173 | Ga0070716_100151651 | Ga0070716_1001516513 | 142 |
| 535 | 3300006175 | Ga0070712_100880235 | Ga0070712_1008802352 | 142 |
| 536 | 3300006237 | Ga0097621_100421935 | Ga0097621_1004219352 | 142 |
| 537 | 3300006358 | Ga0068871_100058306 | Ga0068871_1000583064 | 142 |
| 538 | 3300006852 | Ga0075433_11021222 | Ga0075433_110212222 | 142 |
| 539 | 3300006881 | Ga0068865_100252036 | Ga0068865_1002520362 | 142 |
| 540 | 3300009098 | Ga0105245_10065799 | Ga0105245_100657993 | 142 |
| 541 | 3300009098 | Ga0105245_10071732 | Ga0105245_100717324 | 142 |
| 542 | 3300009174 | Ga0105241_10157530 | Ga0105241_101575302 | 142 |
| 543 | 3300009174 | Ga0105241_10289817 | Ga0105241_102898172 | 142 |
| 544 | 3300009176 | Ga0105242_10059050 | Ga0105242_100590504 | 142 |
| 545 | 3300009177 | Ga0105248_10145566 | Ga0105248_101455662 | 142 |
| 546 | 3300009177 | Ga0105248_10460592 | Ga0105248_104605922 | 142 |
| 547 | 3300009545 | Ga0105237_10068951 | Ga0105237_100689514 | 142 |
| 548 | 3300009545 | Ga0105237_10529883 | Ga0105237_105298832 | 142 |
| 549 | 3300009551 | Ga0105238_10034509 | Ga0105238_100345092 | 142 |
| 550 | 3300010375 | Ga0105239_10259712 | Ga0105239_102597122 | 142 |
| 551 | 3300013100 | Ga0157373_10404552 | Ga0157373_104045522 | 142 |
| 552 | 3300013104 | Ga0157370_10030127 | Ga0157370_100301272 | 142 |
| 553 | 3300013297 | Ga0157378_10046168 | Ga0157378_100461684 | 142 |
| 554 | 3300013306 | Ga0163162_10079862 | Ga0163162_100798623 | 142 |
| 555 | 3300013307 | Ga0157372_10263110 | Ga0157372_102631101 | 142 |
| 556 | 3300014969 | Ga0157376_10063073 | Ga0157376_100630731 | 142 |
| 557 | 3300025321 | Ga0207656_10170656 | Ga0207656_101706561 | 142 |
| 558 | 3300025885 | Ga0207653_10152877 | Ga0207653_101528771 | 142 |
| 559 | 3300025898 | Ga0207692_10245838 | Ga0207692_102458382 | 142 |
| 560 | 3300025899 | Ga0207642_10007211 | Ga0207642_100072115 | 142 |
| 561 | 3300025903 | Ga0207680_10308640 | Ga0207680_103086402 | 142 |
| 562 | 3300025903 | Ga0207680_10316611 | Ga0207680_103166111 | 142 |
| 563 | 3300025910 | Ga0207684_10630297 | Ga0207684_106302971 | 142 |
| 564 | 3300025911 | Ga0207654_10044683 | Ga0207654_100446833 | 142 |
| 565 | 3300025915 | Ga0207693_10020276 | Ga0207693_100202765 | 142 |
| 566 | 3300025916 | Ga0207663_10478210 | Ga0207663_104782101 | 142 |
| 567 | 3300025917 | Ga0207660_10114009 | Ga0207660_101140092 | 142 |
| 568 | 3300025919 | Ga0207657_10003754 | Ga0207657_1000375411 | 142 |
| 569 | 3300025920 | Ga0207649_10214867 | Ga0207649_102148673 | 142 |
| 570 | 3300025922 | Ga0207646_10094649 | Ga0207646_100946491 | 142 |
| 571 | 3300025927 | Ga0207687_10022709 | Ga0207687_100227095 | 142 |
| 572 | 3300025928 | Ga0207700_10077519 | Ga0207700_100775193 | 142 |
| 573 | 3300025931 | Ga0207644_10082443 | Ga0207644_100824432 | 142 |
