F482142

General Info

Members Datasets Scaffolds Average Seq Length
818 320 1636 111

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0785473|Ga0496109_0785473_158_568
Length 136
Sequence MLAPTIETPGNGHTRRVQKAIKEVSMPQKAWSNKRERQYEHIKDSEKKRGASTKRAKEIAARTVNKERAQSGEAKTSSRTSRRDMPSSRRGGQRSGTNRPRGRTKEQLYNEAKRMNIQGRSKMNKAQLQRAVDRRK

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
220 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
221 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 5.87
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 10.64
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0785473 3300048912 Bacteria 890
2 JGI24739J22299_10137418 3300001989 Bacteria 725
3 rootL2_10189647 3300003322 Bacteria 4037
4 Ga0058863_10989014 3300004799 Unclassified 667
5 Ga0070658_10001317 3300005327 Bacteria 21168
6 Ga0070658_11280227 3300005327 Bacteria 637
7 Ga0070676_10387018 3300005328 Bacteria 970
8 Ga0070683_100484079 3300005329 Bacteria 1182
9 Ga0070683_102450382 3300005329 Bacteria 500
10 Ga0070670_100417539 3300005331 Bacteria 1186
11 Ga0070670_101087425 3300005331 Bacteria 729
12 Ga0070670_101383445 3300005331 Bacteria 645
13 Ga0070677_10204927 3300005333 Bacteria 954
14 Ga0070677_10825734 3300005333 Bacteria 531
15 Ga0068869_100200394 3300005334 Bacteria 1574
16 Ga0068869_100377764 3300005334 Bacteria 1161
17 Ga0070666_10866492 3300005335 Bacteria 667
18 Ga0070666_11135141 3300005335 Bacteria 581
19 Ga0070680_100002056 3300005336 Bacteria 14837
20 Ga0070680_100223805 3300005336 Bacteria 1588
21 Ga0070680_100272151 3300005336 Bacteria 1434
22 Ga0070680_100379929 3300005336 Bacteria 1203
23 Ga0070682_100020563 3300005337 Bacteria 3885
24 Ga0070682_100070135 3300005337 Bacteria 2240
25 Ga0070682_101681668 3300005337 Bacteria 551
26 Ga0068868_100087503 3300005338 Bacteria 2506
27 Ga0068868_100171485 3300005338 Bacteria 1796
28 Ga0068868_100298400 3300005338 Bacteria 1368
29 Ga0068868_100603507 3300005338 Bacteria 973
30 Ga0070660_100001059 3300005339 Bacteria 18513
31 Ga0070660_100206874 3300005339 Bacteria 1593
32 Ga0070660_100693447 3300005339 Bacteria 854
33 Ga0070660_101326274 3300005339 Unclassified 611
34 Ga0070691_10010078 3300005341 Bacteria 4306
35 Ga0070691_10745372 3300005341 Bacteria 592
36 Ga0070687_100180389 3300005343 Unclassified 1264
37 Ga0070661_100019788 3300005344 Bacteria 4798
38 Ga0070661_100204067 3300005344 Bacteria 1511
39 Ga0070692_10179734 3300005345 Bacteria 1225
40 Ga0070668_100263215 3300005347 Bacteria 1435
41 Ga0070668_100813772 3300005347 Bacteria 830
42 Ga0070668_100836291 3300005347 Bacteria 820
43 Ga0070668_101556313 3300005347 Bacteria 605
44 Ga0070668_101600125 3300005347 Bacteria 597
45 Ga0070669_100278794 3300005353 Bacteria 1339
46 Ga0070671_100788884 3300005355 Bacteria 827
47 Ga0070671_100836439 3300005355 Bacteria 802
48 Ga0070671_101049655 3300005355 Bacteria 715
49 Ga0070674_100016176 3300005356 Bacteria 4675
50 Ga0070674_100717233 3300005356 Unclassified 856
51 Ga0070674_100954166 3300005356 Bacteria 750
52 Ga0070673_100764928 3300005364 Bacteria 890
53 Ga0070673_100987016 3300005364 Bacteria 784
54 Ga0070688_100097689 3300005365 Bacteria 1931
55 Ga0070688_100195596 3300005365 Bacteria 1411
56 Ga0070659_100078582 3300005366 Bacteria 2632
57 Ga0070659_100180142 3300005366 Bacteria 1734
58 Ga0070659_101077033 3300005366 Bacteria 708
59 Ga0070659_101336346 3300005366 Bacteria 636
60 Ga0070659_101765018 3300005366 Bacteria 554
61 Ga0070667_100821759 3300005367 Bacteria 863
62 Ga0070703_10006205 3300005406 Bacteria 3346
63 Ga0070703_10032071 3300005406 Bacteria 1593
64 Ga0070709_10134154 3300005434 Bacteria 1694
65 Ga0070714_100051876 3300005435 Bacteria 3498
66 Ga0070714_100095366 3300005435 Bacteria 2613
67 Ga0070714_100163932 3300005435 Bacteria 2013
68 Ga0070714_101012583 3300005435 Bacteria 808
69 Ga0070714_101569375 3300005435 Bacteria 643
70 Ga0070714_101656863 3300005435 Bacteria 625
71 Ga0070713_100041632 3300005436 Bacteria 3744
72 Ga0070713_100184557 3300005436 Bacteria 1876
73 Ga0070701_10012626 3300005438 Bacteria 3815
74 Ga0070701_10099674 3300005438 Bacteria 1607
75 Ga0070711_100875103 3300005439 Bacteria 765
76 Ga0070711_101201573 3300005439 Bacteria 656
77 Ga0070711_101333923 3300005439 Bacteria 623
78 Ga0070705_100247089 3300005440 Bacteria 1250
79 Ga0070705_101047971 3300005440 Bacteria 664
80 Ga0070700_100025200 3300005441 Bacteria 3500
81 Ga0070700_100142223 3300005441 Bacteria 1632
82 Ga0070700_100833110 3300005441 Bacteria 746
83 Ga0070700_101022191 3300005441 Bacteria 681
84 Ga0070694_100005959 3300005444 Bacteria 7391
85 Ga0070694_100203331 3300005444 Bacteria 1477
86 Ga0070694_101030362 3300005444 Bacteria 684
87 Ga0070708_100000098 3300005445 Bacteria 57612
88 Ga0070708_100049289 3300005445 Unclassified 3725
89 Ga0070708_100159079 3300005445 Bacteria 2104
90 Ga0070708_100280445 3300005445 Bacteria 1568
91 Ga0070708_100930433 3300005445 Bacteria 816
92 Ga0070678_100112962 3300005456 Bacteria 2128
93 Ga0070678_100639897 3300005456 Bacteria 953
94 Ga0070662_100045060 3300005457 Bacteria 3163
95 Ga0070662_100141613 3300005457 Bacteria 1864
96 Ga0070662_100711748 3300005457 Bacteria 850
97 Ga0070662_101176154 3300005457 Bacteria 659
98 Ga0070662_101533935 3300005457 Bacteria 575
99 Ga0070681_10000146 3300005458 Bacteria 53666
100 Ga0070681_10074540 3300005458 Bacteria 3355
101 Ga0070681_10085889 3300005458 Bacteria 3099
102 Ga0068867_100045908 3300005459 Bacteria 3206
103 Ga0068867_101973990 3300005459 Bacteria 551
104 Ga0070685_10353069 3300005466 Bacteria 1006
105 Ga0070685_11410768 3300005466 Bacteria 535
106 Ga0070706_100000289 3300005467 Bacteria 61005
107 Ga0070706_100002031 3300005467 Bacteria 20755
108 Ga0070706_100080109 3300005467 Bacteria 3024
109 Ga0070707_100000191 3300005468 Bacteria 61005
110 Ga0070707_100008032 3300005468 Bacteria 9800
111 Ga0070707_100092670 3300005468 Bacteria 2925
112 Ga0070707_100448918 3300005468 Bacteria 1250
113 Ga0070707_100591730 3300005468 Unclassified 1072
114 Ga0070707_101296782 3300005468 Bacteria 695
115 Ga0070707_101501691 3300005468 Bacteria 641
116 Ga0070707_101698231 3300005468 Bacteria 598
117 Ga0070707_101714069 3300005468 Bacteria 595
118 Ga0070698_100004769 3300005471 Bacteria 14884
119 Ga0070698_100016558 3300005471 Bacteria 7779
120 Ga0070698_100658609 3300005471 Unclassified 988
121 Ga0070698_102194268 3300005471 Bacteria 506
122 Ga0070699_100004860 3300005518 Bacteria 11858
123 Ga0070699_100079802 3300005518 Bacteria 2851
124 Ga0070699_100158340 3300005518 Bacteria 2004
125 Ga0070699_100470917 3300005518 Bacteria 1140
126 Ga0070679_100001508 3300005530 Bacteria 20697
127 Ga0070679_100024839 3300005530 Bacteria 5873
128 Ga0070679_100257248 3300005530 Bacteria 1701
129 Ga0070679_101368331 3300005530 Bacteria 654
130 Ga0070684_100262475 3300005535 Bacteria 1580
131 Ga0070684_100827727 3300005535 Bacteria 866
132 Ga0070697_100003321 3300005536 Bacteria 12363
133 Ga0070697_100045107 3300005536 Bacteria 3572
134 Ga0070697_100067613 3300005536 Bacteria 2923
135 Ga0070697_100695744 3300005536 Unclassified 897
136 Ga0068853_100088314 3300005539 Bacteria 2721
137 Ga0068853_100287144 3300005539 Bacteria 1518
138 Ga0068853_100326596 3300005539 Bacteria 1423
139 Ga0068853_100536115 3300005539 Bacteria 1108
140 Ga0068853_102284767 3300005539 Bacteria 524
141 Ga0070672_101135450 3300005543 Bacteria 695
142 Ga0070686_100044884 3300005544 Bacteria 2781
143 Ga0070686_100156544 3300005544 Bacteria 1601
144 Ga0070686_101271259 3300005544 Bacteria 614
145 Ga0070686_101398908 3300005544 Bacteria 587