| 574 | 3300025933 | Ga0207706_10068569 | Ga0207706_100685692 | 142 |
| 575 | 3300025933 | Ga0207706_10160293 | Ga0207706_101602932 | 142 |
| 576 | 3300025934 | Ga0207686_10000309 | Ga0207686_1000030931 | 142 |
| 577 | 3300025937 | Ga0207669_10030394 | Ga0207669_100303944 | 142 |
| 578 | 3300025938 | Ga0207704_10507253 | Ga0207704_105072532 | 142 |
| 579 | 3300025939 | Ga0207665_10015247 | Ga0207665_100152475 | 142 |
| 580 | 3300025939 | Ga0207665_10031433 | Ga0207665_100314334 | 142 |
| 581 | 3300025941 | Ga0207711_10306798 | Ga0207711_103067982 | 142 |
| 582 | 3300025942 | Ga0207689_10022153 | Ga0207689_100221534 | 142 |
| 583 | 3300025942 | Ga0207689_10145581 | Ga0207689_101455813 | 142 |
| 584 | 3300025944 | Ga0207661_10025375 | Ga0207661_100253754 | 142 |
| 585 | 3300025945 | Ga0207679_10175790 | Ga0207679_101757902 | 142 |
| 586 | 3300025949 | Ga0207667_11842851 | Ga0207667_118428511 | 142 |
| 587 | 3300025981 | Ga0207640_10059072 | Ga0207640_100590723 | 142 |
| 588 | 3300025981 | Ga0207640_10209591 | Ga0207640_102095911 | 142 |
| 589 | 3300025986 | Ga0207658_10144705 | Ga0207658_101447052 | 142 |
| 590 | 3300026023 | Ga0207677_10033258 | Ga0207677_100332582 | 142 |
| 591 | 3300026067 | Ga0207678_10072541 | Ga0207678_100725412 | 142 |
| 592 | 3300026078 | Ga0207702_11131591 | Ga0207702_111315911 | 142 |
| 593 | 3300026089 | Ga0207648_10059765 | Ga0207648_100597652 | 142 |
| 594 | 3300026116 | Ga0207674_10009820 | Ga0207674_100098202 | 142 |
| 595 | 3300026121 | Ga0207683_10011693 | Ga0207683_100116934 | 142 |
| 596 | 3300026142 | Ga0207698_10112725 | Ga0207698_101127253 | 142 |
| 597 | 3300028381 | Ga0268264_10031276 | Ga0268264_100312762 | 142 |
| 598 | 3300035083 | Ga0373926_0125457 | Ga0373926_0125457_139_585 | 142 |
| 599 | 3300035118 | Ga0373954_0011052 | Ga0373954_0011052_2503_2949 | 142 |
| 600 | 3300035170 | Ga0373943_0099231 | Ga0373943_0099231_1057_1503 | 142 |
| 601 | 3300035171 | Ga0373946_0259789 | Ga0373946_0259789_230_676 | 142 |
| 602 | 3300035172 | Ga0373955_0065131 | Ga0373955_0065131_762_1208 | 142 |
| 603 | 3300035725 | Ga0373947_0013481 | Ga0373947_0013481_1340_1786 | 142 |
| 604 | 3300036401 | Ga0373937_0637860 | Ga0373937_0637860_21_467 | 142 |
| 605 | 3300037068 | Ga0373925_0026702 | Ga0373925_0026702_1327_1773 | 142 |
| 606 | 3300039438 | Ga0436360_0083715 | Ga0436360_0083715_1719_2156 | 142 |
| 607 | 3300042005 | Ga0439448_0072660 | Ga0439448_0072660_53_499 | 142 |
| 608 | 3300046459 | Ga0495629_0032786 | Ga0495629_0032786_2731_3177 | 142 |
| 609 | 3300046462 | Ga0495651_0380857 | Ga0495651_0380857_465_911 | 142 |
| 610 | 3300046463 | Ga0495653_0761376 | Ga0495653_0761376_66_512 | 142 |
| 611 | 3300046472 | Ga0495580_0042011 | Ga0495580_0042011_1034_1480 | 142 |
| 612 | 3300046473 | Ga0495582_0059191 | Ga0495582_0059191_1650_2096 | 142 |
| 613 | 3300046475 | Ga0495639_0184572 | Ga0495639_0184572_185_631 | 142 |
| 614 | 3300046476 | Ga0495662_0005009 | Ga0495662_0005009_5524_5970 | 142 |
| 615 | 3300046514 | Ga0495618_0418964 | Ga0495618_0418964_149_595 | 142 |
| 616 | 3300046516 | Ga0495628_0184769 | Ga0495628_0184769_725_1171 | 142 |
| 617 | 3300046517 | Ga0495630_0157418 | Ga0495630_0157418_351_797 | 142 |
| 618 | 3300046531 | Ga0495665_0035617 | Ga0495665_0035617_945_1391 | 142 |
| 619 | 3300046535 | Ga0495586_0154120 | Ga0495586_0154120_506_952 | 142 |
| 620 | 3300046543 | Ga0495645_0016994 | Ga0495645_0016994_1888_2334 | 142 |
| 621 | 3300046642 | Ga0495634_0161849 | Ga0495634_0161849_389_835 | 142 |
| 622 | 3300046663 | Ga0495635_0031580 | Ga0495635_0031580_1158_1604 | 142 |
| 623 | 3300046681 | Ga0495647_0005451 | Ga0495647_0005451_980_1426 | 142 |
| 624 | 3300046683 | Ga0495658_0043035 | Ga0495658_0043035_1506_1952 | 142 |
| 625 | 3300046809 | Ga0495600_0036077 | Ga0495600_0036077_1741_2187 | 142 |
| 626 | 3300047315 | Ga0495581_0000877 | Ga0495581_0000877_5233_5679 | 142 |
| 627 | 3300047322 | Ga0495680_0046751 | Ga0495680_0046751_1825_2271 | 142 |
| 628 | 3300047471 | Ga0495684_0088468 | Ga0495684_0088468_676_1122 | 142 |
| 629 | 3300047673 | Ga0495593_0081830 | Ga0495593_0081830_772_1218 | 142 |
| 630 | 3300048089 | Ga0495614_0100924 | Ga0495614_0100924_142_588 | 142 |
| 631 | 3300048905 | Ga0496102_0083058 | Ga0496102_0083058_59_505 | 142 |
| 632 | 3300048906 | Ga0496103_0931315 | Ga0496103_0931315_16_462 | 142 |
| 633 | 3300049577 | Ga0501041_0468026 | Ga0501041_0468026_311_760 | 142 |
| 634 | 3300049591 | Ga0501075_0551404 | Ga0501075_0551404_398_844 | 142 |
| 635 | 3300050513 | nmdc:mga0rr50_126638_c1 | nmdc:mga0rr50_126638_c1_517_966 | 142 |
| 636 | 3300053077 | Ga0495601_0180580 | Ga0495601_0180580_68_514 | 142 |
| 637 | 3300053085 | Ga0495619_0194382 | Ga0495619_0194382_463_909 | 142 |
| 638 | 3300060353 | Ga0501082_0240424 | Ga0501082_0240424_36_482 | 142 |
| 639 | 3300005330 | Ga0070690_100003532 | Ga0070690_1000035325 | 143 |
| 640 | 3300005331 | Ga0070670_100078873 | Ga0070670_1000788732 | 143 |
| 641 | 3300005334 | Ga0068869_100544173 | Ga0068869_1005441731 | 143 |
| 642 | 3300005335 | Ga0070666_10025918 | Ga0070666_100259184 | 143 |
| 643 | 3300005336 | Ga0070680_100590892 | Ga0070680_1005908921 | 143 |
| 644 | 3300005338 | Ga0068868_100136971 | Ga0068868_1001369712 | 143 |
| 645 | 3300005340 | Ga0070689_100003591 | Ga0070689_1000035917 | 143 |
| 646 | 3300005355 | Ga0070671_100019330 | Ga0070671_1000193302 | 143 |
| 647 | 3300005364 | Ga0070673_100000900 | Ga0070673_10000090013 | 143 |
| 648 | 3300005365 | Ga0070688_100000350 | Ga0070688_10000035017 | 143 |
| 649 | 3300005436 | Ga0070713_100034347 | Ga0070713_1000343473 | 143 |
| 650 | 3300005437 | Ga0070710_10001633 | Ga0070710_100016332 | 143 |