146 Ga0070695_100027847 3300005545 Bacteria 3504
147 Ga0070695_100089735 3300005545 Bacteria 2050
148 Ga0070695_101080632 3300005545 Bacteria 656
149 Ga0070695_101162347 3300005545 Bacteria 634
150 Ga0070695_101251016 3300005545 Bacteria 612
151 Ga0070696_100020849 3300005546 Bacteria 4441
152 Ga0070696_100267557 3300005546 Bacteria 1298
153 Ga0070696_100435365 3300005546 Bacteria 1032
154 Ga0070693_100522651 3300005547 Bacteria 845
155 Ga0070693_100631049 3300005547 Bacteria 777
156 Ga0070704_100001817 3300005549 Bacteria 11744
157 Ga0070704_100049008 3300005549 Bacteria 2960
158 Ga0070704_100203237 3300005549 Bacteria 1601
159 Ga0068855_100027498 3300005563 Bacteria 6802
160 Ga0068855_100252954 3300005563 Bacteria 1965
161 Ga0068855_100539604 3300005563 Bacteria 1264
162 Ga0068855_100541922 3300005563 Bacteria 1260
163 Ga0070664_100856891 3300005564 Bacteria 851
164 Ga0070664_101149920 3300005564 Bacteria 732
165 Ga0068854_100104227 3300005578 Bacteria 2130
166 Ga0068854_100611026 3300005578 Bacteria 932
167 Ga0068854_100820922 3300005578 Bacteria 812
168 Ga0068856_100342778 3300005614 Bacteria 1513
169 Ga0068856_100461391 3300005614 Bacteria 1291
170 Ga0068856_100971122 3300005614 Bacteria 868
171 Ga0070702_100020354 3300005615 Bacteria 3474
172 Ga0070702_100021830 3300005615 Bacteria 3376
173 Ga0070702_100782704 3300005615 Bacteria 736
174 Ga0068852_100209228 3300005616 Bacteria 1850
175 Ga0068852_100692446 3300005616 Bacteria 1029
176 Ga0068852_101132739 3300005616 Bacteria 803
177 Ga0068859_100376796 3300005617 Bacteria 1515
178 Ga0068864_100077607 3300005618 Bacteria 2905
179 Ga0068864_100178903 3300005618 Bacteria 1938
180 Ga0068864_100638528 3300005618 Bacteria 1036
181 Ga0068864_102198060 3300005618 Bacteria 558
182 Ga0068866_10140990 3300005718 Bacteria 1384
183 Ga0068861_100261828 3300005719 Bacteria 1481
184 Ga0068861_100789379 3300005719 Bacteria 890
185 Ga0068858_100000021 3300005842 Bacteria 172933
186 Ga0068858_101402674 3300005842 Bacteria 688
187 Ga0068860_100229269 3300005843 Bacteria 1805
188 Ga0068862_100205631 3300005844 Bacteria 1777
189 Ga0068862_100622901 3300005844 Bacteria 1038
190 Ga0068862_100651515 3300005844 Bacteria 1016
191 Ga0068862_101288524 3300005844 Unclassified 731
192 Ga0081455_10005414 3300005937 Bacteria 14008
193 Ga0081455_10025004 3300005937 Bacteria 5518
194 Ga0081455_10030694 3300005937 Bacteria 4878
195 Ga0081455_10122209 3300005937 Bacteria 2050
196 Ga0081538_10022275 3300005981 Bacteria 4594
197 Ga0081538_10073881 3300005981 Bacteria 1860
198 Ga0081540_1025768 3300005983 Bacteria 3375
199 Ga0081539_10003063 3300005985 Bacteria 21559
200 Ga0070717_10043162 3300006028 Bacteria 3679
201 Ga0070717_10115698 3300006028 Bacteria 2292
202 Ga0070717_11282425 3300006028 Bacteria 666
203 Ga0070717_11433601 3300006028 Bacteria 627
204 Ga0070717_11914093 3300006028 Bacteria 535
205 Ga0075365_10109300 3300006038 Bacteria 1899
206 Ga0075364_10156503 3300006051 Bacteria 1537
207 Ga0075364_10273757 3300006051 Bacteria 1148
208 Ga0075364_10888511 3300006051 Bacteria 607
209 Ga0070715_10681915 3300006163 Bacteria 612
210 Ga0070712_100021456 3300006175 Bacteria 4242
211 Ga0070712_100113711 3300006175 Bacteria 2025
212 Ga0070712_100186229 3300006175 Bacteria 1621
213 Ga0070712_101912409 3300006175 Bacteria 519
214 Ga0097621_100238790 3300006237 Bacteria 1588
215 Ga0097621_101403678 3300006237 Bacteria 661
216 Ga0068871_100409681 3300006358 Bacteria 1209
217 Ga0068871_101867201 3300006358 Bacteria 571
218 Ga0075428_100033674 3300006844 Bacteria 5654
219 Ga0075428_100364071 3300006844 Bacteria 1551
220 Ga0075428_101297882 3300006844 Bacteria 766
221 Ga0075431_101274791 3300006847 Bacteria 696
222 Ga0075433_10253621 3300006852 Bacteria 1561
223 Ga0075434_100295787 3300006871 Bacteria 1639
224 Ga0075434_100390477 3300006871 Bacteria 1413
225 Ga0075434_100393053 3300006871 Bacteria 1407
226 Ga0075429_100186194 3300006880 Bacteria 1819
227 Ga0075429_100314789 3300006880 Bacteria 1370
228 Ga0075429_100842737 3300006880 Bacteria 803
229 Ga0075429_100869216 3300006880 Bacteria 789
230 Ga0068865_100078451 3300006881 Bacteria 2362
231 Ga0068865_100131476 3300006881 Bacteria 1876
232 Ga0075436_100099707 3300006914 Bacteria 2022
233 Ga0075436_100776798 3300006914 Bacteria 712
234 Ga0075436_101437743 3300006914 Bacteria 523
235 Ga0097620_100376798 3300006931 Bacteria 1515
236 Ga0075435_101171743 3300007076 Bacteria 672
237 Ga0075435_101753285 3300007076 Bacteria 545
238 Ga0105240_10038889 3300009093 Bacteria 6099
239 Ga0105240_10236909 3300009093 Bacteria 2118
240 Ga0105240_10516948 3300009093 Bacteria 1325
241 Ga0111539_10408304 3300009094 Bacteria 1582
242 Ga0111539_10865773 3300009094 Bacteria 1051
243 Ga0111539_11033776 3300009094 Bacteria 955
244 Ga0111539_11591347 3300009094 Bacteria 758
245 Ga0111539_13359805 3300009094 Bacteria 515
246 Ga0105245_10017007 3300009098 Bacteria 6349
247 Ga0105245_10039361 3300009098 Bacteria 4208
248 Ga0105245_10293934 3300009098 Bacteria 1592
249 Ga0105245_10315594 3300009098 Bacteria 1538
250 Ga0105245_10498602 3300009098 Bacteria 1233
251 Ga0105245_10605204 3300009098 Bacteria 1123
252 Ga0105245_11642925 3300009098 Bacteria 694
253 Ga0105245_12011262 3300009098 Bacteria 631
254 Ga0105245_13115745 3300009098 Bacteria 514
255 Ga0105247_10517389 3300009101 Bacteria 872
256 Ga0114129_10009387 3300009147 Bacteria 13946
257 Ga0114129_10567774 3300009147 Bacteria 1473
258 Ga0114129_11002000 3300009147 Bacteria 1052
259 Ga0105243_10039454 3300009148 Bacteria 3681
260 Ga0105243_10078428 3300009148 Bacteria 2689
261 Ga0105243_10117174 3300009148 Bacteria 2238
262 Ga0105243_10651771 3300009148 Bacteria 1020
263 Ga0105243_11399702 3300009148 Bacteria 720
264 Ga0105241_11263635 3300009174 Bacteria 702
265 Ga0105242_10014890 3300009176 Bacteria 6026
266 Ga0105242_10247857 3300009176 Bacteria 1604
267 Ga0105242_11439497 3300009176 Bacteria 718
268 Ga0105248_10000239 3300009177 Bacteria 63565
269 Ga0105248_10464987 3300009177 Bacteria 1426
270 Ga0105248_11234334 3300009177 Bacteria 845
271 Ga0105248_12052272 3300009177 Bacteria 650
272 Ga0105237_10728136 3300009545 Bacteria 998
273 Ga0105238_10070580 3300009551 Bacteria 3492
274 Ga0105238_10370824 3300009551 Bacteria 1422
275 Ga0105238_11768254 3300009551 Bacteria 650
276 Ga0105238_11856158 3300009551 Bacteria 635
277 Ga0105238_12227703 3300009551 Bacteria 583
278 Ga0105238_12277995 3300009551 Bacteria 577
279 Ga0105249_10066335 3300009553 Bacteria 3323
280 Ga0105249_10212018 3300009553 Bacteria 1901
281 Ga0105249_10264485 3300009553 Bacteria 1711
282 Ga0105249_10272403 3300009553 Bacteria 1687
283 Ga0105249_10834098 3300009553 Bacteria 987
284 Ga0105249_11052991 3300009553 Bacteria 883
285 Ga0105249_11963553 3300009553 Bacteria 658
286 Ga0105239_10123307 3300010375 Bacteria 2879
287 Ga0105239_10131578 3300010375 Bacteria 2783
288 Ga0105239_10268236 3300010375 Bacteria 1919
289 Ga0105239_10302894 3300010375 Bacteria 1800
290 Ga0105239_12131678 3300010375 Bacteria 651
291 Ga0105246_10288069 3300011119 Bacteria 1320
292 Ga0105246_10308182 3300011119 Bacteria 1281
293 Ga0105246_11343937 3300011119 Bacteria 664
294 Ga0105246_12053237 3300011119 Bacteria 553
295 Ga0154019_111867 3300013044 Bacteria 632
296 Ga0157371_10088248 3300013102 Bacteria 2196
297 Ga0157371_10150762 3300013102 Bacteria 1658
298 Ga0157370_10453083 3300013104 Bacteria 1179
299 Ga0157370_10678604 3300013104 Bacteria 941
300 Ga0157370_11549986 3300013104 Bacteria 595
301 Ga0157369_10051901 3300013105 Bacteria 4437
302 Ga0157369_10609648 3300013105 Bacteria 1126