| 651 | 3300005437 | Ga0070710_11458157 | Ga0070710_114581571 | 143 |
| 652 | 3300005439 | Ga0070711_100707735 | Ga0070711_1007077351 | 143 |
| 653 | 3300005445 | Ga0070708_100704218 | Ga0070708_1007042181 | 143 |
| 654 | 3300005445 | Ga0070708_100750865 | Ga0070708_1007508652 | 143 |
| 655 | 3300005445 | Ga0070708_100770521 | Ga0070708_1007705212 | 143 |
| 656 | 3300005455 | Ga0070663_100289110 | Ga0070663_1002891102 | 143 |
| 657 | 3300005458 | Ga0070681_10006305 | Ga0070681_100063058 | 143 |
| 658 | 3300005466 | Ga0070685_10001662 | Ga0070685_100016622 | 143 |
| 659 | 3300005467 | Ga0070706_100198448 | Ga0070706_1001984482 | 143 |
| 660 | 3300005468 | Ga0070707_100021881 | Ga0070707_1000218813 | 143 |
| 661 | 3300005468 | Ga0070707_100110320 | Ga0070707_1001103203 | 143 |
| 662 | 3300005518 | Ga0070699_100125703 | Ga0070699_1001257032 | 143 |
| 663 | 3300005518 | Ga0070699_100146920 | Ga0070699_1001469202 | 143 |
| 664 | 3300005530 | Ga0070679_100035778 | Ga0070679_1000357781 | 143 |
| 665 | 3300005535 | Ga0070684_101692507 | Ga0070684_1016925071 | 143 |
| 666 | 3300005539 | Ga0068853_100424828 | Ga0068853_1004248281 | 143 |
| 667 | 3300005543 | Ga0070672_100216948 | Ga0070672_1002169482 | 143 |
| 668 | 3300005544 | Ga0070686_100026376 | Ga0070686_1000263762 | 143 |
| 669 | 3300005564 | Ga0070664_100724119 | Ga0070664_1007241191 | 143 |
| 670 | 3300005577 | Ga0068857_100215963 | Ga0068857_1002159632 | 143 |
| 671 | 3300005578 | Ga0068854_102128963 | Ga0068854_1021289631 | 143 |
| 672 | 3300005614 | Ga0068856_100043666 | Ga0068856_1000436664 | 143 |
| 673 | 3300005614 | Ga0068856_100066951 | Ga0068856_1000669513 | 143 |
| 674 | 3300005614 | Ga0068856_101648155 | Ga0068856_1016481551 | 143 |
| 675 | 3300005617 | Ga0068859_100003361 | Ga0068859_1000033615 | 143 |
| 676 | 3300005618 | Ga0068864_100001097 | Ga0068864_1000010978 | 143 |
| 677 | 3300005840 | Ga0068870_10142783 | Ga0068870_101427833 | 143 |
| 678 | 3300005841 | Ga0068863_100033322 | Ga0068863_1000333223 | 143 |
| 679 | 3300005842 | Ga0068858_100003252 | Ga0068858_1000032524 | 143 |
| 680 | 3300005985 | Ga0081539_10031253 | Ga0081539_100312534 | 143 |
| 681 | 3300006028 | Ga0070717_10177798 | Ga0070717_101777982 | 143 |
| 682 | 3300006028 | Ga0070717_11457696 | Ga0070717_114576961 | 143 |
| 683 | 3300006173 | Ga0070716_100078915 | Ga0070716_1000789152 | 143 |
| 684 | 3300006237 | Ga0097621_100026459 | Ga0097621_1000264594 | 143 |
| 685 | 3300006852 | Ga0075433_10230781 | Ga0075433_102307812 | 143 |
| 686 | 3300006871 | Ga0075434_100211414 | Ga0075434_1002114142 | 143 |
| 687 | 3300006914 | Ga0075436_100104552 | Ga0075436_1001045523 | 143 |
| 688 | 3300006931 | Ga0097620_100003360 | Ga0097620_1000033605 | 143 |
| 689 | 3300009098 | Ga0105245_10030436 | Ga0105245_100304364 | 143 |