303 Ga0157369_11129820 3300013105 Bacteria 800
304 Ga0157374_10178869 3300013296 Bacteria 2071
305 Ga0157374_11645104 3300013296 Bacteria 666
306 Ga0157378_10280619 3300013297 Bacteria 1605
307 Ga0163162_10027012 3300013306 Bacteria 5677
308 Ga0163162_10745657 3300013306 Bacteria 1099
309 Ga0163162_12621382 3300013306 Bacteria 580
310 Ga0163162_12924394 3300013306 Bacteria 549
311 Ga0163162_13424337 3300013306 Bacteria 506
312 Ga0157372_10031794 3300013307 Bacteria 5782
313 Ga0157372_10090674 3300013307 Bacteria 3476
314 Ga0157372_10246988 3300013307 Bacteria 2071
315 Ga0157372_11397285 3300013307 Bacteria 807
316 Ga0157375_10090696 3300013308 Bacteria 3116
317 Ga0157375_10573531 3300013308 Bacteria 1289
318 Ga0157375_12217883 3300013308 Bacteria 654
319 Ga0163163_10052355 3300014325 Bacteria 4027
320 Ga0163163_10517158 3300014325 Bacteria 1256
321 Ga0163163_10576187 3300014325 Bacteria 1188
322 Ga0163163_12285164 3300014325 Bacteria 600
323 Ga0157380_10096264 3300014326 Bacteria 2454
324 Ga0157380_10321541 3300014326 Bacteria 1435
325 Ga0157380_10676082 3300014326 Bacteria 1034
326 Ga0157380_10851443 3300014326 Bacteria 934
327 Ga0182008_10669251 3300014497 Bacteria 590
328 Ga0157377_10459348 3300014745 Bacteria 881
329 Ga0157377_10565948 3300014745 Bacteria 805
330 Ga0157379_10000005 3300014968 Bacteria 172948
331 Ga0157379_11065707 3300014968 Bacteria 773
332 Ga0157376_11388397 3300014969 Bacteria 734
333 Ga0157376_12199489 3300014969 Bacteria 590
334 Ga0163161_10012371 3300017792 Bacteria 5924
335 Ga0163161_10128487 3300017792 Bacteria 1910
336 Ga0163161_10240795 3300017792 Unclassified 1407
337 Ga0163161_10371603 3300017792 Bacteria 1141
338 Ga0163161_10816149 3300017792 Bacteria 785
339 Ga0197907_10100650 3300020069 Bacteria 2147
340 Ga0197907_10315364 3300020069 Bacteria 718
341 Ga0206356_10670332 3300020070 Bacteria 1374
342 Ga0206356_10746468 3300020070 Bacteria 4837
343 Ga0206356_10746819 3300020070 Bacteria 566
344 Ga0206349_1078849 3300020075 Bacteria 1486
345 Ga0206349_1216531 3300020075 Bacteria 637
346 Ga0206349_1817084 3300020075 Bacteria 1006
347 Ga0206355_1200414 3300020076 Bacteria 1880
348 Ga0206355_1531826 3300020076 Bacteria 838
349 Ga0206351_10190591 3300020077 Bacteria 567
350 Ga0206351_10878099 3300020077 Bacteria 1167
351 Ga0206352_10022606 3300020078 Bacteria 734
352 Ga0206352_10576235 3300020078 Bacteria 522
353 Ga0206352_10750745 3300020078 Bacteria 607
354 Ga0206352_10966441 3300020078 Bacteria 574
355 Ga0206352_10997705 3300020078 Bacteria 532
356 Ga0206350_10644487 3300020080 Bacteria 508
357 Ga0206350_10647596 3300020080 Bacteria 1008
358 Ga0206350_11110681 3300020080 Bacteria 1224
359 Ga0206354_10294052 3300020081 Bacteria 1477
360 Ga0206354_11092444 3300020081 Bacteria 2537
361 Ga0206353_10429644 3300020082 Bacteria 1585
362 Ga0206353_10463855 3300020082 Bacteria 915
363 Ga0206353_11660508 3300020082 Bacteria 4198
364 Ga0154015_1074964 3300020610 Bacteria 1221
365 Ga0213876_10021168 3300021384 Bacteria 3439
366 Ga0213876_10051009 3300021384 Bacteria 2186
367 Ga0213876_10267343 3300021384 Bacteria 909
368 Ga0224712_10007292 3300022467 Bacteria 3211
369 Ga0224712_10038113 3300022467 Bacteria 1793
370 Ga0224712_10077188 3300022467 Bacteria 1367
371 Ga0224712_10102824 3300022467 Bacteria 1214
372 Ga0224712_10138288 3300022467 Bacteria 1070
373 Ga0224712_10180893 3300022467 Bacteria 950
374 Ga0224712_10183259 3300022467 Bacteria 944
375 Ga0224712_10239319 3300022467 Bacteria 836
376 Ga0224712_10291776 3300022467 Bacteria 761
377 Ga0224712_10348210 3300022467 Bacteria 700
378 Ga0224712_10527803 3300022467 Bacteria 572
379 Ga0224572_1056167 3300024225 Unclassified 731
380 Ga0207656_10308560 3300025321 Bacteria 784
381 Ga0207642_10063631 3300025899 Bacteria 1726
382 Ga0207688_10076173 3300025901 Bacteria 1910
383 Ga0207680_10968215 3300025903 Bacteria 610
384 Ga0207647_10512295 3300025904 Bacteria 668
385 Ga0207699_10256043 3300025906 Bacteria 1208
386 Ga0207645_10340364 3300025907 Bacteria 1003
387 Ga0207645_10411910 3300025907 Bacteria 910
388 Ga0207705_10109912 3300025909 Bacteria 2036
389 Ga0207705_10497188 3300025909 Bacteria 947
390 Ga0207684_10000145 3300025910 Bacteria 126387
391 Ga0207684_10000365 3300025910 Bacteria 61058
392 Ga0207684_10328865 3300025910 Bacteria 1317
393 Ga0207707_10000180 3300025912 Bacteria 66035
394 Ga0207707_10071327 3300025912 Bacteria 3027
395 Ga0207707_10240863 3300025912 Bacteria 1573
396 Ga0207707_10824448 3300025912 Bacteria 771
397 Ga0207707_11500006 3300025912 Bacteria 534
398 Ga0207695_10077670 3300025913 Bacteria 3371
399 Ga0207695_10650588 3300025913 Bacteria 935
400 Ga0207693_10445784 3300025915 Bacteria 1012
401 Ga0207663_10165330 3300025916 Bacteria 1566
402 Ga0207663_10767840 3300025916 Bacteria 766
403 Ga0207663_10915350 3300025916 Bacteria 702
404 Ga0207660_10023044 3300025917 Bacteria 4202
405 Ga0207660_10156018 3300025917 Bacteria 1757
406 Ga0207660_10246001 3300025917 Bacteria 1410
407 Ga0207662_10272738 3300025918 Bacteria 1117
408 Ga0207657_10001687 3300025919 Bacteria 23810
409 Ga0207657_10046373 3300025919 Bacteria 3807
410 Ga0207657_10577355 3300025919 Bacteria 878
411 Ga0207649_10048234 3300025920 Bacteria 2626
412 Ga0207649_10082895 3300025920 Bacteria 2080
413 Ga0207649_11296911 3300025920 Bacteria 576
414 Ga0207652_10000114 3300025921 Bacteria 88058
415 Ga0207652_10017619 3300025921 Bacteria 5846
416 Ga0207652_10042448 3300025921 Bacteria 3871
417 Ga0207652_10279939 3300025921 Bacteria 1505
418 Ga0207652_11061817 3300025921 Bacteria 710
419 Ga0207646_10000027 3300025922 Bacteria 235383
420 Ga0207646_10000034 3300025922 Bacteria 212493
421 Ga0207646_10000556 3300025922 Bacteria 49172
422 Ga0207646_10146262 3300025922 Bacteria 2130
423 Ga0207646_10191913 3300025922 Bacteria 1845
424 Ga0207646_10477413 3300025922 Bacteria 1124
425 Ga0207646_10512224 3300025922 Bacteria 1080
426 Ga0207646_10726575 3300025922 Bacteria 887
427 Ga0207646_10881519 3300025922 Bacteria 794
428 Ga0207681_10647444 3300025923 Bacteria 876
429 Ga0207694_10165963 3300025924 Bacteria 1786
430 Ga0207694_10456801 3300025924 Bacteria 1067
431 Ga0207650_10839277 3300025925 Bacteria 779
432 Ga0207659_10654535 3300025926 Bacteria 898
433 Ga0207687_10327024 3300025927 Bacteria 1243
434 Ga0207687_10632925 3300025927 Bacteria 904
435 Ga0207687_10933819 3300025927 Bacteria 743
436 Ga0207687_11941173 3300025927 Bacteria 503
437 Ga0207700_10313387 3300025928 Bacteria 1358
438 Ga0207700_10371224 3300025928 Bacteria 1249
439 Ga0207664_10031085 3300025929 Bacteria 4082
440 Ga0207664_10098342 3300025929 Bacteria 2413
441 Ga0207664_10148510 3300025929 Bacteria 1989
442 Ga0207664_10962094 3300025929 Bacteria 766
443 Ga0207644_10309324 3300025931 Bacteria 1275
444 Ga0207644_10630979 3300025931 Bacteria 891
445 Ga0207690_10458547 3300025932 Bacteria 1025
446 Ga0207690_11311260 3300025932 Bacteria 605
447 Ga0207706_10025395 3300025933 Bacteria 5308
448 Ga0207706_10038285 3300025933 Bacteria 4254
449 Ga0207706_10645023 3300025933 Bacteria 907
450 Ga0207686_10137139 3300025934 Bacteria 1686
451 Ga0207686_10193887 3300025934 Bacteria 1450
452 Ga0207686_10225017 3300025934 Bacteria 1357
453 Ga0207709_10171848 3300025935 Bacteria 1522
454 Ga0207709_10320605 3300025935 Bacteria 1160
455 Ga0207709_10339671 3300025935 Bacteria 1130
456 Ga0207709_10517945 3300025935 Bacteria 933
457 Ga0207709_10613230 3300025935 Bacteria 863
458 Ga0207709_11562098 3300025935 Bacteria 548
459 Ga0207670_10614234 3300025936 Bacteria 894
460 Ga0207670_11025362 3300025936 Bacteria 695
461 Ga0207669_10364066 3300025937 Bacteria 1121
462 Ga0207669_10613426 3300025937 Bacteria 886
463 Ga0207669_10643895 3300025937 Bacteria 866
464 Ga0207669_10869507 3300025937 Bacteria 751
465 Ga0207669_10874930 3300025937 Bacteria 749
466 Ga0207704_10033567 3300025938 Bacteria 2920
467 Ga0207704_10871028 3300025938 Bacteria 756
468 Ga0207691_10483107 3300025940 Bacteria 1053
469 Ga0207711_10000321 3300025941 Bacteria 51456
470 Ga0207711_10226028 3300025941 Bacteria 1713
471 Ga0207689_11161030 3300025942 Bacteria 650
472 Ga0207679_11007877 3300025945 Bacteria 763
473 Ga0207667_10122966 3300025949 Bacteria 2674
474 Ga0207667_10211919 3300025949 Bacteria 1986
475 Ga0207667_10660788 3300025949 Bacteria 1050
476 Ga0207712_10196004 3300025961 Bacteria 1598
477 Ga0207712_10598144 3300025961 Bacteria 954
478 Ga0207712_10758716 3300025961 Bacteria 850
479 Ga0207668_10365256 3300025972 Bacteria 1211
480 Ga0207668_11935294 3300025972 Bacteria 531
481 Ga0207640_10306968 3300025981 Bacteria 1258
482 Ga0207640_10337618 3300025981 Bacteria 1206
483 Ga0207640_10833898 3300025981 Bacteria 801
484 Ga0207640_10931003 3300025981 Bacteria 761
485 Ga0207640_11184256 3300025981 Bacteria 679
486 Ga0207640_11594988 3300025981 Bacteria 588
487 Ga0207658_11174267 3300025986 Bacteria 702
488 Ga0207677_10042644 3300026023 Bacteria 3010
489 Ga0207677_10048148 3300026023 Bacteria 2868
490 Ga0207677_10432416 3300026023 Bacteria 1124
491 Ga0207677_11000768 3300026023 Bacteria 758
492 Ga0207703_10000001 3300026035 Bacteria 822925
493 Ga0207703_10162355 3300026035 Bacteria 1958
494 Ga0207703_10462253 3300026035 Bacteria 1187
495 Ga0207703_11123667 3300026035 Bacteria 755
496 Ga0207639_10187880 3300026041 Bacteria 1763
497 Ga0207639_10825315 3300026041 Bacteria 865
498 Ga0207639_11603828 3300026041 Bacteria 610
499 Ga0207639_12301642 3300026041 Bacteria 500
500 Ga0207678_10163153 3300026067 Bacteria 1903
501 Ga0207708_10011288 3300026075 Bacteria 6648
502 Ga0207708_10203339 3300026075 Bacteria 1581
503 Ga0207708_10308067 3300026075 Bacteria 1289
504 Ga0207708_11446908 3300026075 Bacteria 603
505 Ga0207708_11987694 3300026075 Bacteria 509
506 Ga0207702_10484562 3300026078 Bacteria 1204
507 Ga0207702_11329602 3300026078 Bacteria 713
508 Ga0207641_12372829 3300026088 Bacteria 530
509 Ga0207648_10029468 3300026089 Bacteria 4867
510 Ga0207648_10826294 3300026089 Bacteria 863
511 Ga0207676_10749377 3300026095 Bacteria 950
512 Ga0207675_100192177 3300026118 Bacteria 1958
513 Ga0207675_100387441 3300026118 Bacteria 1375
514 Ga0207683_10060866 3300026121 Bacteria 3320
515 Ga0207683_10126567 3300026121 Bacteria 2296
516 Ga0207698_10520728 3300026142 Bacteria 1160
517 Ga0207428_10181910 3300027907 Bacteria 1588
518 Ga0207428_10499455 3300027907 Bacteria 883
519 Ga0207428_10962243 3300027907 Bacteria 601
520 Ga0268266_10772353 3300028379 Bacteria 928
521 Ga0268266_11679946 3300028379 Bacteria 610
522 Ga0268265_10155355 3300028380 Bacteria 1935
523 Ga0268265_10191974 3300028380 Bacteria 1765
524 Ga0268264_10220749 3300028381 Bacteria 1745
525 Ga0307512_10142391 3300030522 Bacteria 1463
526 Ga0265327_10001635 3300031251 Bacteria 27013
527 Ga0265327_10002138 3300031251 Bacteria 21833
528 Ga0265327_10240639 3300031251 Bacteria 809
529 Ga0307413_10382842 3300031824 Bacteria 1097
530 Ga0307409_100376716 3300031995 Bacteria 1348
531 Ga0307416_100136853 3300032002 Bacteria 2218
532 Ga0307416_102156031 3300032002 Bacteria 659
533 Ga0307415_100116926 3300032126 Bacteria 1990
534 Ga0307415_100356437 3300032126 Bacteria 1234
535 Ga0307415_100751394 3300032126 Bacteria 885
536 Ga0373926_0041964 3300035083 Bacteria 1636
537 Ga0373944_0005557 3300035089 Bacteria 3323
538 Ga0373952_0029936 3300035092 Bacteria 1203
539 Ga0373952_0172229 3300035092 Bacteria 619
540 Ga0373936_0089741 3300035113 Bacteria 1288
541 Ga0373939_0101365 3300035114 Bacteria 989
542 Ga0373939_0461864 3300035114 Bacteria 536
543 Ga0373945_0138608 3300035116 Bacteria 979
544 Ga0373956_0392529 3300035119 Bacteria 662
545 Ga0373943_0028114 3300035170 Bacteria 2648
546 Ga0373931_0042590 3300035691 Bacteria 2388
547 Ga0373931_0598035 3300035691 Bacteria 721
548 Ga0373927_0108798 3300035695 Bacteria 1806
549 Ga0373947_0002516 3300035725 Bacteria 11013
550 Ga0373925_0281517 3300037068 Bacteria 1339
551 Ga0395899_0002898 3300037312 Bacteria 13785
552 Ga0395899_0003873 3300037312 Bacteria 11801
553 Ga0395899_0026661 3300037312 Bacteria 4359
554 Ga0395899_0077305 3300037312 Bacteria 2427
555 Ga0395899_0234048 3300037312 Bacteria 1267
556 Ga0395900_0009247 3300037418 Bacteria 10103
557 Ga0395900_0027608 3300037418 Bacteria 5814
558 Ga0395900_0106284 3300037418 Bacteria 2883
559 Ga0395900_0176954 3300037418 Bacteria 2169
560 Ga0395900_0224462 3300037418 Bacteria 1892
561 Ga0395900_0472550 3300037418 Bacteria 1207
562 Ga0395900_0651759 3300037418 Bacteria 989
563 Ga0395900_0707021 3300037418 Bacteria 941
564 Ga0395900_0755246 3300037418 Bacteria 903
565 Ga0395900_0876824 3300037418 Bacteria 822
566 Ga0395898_0001745 3300037466 Bacteria 28669
567 Ga0395898_0007360 3300037466 Bacteria 11686
568 Ga0395898_0037404 3300037466 Bacteria 4814
569 Ga0395898_0051743 3300037466 Bacteria 4015
570 Ga0395898_0055848 3300037466 Bacteria 3851
571 Ga0395898_0116349 3300037466 Bacteria 2562
572 Ga0395898_0157829 3300037466 Bacteria 2170
573 Ga0395898_0251048 3300037466 Bacteria 1687
574 Ga0395898_0342261 3300037466 Bacteria 1426
575 Ga0395898_0375029 3300037466 Bacteria 1357
576 Ga0395898_0420219 3300037466 Bacteria 1274
577 Ga0395898_0562092 3300037466 Bacteria 1083
578 Ga0395898_1603431 3300037466 Bacteria 575
579 Ga0395905_0003801 3300037471 Bacteria 15967
580 Ga0395905_0045559 3300037471 Bacteria 4113
581 Ga0395905_0109850 3300037471 Bacteria 2589
582 Ga0395905_0158873 3300037471 Bacteria 2125
583 Ga0395905_0340116 3300037471 Bacteria 1392
584 Ga0395905_0410223 3300037471 Bacteria 1250
585 Ga0395905_0470603 3300037471 Bacteria 1155
586 Ga0395905_0690835 3300037471 Bacteria 923
587 Ga0395905_1326454 3300037471 Bacteria 623
588 Ga0436364_1403495 3300037853 Bacteria 15743
589 Ga0395901_0002143 3300038443 Bacteria 20171
590 Ga0395901_0003436 3300038443 Bacteria 15958
591 Ga0395901_0007745 3300038443 Bacteria 10836
592 Ga0395901_0010703 3300038443 Bacteria 9299
593 Ga0395901_0047596 3300038443 Bacteria 4452
594 Ga0395901_0047633 3300038443 Bacteria 4451
595 Ga0395901_0060240 3300038443 Bacteria 3950
596 Ga0395901_0111459 3300038443 Bacteria 2873
597 Ga0395901_0392882 3300038443 Bacteria 1426
598 Ga0395901_0453863 3300038443 Bacteria 1311
599 Ga0395901_0480418 3300038443 Bacteria 1267
600 Ga0395901_0595909 3300038443 Bacteria 1115
601 Ga0395901_0626993 3300038443 Bacteria 1081
602 Ga0395901_0983088 3300038443 Bacteria 821
603 Ga0395901_1200226 3300038443 Bacteria 725
604 Ga0395901_1316784 3300038443 Bacteria 684
605 Ga0436365_0948752 3300039437 Bacteria 7449
606 Ga0436363_0681994 3300039450 Bacteria 1694
607 Ga0436362_0786842 3300039453 Bacteria 833
608 Ga0451789_1278943 3300041443 Bacteria 932
609 Ga0451791_1146278 3300041451 Bacteria 527
610 Ga0451793_1929211 3300041452 Bacteria 624
611 Ga0451804_0081368 3300041463 Bacteria 567
612 Ga0451835_0403212 3300041492 Bacteria 735
613 Ga0451839_1602830 3300041496 Bacteria 505
614 Ga0451851_0087526 3300041507 Bacteria 586
615 Ga0451853_1035470 3300041512 Bacteria 1121
616 Ga0451853_1409034 3300041512 Bacteria 1144
617 Ga0439455_0151962 3300042012 Bacteria 659
618 Ga0439464_0063319 3300042439 Bacteria 1085
619 Ga0450918_061679 3300042531 Bacteria 694
620 Ga0466972_0060339 3300044658 Bacteria 1820