| 690 | 3300009177 | Ga0105248_10023280 | Ga0105248_100232804 | 143 |
| 691 | 3300011119 | Ga0105246_10795127 | Ga0105246_107951271 | 143 |
| 692 | 3300013100 | Ga0157373_10099647 | Ga0157373_100996472 | 143 |
| 693 | 3300013104 | Ga0157370_10054530 | Ga0157370_100545304 | 143 |
| 694 | 3300013296 | Ga0157374_10000720 | Ga0157374_1000072019 | 143 |
| 695 | 3300013297 | Ga0157378_10050114 | Ga0157378_100501144 | 143 |
| 696 | 3300013307 | Ga0157372_10278912 | Ga0157372_102789122 | 143 |
| 697 | 3300013308 | Ga0157375_10005228 | Ga0157375_100052283 | 143 |
| 698 | 3300014745 | Ga0157377_10040974 | Ga0157377_100409742 | 143 |
| 699 | 3300014968 | Ga0157379_10012192 | Ga0157379_100121924 | 143 |
| 700 | 3300014968 | Ga0157379_10083915 | Ga0157379_100839153 | 143 |
| 701 | 3300014969 | Ga0157376_10032686 | Ga0157376_100326862 | 143 |
| 702 | 3300017792 | Ga0163161_10613103 | Ga0163161_106131031 | 143 |
| 703 | 3300025898 | Ga0207692_10495984 | Ga0207692_104959841 | 143 |
| 704 | 3300025903 | Ga0207680_10000776 | Ga0207680_100007764 | 143 |
| 705 | 3300025905 | Ga0207685_10076575 | Ga0207685_100765752 | 143 |
| 706 | 3300025908 | Ga0207643_10065920 | Ga0207643_100659203 | 143 |
| 707 | 3300025910 | Ga0207684_10235438 | Ga0207684_102354382 | 143 |
| 708 | 3300025912 | Ga0207707_10052439 | Ga0207707_100524394 | 143 |
| 709 | 3300025915 | Ga0207693_10000485 | Ga0207693_1000048537 | 143 |
| 710 | 3300025916 | Ga0207663_10219095 | Ga0207663_102190951 | 143 |
| 711 | 3300025917 | Ga0207660_10506949 | Ga0207660_105069492 | 143 |
| 712 | 3300025918 | Ga0207662_10560617 | Ga0207662_105606171 | 143 |
| 713 | 3300025920 | Ga0207649_10059546 | Ga0207649_100595462 | 143 |
| 714 | 3300025921 | Ga0207652_10365818 | Ga0207652_103658182 | 143 |
| 715 | 3300025922 | Ga0207646_10020487 | Ga0207646_100204874 | 143 |
| 716 | 3300025922 | Ga0207646_10963111 | Ga0207646_109631112 | 143 |
| 717 | 3300025926 | Ga0207659_10563910 | Ga0207659_105639101 | 143 |
| 718 | 3300025927 | Ga0207687_10005926 | Ga0207687_100059262 | 143 |
| 719 | 3300025928 | Ga0207700_10001822 | Ga0207700_1000182210 | 143 |
| 720 | 3300025936 | Ga0207670_10002158 | Ga0207670_100021584 | 143 |
| 721 | 3300025939 | Ga0207665_10004200 | Ga0207665_100042009 | 143 |
| 722 | 3300025940 | Ga0207691_10792312 | Ga0207691_107923122 | 143 |
| 723 | 3300025941 | Ga0207711_10000115 | Ga0207711_1000011524 | 143 |
| 724 | 3300025960 | Ga0207651_10001799 | Ga0207651_100017997 | 143 |
| 725 | 3300025986 | Ga0207658_10005849 | Ga0207658_100058493 | 143 |
| 726 | 3300026023 | Ga0207677_10000395 | Ga0207677_1000039522 | 143 |
| 727 | 3300026035 | Ga0207703_10012230 | Ga0207703_100122306 | 143 |
| 728 | 3300026041 | Ga0207639_10077253 | Ga0207639_100772532 | 143 |
| 729 | 3300026067 | Ga0207678_10145091 | Ga0207678_101450913 | 143 |