621 Ga0466961_0390842 3300044693 Bacteria 844
622 Ga0466964_0272437 3300044706 Bacteria 843
623 Ga0466964_0593842 3300044706 Bacteria 606
624 Ga0453684_0295227 3300044712 Bacteria 1844
625 Ga0466968_0709623 3300044735 Bacteria 514
626 Ga0466960_0441381 3300044901 Bacteria 755
627 Ga0466967_0024217 3300045976 Bacteria 4987
628 Ga0466967_0044979 3300045976 Bacteria 3834
629 Ga0466967_0137759 3300045976 Bacteria 2271
630 Ga0466967_0149913 3300045976 Bacteria 2179
631 Ga0466967_0459635 3300045976 Bacteria 1245
632 Ga0466967_0621991 3300045976 Bacteria 1067
633 Ga0466967_1131282 3300045976 Bacteria 780
634 Ga0466967_1296292 3300045976 Bacteria 725
635 Ga0466967_2020109 3300045976 Bacteria 573
636 Ga0495603_0001198 3300046455 Bacteria 15133
637 Ga0495603_0033546 3300046455 Bacteria 3089
638 Ga0495603_0471913 3300046455 Bacteria 718
639 Ga0495641_0001460 3300046461 Bacteria 20059
640 Ga0495582_0015341 3300046473 Bacteria 4209
641 Ga0495605_0108933 3300046474 Bacteria 1266
642 Ga0495639_0576192 3300046475 Bacteria 578
643 Ga0495585_0430677 3300046492 Bacteria 633
644 Ga0495594_0001348 3300046499 Bacteria 12740
645 Ga0495594_0131483 3300046499 Bacteria 1418
646 Ga0495594_0150692 3300046499 Bacteria 1320
647 Ga0495644_0104407 3300046523 Bacteria 1073
648 Ga0495663_0099815 3300046525 Bacteria 955
649 Ga0495666_0047536 3300046526 Bacteria 2067
650 Ga0495666_0167840 3300046526 Bacteria 1016
651 Ga0495642_0071980 3300046528 Bacteria 1447
652 Ga0495652_0677488 3300046529 Bacteria 696
653 Ga0495640_0855743 3300046533 Bacteria 540
654 Ga0495586_0533925 3300046535 Bacteria 677
655 Ga0495588_0002101 3300046674 Bacteria 8545
656 Ga0495588_0140416 3300046674 Bacteria 1276
657 Ga0495647_0025975 3300046681 Bacteria 2143
658 Ga0495658_0162038 3300046683 Bacteria 1380
659 Ga0495613_0011076 3300046689 Bacteria 6696
660 Ga0495589_0170710 3300046794 Bacteria 1034
661 Ga0495604_0612637 3300047317 Bacteria 697
662 Ga0495676_0004181 3300047321 Bacteria 13183
663 Ga0495676_0429929 3300047321 Bacteria 873
664 Ga0495676_0549784 3300047321 Bacteria 755
665 Ga0495680_0183277 3300047322 Bacteria 1510
666 Ga0495685_111174 3300047447 Bacteria 902
667 Ga0496100_0031199 3300048903 Bacteria 3311
668 Ga0496100_0074729 3300048903 Bacteria 2271
669 Ga0496100_0901835 3300048903 Bacteria 694
670 Ga0496101_0013039 3300048904 Bacteria 5561
671 Ga0496101_0124460 3300048904 Bacteria 1952
672 Ga0496101_0191825 3300048904 Bacteria 1577
673 Ga0496101_0328542 3300048904 Bacteria 1200
674 Ga0496102_0073411 3300048905 Bacteria 3144
675 Ga0496102_0138652 3300048905 Bacteria 2280
676 Ga0496102_0231882 3300048905 Bacteria 1740
677 Ga0496102_0272016 3300048905 Bacteria 1597
678 Ga0496102_0409223 3300048905 Bacteria 1274
679 Ga0496102_0698843 3300048905 Bacteria 937
680 Ga0496103_0030273 3300048906 Bacteria 3294
681 Ga0496103_0115453 3300048906 Bacteria 1707
682 Ga0496103_0176617 3300048906 Bacteria 1372
683 Ga0496104_0013175 3300048907 Bacteria 7454
684 Ga0496104_0091360 3300048907 Bacteria 2910
685 Ga0496104_0158667 3300048907 Bacteria 2170
686 Ga0496104_0175252 3300048907 Unclassified 2055
687 Ga0496104_0182384 3300048907 Bacteria 2010
688 Ga0496104_0968583 3300048907 Bacteria 755
689 Ga0496105_0038494 3300048908 Bacteria 3939
690 Ga0496105_0079462 3300048908 Bacteria 2709
691 Ga0496105_0227213 3300048908 Bacteria 1517
692 Ga0496106_0011451 3300048909 Bacteria 6561
693 Ga0496106_0287226 3300048909 Bacteria 1318
694 Ga0496106_0958708 3300048909 Bacteria 674
695 Ga0496106_1529103 3300048909 Unclassified 513
696 Ga0496107_0001150 3300048910 Bacteria 16019
697 Ga0496107_0150608 3300048910 Bacteria 1721
698 Ga0496107_0235749 3300048910 Bacteria 1362
699 Ga0496107_0257968 3300048910 Bacteria 1297
700 Ga0496107_0331340 3300048910 Bacteria 1133
701 Ga0496107_0577091 3300048910 Bacteria 832
702 Ga0496107_0877379 3300048910 Bacteria 655
703 Ga0496107_1289571 3300048910 Bacteria 523
704 Ga0496108_0020577 3300048911 Bacteria 5422
705 Ga0496108_0070728 3300048911 Bacteria 2945
706 Ga0496108_0072258 3300048911 Bacteria 2912
707 Ga0496108_0778391 3300048911 Bacteria 826
708 Ga0496109_0019909 3300048912 Bacteria 5923
709 Ga0496109_0020613 3300048912 Bacteria 5823
710 Ga0496109_0141994 3300048912 Bacteria 2246
711 Ga0496109_0173931 3300048912 Bacteria 2021
712 Ga0496109_0252543 3300048912 Bacteria 1661
713 Ga0496109_0678432 3300048912 Bacteria 968
714 Ga0496109_0798687 3300048912 Bacteria 882
715 Ga0496109_1357897 3300048912 Bacteria 646
716 Ga0496109_1385109 3300048912 Bacteria 639
717 Ga0496110_0008791 3300048913 Bacteria 8138
718 Ga0496110_0060410 3300048913 Bacteria 3343
719 Ga0496110_0135411 3300048913 Bacteria 2226
720 Ga0496110_0492448 3300048913 Bacteria 1116
721 Ga0496110_0654256 3300048913 Bacteria 951
722 Ga0496110_0670277 3300048913 Bacteria 938
723 Ga0496110_0768975 3300048913 Bacteria 867
724 Ga0496110_1152991 3300048913 Unclassified 684
725 Ga0496110_1483093 3300048913 Bacteria 588
726 Ga0496111_0012957 3300048914 Bacteria 5659
727 Ga0496111_0045478 3300048914 Bacteria 3159
728 Ga0496111_0560017 3300048914 Bacteria 839
729 Ga0496111_0709247 3300048914 Bacteria 731
730 Ga0496112_0003433 3300048915 Bacteria 13084
731 Ga0496112_0012288 3300048915 Bacteria 7863
732 Ga0496112_0137666 3300048915 Bacteria 2411
733 Ga0496112_1826406 3300048915 Bacteria 520
734 Ga0496112_1935830 3300048915 Bacteria 501
735 Ga0496113_0222141 3300048916 Bacteria 1505
736 Ga0496113_0415168 3300048916 Bacteria 1081
737 Ga0496113_0716234 3300048916 Bacteria 798
738 Ga0496114_0239539 3300048917 Bacteria 1595
739 Ga0496114_0306364 3300048917 Bacteria 1403
740 Ga0496114_0366196 3300048917 Bacteria 1275
741 Ga0496114_0599613 3300048917 Bacteria 971
742 Ga0496114_0696775 3300048917 Bacteria 891
743 Ga0496114_0713770 3300048917 Bacteria 879
744 Ga0496114_0763411 3300048917 Bacteria 845
745 Ga0496114_1032200 3300048917 Bacteria 706
746 Ga0496114_1305323 3300048917 Bacteria 613
747 Ga0496115_0041238 3300048918 Bacteria 3672
748 Ga0496115_0242644 3300048918 Bacteria 1485
749 Ga0501306_032430 3300049127 Bacteria 782
750 Ga0501040_0360027 3300049576 Bacteria 1043
751 Ga0501041_0573704 3300049577 Bacteria 720
752 Ga0501043_0556216 3300049579 Bacteria 852
753 Ga0501046_0903690 3300049580 Bacteria 616
754 Ga0501047_0000168 3300049581 Bacteria 80293
755 Ga0501047_0177033 3300049581 Bacteria 2000
756 Ga0501067_0000062 3300049583 Bacteria 61908
757 Ga0501067_0022387 3300049583 Bacteria 3497
758 Ga0501068_0000016 3300049584 Bacteria 62571
759 Ga0501069_0001293 3300049585 Bacteria 12281
760 Ga0501069_0017147 3300049585 Bacteria 3894
761 Ga0501070_0133635 3300049586 Bacteria 2049
762 Ga0501070_0199626 3300049586 Bacteria 1643
763 Ga0501070_0620391 3300049586 Bacteria 861
764 Ga0501071_0311096 3300049587 Bacteria 1195
765 Ga0501074_0072108 3300049590 Bacteria 2482
766 Ga0501074_0488053 3300049590 Bacteria 873
767 Ga0501075_0397449 3300049591 Bacteria 1051
768 Ga0501075_1195763 3300049591 Bacteria 577
769 Ga0501076_1249967 3300049592 Bacteria 611
770 Ga0501080_0599720 3300049742 Bacteria 978
771 Ga0501080_1555942 3300049742 Bacteria 561
772 Ga0501083_0961461 3300049744 Bacteria 556
773 Ga0501044_1181744 3300049823 Bacteria 633
774 nmdc:mga03683_371741_c1 3300050489 Bacteria 679
775 nmdc:mga00v17_85210_c1 3300050491 Bacteria 1978
776 nmdc:mga0yw44_394917_c1 3300050492 Bacteria 935
777 nmdc:mga0yw44_665799_c1 3300050492 Bacteria 707
778 nmdc:mga05p37_1541824_c1 3300050507 Bacteria 659
779 nmdc:mga05p37_179478_c1 3300050507 Bacteria 2577
780 nmdc:mga05p37_317441_c1 3300050507 Bacteria 1845
781 nmdc:mga09592_301017_c1 3300050508 Bacteria 1390