| 730 | 3300026078 | Ga0207702_10105738 | Ga0207702_101057382 | 143 |
| 731 | 3300026088 | Ga0207641_10006084 | Ga0207641_100060843 | 143 |
| 732 | 3300026095 | Ga0207676_10001026 | Ga0207676_1000102618 | 143 |
| 733 | 3300026116 | Ga0207674_10172794 | Ga0207674_101727943 | 143 |
| 734 | 3300028379 | Ga0268266_10003868 | Ga0268266_100038683 | 143 |
| 735 | 3300028381 | Ga0268264_10008970 | Ga0268264_100089706 | 143 |
| 736 | 3300031548 | Ga0307408_100040588 | Ga0307408_1000405883 | 143 |
| 737 | 3300031824 | Ga0307413_10506758 | Ga0307413_105067581 | 143 |
| 738 | 3300031901 | Ga0307406_10086231 | Ga0307406_100862312 | 143 |
| 739 | 3300031901 | Ga0307406_10639886 | Ga0307406_106398861 | 143 |
| 740 | 3300031903 | Ga0307407_10785273 | Ga0307407_107852731 | 143 |
| 741 | 3300031903 | Ga0307407_10878439 | Ga0307407_108784391 | 143 |
| 742 | 3300031911 | Ga0307412_10075440 | Ga0307412_100754401 | 143 |
| 743 | 3300031911 | Ga0307412_10916391 | Ga0307412_109163911 | 143 |
| 744 | 3300031995 | Ga0307409_100195672 | Ga0307409_1001956722 | 143 |
| 745 | 3300032002 | Ga0307416_100116610 | Ga0307416_1001166102 | 143 |
| 746 | 3300032002 | Ga0307416_100223850 | Ga0307416_1002238501 | 143 |
| 747 | 3300032004 | Ga0307414_10052479 | Ga0307414_100524793 | 143 |
| 748 | 3300032005 | Ga0307411_10017221 | Ga0307411_100172212 | 143 |
| 749 | 3300032126 | Ga0307415_100140415 | Ga0307415_1001404152 | 143 |
| 750 | 3300035086 | Ga0373934_0005290 | Ga0373934_0005290_989_1441 | 143 |
| 751 | 3300035111 | Ga0373923_0003535 | Ga0373923_0003535_826_1278 | 143 |
| 752 | 3300035113 | Ga0373936_0068007 | Ga0373936_0068007_944_1396 | 143 |
| 753 | 3300035116 | Ga0373945_0038227 | Ga0373945_0038227_247_699 | 143 |
| 754 | 3300035117 | Ga0373953_0055692 | Ga0373953_0055692_973_1425 | 143 |
| 755 | 3300035119 | Ga0373956_0007834 | Ga0373956_0007834_2892_3344 | 143 |
| 756 | 3300035120 | Ga0373957_0055008 | Ga0373957_0055008_33_485 | 143 |
| 757 | 3300035170 | Ga0373943_0023626 | Ga0373943_0023626_1311_1763 | 143 |
| 758 | 3300035172 | Ga0373955_0006516 | Ga0373955_0006516_889_1341 | 143 |
| 759 | 3300035410 | Ga0373924_0004316 | Ga0373924_0004316_987_1439 | 143 |
| 760 | 3300035691 | Ga0373931_0188382 | Ga0373931_0188382_579_1031 | 143 |
| 761 | 3300035692 | Ga0373935_0349087 | Ga0373935_0349087_337_789 | 143 |
| 762 | 3300035692 | Ga0373935_1284530 | Ga0373935_1284530_26_478 | 143 |
| 763 | 3300035695 | Ga0373927_0026989 | Ga0373927_0026989_1772_2224 | 143 |
| 764 | 3300035724 | Ga0373933_0867000 | Ga0373933_0867000_19_471 | 143 |
| 765 | 3300036401 | Ga0373937_0011385 | Ga0373937_0011385_1355_1807 | 143 |
| 766 | 3300036401 | Ga0373937_0262034 | Ga0373937_0262034_929_1381 | 143 |
| 767 | 3300046472 | Ga0495580_0069770 | Ga0495580_0069770_1176_1628 | 143 |
| 768 | 3300046477 | Ga0495664_0122682 | Ga0495664_0122682_1047_1499 | 143 |
| 769 | 3300046516 | Ga0495628_0200032 | Ga0495628_0200032_876_1328 | 143 |
| 770 | 3300046535 | Ga0495586_0467055 | Ga0495586_0467055_254_706 | 143 |
| 771 | 3300046679 | Ga0495623_0054150 | Ga0495623_0054150_1921_2373 | 143 |
| 772 | 3300046680 | Ga0495646_0667532 | Ga0495646_0667532_15_467 | 143 |
| 773 | 3300047317 | Ga0495604_0073448 | Ga0495604_0073448_1782_2234 | 143 |
| 774 | 3300047319 | Ga0495674_0144453 | Ga0495674_0144453_137_589 | 143 |
| 775 | 3300048088 | Ga0495602_0151409 | Ga0495602_0151409_473_925 | 143 |
| 776 | 3300048088 | Ga0495602_0327593 | Ga0495602_0327593_147_599 | 143 |
| 777 | 3300048903 | Ga0496100_0045980 | Ga0496100_0045980_660_1112 | 143 |
| 778 | 3300048904 | Ga0496101_0063364 | Ga0496101_0063364_646_1098 | 143 |
| 779 | 3300048907 | Ga0496104_0012262 | Ga0496104_0012262_2669_3121 | 143 |
| 780 | 3300048908 | Ga0496105_0022388 | Ga0496105_0022388_3981_4433 | 143 |
| 781 | 3300048909 | Ga0496106_0075683 | Ga0496106_0075683_1900_2352 | 143 |
| 782 | 3300048911 | Ga0496108_0256473 | Ga0496108_0256473_251_703 | 143 |
| 783 | 3300048913 | Ga0496110_0900889 | Ga0496110_0900889_97_549 | 143 |
| 784 | 3300048915 | Ga0496112_0001102 | Ga0496112_0001102_18088_18540 | 143 |
| 785 | 3300048917 | Ga0496114_0071403 | Ga0496114_0071403_505_957 | 143 |
| 786 | 3300048918 | Ga0496115_0046886 | Ga0496115_0046886_149_601 | 143 |
| 787 | 3300049575 | Ga0501039_0160978 | Ga0501039_0160978_311_763 | 143 |
| 788 | 3300049576 | Ga0501040_0135556 | Ga0501040_0135556_1214_1666 | 143 |
| 789 | 3300049580 | Ga0501046_0135428 | Ga0501046_0135428_269_721 | 143 |
| 790 | 3300049582 | Ga0501048_0211977 | Ga0501048_0211977_653_1105 | 143 |
| 791 | 3300049588 | Ga0501072_0041079 | Ga0501072_0041079_1447_1899 | 143 |
| 792 | 3300049590 | Ga0501074_0156011 | Ga0501074_0156011_979_1431 | 143 |
| 793 | 3300049592 | Ga0501076_0178126 | Ga0501076_0178126_388_840 | 143 |
| 794 | 3300049741 | Ga0501079_0288108 | Ga0501079_0288108_645_1097 | 143 |
| 795 | 3300050489 | nmdc:mga03683_193709_c1 | nmdc:mga03683_193709_c1_65_514 | 143 |
| 796 | 3300050493 | nmdc:mga0k408_370375_c1 | nmdc:mga0k408_370375_c1_115_564 | 143 |
| 797 | 3300050514 | nmdc:mga08x19_284896_c1 | nmdc:mga08x19_284896_c1_422_874 | 143 |
| 798 | 3300053078 | Ga0495612_0089439 | Ga0495612_0089439_375_827 | 143 |
| 799 | 3300061734 | Ga0530510_0466904 | Ga0530510_0466904_222_674 | 143 |
| 800 | 3300025898 | Ga0207692_10646100 | Ga0207692_106461001 | 144 |
| 801 | 3300037068 | Ga0373925_0170804 | Ga0373925_0170804_370_861 | 144 |
| 802 | 3300045051 | Ga0451576_0363406 | Ga0451576_0363406_240_680 | 146 |
| 803 | 3300050509 | nmdc:mga0qj67_19003_c1 | nmdc:mga0qj67_19003_c1_4488_4931 | 146 |
| 804 | 3300050510 | nmdc:mga06r32_62517_c1 | nmdc:mga06r32_62517_c1_3130_3573 | 146 |