782 nmdc:mga09592_76442_c1 3300050508 Bacteria 2847
783 nmdc:mga09592_972732_c1 3300050508 Bacteria 711
784 nmdc:mga0qj67_158327_c1 3300050509 Bacteria 1838
785 nmdc:mga06r32_1302885_c1 3300050510 Bacteria 670
786 nmdc:mga06r32_344458_c1 3300050510 Bacteria 1475
787 nmdc:mga08y16_1405022_c1 3300050511 Bacteria 661
788 nmdc:mga08y16_205849_c1 3300050511 Bacteria 2039
789 nmdc:mga0n895_107963_c1 3300050512 Bacteria 2797
790 nmdc:mga0n895_338039_c1 3300050512 Bacteria 1525
791 nmdc:mga0n895_477941_c1 3300050512 Bacteria 1257
792 nmdc:mga0n895_512662_c1 3300050512 Bacteria 1207
793 nmdc:mga0rr50_804361_c1 3300050513 Bacteria 802
794 nmdc:mga08x19_1267472_c1 3300050514 Bacteria 522
795 nmdc:mga08x19_64140_c1 3300050514 Bacteria 2385
796 Ga0495619_0227883 3300053085 Bacteria 1291
797 Ga0495619_0279492 3300053085 Bacteria 1157
798 Ga0500646_0001030 3300053090 Bacteria 7620
799 Ga0500566_0000405 3300053094 Bacteria 24016
800 Ga0500628_259575 3300053129 Bacteria 512
801 Ga0501084_0849419 3300054114 Bacteria 768
802 Ga0590075_027127 3300059424 Bacteria 1443
803 Ga0590077_011750 3300059426 Bacteria 1810
804 Ga0587066_007459 3300059490 Bacteria 1484
805 Ga0587073_0001422 3300059492 Bacteria 2783
806 Ga0587082_007229 3300059504 Bacteria 1508
807 Ga0587089_004757 3300059509 Bacteria 1511
808 Ga0587099_001966 3300059622 Bacteria 1558
809 Ga0587122_005855 3300059628 Bacteria 1043
810 Ga0587128_000691 3300059630 Bacteria 2745
811 Ga0587114_000434 3300059655 Bacteria 2765
812 Ga0501082_0175922 3300060353 Bacteria 1861
813 Ga0501082_1320808 3300060353 Bacteria 630
814 Ga0530510_0050654 3300061734 Bacteria 2999
815 Ga0530510_0081302 3300061734 Bacteria 2359
816 Ga0530510_0138625 3300061734 Bacteria 1791
817 Ga0530510_0774769 3300061734 Bacteria 732
818 3006491275 3006486233 Bacteria 8157040
819 Ga0496109_0785473
820 JGI24739J22299_10137418
821 rootL2_10189647
822 Ga0058863_10989014
823 Ga0070658_10001317
824 Ga0070658_11280227
825 Ga0070676_10387018
826 Ga0070683_100484079
827 Ga0070683_102450382
828 Ga0070670_100417539
829 Ga0070670_101087425
830 Ga0070670_101383445
831 Ga0070677_10204927
832 Ga0070677_10825734
833 Ga0068869_100200394
834 Ga0068869_100377764
835 Ga0070666_10866492
836 Ga0070666_11135141
837 Ga0070680_100002056
838 Ga0070680_100223805
839 Ga0070680_100272151
840 Ga0070680_100379929
841 Ga0070682_100020563
842 Ga0070682_100070135
843 Ga0070682_101681668
844 Ga0068868_100087503
845 Ga0068868_100171485
846 Ga0068868_100298400
847 Ga0068868_100603507
848 Ga0070660_100001059
849 Ga0070660_100206874
850 Ga0070660_100693447
851 Ga0070660_101326274
852 Ga0070691_10010078
853 Ga0070691_10745372
854 Ga0070687_100180389
855 Ga0070661_100019788
856 Ga0070661_100204067
857 Ga0070692_10179734
858 Ga0070668_100263215
859 Ga0070668_100813772
860 Ga0070668_100836291
861 Ga0070668_101556313
862 Ga0070668_101600125
863 Ga0070669_100278794
864 Ga0070671_100788884
865 Ga0070671_100836439
866 Ga0070671_101049655
867 Ga0070674_100016176
868 Ga0070674_100717233
869 Ga0070674_100954166
870 Ga0070673_100764928
871 Ga0070673_100987016
872 Ga0070688_100097689
873 Ga0070688_100195596
874 Ga0070659_100078582
875 Ga0070659_100180142
876 Ga0070659_101077033
877 Ga0070659_101336346
878 Ga0070659_101765018
879 Ga0070667_100821759
880 Ga0070703_10006205
881 Ga0070703_10032071
882 Ga0070709_10134154
883 Ga0070714_100051876
884 Ga0070714_100095366
885 Ga0070714_100163932
886 Ga0070714_101012583
887 Ga0070714_101569375
888 Ga0070714_101656863
889 Ga0070713_100041632
890 Ga0070713_100184557
891 Ga0070701_10012626
892 Ga0070701_10099674
893 Ga0070711_100875103
894 Ga0070711_101201573
895 Ga0070711_101333923
896 Ga0070705_100247089
897 Ga0070705_101047971
898 Ga0070700_100025200
899 Ga0070700_100142223
900 Ga0070700_100833110
901 Ga0070700_101022191
902 Ga0070694_100005959
903 Ga0070694_100203331
904 Ga0070694_101030362
905 Ga0070708_100000098
906 Ga0070708_100049289
907 Ga0070708_100159079
908 Ga0070708_100280445
909 Ga0070708_100930433
910 Ga0070678_100112962
911 Ga0070678_100639897
912 Ga0070662_100045060
913 Ga0070662_100141613
914 Ga0070662_100711748
915 Ga0070662_101176154
916 Ga0070662_101533935
917 Ga0070681_10000146
918 Ga0070681_10074540
919 Ga0070681_10085889
920 Ga0068867_100045908
921 Ga0068867_101973990
922 Ga0070685_10353069
923 Ga0070685_11410768
924 Ga0070706_100000289
925 Ga0070706_100002031
926 Ga0070706_100080109
927 Ga0070707_100000191
928 Ga0070707_100008032
929 Ga0070707_100092670
930 Ga0070707_100448918
931 Ga0070707_100591730
932 Ga0070707_101296782
933 Ga0070707_101501691
934 Ga0070707_101698231
935 Ga0070707_101714069
936 Ga0070698_100004769
937 Ga0070698_100016558
938 Ga0070698_100658609
939 Ga0070698_102194268
940 Ga0070699_100004860
941 Ga0070699_100079802
942 Ga0070699_100158340
943 Ga0070699_100470917
944 Ga0070679_100001508
945 Ga0070679_100024839
946 Ga0070679_100257248
947 Ga0070679_101368331
948 Ga0070684_100262475
949 Ga0070684_100827727
950 Ga0070697_100003321
951 Ga0070697_100045107
952 Ga0070697_100067613
953 Ga0070697_100695744
954 Ga0068853_100088314
955 Ga0068853_100287144
956 Ga0068853_100326596
957 Ga0068853_100536115
958 Ga0068853_102284767
959 Ga0070672_101135450
960 Ga0070686_100044884
961 Ga0070686_100156544
962 Ga0070686_101271259
963 Ga0070686_101398908
964 Ga0070695_100027847
965 Ga0070695_100089735
966 Ga0070695_101080632
967 Ga0070695_101162347
968 Ga0070695_101251016
969 Ga0070696_100020849
970 Ga0070696_100267557
971 Ga0070696_100435365
972 Ga0070693_100522651
973 Ga0070693_100631049
974 Ga0070704_100001817
975 Ga0070704_100049008
976 Ga0070704_100203237
977 Ga0068855_100027498
978 Ga0068855_100252954
979 Ga0068855_100539604
980 Ga0068855_100541922
981 Ga0070664_100856891
982 Ga0070664_101149920
983 Ga0068854_100104227
984 Ga0068854_100611026
985 Ga0068854_100820922
986 Ga0068856_100342778
987 Ga0068856_100461391
988 Ga0068856_100971122
989 Ga0070702_100020354
990 Ga0070702_100021830
991 Ga0070702_100782704
992 Ga0068852_100209228
993 Ga0068852_100692446
994 Ga0068852_101132739
995 Ga0068859_100376796
996 Ga0068864_100077607
997 Ga0068864_100178903
998 Ga0068864_100638528
999 Ga0068864_102198060
1000 Ga0068866_10140990
1001 Ga0068861_100261828
1002 Ga0068861_100789379
1003 Ga0068858_100000021
1004 Ga0068858_101402674
1005 Ga0068860_100229269
1006 Ga0068862_100205631
1007 Ga0068862_100622901
1008 Ga0068862_100651515
1009 Ga0068862_101288524
1010 Ga0081455_10005414
1011 Ga0081455_10025004
1012 Ga0081455_10030694
1013 Ga0081455_10122209
1014 Ga0081538_10022275
1015 Ga0081538_10073881
1016 Ga0081540_1025768
1017 Ga0081539_10003063
1018 Ga0070717_10043162
1019 Ga0070717_10115698
1020 Ga0070717_11282425
1021 Ga0070717_11433601
1022 Ga0070717_11914093
1023 Ga0075365_10109300
1024 Ga0075364_10156503
1025 Ga0075364_10273757
1026 Ga0075364_10888511
1027 Ga0070715_10681915
1028 Ga0070712_100021456
1029 Ga0070712_100113711
1030 Ga0070712_100186229
1031 Ga0070712_101912409
1032 Ga0097621_100238790
1033 Ga0097621_101403678
1034 Ga0068871_100409681
1035 Ga0068871_101867201
1036 Ga0075428_100033674
1037 Ga0075428_100364071
1038 Ga0075428_101297882
1039 Ga0075431_101274791
1040 Ga0075433_10253621
1041 Ga0075434_100295787
1042 Ga0075434_100390477
1043 Ga0075434_100393053
1044 Ga0075429_100186194
1045 Ga0075429_100314789
1046 Ga0075429_100842737
1047 Ga0075429_100869216
1048 Ga0068865_100078451
1049 Ga0068865_100131476
1050 Ga0075436_100099707
1051 Ga0075436_100776798
1052 Ga0075436_101437743
1053 Ga0097620_100376798
1054 Ga0075435_101171743
1055 Ga0075435_101753285
1056 Ga0105240_10038889
1057 Ga0105240_10236909
1058 Ga0105240_10516948
1059 Ga0111539_10408304
1060 Ga0111539_10865773
1061 Ga0111539_11033776
1062 Ga0111539_11591347
1063 Ga0111539_13359805
1064 Ga0105245_10017007
1065 Ga0105245_10039361
1066 Ga0105245_10293934
1067 Ga0105245_10315594
1068 Ga0105245_10498602
1069 Ga0105245_10605204
1070 Ga0105245_11642925
1071 Ga0105245_12011262
1072 Ga0105245_13115745
1073 Ga0105247_10517389
1074 Ga0114129_10009387
1075 Ga0114129_10567774
1076 Ga0114129_11002000
1077 Ga0105243_10039454
1078 Ga0105243_10078428
1079 Ga0105243_10117174
1080 Ga0105243_10651771
1081 Ga0105243_11399702
1082 Ga0105241_11263635
1083 Ga0105242_10014890
1084 Ga0105242_10247857
1085 Ga0105242_11439497
1086 Ga0105248_10000239
1087 Ga0105248_10464987
1088 Ga0105248_11234334
1089 Ga0105248_12052272
1090 Ga0105237_10728136
1091 Ga0105238_10070580
1092 Ga0105238_10370824
1093 Ga0105238_11768254
1094 Ga0105238_11856158
1095 Ga0105238_12227703
1096 Ga0105238_12277995
1097 Ga0105249_10066335
1098 Ga0105249_10212018
1099 Ga0105249_10264485
1100 Ga0105249_10272403
1101 Ga0105249_10834098
1102 Ga0105249_11052991
1103 Ga0105249_11963553
1104 Ga0105239_10123307
1105 Ga0105239_10131578
1106 Ga0105239_10268236
1107 Ga0105239_10302894
1108 Ga0105239_12131678
1109 Ga0105246_10288069
1110 Ga0105246_10308182
1111 Ga0105246_11343937
1112 Ga0105246_12053237
1113 Ga0154019_111867
1114 Ga0157371_10088248
1115 Ga0157371_10150762
1116 Ga0157370_10453083
1117 Ga0157370_10678604
1118 Ga0157370_11549986
1119 Ga0157369_10051901
1120 Ga0157369_10609648
1121 Ga0157369_11129820
1122 Ga0157374_10178869
1123 Ga0157374_11645104
1124 Ga0157378_10280619
1125 Ga0163162_10027012
1126 Ga0163162_10745657
1127 Ga0163162_12621382
1128 Ga0163162_12924394
1129 Ga0163162_13424337
1130 Ga0157372_10031794
1131 Ga0157372_10090674
1132 Ga0157372_10246988
1133 Ga0157372_11397285
1134 Ga0157375_10090696
1135 Ga0157375_10573531
1136 Ga0157375_12217883
1137 Ga0163163_10052355
1138 Ga0163163_10517158
1139 Ga0163163_10576187
1140 Ga0163163_12285164
1141 Ga0157380_10096264
1142 Ga0157380_10321541
1143 Ga0157380_10676082
1144 Ga0157380_10851443
1145 Ga0182008_10669251
1146 Ga0157377_10459348
1147 Ga0157377_10565948
1148 Ga0157379_10000005
1149 Ga0157379_11065707
1150 Ga0157376_11388397
1151 Ga0157376_12199489
1152 Ga0163161_10012371
1153 Ga0163161_10128487
1154 Ga0163161_10240795
1155 Ga0163161_10371603
1156 Ga0163161_10816149
1157 Ga0197907_10100650
1158 Ga0197907_10315364
1159 Ga0206356_10670332
1160 Ga0206356_10746468
1161 Ga0206356_10746819
1162 Ga0206349_1078849
1163 Ga0206349_1216531
1164 Ga0206349_1817084
1165 Ga0206355_1200414
1166 Ga0206355_1531826
1167 Ga0206351_10190591
1168 Ga0206351_10878099
1169 Ga0206352_10022606
1170 Ga0206352_10576235
1171 Ga0206352_10750745
1172 Ga0206352_10966441
1173 Ga0206352_10997705
1174 Ga0206350_10644487
1175 Ga0206350_10647596
1176 Ga0206350_11110681
1177 Ga0206354_10294052
1178 Ga0206354_11092444
1179 Ga0206353_10429644
1180 Ga0206353_10463855
1181 Ga0206353_11660508
1182 Ga0154015_1074964
1183 Ga0213876_10021168
1184 Ga0213876_10051009
1185 Ga0213876_10267343
1186 Ga0224712_10007292
1187 Ga0224712_10038113
1188 Ga0224712_10077188
1189 Ga0224712_10102824
1190 Ga0224712_10138288
1191 Ga0224712_10180893
1192 Ga0224712_10183259
1193 Ga0224712_10239319
1194 Ga0224712_10291776
1195 Ga0224712_10348210
1196 Ga0224712_10527803
1197 Ga0224572_1056167
1198 Ga0207656_10308560
1199 Ga0207642_10063631
1200 Ga0207688_10076173
1201 Ga0207680_10968215
1202 Ga0207647_10512295
1203 Ga0207699_10256043
1204 Ga0207645_10340364
1205 Ga0207645_10411910
1206 Ga0207705_10109912
1207 Ga0207705_10497188
1208 Ga0207684_10000145
1209 Ga0207684_10000365
1210 Ga0207684_10328865
1211 Ga0207707_10000180
1212 Ga0207707_10071327
1213 Ga0207707_10240863
1214 Ga0207707_10824448
1215 Ga0207707_11500006
1216 Ga0207695_10077670
1217 Ga0207695_10650588
1218 Ga0207693_10445784
1219 Ga0207663_10165330
1220 Ga0207663_10767840
1221 Ga0207663_10915350
1222 Ga0207660_10023044
1223 Ga0207660_10156018
1224 Ga0207660_10246001
1225 Ga0207662_10272738
1226 Ga0207657_10001687
1227 Ga0207657_10046373
1228 Ga0207657_10577355
1229 Ga0207649_10048234
1230 Ga0207649_10082895
1231 Ga0207649_11296911
1232 Ga0207652_10000114
1233 Ga0207652_10017619
1234 Ga0207652_10042448
1235 Ga0207652_10279939
1236 Ga0207652_11061817
1237 Ga0207646_10000027
1238 Ga0207646_10000034
1239 Ga0207646_10000556
1240 Ga0207646_10146262
1241 Ga0207646_10191913
1242 Ga0207646_10477413
1243 Ga0207646_10512224
1244 Ga0207646_10726575
1245 Ga0207646_10881519
1246 Ga0207681_10647444
1247 Ga0207694_10165963
1248 Ga0207694_10456801
1249 Ga0207650_10839277
1250 Ga0207659_10654535
1251 Ga0207687_10327024
1252 Ga0207687_10632925
1253 Ga0207687_10933819
1254 Ga0207687_11941173
1255 Ga0207700_10313387
1256 Ga0207700_10371224
1257 Ga0207664_10031085
1258 Ga0207664_10098342
1259 Ga0207664_10148510
1260 Ga0207664_10962094
1261 Ga0207644_10309324
1262 Ga0207644_10630979
1263 Ga0207690_10458547
1264 Ga0207690_11311260
1265 Ga0207706_10025395
1266 Ga0207706_10038285
1267 Ga0207706_10645023
1268 Ga0207686_10137139
1269 Ga0207686_10193887
1270 Ga0207686_10225017
1271 Ga0207709_10171848
1272 Ga0207709_10320605
1273 Ga0207709_10339671
1274 Ga0207709_10517945
1275 Ga0207709_10613230
1276 Ga0207709_11562098
1277 Ga0207670_10614234
1278 Ga0207670_11025362
1279 Ga0207669_10364066
1280 Ga0207669_10613426
1281 Ga0207669_10643895
1282 Ga0207669_10869507
1283 Ga0207669_10874930
1284 Ga0207704_10033567
1285 Ga0207704_10871028
1286 Ga0207691_10483107
1287 Ga0207711_10000321
1288 Ga0207711_10226028
1289 Ga0207689_11161030
1290 Ga0207679_11007877
1291 Ga0207667_10122966
1292 Ga0207667_10211919
1293 Ga0207667_10660788
1294 Ga0207712_10196004
1295 Ga0207712_10598144
1296 Ga0207712_10758716
1297 Ga0207668_10365256
1298 Ga0207668_11935294
1299 Ga0207640_10306968
1300 Ga0207640_10337618
1301 Ga0207640_10833898
1302 Ga0207640_10931003
1303 Ga0207640_11184256
1304 Ga0207640_11594988
1305 Ga0207658_11174267
1306 Ga0207677_10042644
1307 Ga0207677_10048148
1308 Ga0207677_10432416
1309 Ga0207677_11000768
1310 Ga0207703_10000001
1311 Ga0207703_10162355
1312 Ga0207703_10462253
1313 Ga0207703_11123667
1314 Ga0207639_10187880
1315 Ga0207639_10825315
1316 Ga0207639_11603828
1317 Ga0207639_12301642
1318 Ga0207678_10163153
1319 Ga0207708_10011288
1320 Ga0207708_10203339
1321 Ga0207708_10308067
1322 Ga0207708_11446908
1323 Ga0207708_11987694
1324 Ga0207702_10484562
1325 Ga0207702_11329602
1326 Ga0207641_12372829
1327 Ga0207648_10029468
1328 Ga0207648_10826294
1329 Ga0207676_10749377
1330 Ga0207675_100192177
1331 Ga0207675_100387441
1332 Ga0207683_10060866
1333 Ga0207683_10126567
1334 Ga0207698_10520728
1335 Ga0207428_10181910
1336 Ga0207428_10499455
1337 Ga0207428_10962243
1338 Ga0268266_10772353
1339 Ga0268266_11679946
1340 Ga0268265_10155355
1341 Ga0268265_10191974
1342 Ga0268264_10220749
1343 Ga0307512_10142391
1344 Ga0265327_10001635
1345 Ga0265327_10002138
1346 Ga0265327_10240639
1347 Ga0307413_10382842
1348 Ga0307409_100376716
1349 Ga0307416_100136853
1350 Ga0307416_102156031
1351 Ga0307415_100116926
1352 Ga0307415_100356437
1353 Ga0307415_100751394
1354 Ga0373926_0041964
1355 Ga0373944_0005557
1356 Ga0373952_0029936
1357 Ga0373952_0172229
1358 Ga0373936_0089741
1359 Ga0373939_0101365
1360 Ga0373939_0461864
1361 Ga0373945_0138608
1362 Ga0373956_0392529
1363 Ga0373943_0028114
1364 Ga0373931_0042590
1365 Ga0373931_0598035
1366 Ga0373927_0108798
1367 Ga0373947_0002516
1368 Ga0373925_0281517
1369 Ga0395899_0002898
1370 Ga0395899_0003873
1371 Ga0395899_0026661
1372 Ga0395899_0077305
1373 Ga0395899_0234048
1374 Ga0395900_0009247
1375 Ga0395900_0027608
1376 Ga0395900_0106284
1377 Ga0395900_0176954
1378 Ga0395900_0224462
1379 Ga0395900_0472550
1380 Ga0395900_0651759
1381 Ga0395900_0707021
1382 Ga0395900_0755246
1383 Ga0395900_0876824
1384 Ga0395898_0001745
1385 Ga0395898_0007360
1386 Ga0395898_0037404
1387 Ga0395898_0051743
1388 Ga0395898_0055848
1389 Ga0395898_0116349
1390 Ga0395898_0157829
1391 Ga0395898_0251048
1392 Ga0395898_0342261
1393 Ga0395898_0375029
1394 Ga0395898_0420219
1395 Ga0395898_0562092
1396 Ga0395898_1603431
1397 Ga0395905_0003801
1398 Ga0395905_0045559
1399 Ga0395905_0109850
1400 Ga0395905_0158873
1401 Ga0395905_0340116
1402 Ga0395905_0410223
1403 Ga0395905_0470603
1404 Ga0395905_0690835
1405 Ga0395905_1326454
1406 Ga0436364_1403495
1407 Ga0395901_0002143
1408 Ga0395901_0003436
1409 Ga0395901_0007745
1410 Ga0395901_0010703
1411 Ga0395901_0047596
1412 Ga0395901_0047633
1413 Ga0395901_0060240
1414 Ga0395901_0111459
1415 Ga0395901_0392882
1416 Ga0395901_0453863
1417 Ga0395901_0480418
1418 Ga0395901_0595909
1419 Ga0395901_0626993
1420 Ga0395901_0983088
1421 Ga0395901_1200226
1422 Ga0395901_1316784
1423 Ga0436365_0948752
1424 Ga0436363_0681994
1425 Ga0436362_0786842
1426 Ga0451789_1278943
1427 Ga0451791_1146278
1428 Ga0451793_1929211
1429 Ga0451804_0081368
1430 Ga0451835_0403212
1431 Ga0451839_1602830
1432 Ga0451851_0087526
1433 Ga0451853_1035470
1434 Ga0451853_1409034
1435 Ga0439455_0151962
1436 Ga0439464_0063319
1437 Ga0450918_061679
1438 Ga0466972_0060339
1439 Ga0466961_0390842
1440 Ga0466964_0272437
1441 Ga0466964_0593842
1442 Ga0453684_0295227
1443 Ga0466968_0709623
1444 Ga0466960_0441381
1445 Ga0466967_0024217
1446 Ga0466967_0044979
1447 Ga0466967_0137759
1448 Ga0466967_0149913
1449 Ga0466967_0459635
1450 Ga0466967_0621991
1451 Ga0466967_1131282
1452 Ga0466967_1296292
1453 Ga0466967_2020109
1454 Ga0495603_0001198
1455 Ga0495603_0033546
1456 Ga0495603_0471913
1457 Ga0495641_0001460
1458 Ga0495582_0015341
1459 Ga0495605_0108933
1460 Ga0495639_0576192
1461 Ga0495585_0430677
1462 Ga0495594_0001348
1463 Ga0495594_0131483
1464 Ga0495594_0150692
1465 Ga0495644_0104407
1466 Ga0495663_0099815
1467 Ga0495666_0047536
1468 Ga0495666_0167840
1469 Ga0495642_0071980
1470 Ga0495652_0677488
1471 Ga0495640_0855743
1472 Ga0495586_0533925
1473 Ga0495588_0002101
1474 Ga0495588_0140416
1475 Ga0495647_0025975
1476 Ga0495658_0162038
1477 Ga0495613_0011076
1478 Ga0495589_0170710
1479 Ga0495604_0612637
1480 Ga0495676_0004181
1481 Ga0495676_0429929
1482 Ga0495676_0549784
1483 Ga0495680_0183277
1484 Ga0495685_111174
1485 Ga0496100_0031199
1486 Ga0496100_0074729
1487 Ga0496100_0901835
1488 Ga0496101_0013039
1489 Ga0496101_0124460
1490 Ga0496101_0191825
1491 Ga0496101_0328542
1492 Ga0496102_0073411
1493 Ga0496102_0138652
1494 Ga0496102_0231882
1495 Ga0496102_0272016
1496 Ga0496102_0409223
1497 Ga0496102_0698843
1498 Ga0496103_0030273
1499 Ga0496103_0115453
1500 Ga0496103_0176617
1501 Ga0496104_0013175
1502 Ga0496104_0091360
1503 Ga0496104_0158667
1504 Ga0496104_0175252
1505 Ga0496104_0182384
1506 Ga0496104_0968583
1507 Ga0496105_0038494
1508 Ga0496105_0079462
1509 Ga0496105_0227213
1510 Ga0496106_0011451
1511 Ga0496106_0287226
1512 Ga0496106_0958708
1513 Ga0496106_1529103
1514 Ga0496107_0001150
1515 Ga0496107_0150608
1516 Ga0496107_0235749
1517 Ga0496107_0257968
1518 Ga0496107_0331340
1519 Ga0496107_0577091
1520 Ga0496107_0877379
1521 Ga0496107_1289571
1522 Ga0496108_0020577
1523 Ga0496108_0070728
1524 Ga0496108_0072258
1525 Ga0496108_0778391
1526 Ga0496109_0019909
1527 Ga0496109_0020613
1528 Ga0496109_0141994
1529 Ga0496109_0173931
1530 Ga0496109_0252543
1531 Ga0496109_0678432
1532 Ga0496109_0798687
1533 Ga0496109_1357897
1534 Ga0496109_1385109
1535 Ga0496110_0008791
1536 Ga0496110_0060410
1537 Ga0496110_0135411
1538 Ga0496110_0492448
1539 Ga0496110_0654256
1540 Ga0496110_0670277
1541 Ga0496110_0768975
1542 Ga0496110_1152991
1543 Ga0496110_1483093
1544 Ga0496111_0012957
1545 Ga0496111_0045478
1546 Ga0496111_0560017
1547 Ga0496111_0709247
1548 Ga0496112_0003433
1549 Ga0496112_0012288
1550 Ga0496112_0137666
1551 Ga0496112_1826406
1552 Ga0496112_1935830
1553 Ga0496113_0222141
1554 Ga0496113_0415168
1555 Ga0496113_0716234
1556 Ga0496114_0239539
1557 Ga0496114_0306364
1558 Ga0496114_0366196
1559 Ga0496114_0599613
1560 Ga0496114_0696775
1561 Ga0496114_0713770
1562 Ga0496114_0763411
1563 Ga0496114_1032200
1564 Ga0496114_1305323
1565 Ga0496115_0041238
1566 Ga0496115_0242644
1567 Ga0501306_032430
1568 Ga0501040_0360027
1569 Ga0501041_0573704
1570 Ga0501043_0556216
1571 Ga0501046_0903690
1572 Ga0501047_0000168
1573 Ga0501047_0177033
1574 Ga0501067_0000062
1575 Ga0501067_0022387
1576 Ga0501068_0000016
1577 Ga0501069_0001293
1578 Ga0501069_0017147
1579 Ga0501070_0133635
1580 Ga0501070_0199626
1581 Ga0501070_0620391
1582 Ga0501071_0311096
1583 Ga0501074_0072108
1584 Ga0501074_0488053
1585 Ga0501075_0397449
1586 Ga0501075_1195763
1587 Ga0501076_1249967
1588 Ga0501080_0599720
1589 Ga0501080_1555942
1590 Ga0501083_0961461
1591 Ga0501044_1181744
1592 nmdc:mga03683_371741_c1
1593 nmdc:mga00v17_85210_c1
1594 nmdc:mga0yw44_394917_c1
1595 nmdc:mga0yw44_665799_c1
1596 nmdc:mga05p37_1541824_c1
1597 nmdc:mga05p37_179478_c1
1598 nmdc:mga05p37_317441_c1
1599 nmdc:mga09592_301017_c1
1600 nmdc:mga09592_76442_c1
1601 nmdc:mga09592_972732_c1
1602 nmdc:mga0qj67_158327_c1
1603 nmdc:mga06r32_1302885_c1
1604 nmdc:mga06r32_344458_c1
1605 nmdc:mga08y16_1405022_c1
1606 nmdc:mga08y16_205849_c1
1607 nmdc:mga0n895_107963_c1
1608 nmdc:mga0n895_338039_c1
1609 nmdc:mga0n895_477941_c1
1610 nmdc:mga0n895_512662_c1
1611 nmdc:mga0rr50_804361_c1
1612 nmdc:mga08x19_1267472_c1
1613 nmdc:mga08x19_64140_c1
1614 Ga0495619_0227883
1615 Ga0495619_0279492
1616 Ga0500646_0001030
1617 Ga0500566_0000405
1618 Ga0500628_259575
1619 Ga0501084_0849419
1620 Ga0590075_027127
1621 Ga0590077_011750
1622 Ga0587066_007459
1623 Ga0587073_0001422
1624 Ga0587082_007229
1625 Ga0587089_004757
1626 Ga0587099_001966
1627 Ga0587122_005855
1628 Ga0587128_000691
1629 Ga0587114_000434
1630 Ga0501082_0175922
1631 Ga0501082_1320808
1632 Ga0530510_0050654
1633 Ga0530510_0081302
1634 Ga0530510_0138625
1635 Ga0530510_0774769
1636 3006491275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tfe-assembly1.cif.gz_A-2 dimerization domain of ef-ts from t. thermophilus 0.8163 4 43
4r71-assembly2.cif.gz_C structure of the qbeta holoenzyme complex in the p1211 crystal form 0.7674 2 44
2rcy-assembly1.cif.gz_B-2 crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.4205 14 110
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.4146 14 110
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.4016 14 110
ID Description Score Start End Superfamily
af_Q2FWD7_13_140_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9272 76 110 2.40.50.140
3ibyB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8723 4 40 1.10.287.1770
af_Q5AD67_599_817_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8473 4 47 3.40.50.300
2a8vC01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.8458 76 110 1.10.720.10
2a8vA01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.8454 76 110 1.10.720.10
ID Description Score Start End GO Terms
AF-A0A538L3B4-F1-model_v4 Plasmid stabilization protein 1.011 77 110
AF-A0A841FJ41-F1-model_v4 Hemerythrin superfamily protein 1.006 78 111
AF-A0A7W7S4R3-F1-model_v4 Rho termination factor-like N-terminal domain-containing protein 0.9964 77 110 GO:0006353
AF-A0A7Z0EI02-F1-model_v4 Non-homologous end joining protein Ku 0.9858 76 110 GO:0003690
GO:0006303
GO:0006310
AF-A0A366J3K5-F1-model_v4 deleted 0.9804 77 110

Map