| 805 | 3300005458 | Ga0070681_10001782 | Ga0070681_100017822 | 149 |
| 806 | 3300005467 | Ga0070706_100023380 | Ga0070706_1000233803 | 149 |
| 807 | 3300005468 | Ga0070707_100041931 | Ga0070707_1000419313 | 149 |
| 808 | 3300005530 | Ga0070679_100088970 | Ga0070679_1000889703 | 149 |
| 809 | 3300005536 | Ga0070697_100052298 | Ga0070697_1000522983 | 149 |
| 810 | 3300005545 | Ga0070695_100520808 | Ga0070695_1005208082 | 149 |
| 811 | 3300005546 | Ga0070696_100125487 | Ga0070696_1001254872 | 149 |
| 812 | 3300006852 | Ga0075433_10361551 | Ga0075433_103615512 | 149 |
| 813 | 3300007076 | Ga0075435_100442774 | Ga0075435_1004427742 | 149 |
| 814 | 3300025910 | Ga0207684_10134031 | Ga0207684_101340311 | 149 |
| 815 | 3300025922 | Ga0207646_10031238 | Ga0207646_100312383 | 149 |
| 816 | 3300053727 | Ga0500611_029221 | Ga0500611_029221_72_557 | 149 |
| 817 | 3300005290 | Ga0065712_10271989 | Ga0065712_102719892 | 165 |
| 818 | 3300048907 | Ga0496104_0918328 | Ga0496104_0918328_68_565 | 165 |
| 819 | 3300048911 | Ga0496108_0720491 | Ga0496108_0720491_306_803 | 165 |
| 820 | 3300048917 | Ga0496114_0251246 | Ga0496114_0251246_251_748 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s56-assembly2.cif.gz_B | "crystal structure of ""truncated"" hemoglobin n (hbn) from mycobacterium tuberculosis, soaked with xe atoms" | 0.9764 | 33 | 148 |
| 2gkn-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant | 0.9761 | 32 | 147 |
| 1idr-assembly1.cif.gz_A | crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis | 0.9751 | 33 | 147 |
| 2gkm-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant | 0.9738 | 32 | 146 |
| 2gkn-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant | 0.9736 | 32 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aq5A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9593 | 32 | 148 | 1.10.490.10 |
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9572 | 33 | 148 | 1.10.490.10 |
| 1uvxA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.952 | 33 | 146 | 1.10.490.10 |
| 3aq5A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9514 | 32 | 148 | 1.10.490.10 |
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9493 | 33 | 148 | 1.10.490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356RAY6-F1-model_v4 | Group 1 truncated hemoglobin | 1 | 32 | 146 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
| AF-A0A535PEK7-F1-model_v4 | Group 1 truncated hemoglobin | 0.9978 | 32 | 146 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
| AF-A0A375CCR9-F1-model_v4 | deleted | 0.9954 | 42 | 148 |
|
| AF-A0A1W9IZ32-F1-model_v4 | Cytochrome P460 domain-containing protein | 0.9906 | 29 | 148 |
GO:0019825
GO:0020037 GO:0046872 |
| AF-A0A7W1AJE8-F1-model_v4 | Group 1 truncated hemoglobin | 0.9905 | 29 | 147 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar