F482139

General Info

Members Datasets Scaffolds Average Seq Length
818 392 818 290

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0103831|Ga0495599_0103831_103_1041
Length 312
Sequence LAGHDTVVGGEVSHVNIGFVGLGAMGALIVPRLMAAGHKVTGWNRSREKAEPLIAAGMAFAATPRAVAEASNIVFSIVTDSAAVKAVALGPDSIVSGLRKGGIYIDMSTIEPDASRAIAVQFAKAGSIMLDGPLSGSPVTVKAGQASVMIGGDTDAFERAKPVLLAIGPKVTRIGGNGLACQMKIAVNLLLMVEVVCFGEAVALAEKGGVSREAAVDAILKSVAASPVLGYRGPFILDGKMPQVPLADVTLQQKDMVLALNLARQLGSPTPLAAAANEMMNACRGLGIDGNDFVVAHEVYRRLGGQDSGGQS

Samples

Sample ID Description Type Environment
1 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
217 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
255 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
258 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
378 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
383 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
384 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
385 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
386 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 7.46
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_101096 3300001430 Bacteria 1242
2 JGI24739J22299_10002121 3300001989 Bacteria 7595
3 JGI24737J22298_10052069 3300001990 Bacteria 1242
4 JGI24738J21930_10000603 3300002075 Bacteria 10284
5 JGI24744J21845_10021141 3300002077 Bacteria 1281
6 JGI24742J22300_10000182 3300002244 Bacteria 9344
7 JGI25153J46596_10001830 3300003215 Bacteria 12615
8 JGI25404J52841_10001497 3300003659 Bacteria 4129
9 Ga0065712_10073712 3300005290 Bacteria 4301
10 Ga0065715_10033142 3300005293 Bacteria 1333
11 Ga0065715_10038806 3300005293 Bacteria 1302
12 Ga0065715_10105333 3300005293 Bacteria 2888
13 Ga0070658_10008341 3300005327 Bacteria 8334
14 Ga0070676_10051418 3300005328 Bacteria 2419
15 Ga0070676_10064937 3300005328 Bacteria 2178
16 Ga0070676_10131434 3300005328 Bacteria 1583
17 Ga0070683_100112237 3300005329 Bacteria 2572
18 Ga0070683_100179942 3300005329 Bacteria 2007
19 Ga0070690_100009488 3300005330 Bacteria 5639
20 Ga0070690_100061022 3300005330 Bacteria 2428
21 Ga0070690_100065647 3300005330 Bacteria 2346
22 Ga0070690_100070519 3300005330 Bacteria 2270
23 Ga0070690_100078035 3300005330 Bacteria 2163
24 Ga0070670_100003446 3300005331 Bacteria 13127
25 Ga0070670_100253137 3300005331 Bacteria 1534
26 Ga0070677_10000850 3300005333 Bacteria 10051
27 Ga0070677_10005124 3300005333 Bacteria 4307
28 Ga0068869_100068955 3300005334 Bacteria 2613
29 Ga0070666_10035891 3300005335 Bacteria 3288
30 Ga0070680_100002046 3300005336 Bacteria 14868
31 Ga0070680_100029747 3300005336 Bacteria 4385
32 Ga0070680_100148328 3300005336 Bacteria 1969
33 Ga0070680_100295800 3300005336 Bacteria 1372
34 Ga0070682_100051160 3300005337 Bacteria 2581
35 Ga0070682_100097231 3300005337 Bacteria 1937
36 Ga0068868_100007860 3300005338 Bacteria 7613
37 Ga0068868_100068138 3300005338 Bacteria 2833
38 Ga0070660_100014760 3300005339 Bacteria 5635
39 Ga0070660_100057652 3300005339 Bacteria 3009
40 Ga0070660_100067823 3300005339 Bacteria 2780
41 Ga0070689_100032584 3300005340 Bacteria 3965
42 Ga0070691_10015311 3300005341 Bacteria 3523
43 Ga0070691_10079341 3300005341 Bacteria 1604
44 Ga0070691_10087488 3300005341 Bacteria 1532
45 Ga0070687_100074678 3300005343 Bacteria 1831
46 Ga0070661_100034503 3300005344 Bacteria 3669
47 Ga0070692_10014667 3300005345 Bacteria 3688
48 Ga0070669_100134924 3300005353 Bacteria 1898
49 Ga0070675_100031240 3300005354 Bacteria 4304
50 Ga0070671_100031396 3300005355 Bacteria 4387
51 Ga0070671_100048924 3300005355 Bacteria 3518
52 Ga0070671_100088793 3300005355 Bacteria 2587
53 Ga0070671_100109517 3300005355 Bacteria 2320
54 Ga0070674_100004085 3300005356 Bacteria 8293
55 Ga0070674_100044083 3300005356 Bacteria 3039
56 Ga0070674_100468251 3300005356 Bacteria 1043
57 Ga0070673_100024056 3300005364 Bacteria 4459
58 Ga0070673_100074134 3300005364 Bacteria 2742
59 Ga0070688_100217271 3300005365 Bacteria 1345
60 Ga0070667_100179532 3300005367 Bacteria 1872
61 Ga0070667_100245963 3300005367 Bacteria 1598
62 Ga0070703_10000581 3300005406 Bacteria 13211
63 Ga0070703_10056791 3300005406 Bacteria 1269
64 Ga0070709_10015619 3300005434 Bacteria 4323
65 Ga0070709_10047996 3300005434 Bacteria 2662
66 Ga0070713_100009134 3300005436 Bacteria 7073
67 Ga0070710_10042196 3300005437 Bacteria 2521
68 Ga0070710_10071345 3300005437 Bacteria 2003
69 Ga0070701_10004158 3300005438 Bacteria 5819
70 Ga0070701_10016834 3300005438 Bacteria 3406
71 Ga0070711_100040118 3300005439 Bacteria 3156
72 Ga0070711_100110934 3300005439 Bacteria 2013
73 Ga0070705_100000029 3300005440 Bacteria 74892
74 Ga0070705_100046450 3300005440 Bacteria 2503
75 Ga0070700_100006751 3300005441 Bacteria 6149
76 Ga0070700_100035933 3300005441 Bacteria 3002
77 Ga0070694_100001913 3300005444 Bacteria 12326
78 Ga0070708_100019278 3300005445 Bacteria 5729
79 Ga0070663_100017829 3300005455 Bacteria 4641
80 Ga0070663_100021364 3300005455 Bacteria 4304
81 Ga0070663_100401338 3300005455 Bacteria 1121
82 Ga0070663_100438002 3300005455 Bacteria 1075
83 Ga0070678_100015278 3300005456 Bacteria 4875
84 Ga0070678_100034483 3300005456 Bacteria 3525
85 Ga0070678_100122904 3300005456 Bacteria 2050
86 Ga0070681_10006973 3300005458 Bacteria 10994
87 Ga0070681_10019175 3300005458 Bacteria 6845
88 Ga0070681_10021379 3300005458 Bacteria 6488
89 Ga0070681_10037074 3300005458 Bacteria 4893
90 Ga0068867_100032997 3300005459 Bacteria 3746
91 Ga0068867_100036282 3300005459 Bacteria 3578
92 Ga0070685_10013164 3300005466 Bacteria 4356
93 Ga0070685_10020314 3300005466 Bacteria 3594
94 Ga0070685_10064762 3300005466 Bacteria 2150
95 Ga0070699_100002214 3300005518 Bacteria 17577
96 Ga0070699_100249741 3300005518 Bacteria 1585
97 Ga0070679_100045743 3300005530 Bacteria 4361
98 Ga0070679_100058074 3300005530 Bacteria 3856
99 Ga0070679_100090727 3300005530 Bacteria 3044
100 Ga0070679_100098937 3300005530 Bacteria 2904
101 Ga0070679_100195835 3300005530 Bacteria 1988
102 Ga0070679_100217549 3300005530 Bacteria 1872
103 Ga0070684_100021722 3300005535 Bacteria 5346
104 Ga0070684_100277916 3300005535 Bacteria 1534
105 Ga0070697_100004654 3300005536 Bacteria 10530
106 Ga0070697_100297716 3300005536 Bacteria 1386
107 Ga0068853_100001878 3300005539 Bacteria 15466
108 Ga0070672_100171918 3300005543 Bacteria 1802
109 Ga0070672_100225401 3300005543 Bacteria 1573
110 Ga0070686_100017153 3300005544 Bacteria 4226
111 Ga0070686_100168685 3300005544 Unclassified 1546
112 Ga0070695_100000160 3300005545 Bacteria 32049
113 Ga0070693_100032047 3300005547 Bacteria 2886
114 Ga0070693_100060169 3300005547 Bacteria 2204
115 Ga0070665_100515242 3300005548 Bacteria 1208
116 Ga0070704_100016986 3300005549 Bacteria 4615
117 Ga0070704_100289452 3300005549 Bacteria 1360
118 Ga0068855_100111876 3300005563 Bacteria 3134
119 Ga0068855_100395816 3300005563 Bacteria 1515
120 Ga0070664_100025168 3300005564 Bacteria 4931
121 Ga0070664_100033488 3300005564 Bacteria 4304
122 Ga0068857_100003866 3300005577 Bacteria 12607
123 Ga0068857_100057660 3300005577 Bacteria 3447
124 Ga0068857_100361934 3300005577 Bacteria 1345
125 Ga0068854_100008558 3300005578 Bacteria 6584
126 Ga0068854_100202033 3300005578 Unclassified 1563
127 Ga0068856_100061788 3300005614 Bacteria 3701
128 Ga0068856_100086050 3300005614 Bacteria 3123
129 Ga0070702_100037215 3300005615 Bacteria 2702
130 Ga0068852_100045885 3300005616 Bacteria 3720
131 Ga0068859_100003957 3300005617 Bacteria 15121
132 Ga0068859_100048711 3300005617 Bacteria 4256
133 Ga0068859_100078377 3300005617 Bacteria 3344
134 Ga0068859_100301684 3300005617 Bacteria 1695
135 Ga0068864_100003430 3300005618 Bacteria 13111
136 Ga0068864_100057124 3300005618 Bacteria 3372
137 Ga0068866_10011424 3300005718 Bacteria 3841
138 Ga0068866_10206396 3300005718 Bacteria 1177
139 Ga0068861_100061076 3300005719 Bacteria 2891
140 Ga0068861_100186890 3300005719 Bacteria 1729
141 Ga0068861_100280561 3300005719 Bacteria 1434
142 Ga0068863_100003702 3300005841 Bacteria 15115
143 Ga0068858_100010330 3300005842 Bacteria 8845
144 Ga0068858_100237366 3300005842 Bacteria 1729
145 Ga0068860_100004938 3300005843 Bacteria 13591
146 Ga0068860_100058980 3300005843 Bacteria 3650
147 Ga0068860_100076084 3300005843 Bacteria 3192
148 Ga0068860_100136419 3300005843 Bacteria 2356
149 Ga0068860_100464997 3300005843 Bacteria 1259
150 Ga0068862_100000814 3300005844 Bacteria 30885
151 Ga0068862_100087829 3300005844 Bacteria 2704
152 Ga0068862_100320396 3300005844 Bacteria 1431
153 Ga0081538_10019318 3300005981 Bacteria 5070
154 Ga0081538_10046977 3300005981 Bacteria 2654
155 Ga0081540_1000869 3300005983 Bacteria 27365
156 Ga0070717_10070194 3300006028 Bacteria 2919
157 Ga0075365_10018339 3300006038 Bacteria 4302
158 Ga0075365_10131953 3300006038 Bacteria 1729
159 Ga0075368_10028739 3300006042 Bacteria 2149
160 Ga0075364_10009379 3300006051 Bacteria 5868
161 Ga0075364_10173526 3300006051 Bacteria 1458
162 Ga0070712_100004896 3300006175 Bacteria 8281
163 Ga0070712_100070696 3300006175 Bacteria 2495
164 Ga0075362_10025889 3300006177 Bacteria 2502
165 Ga0075362_10056957 3300006177 Bacteria 1760
166 Ga0075367_10001375 3300006178 Bacteria 10378
167 Ga0075369_10013818 3300006186 Bacteria 3213
168 Ga0075366_10027627 3300006195 Bacteria 3330
169 Ga0075366_10030441 3300006195 Bacteria 3173
170 Ga0075366_10110707 3300006195 Bacteria 1651
171 Ga0097621_100004664 3300006237 Bacteria 9574
172 Ga0075370_10246697 3300006353 Bacteria 1058
173 Ga0068871_100001982 3300006358 Bacteria 13874
174 Ga0075430_100124411 3300006846 Bacteria 2150
175 Ga0075431_100064079 3300006847 Bacteria 3794
176 Ga0075431_100326322 3300006847 Bacteria 1547
177 Ga0075431_100459746 3300006847 Bacteria 1267
178 Ga0075433_10069775 3300006852 Bacteria 3087
179 Ga0075434_100074529 3300006871 Bacteria 3387
180 Ga0075434_100160183 3300006871 Bacteria 2270
181 Ga0075429_100258159 3300006880 Bacteria 1526
182 Ga0075429_100303409 3300006880 Bacteria 1398
183 Ga0068865_100014555 3300006881 Bacteria 5001
184 Ga0068865_100176589 3300006881 Bacteria 1642
185 Ga0068865_100176733 3300006881 Bacteria 1641
186 Ga0068865_100298447 3300006881 Bacteria 1289
187 Ga0097620_100003957 3300006931 Bacteria 15121
188 Ga0097620_100048710 3300006931 Bacteria 4256
189 Ga0097620_100078378 3300006931 Bacteria 3344
190 Ga0097620_100301689 3300006931 Bacteria 1695
191 Ga0075435_100411321 3300007076 Bacteria 1164
192 Ga0105244_10046414 3300009036 Bacteria 2232
193 Ga0105250_10025315 3300009092 Bacteria 2391
194 Ga0105240_10018034 3300009093 Bacteria 9492
195 Ga0105240_10037984 3300009093 Bacteria 6183
196 Ga0105240_10096089 3300009093 Bacteria 3612
197 Ga0111539_10046029 3300009094 Bacteria 5221
198 Ga0111539_10118849 3300009094 Bacteria 3098
199 Ga0105245_10005456 3300009098 Bacteria 11171
200 Ga0105245_10021701 3300009098 Bacteria 5637
201 Ga0105245_10105815 3300009098 Bacteria 2610
202 Ga0105247_10010633 3300009101 Bacteria 5557
203 Ga0105247_10022193 3300009101 Bacteria 3822
204 Ga0105247_10177358 3300009101 Bacteria 1420
205 Ga0114129_10008798 3300009147 Bacteria 14405
206 Ga0114129_10173116 3300009147 Bacteria 2942
207 Ga0105243_10017609 3300009148 Bacteria 5403
208 Ga0105243_10062943 3300009148 Bacteria 2972
209 Ga0105243_10481139 3300009148 Bacteria 1172
210 Ga0105241_10023596 3300009174 Bacteria 4562
211 Ga0105241_10075162 3300009174 Bacteria 2632
212 Ga0105242_10036922 3300009176 Bacteria 3922
213 Ga0105242_10114216 3300009176 Bacteria 2307
214 Ga0105242_10387107 3300009176 Bacteria 1301
215 Ga0105248_10001504 3300009177 Bacteria 25935
216 Ga0105248_10018134 3300009177 Bacteria 7772
217 Ga0105248_10035902 3300009177 Bacteria 5544
218 Ga0105248_10071786 3300009177 Bacteria 3890
219 Ga0105248_10077990 3300009177 Bacteria 3725
220 Ga0105237_10065342 3300009545 Bacteria 3635
221 Ga0105238_10005215 3300009551 Bacteria 12837
222 Ga0105238_10020403 3300009551 Bacteria 6746
223 Ga0105238_10042427 3300009551 Bacteria 4606
224 Ga0105238_10309892 3300009551 Bacteria 1563
225 Ga0105249_10000961 3300009553 Bacteria 25470
226 Ga0105239_10027540 3300010375 Bacteria 6255
227 Ga0105239_10347400 3300010375 Bacteria 1675
228 Ga0105239_10578783 3300010375 Bacteria 1280
229 Ga0157373_10045521 3300013100 Bacteria 3132
230 Ga0157371_10025553 3300013102 Bacteria 4302
231 Ga0157371_10065389 3300013102 Bacteria 2576
232 Ga0157370_10094886 3300013104 Bacteria 2798
233 Ga0157370_10302121 3300013104 Bacteria 1477
234 Ga0157369_10202355 3300013105 Bacteria 2084
235 Ga0157369_10538050 3300013105 Bacteria 1208
236 Ga0157369_10765283 3300013105 Bacteria 993
237 Ga0157374_10018784 3300013296 Bacteria 6109
238 Ga0157378_10070619 3300013297 Bacteria 3136
239 Ga0157378_10613459 3300013297 Bacteria 1100
240 Ga0163162_10062793 3300013306 Bacteria 3755
241 Ga0163162_10140638 3300013306 Bacteria 2527
242 Ga0163162_10235538 3300013306 Bacteria 1961
243 Ga0157372_10014878 3300013307 Bacteria 8329
244 Ga0157372_10185734 3300013307 Bacteria 2407
245 Ga0157372_10215503 3300013307 Bacteria 2225
246 Ga0157372_10280924 3300013307 Bacteria 1936
247 Ga0157375_10070481 3300013308 Bacteria 3506
248 Ga0157375_10306592 3300013308 Bacteria 1752
249 Ga0163163_10041560 3300014325 Bacteria 4497
250 Ga0163163_10083757 3300014325 Bacteria 3194
251 Ga0163163_10755232 3300014325 Bacteria 1036
252 Ga0157380_10247840 3300014326 Bacteria 1610
253 Ga0157380_10397726 3300014326 Bacteria 1306
254 Ga0157377_10010239 3300014745 Bacteria 4631
255 Ga0157379_10049595 3300014968 Bacteria 3749
256 Ga0157379_10095739 3300014968 Bacteria 2664
257 Ga0157379_10537301 3300014968 Bacteria 1087
258 Ga0157376_10002979 3300014969 Bacteria 11611
259 Ga0157376_10159259 3300014969 Bacteria 2044
260 Ga0163161_10000941 3300017792 Bacteria 22395
261 Ga0163161_10216051 3300017792 Bacteria 1483
262 Ga0163161_10220971 3300017792 Bacteria 1467
263 Ga0206354_10355791 3300020081 Bacteria 1902
264 Ga0206353_11753873 3300020082 Bacteria 1075
265 Ga0213876_10006322 3300021384 Bacteria 6455
266 Ga0209758_1000428 3300025297 Bacteria 71178
267 Ga0207697_10002352 3300025315 Bacteria 9849
268 Ga0207697_10019741 3300025315 Bacteria 2761
269 Ga0207653_10000445 3300025885 Bacteria 16882
270 Ga0207653_10006154 3300025885 Bacteria 3740
271 Ga0207682_10000293 3300025893 Bacteria 22550
272 Ga0207682_10000391 3300025893 Bacteria 20145
273 Ga0207682_10032321 3300025893 Bacteria 2103
274 Ga0207692_10056116 3300025898 Bacteria 2019
275 Ga0207692_10094419 3300025898 Bacteria 1629
276 Ga0207642_10154074 3300025899 Unclassified 1227
277 Ga0207710_10006497 3300025900 Bacteria 4986
278 Ga0207710_10018896 3300025900 Bacteria 2935
279 Ga0207710_10170202 3300025900 Bacteria 1065
280 Ga0207688_10000070 3300025901 Bacteria 38023
281 Ga0207688_10291995 3300025901 Bacteria 995
282 Ga0207680_10101877 3300025903 Bacteria 1846
283 Ga0207647_10048930 3300025904 Bacteria 2624
284 Ga0207699_10071795 3300025906 Bacteria 2118
285 Ga0207645_10041285 3300025907 Bacteria 2953
286 Ga0207645_10085916 3300025907 Bacteria 2020
287 Ga0207645_10112775 3300025907 Bacteria 1761
288 Ga0207643_10000123 3300025908 Bacteria 53091
289 Ga0207643_10114919 3300025908 Bacteria 1589
290 Ga0207705_10124153 3300025909 Bacteria 1917
291 Ga0207707_10004337 3300025912 Bacteria 12553
292 Ga0207707_10011032 3300025912 Bacteria 7863
293 Ga0207707_10012557 3300025912 Bacteria 7362
294 Ga0207707_10060483 3300025912 Bacteria 3295
295 Ga0207707_10346084 3300025912 Bacteria 1281
296 Ga0207695_10134638 3300025913 Bacteria 2425
297 Ga0207695_10220917 3300025913 Bacteria 1802
298 Ga0207693_10004569 3300025915 Bacteria 11683
299 Ga0207693_10010674 3300025915 Bacteria 7456
300 Ga0207693_10045608 3300025915 Bacteria 3444
301 Ga0207663_10030224 3300025916 Bacteria 3193
302 Ga0207663_10070522 3300025916 Bacteria 2252
303 Ga0207663_10089629 3300025916 Bacteria 2037
304 Ga0207660_10002992 3300025917 Bacteria 11072
305 Ga0207660_10004649 3300025917 Bacteria 8948
306 Ga0207660_10029631 3300025917 Bacteria 3757
307 Ga0207660_10093782 3300025917 Bacteria 2231
308 Ga0207660_10227006 3300025917 Bacteria 1467
309 Ga0207662_10015158 3300025918 Bacteria 4333
310 Ga0207657_10008644 3300025919 Bacteria 10309
311 Ga0207657_10009786 3300025919 Bacteria 9610
312 Ga0207657_10048246 3300025919 Bacteria 3719
313 Ga0207657_10240437 3300025919 Bacteria 1446
314 Ga0207649_10029754 3300025920 Bacteria 3228
315 Ga0207649_10167301 3300025920 Bacteria 1528
316 Ga0207652_10015347 3300025921 Bacteria 6220
317 Ga0207652_10016117 3300025921 Bacteria 6095
318 Ga0207652_10033952 3300025921 Bacteria 4297
319 Ga0207652_10066903 3300025921 Bacteria 3115
320 Ga0207652_10234136 3300025921 Bacteria 1655
321 Ga0207652_10364349 3300025921 Bacteria 1304
322 Ga0207681_10011037 3300025923 Bacteria 5548
323 Ga0207694_10062629 3300025924 Bacteria 2896
324 Ga0207694_10099955 3300025924 Bacteria 2298
325 Ga0207650_10002345 3300025925 Bacteria 13152
326 Ga0207659_10011847 3300025926 Bacteria 5522
327 Ga0207687_10086721 3300025927 Bacteria 2274
328 Ga0207687_10297796 3300025927 Bacteria 1298
329 Ga0207700_10011773 3300025928 Bacteria 5598
330 Ga0207664_10016757 3300025929 Bacteria 5353
331 Ga0207644_10015103 3300025931 Bacteria 5180
332 Ga0207644_10016369 3300025931 Bacteria 4989
333 Ga0207690_10113766 3300025932 Bacteria 1953
334 Ga0207706_10002469 3300025933 Bacteria 18019
335 Ga0207686_10002206 3300025934 Bacteria 10719
336 Ga0207686_10042645 3300025934 Bacteria 2775
337 Ga0207686_10215374 3300025934 Bacteria 1383
338 Ga0207709_10008232 3300025935 Bacteria 5776
339 Ga0207709_10037345 3300025935 Bacteria 2886
340 Ga0207709_10052962 3300025935 Bacteria 2495
341 Ga0207709_10120711 3300025935 Bacteria 1769
342 Ga0207670_10002470 3300025936 Bacteria 9703
343 Ga0207670_10012750 3300025936 Bacteria 4929
344 Ga0207670_10332602 3300025936 Archaea 1198
345 Ga0207669_10007077 3300025937 Bacteria 5164
346 Ga0207669_10194838 3300025937 Bacteria 1465
347 Ga0207704_10138250 3300025938 Bacteria 1699
348 Ga0207704_10141154 3300025938 Bacteria 1685
349 Ga0207704_10258892 3300025938 Bacteria 1311
350 Ga0207665_10066777 3300025939 Bacteria 2448
351 Ga0207691_10001015 3300025940 Bacteria 27838
352 Ga0207691_10004072 3300025940 Bacteria 14179
353 Ga0207691_10141859 3300025940 Bacteria 2117
354 Ga0207691_10230051 3300025940 Bacteria 1606
355 Ga0207711_10015167 3300025941 Bacteria 6400
356 Ga0207711_10039695 3300025941 Bacteria 4004
357 Ga0207711_10045937 3300025941 Bacteria 3732
358 Ga0207711_10103861 3300025941 Bacteria 2517
359 Ga0207711_10436593 3300025941 Bacteria 1218
360 Ga0207689_10007859 3300025942 Bacteria 9317
361 Ga0207689_10090789 3300025942 Bacteria 2510
362 Ga0207661_10022343 3300025944 Bacteria 4762
363 Ga0207661_10075558 3300025944 Bacteria 2765
364 Ga0207667_10030658 3300025949 Bacteria 5814
365 Ga0207667_10135727 3300025949 Bacteria 2533
366 Ga0207667_10195824 3300025949 Bacteria 2073
367 Ga0207651_10050097 3300025960 Bacteria 2834
368 Ga0207651_10123352 3300025960 Bacteria 1969
369 Ga0207651_10133205 3300025960 Bacteria 1906
370 Ga0207712_10001153 3300025961 Bacteria 18408
371 Ga0207712_10213862 3300025961 Bacteria 1537
372 Ga0207658_10023467 3300025986 Bacteria 4306
373 Ga0207658_10199650 3300025986 Bacteria 1669
374 Ga0207658_10432633 3300025986 Bacteria 1162
375 Ga0207677_10019295 3300026023 Bacteria 4115
376 Ga0207677_10119426 3300026023 Bacteria 1980
377 Ga0207703_10076901 3300026035 Bacteria 2769
378 Ga0207703_10091104 3300026035 Bacteria 2564
379 Ga0207639_10057698 3300026041 Bacteria 2982
380 Ga0207639_10102153 3300026041 Bacteria 2320
381 Ga0207678_10000688 3300026067 Bacteria 30961
382 Ga0207678_10031385 3300026067 Bacteria 4634
383 Ga0207678_10296910 3300026067 Bacteria 1388
384 Ga0207708_10007349 3300026075 Bacteria 8140
385 Ga0207702_10274011 3300026078 Bacteria 1593
386 Ga0207648_10002850 3300026089 Bacteria 18308
387 Ga0207648_10062381 3300026089 Bacteria 3249
388 Ga0207676_10001647 3300026095 Bacteria 16445
389 Ga0207676_10045488 3300026095 Bacteria 3392
390 Ga0207676_10063875 3300026095 Bacteria 2925
391 Ga0207676_10102860 3300026095 Bacteria 2372
392 Ga0207674_10010786 3300026116 Bacteria 10306
393 Ga0207674_10015583 3300026116 Bacteria 8347
394 Ga0207674_10034544 3300026116 Bacteria 5283
395 Ga0207675_100075881 3300026118 Bacteria 3147
396 Ga0207675_100174468 3300026118 Bacteria 2056
397 Ga0207675_100314555 3300026118 Bacteria 1528
398 Ga0207683_10032865 3300026121 Bacteria 4507
399 Ga0207683_10071264 3300026121 Bacteria 3072
400 Ga0207683_10288703 3300026121 Bacteria 1500
401 Ga0207698_10098028 3300026142 Bacteria 2421
402 Ga0207698_10102424 3300026142 Bacteria 2377
403 Ga0207698_10129801 3300026142 Bacteria 2151
404 Ga0210002_1000422 3300027617 Bacteria 5737
405 Ga0209983_1001018 3300027665 Bacteria 6206
406 Ga0209971_1001863 3300027682 Bacteria 5161
407 Ga0209966_1001831 3300027695 Bacteria 3601
408 Ga0209998_10002702 3300027717 Bacteria 4002
409 Ga0209974_10018690 3300027876 Bacteria 2299
410 Ga0207428_10034736 3300027907 Bacteria 4128
411 Ga0268266_10118273 3300028379 Bacteria 2356
412 Ga0268265_10001430 3300028380 Bacteria 20132
413 Ga0268265_10154089 3300028380 Bacteria 1942
414 Ga0268264_10085414 3300028381 Bacteria 2709
415 Ga0268264_10117817 3300028381 Bacteria 2336
416 Ga0268264_10254174 3300028381 Bacteria 1634
417 Ga0265318_10007557 3300028577 Bacteria 4901
418 Ga0265338_10133447 3300028800 Bacteria 1956
419 Ga0265330_10022924 3300031235 Bacteria 2837
420 Ga0265332_10033062 3300031238 Bacteria 2252
421 Ga0265320_10030967 3300031240 Bacteria 2753
422 Ga0265325_10000004 3300031241 Bacteria 347347
423 Ga0265325_10000637 3300031241 Bacteria 25504
424 Ga0265325_10000671 3300031241 Bacteria 24941
425 Ga0265325_10006661 3300031241 Bacteria 6988
426 Ga0265325_10015673 3300031241 Bacteria 4257
427 Ga0265325_10018972 3300031241 Bacteria 3809
428 Ga0265325_10048143 3300031241 Bacteria 2204
429 Ga0265340_10038400 3300031247 Bacteria 2368
430 Ga0265340_10043763 3300031247 Bacteria 2193
431 Ga0265339_10009785 3300031249 Bacteria 5992
432 Ga0265339_10012548 3300031249 Bacteria 5170
433 Ga0265316_10009607 3300031344 Bacteria 8887
434 Ga0265316_10127728 3300031344 Bacteria 1916
435 Ga0265313_10000118 3300031595 Bacteria 79605
436 Ga0265313_10005881 3300031595 Bacteria 8894
437 Ga0265313_10010184 3300031595 Bacteria 5996
438 Ga0265313_10010448 3300031595 Bacteria 5867
439 Ga0265314_10012846 3300031711 Bacteria 6803
440 Ga0265314_10085898 3300031711 Bacteria 2062
441 Ga0265342_10000674 3300031712 Bacteria 35642
442 Ga0265342_10013532 3300031712 Bacteria 5468
443 Ga0265342_10019918 3300031712 Bacteria 4315
444 Ga0316576_10005448 3300031727 Bacteria 7777
445 Ga0316578_10000852 3300031728 Bacteria 11447
446 Ga0307416_100439397 3300032002 Bacteria 1354
447 Ga0307415_100347008 3300032126 Bacteria 1248
448 Ga0316583_10016641 3300032133 Bacteria 2645
449 Ga0373930_0005799 3300034816 Bacteria 2066
450 Ga0373958_0017723 3300034819 Bacteria 1284
451 Ga0373938_0003020 3300034957 Bacteria 2731
452 Ga0373928_0031699 3300035084 Bacteria 1175
453 Ga0373934_0019984 3300035086 Bacteria 2574
454 Ga0373949_0005787 3300035090 Bacteria 2750
455 Ga0373952_0004789 3300035092 Bacteria 2462
456 Ga0373952_0014494 3300035092 Bacteria 1579
457 Ga0373952_0031509 3300035092 Bacteria 1179
458 Ga0373936_0012370 3300035113 Bacteria 3246
459 Ga0373939_0022407 3300035114 Unclassified 1741
460 Ga0373939_0026565 3300035114 Bacteria 1633
461 Ga0373941_0007639 3300035115 Bacteria 2653
462 Ga0373945_0013554 3300035116 Bacteria 2722
463 Ga0373953_0008276 3300035117 Bacteria 3525
464 Ga0373953_0055621 3300035117 Bacteria 1607
465 Ga0373954_0009161 3300035118 Bacteria 4355
466 Ga0373954_0133203 3300035118 Bacteria 1211
467 Ga0373956_0007281 3300035119 Bacteria 4456
468 Ga0373957_0030808 3300035120 Bacteria 1967
469 Ga0373943_0012011 3300035170 Bacteria 3898
470 Ga0373943_0014642 3300035170 Bacteria 3555
471 Ga0373946_0074127 3300035171 Bacteria 1477
472 Ga0373946_0082989 3300035171 Unclassified 1406
473 Ga0373955_0006492 3300035172 Bacteria 5329
474 Ga0373955_0032412 3300035172 Bacteria 2742
475 Ga0373942_0039300 3300035207 Bacteria 1286
476 Ga0373961_0009231 3300035241 Bacteria 2410
477 Ga0373961_0063400 3300035241 Bacteria 1127
478 Ga0373962_0002525 3300035242 Bacteria 4343
479 Ga0316574_0003805 3300035398 Bacteria 7826
480 Ga0373924_0164112 3300035410 Bacteria 975
481 Ga0373931_0003778 3300035691 Bacteria 6851
482 Ga0373931_0024303 3300035691 Bacteria 3068
483 Ga0373931_0165701 3300035691 Bacteria 1298
484 Ga0373935_0017861 3300035692 Bacteria 4309
485 Ga0373935_0046414 3300035692 Bacteria 2744
486 Ga0373935_0559082 3300035692 Bacteria 834
487 Ga0373927_0031014 3300035695 Bacteria 3487
488 Ga0373927_0299325 3300035695 Bacteria 1058
489 Ga0373933_0003561 3300035724 Bacteria 8656
490 Ga0373947_0030379 3300035725 Bacteria 3174
491 Ga0373937_0002015 3300036401 Bacteria 16944
492 Ga0373937_0025551 3300036401 Bacteria 5333
493 Ga0373937_0391092 3300036401 Bacteria 1319
494 Ga0373937_0653894 3300036401 Bacteria 997
495 Ga0316584_0533536 3300036712 Unclassified 821
496 Ga0373925_0030165 3300037068 Bacteria 3979
497 Ga0373925_0134357 3300037068 Bacteria 1932
498 Ga0373925_0137764 3300037068 Bacteria 1908
499 Ga0395899_0089309 3300037312 Bacteria 2235
500 Ga0395899_0341462 3300037312 Unclassified 1004
501 Ga0395900_0016731 3300037418 Bacteria 7480
502 Ga0395900_0049091 3300037418 Bacteria 4347
503 Ga0395898_0006493 3300037466 Bacteria 12490
504 Ga0395898_0012187 3300037466 Bacteria 8894
505 Ga0395901_0076786 3300038443 Bacteria 3485
506 Ga0395901_0153652 3300038443 Bacteria 2417
507 Ga0395901_0449982 3300038443 Bacteria 1317
508 Ga0436365_0368495 3300039437 Bacteria 2520
509 Ga0436365_0940061 3300039437 Bacteria 15467
510 Ga0436365_1063276 3300039437 Bacteria 1888
511 Ga0436365_1065374 3300039437 Bacteria 2648
512 Ga0436365_1497092 3300039437 Bacteria 975
513 Ga0436360_0713145 3300039438 Bacteria 1693
514 Ga0439453_0002540 3300041408 Bacteria 2530
515 Ga0439450_040575 3300042008 Bacteria 1079
516 Ga0439455_0006154 3300042012 Bacteria 2477
517 Ga0439463_019687 3300042016 Bacteria 1681
518 Ga0450909_016028 3300042185 Bacteria 1106
519 Ga0439435_0059131 3300042436 Bacteria 1113
520 Ga0439464_0044445 3300042439 Bacteria 1272
521 Ga0439460_0034896 3300042461 Bacteria 1452
522 Ga0466961_0056701 3300044693 Bacteria 2496
523 Ga0466963_0028079 3300044694 Bacteria 3609
524 Ga0466963_0097736 3300044694 Bacteria 2006
525 Ga0466957_0020555 3300044842 Bacteria 3885
526 Ga0466959_0366817 3300045049 Bacteria 981
527 Ga0466958_0040706 3300045836 Bacteria 2793
528 Ga0466967_0026063 3300045976 Bacteria 4835
529 Ga0466967_0034563 3300045976 Bacteria 4292
530 Ga0466967_0327322 3300045976 Bacteria 1479
531 Ga0495592_0037989 3300046454 Bacteria 3623
532 Ga0495603_0014815 3300046455 Bacteria 4715
533 Ga0495603_0047868 3300046455 Bacteria 2546
534 Ga0495629_0166533 3300046459 Bacteria 1530
535 Ga0495638_0093024 3300046460 Bacteria 1814
536 Ga0495638_0174943 3300046460 Bacteria 1229
537 Ga0495641_0023441 3300046461 Bacteria 3065
538 Ga0495651_0020442 3300046462 Bacteria 5140
539 Ga0495653_0000751 3300046463 Bacteria 24812
540 Ga0495580_0312123 3300046472 Bacteria 1069
541 Ga0495582_0011728 3300046473 Bacteria 4830
542 Ga0495605_0033157 3300046474 Bacteria 2624
543 Ga0495639_0041542 3300046475 Bacteria 2071
544 Ga0495662_0008327 3300046476 Bacteria 5099
545 Ga0495664_0014023 3300046477 Bacteria 4540
546 Ga0495664_0032905 3300046477 Bacteria 3045
547 Ga0495594_0080736 3300046499 Unclassified 1815
548 Ga0495608_0008056 3300046511 Bacteria 7405
549 Ga0495618_0007287 3300046514 Bacteria 6694
550 Ga0495618_0038175 3300046514 Bacteria 3017
551 Ga0495628_0004433 3300046516 Bacteria 12452
552 Ga0495628_0074254 3300046516 Bacteria 2649
553 Ga0495630_0032173 3300046517 Bacteria 3907
554 Ga0495630_0169219 3300046517 Unclassified 1664
555 Ga0495652_0003050 3300046529 Bacteria 16791
556 Ga0495652_0013600 3300046529 Bacteria 7325
557 Ga0495652_0042670 3300046529 Bacteria 3910
558 Ga0495652_0239581 3300046529 Bacteria 1351
559 Ga0495640_0024383 3300046533 Bacteria 4402
560 Ga0495640_0072843 3300046533 Bacteria 2300
561 Ga0495587_0004793 3300046536 Bacteria 8882
562 Ga0495587_0027469 3300046536 Bacteria 3465
563 Ga0495598_0001166 3300046537 Bacteria 5078
564 Ga0495645_0000362 3300046543 Bacteria 31574
565 Ga0495667_0008809 3300046559 Bacteria 6861
566 Ga0495667_0043814 3300046559 Bacteria 2964
567 Ga0495656_0128624 3300046615 Bacteria 1203
568 Ga0495634_0043895 3300046642 Bacteria 3028
569 Ga0495635_0018844 3300046663 Bacteria 4817
570 Ga0495635_0023357 3300046663 Bacteria 4310
571 Ga0495635_0079835 3300046663 Bacteria 2239
572 Ga0495588_0027130 3300046674 Bacteria 2862
573 Ga0495657_0005082 3300046675 Bacteria 10450
574 Ga0495657_0026388 3300046675 Bacteria 4113
575 Ga0495599_0055185 3300046678 Bacteria 2488
576 Ga0495599_0061128 3300046678 Bacteria 2354
577 Ga0495599_0103831 3300046678 Bacteria 1771
578 Ga0495623_0042547 3300046679 Bacteria 2893
579 Ga0495646_0095916 3300046680 Bacteria 1706
580 Ga0495646_0115692 3300046680 Bacteria 1522
581 Ga0495647_0057327 3300046681 Bacteria 1529
582 Ga0495647_0098963 3300046681 Bacteria 1205
583 Ga0495658_0056265 3300046683 Bacteria 2242
584 Ga0495669_0009448 3300046684 Bacteria 4113
585 Ga0495624_0035632 3300046690 Bacteria 3212
586 Ga0495600_0002228 3300046809 Bacteria 11036
587 Ga0495604_0002960 3300047317 Bacteria 13601
588 Ga0495604_0094303 3300047317 Bacteria 2213
589 Ga0495604_0146254 3300047317 Bacteria 1684
590 Ga0495674_0020696 3300047319 Bacteria 6092
591 Ga0495674_0053171 3300047319 Bacteria 3561
592 Ga0495676_0058839 3300047321 Bacteria 3021
593 Ga0495680_0008230 3300047322 Bacteria 9499
594 Ga0495680_0033364 3300047322 Bacteria 4169
595 Ga0495675_0012940 3300047444 Bacteria 5259
596 Ga0495675_0085333 3300047444 Bacteria 1985
597 Ga0495675_0117824 3300047444 Bacteria 1655
598 Ga0495677_0122042 3300047445 Bacteria 994
599 Ga0495685_026971 3300047447 Bacteria 1976
600 Ga0495681_0139167 3300047470 Bacteria 1027
601 Ga0495684_0154548 3300047471 Bacteria 1714
602 Ga0495593_0149527 3300047673 Bacteria 1181
603 Ga0495593_0162320 3300047673 Bacteria 1128
604 Ga0495602_0003618 3300048088 Bacteria 16007
605 Ga0495602_0012504 3300048088 Bacteria 8717
606 Ga0495602_0094183 3300048088 Bacteria 2476
607 Ga0495615_0019781 3300048090 Bacteria 1499
608 Ga0496100_0029999 3300048903 Bacteria 3369
609 Ga0496100_0096611 3300048903 Bacteria 2027
610 Ga0496100_0177586 3300048903 Bacteria 1538
611 Ga0496100_0299312 3300048903 Bacteria 1204
612 Ga0496101_0018116 3300048904 Bacteria 4782
613 Ga0496101_0025685 3300048904 Bacteria 4088
614 Ga0496102_0008005 3300048905 Bacteria 9033
615 Ga0496102_0010790 3300048905 Bacteria 7868
616 Ga0496102_0058812 3300048905 Bacteria 3513
617 Ga0496102_0116302 3300048905 Bacteria 2495
618 Ga0496102_0152153 3300048905 Bacteria 2174
619 Ga0496102_0329100 3300048905 Bacteria 1439
620 Ga0496103_0016769 3300048906 Bacteria 4375
621 Ga0496103_0016949 3300048906 Bacteria 4352
622 Ga0496103_0058138 3300048906 Bacteria 2402
623 Ga0496104_0000827 3300048907 Bacteria 26682
624 Ga0496104_0003340 3300048907 Bacteria 13851
625 Ga0496104_0008871 3300048907 Bacteria 8938
626 Ga0496104_0082139 3300048907 Bacteria 3073
627 Ga0496104_0331835 3300048907 Bacteria 1434
628 Ga0496105_0002816 3300048908 Bacteria 12715
629 Ga0496105_0004588 3300048908 Bacteria 10405
630 Ga0496106_0000691 3300048909 Bacteria 24224
631 Ga0496106_0039341 3300048909 Bacteria 3541
632 Ga0496106_0047139 3300048909 Bacteria 3242
633 Ga0496106_0084989 3300048909 Bacteria 2435
634 Ga0496107_0004871 3300048910 Bacteria 9120
635 Ga0496107_0051145 3300048910 Bacteria 2979
636 Ga0496107_0061808 3300048910 Bacteria 2712
637 Ga0496108_0007809 3300048911 Bacteria 8668
638 Ga0496108_0028673 3300048911 Bacteria 4606
639 Ga0496108_0087996 3300048911 Bacteria 2639
640 Ga0496108_0151059 3300048911 Bacteria 2004
641 Ga0496108_0228304 3300048911 Bacteria 1618
642 Ga0496108_0334005 3300048911 Bacteria 1322
643 Ga0496109_0007061 3300048912 Bacteria 9476
644 Ga0496109_0020039 3300048912 Bacteria 5906
645 Ga0496109_0037747 3300048912 Bacteria 4365
646 Ga0496109_0322353 3300048912 Bacteria 1458
647 Ga0496110_0023803 3300048913 Bacteria 5212
648 Ga0496110_0061326 3300048913 Bacteria 3319
649 Ga0496110_0091910 3300048913 Bacteria 2715
650 Ga0496110_0105732 3300048913 Bacteria 2525
651 Ga0496110_0295722 3300048913 Bacteria 1475
652 Ga0496110_0356901 3300048913 Bacteria 1332
653 Ga0496111_0005954 3300048914 Bacteria 7867
654 Ga0496111_0168288 3300048914 Bacteria 1628
655 Ga0496111_0241384 3300048914 Bacteria 1342
656 Ga0496112_0070199 3300048915 Bacteria 3462
657 Ga0496112_0133992 3300048915 Bacteria 2448
658 Ga0496112_0176317 3300048915 Bacteria 2102
659 Ga0496112_0367973 3300048915 Bacteria 1379
660 Ga0496113_0006670 3300048916 Bacteria 7345
661 Ga0496113_0060134 3300048916 Bacteria 2863
662 Ga0496113_0234602 3300048916 Bacteria 1463
663 Ga0496114_0007484 3300048917 Bacteria 8632
664 Ga0496114_0070788 3300048917 Bacteria 2930
665 Ga0496114_0197915 3300048917 Bacteria 1759
666 Ga0496115_0003882 3300048918 Bacteria 10775
667 Ga0496115_0056660 3300048918 Bacteria 3150
668 Ga0496115_0058141 3300048918 Bacteria 3111
669 Ga0501031_0012832 3300049568 Bacteria 5474
670 Ga0501031_0015920 3300049568 Bacteria 4882
671 Ga0501032_0079651 3300049569 Bacteria 2181
672 Ga0501033_0009055 3300049570 Bacteria 7680
673 Ga0501033_0019159 3300049570 Bacteria 5174
674 Ga0501033_0043734 3300049570 Bacteria 3335
675 Ga0501034_0000319 3300049571 Bacteria 84488
676 Ga0501034_0006473 3300049571 Bacteria 12613
677 Ga0501034_0042869 3300049571 Bacteria 4580
678 Ga0501034_0073408 3300049571 Bacteria 3430
679 Ga0501034_0099042 3300049571 Bacteria 2910
680 Ga0501034_0178057 3300049571 Bacteria 2092
681 Ga0501036_0019093 3300049572 Bacteria 5752
682 Ga0501036_0200179 3300049572 Bacteria 1680
683 Ga0501038_0008825 3300049574 Bacteria 9247
684 Ga0501038_0074431 3300049574 Bacteria 2873
685 Ga0501038_0123920 3300049574 Bacteria 2128
686 Ga0501038_0151507 3300049574 Bacteria 1890
687 Ga0501039_0010144 3300049575 Bacteria 7177
688 Ga0501039_0145115 3300049575 Bacteria 1865
689 Ga0501039_0244502 3300049575 Bacteria 1411
690 Ga0501040_0094811 3300049576 Bacteria 2077
691 Ga0501042_0066804 3300049578 Bacteria 2571
692 Ga0501042_0124335 3300049578 Bacteria 1857
693 Ga0501046_0061644 3300049580 Bacteria 2931
694 Ga0501046_0067556 3300049580 Bacteria 2784
695 Ga0501047_0004229 3300049581 Bacteria 13514
696 Ga0501047_0032947 3300049581 Bacteria 5003
697 Ga0501047_0065145 3300049581 Bacteria 3513
698 Ga0501047_0071043 3300049581 Bacteria 3351
699 Ga0501047_0243430 3300049581 Bacteria 1648
700 Ga0501048_0019705 3300049582 Bacteria 4947
701 Ga0501067_0020479 3300049583 Bacteria 3661
702 Ga0501067_0043246 3300049583 Bacteria 2501
703 Ga0501068_0012758 3300049584 Bacteria 4772
704 Ga0501068_0147326 3300049584 Bacteria 1478
705 Ga0501069_0002514 3300049585 Bacteria 9362
706 Ga0501069_0010152 3300049585 Bacteria 4981
707 Ga0501069_0015088 3300049585 Bacteria 4139
708 Ga0501069_0037545 3300049585 Bacteria 2673
709 Ga0501069_0117473 3300049585 Bacteria 1518
710 Ga0501070_0007456 3300049586 Bacteria 9293
711 Ga0501070_0020970 3300049586 Bacteria 5481
712 Ga0501070_0028420 3300049586 Bacteria 4690
713 Ga0501070_0059878 3300049586 Bacteria 3156
714 Ga0501071_0018829 3300049587 Bacteria 4787
715 Ga0501071_0167455 3300049587 Bacteria 1645
716 Ga0501072_0026931 3300049588 Bacteria 4486
717 Ga0501072_0076081 3300049588 Bacteria 2656
718 Ga0501072_0139840 3300049588 Bacteria 1930
719 Ga0501072_0268011 3300049588 Bacteria 1359
720 Ga0501072_0393328 3300049588 Bacteria 1100
721 Ga0501073_0010312 3300049589 Bacteria 6858
722 Ga0501073_0012418 3300049589 Bacteria 6216
723 Ga0501073_0066027 3300049589 Bacteria 2522
724 Ga0501074_0007397 3300049590 Bacteria 7942
725 Ga0501074_0028981 3300049590 Bacteria 4010
726 Ga0501075_0092049 3300049591 Bacteria 2301
727 Ga0501075_0101143 3300049591 Bacteria 2189
728 Ga0501075_0296529 3300049591 Bacteria 1232
729 Ga0501076_0181826 3300049592 Bacteria 1714
730 Ga0501076_0289733 3300049592 Bacteria 1341
731 Ga0501077_0010632 3300049593 Bacteria 5731
732 Ga0501077_0155522 3300049593 Bacteria 1451
733 Ga0501077_0227813 3300049593 Bacteria 1185
734 Ga0501079_0030249 3300049741 Bacteria 4161
735 Ga0501079_0046847 3300049741 Bacteria 3336
736 Ga0501079_0228077 3300049741 Bacteria 1455
737 Ga0501079_0305614 3300049741 Bacteria 1244
738 Ga0501079_0377270 3300049741 Unclassified 1112
739 Ga0501079_0600855 3300049741 Bacteria 866
740 Ga0501080_0030118 3300049742 Bacteria 5055
741 Ga0501080_0120725 3300049742 Bacteria 2429
742 Ga0501080_0184895 3300049742 Bacteria 1916
743 Ga0501083_0031289 3300049744 Bacteria 3653
744 Ga0501083_0149539 3300049744 Bacteria 1529
745 Ga0501035_0001744 3300049822 Bacteria 21967
746 Ga0501035_0387870 3300049822 Bacteria 1164
747 Ga0501035_0413721 3300049822 Bacteria 1120
748 Ga0501044_0000243 3300049823 Bacteria 68966
749 Ga0501044_0025222 3300049823 Bacteria 6304
750 Ga0501044_0033688 3300049823 Bacteria 5380
751 Ga0501044_0255750 3300049823 Bacteria 1691
752 Ga0501044_0420061 3300049823 Bacteria 1247
753 Ga0501045_0133890 3300049824 Bacteria 1843
754 nmdc:mga03683_16047_c1 3300050489 Bacteria 2806
755 nmdc:mga03683_18029_c1 3300050489 Bacteria 2679
756 nmdc:mga03683_55912_c1 3300050489 Bacteria 1658
757 nmdc:mga00v17_193875_c1 3300050491 Bacteria 1313
758 nmdc:mga0yw44_238713_c1 3300050492 Bacteria 1208
759 nmdc:mga0k408_30511_c1 3300050493 Bacteria 3074
760 nmdc:mga0k408_6984_c1 3300050493 Bacteria 5398
761 nmdc:mga06z11_23082_c1 3300050494 Bacteria 2916
762 nmdc:mga06z11_25944_c1 3300050494 Bacteria 2784
763 nmdc:mga07m45_190474_c1 3300050496 Bacteria 1193
764 nmdc:mga07m45_232941_c1 3300050496 Bacteria 1072
765 nmdc:mga07m45_81689_c1 3300050496 Bacteria 1845
766 nmdc:mga05p37_135088_c1 3300050507 Bacteria 3026
767 nmdc:mga05p37_517672_c1 3300050507 Bacteria 1365
768 nmdc:mga05p37_657760_c1 3300050507 Bacteria 1172
769 nmdc:mga06r32_194571_c1 3300050510 Bacteria 2015
770 nmdc:mga06r32_586727_c1 3300050510 Bacteria 1086
771 nmdc:mga06r32_6250_c1 3300050510 Bacteria 10690
772 nmdc:mga08y16_107681_c1 3300050511 Bacteria 2902
773 nmdc:mga08y16_202474_c1 3300050511 Bacteria 2057
774 nmdc:mga08y16_621396_c1 3300050511 Bacteria 1087
775 nmdc:mga0n895_374977_c1 3300050512 Bacteria 1440
776 nmdc:mga0n895_82205_c1 3300050512 Bacteria 3210
777 nmdc:mga08x19_216209_c1 3300050514 Bacteria 1316
778 nmdc:mga0a205_139884_c1 3300050515 Bacteria 2321
779 nmdc:mga0sz30_3009_c1 3300050516 Bacteria 6043
780 Ga0495601_0000520 3300053077 Bacteria 20314
781 Ga0495601_0013675 3300053077 Bacteria 4881
782 Ga0495601_0013873 3300053077 Bacteria 4851
783 Ga0495601_0023318 3300053077 Bacteria 3802
784 Ga0495601_0058824 3300053077 Bacteria 2436
785 Ga0495601_0186908 3300053077 Bacteria 1354
786 Ga0495612_0006426 3300053078 Bacteria 4831
787 Ga0495612_0010707 3300053078 Bacteria 3705
788 Ga0495612_0011713 3300053078 Bacteria 3534
789 Ga0495655_0009033 3300053083 Bacteria 1917
790 Ga0495595_0001335 3300053084 Bacteria 9585
791 Ga0495595_0001933 3300053084 Bacteria 8041
792 Ga0495595_0082279 3300053084 Bacteria 1535
793 Ga0495619_0000888 3300053085 Bacteria 19654
794 Ga0495619_0017366 3300053085 Bacteria 4556
795 Ga0495619_0025991 3300053085 Bacteria 3763
796 Ga0495619_0086273 3300053085 Bacteria 2121
797 Ga0500643_005044 3300053087 Bacteria 5776
798 Ga0500644_0000501 3300053088 Bacteria 16934
799 Ga0500641_0000893 3300053096 Bacteria 10671
800 Ga0500641_0031920 3300053096 Bacteria 2080
801 Ga0500595_000001 3300053119 Bacteria 1088438
802 Ga0500595_045320 3300053119 Bacteria 1389
803 Ga0500597_050641 3300053120 Bacteria 1769
804 Ga0500618_022359 3300053125 Bacteria 1537
805 Ga0500652_011719 3300053131 Bacteria 3049
806 Ga0500616_0000001 3300053153 Bacteria 1986011
807 Ga0500616_0066835 3300053153 Bacteria 1844
808 Ga0500616_0073169 3300053153 Bacteria 1741
809 Ga0500645_000050 3300053730 Bacteria 99596
810 Ga0501084_0052522 3300054114 Bacteria 3410
811 Ga0501082_0023544 3300060353 Bacteria 5313
812 Ga0501082_0052919 3300060353 Bacteria 3500
813 Ga0501082_0085209 3300060353 Bacteria 2726
814 Ga0501082_0220619 3300060353 Bacteria 1650
815 Ga0501082_0334218 3300060353 Bacteria 1320
816 Ga0466962_0115012 3300061719 Bacteria 1296
817 Ga0530510_0009146 3300061734 Bacteria 6941
818 Ga0530510_0055716 3300061734 Bacteria 2856

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0341462 Ga0395899_0341462_25_849 248
2 3300035171 Ga0373946_0082989 Ga0373946_0082989_614_1366 250
3 3300035692 Ga0373935_0046414 Ga0373935_0046414_1961_2713 250
4 3300036401 Ga0373937_0653894 Ga0373937_0653894_187_939 250
5 3300036712 Ga0316584_0533536 Ga0316584_0533536_49_804 250
6 3300039437 Ga0436365_1497092 Ga0436365_1497092_11_850 250
7 3300042439 Ga0439464_0044445 Ga0439464_0044445_482_1234 250
8 3300046517 Ga0495630_0169219 Ga0495630_0169219_41_793 250
9 3300047444 Ga0495675_0085333 Ga0495675_0085333_1210_1962 250
10 3300047445 Ga0495677_0122042 Ga0495677_0122042_228_980 250
11 3300049581 Ga0501047_0065145 Ga0501047_0065145_1401_2153 250
12 3300049588 Ga0501072_0393328 Ga0501072_0393328_289_1044 250
13 3300049592 Ga0501076_0289733 Ga0501076_0289733_543_1295 250
14 3300049741 Ga0501079_0600855 Ga0501079_0600855_47_799 250
15 3300005616 Ga0068852_100045885 Ga0068852_1000458852 254
16 3300025949 Ga0207667_10135727 Ga0207667_101357273 254
17 3300026142 Ga0207698_10102424 Ga0207698_101024242 254
18 3300035692 Ga0373935_0559082 Ga0373935_0559082_44_823 255
19 3300047317 Ga0495604_0146254 Ga0495604_0146254_222_1103 255
20 3300025907 Ga0207645_10112775 Ga0207645_101127752 256
21 3300013104 Ga0157370_10094886 Ga0157370_100948863 259
22 3300039437 Ga0436365_0940061 Ga0436365_0940061_10692_11588 262
23 3300026121 Ga0207683_10288703 Ga0207683_102887032 266
24 3300005336 Ga0070680_100295800 Ga0070680_1002958002 267
25 3300013307 Ga0157372_10280924 Ga0157372_102809242 267
26 3300037312 Ga0395899_0089309 Ga0395899_0089309_407_1288 267
27 3300037418 Ga0395900_0016731 Ga0395900_0016731_5607_6488 267
28 3300037466 Ga0395898_0012187 Ga0395898_0012187_7049_7930 267
29 3300038443 Ga0395901_0153652 Ga0395901_0153652_969_1850 267
30 3300038443 Ga0395901_0449982 Ga0395901_0449982_202_1167 267
31 3300044694 Ga0466963_0097736 Ga0466963_0097736_261_1136 267
32 3300044842 Ga0466957_0020555 Ga0466957_0020555_2293_3168 267
33 3300045836 Ga0466958_0040706 Ga0466958_0040706_1624_2499 267
34 3300044694 Ga0466963_0028079 Ga0466963_0028079_695_1624 269
35 3300045976 Ga0466967_0034563 Ga0466967_0034563_3310_4239 269
36 3300048903 Ga0496100_0029999 Ga0496100_0029999_1610_2491 269
37 3300005530 Ga0070679_100217549 Ga0070679_1002175493 270
38 3300009093 Ga0105240_10018034 Ga0105240_1001803411 270
39 3300013102 Ga0157371_10065389 Ga0157371_100653892 270
40 3300020082 Ga0206353_11753873 Ga0206353_117538731 270
41 3300025912 Ga0207707_10004337 Ga0207707_100043378 270
42 3300025921 Ga0207652_10015347 Ga0207652_100153473 270
43 3300053730 Ga0500645_000050 Ga0500645_000050_32855_33715 270
44 3300025913 Ga0207695_10220917 Ga0207695_102209172 274
45 3300036401 Ga0373937_0391092 Ga0373937_0391092_480_1304 274
46 3300045049 Ga0466959_0366817 Ga0466959_0366817_136_960 274
47 3300049593 Ga0501077_0227813 Ga0501077_0227813_14_838 274
48 3300049741 Ga0501079_0228077 Ga0501079_0228077_22_849 274
49 3300053119 Ga0500595_045320 Ga0500595_045320_549_1373 274
50 3300061719 Ga0466962_0115012 Ga0466962_0115012_11_835 274
51 3300037418 Ga0395900_0049091 Ga0395900_0049091_1031_1912 276
52 3300037466 Ga0395898_0006493 Ga0395898_0006493_10786_11667 276
53 3300038443 Ga0395901_0076786 Ga0395901_0076786_56_937 276
54 3300035114 Ga0373939_0026565 Ga0373939_0026565_260_1141 278
55 3300046460 Ga0495638_0174943 Ga0495638_0174943_294_1175 280
56 3300031235 Ga0265330_10022924 Ga0265330_100229243 282
57 3300005328 Ga0070676_10064937 Ga0070676_100649372 283
58 3300005330 Ga0070690_100009488 Ga0070690_1000094885 283
59 3300005355 Ga0070671_100109517 Ga0070671_1001095173 283
60 3300005364 Ga0070673_100074134 Ga0070673_1000741343 283
61 3300005434 Ga0070709_10015619 Ga0070709_100156193 283
62 3300005436 Ga0070713_100009134 Ga0070713_1000091344 283
63 3300005466 Ga0070685_10064762 Ga0070685_100647622 283
64 3300005535 Ga0070684_100277916 Ga0070684_1002779162 283
65 3300005543 Ga0070672_100225401 Ga0070672_1002254012 283
66 3300005548 Ga0070665_100515242 Ga0070665_1005152422 283
67 3300005617 Ga0068859_100048711 Ga0068859_1000487115 283
68 3300005719 Ga0068861_100186890 Ga0068861_1001868902 283
69 3300005843 Ga0068860_100058980 Ga0068860_1000589802 283
70 3300006931 Ga0097620_100048710 Ga0097620_1000487102 283
71 3300009092 Ga0105250_10025315 Ga0105250_100253154 283
72 3300009093 Ga0105240_10037984 Ga0105240_100379845 283
73 3300009093 Ga0105240_10096089 Ga0105240_100960894 283
74 3300009094 Ga0111539_10118849 Ga0111539_101188494 283
75 3300009098 Ga0105245_10005456 Ga0105245_100054562 283
76 3300009101 Ga0105247_10010633 Ga0105247_100106333 283
77 3300009101 Ga0105247_10022193 Ga0105247_100221934 283
78 3300009101 Ga0105247_10177358 Ga0105247_101773582 283
79 3300009148 Ga0105243_10017609 Ga0105243_100176095 283
80 3300009148 Ga0105243_10062943 Ga0105243_100629434 283
81 3300009174 Ga0105241_10023596 Ga0105241_100235963 283
82 3300009176 Ga0105242_10114216 Ga0105242_101142163 283
83 3300009176 Ga0105242_10387107 Ga0105242_103871071 283
84 3300009177 Ga0105248_10001504 Ga0105248_1000150425 283
85 3300009177 Ga0105248_10035902 Ga0105248_100359022 283
86 3300009177 Ga0105248_10071786 Ga0105248_100717864 283
87 3300009545 Ga0105237_10065342 Ga0105237_100653423 283
88 3300009551 Ga0105238_10005215 Ga0105238_100052156 283
89 3300010375 Ga0105239_10347400 Ga0105239_103474002 283
90 3300013100 Ga0157373_10045521 Ga0157373_100455214 283
91 3300013102 Ga0157371_10025553 Ga0157371_100255532 283
92 3300013105 Ga0157369_10538050 Ga0157369_105380501 283
93 3300013296 Ga0157374_10018784 Ga0157374_100187848 283
94 3300013306 Ga0163162_10062793 Ga0163162_100627932 283
95 3300013307 Ga0157372_10014878 Ga0157372_100148785 283
96 3300013308 Ga0157375_10070481 Ga0157375_100704814 283
97 3300013308 Ga0157375_10306592 Ga0157375_103065922 283
98 3300014325 Ga0163163_10041560 Ga0163163_100415605 283
99 3300014325 Ga0163163_10083757 Ga0163163_100837572 283
100 3300014326 Ga0157380_10247840 Ga0157380_102478402 283
101 3300014745 Ga0157377_10010239 Ga0157377_100102393 283
102 3300014968 Ga0157379_10049595 Ga0157379_100495953 283
103 3300014969 Ga0157376_10002979 Ga0157376_1000297912 283
104 3300017792 Ga0163161_10220971 Ga0163161_102209712 283
105 3300025297 Ga0209758_1000428 Ga0209758_100042866 283
106 3300025315 Ga0207697_10019741 Ga0207697_100197413 283
107 3300025901 Ga0207688_10291995 Ga0207688_102919951 283
108 3300025907 Ga0207645_10085916 Ga0207645_100859163 283
109 3300025927 Ga0207687_10297796 Ga0207687_102977962 283
110 3300025934 Ga0207686_10215374 Ga0207686_102153742 283
111 3300025935 Ga0207709_10052962 Ga0207709_100529622 283
112 3300025936 Ga0207670_10002470 Ga0207670_100024705 283
113 3300025940 Ga0207691_10230051 Ga0207691_102300512 283
114 3300025941 Ga0207711_10103861 Ga0207711_101038612 283
115 3300025960 Ga0207651_10050097 Ga0207651_100500973 283
116 3300026095 Ga0207676_10063875 Ga0207676_100638752 283
117 3300026118 Ga0207675_100075881 Ga0207675_1000758813 283
118 3300028380 Ga0268265_10154089 Ga0268265_101540892 283
119 3300031241 Ga0265325_10018972 Ga0265325_100189723 283
120 3300031241 Ga0265325_10048143 Ga0265325_100481432 283
121 3300031344 Ga0265316_10009607 Ga0265316_100096072 283
122 3300034816 Ga0373930_0005799 Ga0373930_0005799_499_1365 283
123 3300034957 Ga0373938_0003020 Ga0373938_0003020_1475_2326 283
124 3300035084 Ga0373928_0031699 Ga0373928_0031699_277_1128 283
125 3300035090 Ga0373949_0005787 Ga0373949_0005787_340_1191 283
126 3300035092 Ga0373952_0004789 Ga0373952_0004789_1493_2344 283
127 3300035092 Ga0373952_0014494 Ga0373952_0014494_337_1191 283
128 3300035092 Ga0373952_0031509 Ga0373952_0031509_272_1138 283
129 3300035115 Ga0373941_0007639 Ga0373941_0007639_601_1452 283
130 3300035118 Ga0373954_0133203 Ga0373954_0133203_98_949 283
131 3300035171 Ga0373946_0074127 Ga0373946_0074127_478_1344 283
132 3300035207 Ga0373942_0039300 Ga0373942_0039300_134_985 283
133 3300035242 Ga0373962_0002525 Ga0373962_0002525_1868_2719 283
134 3300035691 Ga0373931_0003778 Ga0373931_0003778_2219_3085 283
135 3300035691 Ga0373931_0024303 Ga0373931_0024303_1807_2658 283
136 3300035691 Ga0373931_0165701 Ga0373931_0165701_313_1179 283
137 3300037068 Ga0373925_0134357 Ga0373925_0134357_1069_1920 283
138 3300039437 Ga0436365_1063276 Ga0436365_1063276_751_1602 283
139 3300041408 Ga0439453_0002540 Ga0439453_0002540_878_1729 283
140 3300042008 Ga0439450_040575 Ga0439450_040575_38_889 283
141 3300042016 Ga0439463_019687 Ga0439463_019687_38_889 283
142 3300042461 Ga0439460_0034896 Ga0439460_0034896_44_895 283
143 3300046460 Ga0495638_0093024 Ga0495638_0093024_359_1210 283
144 3300046516 Ga0495628_0074254 Ga0495628_0074254_715_1581 283
145 3300046529 Ga0495652_0239581 Ga0495652_0239581_324_1190 283
146 3300046680 Ga0495646_0095916 Ga0495646_0095916_56_922 283
147 3300046684 Ga0495669_0009448 Ga0495669_0009448_1262_2113 283
148 3300047470 Ga0495681_0139167 Ga0495681_0139167_145_996 283
149 3300048903 Ga0496100_0096611 Ga0496100_0096611_495_1346 283
150 3300048904 Ga0496101_0025685 Ga0496101_0025685_2695_3561 283
151 3300048905 Ga0496102_0010790 Ga0496102_0010790_4474_5340 283
152 3300048905 Ga0496102_0152153 Ga0496102_0152153_494_1345 283
153 3300048906 Ga0496103_0016769 Ga0496103_0016769_77_943 283
154 3300048907 Ga0496104_0003340 Ga0496104_0003340_11322_12188 283
155 3300048907 Ga0496104_0082139 Ga0496104_0082139_1583_2434 283
156 3300048907 Ga0496104_0331835 Ga0496104_0331835_251_1102 283
157 3300048908 Ga0496105_0004588 Ga0496105_0004588_8473_9339 283
158 3300048909 Ga0496106_0039341 Ga0496106_0039341_752_1603 283
159 3300048910 Ga0496107_0004871 Ga0496107_0004871_5667_6533 283
160 3300048911 Ga0496108_0007809 Ga0496108_0007809_6195_7046 283
161 3300048911 Ga0496108_0028673 Ga0496108_0028673_2296_3162 283
162 3300048911 Ga0496108_0151059 Ga0496108_0151059_326_1192 283
163 3300048911 Ga0496108_0228304 Ga0496108_0228304_399_1250 283
164 3300048912 Ga0496109_0007061 Ga0496109_0007061_6501_7367 283
165 3300048912 Ga0496109_0020039 Ga0496109_0020039_4139_4990 283
166 3300048912 Ga0496109_0037747 Ga0496109_0037747_172_1023 283
167 3300048913 Ga0496110_0023803 Ga0496110_0023803_259_1110 283
168 3300048913 Ga0496110_0091910 Ga0496110_0091910_741_1592 283
169 3300048913 Ga0496110_0105732 Ga0496110_0105732_884_1750 283
170 3300048914 Ga0496111_0005954 Ga0496111_0005954_2722_3588 283
171 3300048914 Ga0496111_0168288 Ga0496111_0168288_688_1539 283
172 3300048915 Ga0496112_0133992 Ga0496112_0133992_845_1711 283
173 3300048915 Ga0496112_0176317 Ga0496112_0176317_91_957 283
174 3300048915 Ga0496112_0367973 Ga0496112_0367973_333_1184 283
175 3300048916 Ga0496113_0006670 Ga0496113_0006670_2579_3430 283
176 3300048916 Ga0496113_0060134 Ga0496113_0060134_1804_2670 283
177 3300048916 Ga0496113_0234602 Ga0496113_0234602_183_1049 283
178 3300048917 Ga0496114_0007484 Ga0496114_0007484_2654_3520 283
179 3300048918 Ga0496115_0003882 Ga0496115_0003882_2545_3411 283
180 3300049568 Ga0501031_0012832 Ga0501031_0012832_2564_3415 283
181 3300049570 Ga0501033_0019159 Ga0501033_0019159_3917_4768 283
182 3300049571 Ga0501034_0042869 Ga0501034_0042869_426_1277 283
183 3300049571 Ga0501034_0099042 Ga0501034_0099042_1002_1853 283
184 3300049572 Ga0501036_0019093 Ga0501036_0019093_2732_3583 283
185 3300049574 Ga0501038_0008825 Ga0501038_0008825_4518_5369 283
186 3300049574 Ga0501038_0151507 Ga0501038_0151507_719_1570 283
187 3300049575 Ga0501039_0010144 Ga0501039_0010144_2657_3508 283
188 3300049576 Ga0501040_0094811 Ga0501040_0094811_23_877 283
189 3300049578 Ga0501042_0066804 Ga0501042_0066804_780_1631 283
190 3300049580 Ga0501046_0061644 Ga0501046_0061644_60_911 283
191 3300049582 Ga0501048_0019705 Ga0501048_0019705_1599_2450 283
192 3300049583 Ga0501067_0020479 Ga0501067_0020479_1680_2531 283
193 3300049584 Ga0501068_0012758 Ga0501068_0012758_1313_2164 283
194 3300049585 Ga0501069_0002514 Ga0501069_0002514_2727_3578 283
195 3300049585 Ga0501069_0117473 Ga0501069_0117473_642_1493 283
196 3300049586 Ga0501070_0020970 Ga0501070_0020970_1544_2395 283
197 3300049587 Ga0501071_0018829 Ga0501071_0018829_1972_2823 283
198 3300049589 Ga0501073_0010312 Ga0501073_0010312_3932_4783 283
199 3300049590 Ga0501074_0007397 Ga0501074_0007397_407_1258 283
200 3300049593 Ga0501077_0010632 Ga0501077_0010632_2297_3148 283
201 3300049741 Ga0501079_0046847 Ga0501079_0046847_2028_2879 283
202 3300049742 Ga0501080_0030118 Ga0501080_0030118_3798_4649 283
203 3300049744 Ga0501083_0031289 Ga0501083_0031289_1731_2582 283
204 3300049822 Ga0501035_0413721 Ga0501035_0413721_163_1014 283
205 3300049823 Ga0501044_0000243 Ga0501044_0000243_3336_4187 283
206 3300049823 Ga0501044_0033688 Ga0501044_0033688_1599_2450 283
207 3300050489 nmdc:mga03683_16047_c1 nmdc:mga03683_16047_c1_1492_2343 283
208 3300050496 nmdc:mga07m45_190474_c1 nmdc:mga07m45_190474_c1_251_1132 283
209 3300050511 nmdc:mga08y16_107681_c1 nmdc:mga08y16_107681_c1_1109_1960 283
210 3300050515 nmdc:mga0a205_139884_c1 nmdc:mga0a205_139884_c1_590_1441 283
211 3300053077 Ga0495601_0013675 Ga0495601_0013675_1244_2110 283
212 3300053078 Ga0495612_0010707 Ga0495612_0010707_592_1458 283
213 3300053083 Ga0495655_0009033 Ga0495655_0009033_10_861 283
214 3300053084 Ga0495595_0082279 Ga0495595_0082279_43_909 283
215 3300053085 Ga0495619_0086273 Ga0495619_0086273_707_1573 283
216 3300053087 Ga0500643_005044 Ga0500643_005044_1941_2792 283
217 3300053088 Ga0500644_0000501 Ga0500644_0000501_9644_10495 283
218 3300053119 Ga0500595_000001 Ga0500595_000001_178420_179271 283
219 3300053120 Ga0500597_050641 Ga0500597_050641_209_1075 283
220 3300053153 Ga0500616_0073169 Ga0500616_0073169_501_1352 283
221 3300060353 Ga0501082_0085209 Ga0501082_0085209_503_1354 283
222 3300045976 Ga0466967_0026063 Ga0466967_0026063_2723_3604 284
223 3300031249 Ga0265339_10012548 Ga0265339_100125482 285
224 3300031712 Ga0265342_10013532 Ga0265342_100135325 285
225 3300005437 Ga0070710_10071345 Ga0070710_100713451 286
226 3300006175 Ga0070712_100004896 Ga0070712_1000048968 286
227 3300025898 Ga0207692_10056116 Ga0207692_100561162 286
228 3300025915 Ga0207693_10010674 Ga0207693_100106743 286
229 3300044693 Ga0466961_0056701 Ga0466961_0056701_1572_2447 291
230 3300005329 Ga0070683_100179942 Ga0070683_1001799422 292
231 3300005530 Ga0070679_100058074 Ga0070679_1000580747 292
232 3300005577 Ga0068857_100361934 Ga0068857_1003619342 292
233 3300009551 Ga0105238_10020403 Ga0105238_100204039 292
234 3300025944 Ga0207661_10075558 Ga0207661_100755583 292
235 3300025949 Ga0207667_10030658 Ga0207667_100306587 292
236 3300026142 Ga0207698_10129801 Ga0207698_101298012 292
237 3300048903 Ga0496100_0177586 Ga0496100_0177586_382_1260 292
238 3300001430 JGI24032J14994_101096 JGI24032J14994_1010961 293
239 3300001989 JGI24739J22299_10002121 JGI24739J22299_100021214 293
240 3300001990 JGI24737J22298_10052069 JGI24737J22298_100520691 293
241 3300002075 JGI24738J21930_10000603 JGI24738J21930_100006037 293
242 3300002077 JGI24744J21845_10021141 JGI24744J21845_100211411 293
243 3300002244 JGI24742J22300_10000182 JGI24742J22300_100001823 293
244 3300003215 JGI25153J46596_10001830 JGI25153J46596_100018305 293
245 3300003659 JGI25404J52841_10001497 JGI25404J52841_100014972 293
246 3300005290 Ga0065712_10073712 Ga0065712_100737122 293
247 3300005293 Ga0065715_10033142 Ga0065715_100331422 293
248 3300005293 Ga0065715_10038806 Ga0065715_100388062 293
249 3300005293 Ga0065715_10105333 Ga0065715_101053333 293
250 3300005327 Ga0070658_10008341 Ga0070658_1000834110 293
251 3300005328 Ga0070676_10051418 Ga0070676_100514183 293
252 3300005328 Ga0070676_10131434 Ga0070676_101314341 293
253 3300005329 Ga0070683_100112237 Ga0070683_1001122372 293
254 3300005330 Ga0070690_100061022 Ga0070690_1000610222 293
255 3300005330 Ga0070690_100065647 Ga0070690_1000656471 293
256 3300005330 Ga0070690_100070519 Ga0070690_1000705192 293
257 3300005330 Ga0070690_100078035 Ga0070690_1000780352 293
258 3300005331 Ga0070670_100003446 Ga0070670_1000034462 293
259 3300005331 Ga0070670_100253137 Ga0070670_1002531372 293
260 3300005333 Ga0070677_10000850 Ga0070677_100008502 293
261 3300005333 Ga0070677_10005124 Ga0070677_100051243 293
262 3300005334 Ga0068869_100068955 Ga0068869_1000689554 293
263 3300005335 Ga0070666_10035891 Ga0070666_100358912 293
264 3300005336 Ga0070680_100002046 Ga0070680_1000020468 293
265 3300005336 Ga0070680_100029747 Ga0070680_1000297473 293
266 3300005336 Ga0070680_100148328 Ga0070680_1001483283 293
267 3300005337 Ga0070682_100051160 Ga0070682_1000511602 293
268 3300005337 Ga0070682_100097231 Ga0070682_1000972312 293
269 3300005338 Ga0068868_100007860 Ga0068868_1000078609 293
270 3300005338 Ga0068868_100068138 Ga0068868_1000681382 293
271 3300005339 Ga0070660_100014760 Ga0070660_1000147607 293
272 3300005339 Ga0070660_100057652 Ga0070660_1000576523 293
273 3300005339 Ga0070660_100067823 Ga0070660_1000678232 293
274 3300005340 Ga0070689_100032584 Ga0070689_1000325844 293
275 3300005341 Ga0070691_10015311 Ga0070691_100153113 293
276 3300005341 Ga0070691_10079341 Ga0070691_100793412 293
277 3300005341 Ga0070691_10087488 Ga0070691_100874881 293
278 3300005343 Ga0070687_100074678 Ga0070687_1000746782 293
279 3300005344 Ga0070661_100034503 Ga0070661_1000345034 293
280 3300005345 Ga0070692_10014667 Ga0070692_100146673 293
281 3300005353 Ga0070669_100134924 Ga0070669_1001349242 293
282 3300005354 Ga0070675_100031240 Ga0070675_1000312402 293
283 3300005355 Ga0070671_100031396 Ga0070671_1000313964 293
284 3300005355 Ga0070671_100048924 Ga0070671_1000489244 293
285 3300005355 Ga0070671_100088793 Ga0070671_1000887933 293
286 3300005356 Ga0070674_100004085 Ga0070674_1000040856 293
287 3300005356 Ga0070674_100044083 Ga0070674_1000440833 293
288 3300005356 Ga0070674_100468251 Ga0070674_1004682511 293
289 3300005364 Ga0070673_100024056 Ga0070673_1000240565 293
290 3300005365 Ga0070688_100217271 Ga0070688_1002172711 293
291 3300005367 Ga0070667_100179532 Ga0070667_1001795322 293
292 3300005367 Ga0070667_100245963 Ga0070667_1002459632 293
293 3300005406 Ga0070703_10000581 Ga0070703_100005812 293
294 3300005406 Ga0070703_10056791 Ga0070703_100567912 293
295 3300005434 Ga0070709_10047996 Ga0070709_100479963 293
296 3300005437 Ga0070710_10042196 Ga0070710_100421962 293
297 3300005438 Ga0070701_10004158 Ga0070701_100041585 293
298 3300005438 Ga0070701_10016834 Ga0070701_100168343 293
299 3300005439 Ga0070711_100040118 Ga0070711_1000401184 293
300 3300005439 Ga0070711_100110934 Ga0070711_1001109342 293
301 3300005440 Ga0070705_100000029 Ga0070705_10000002939 293
302 3300005440 Ga0070705_100046450 Ga0070705_1000464504 293
303 3300005441 Ga0070700_100006751 Ga0070700_1000067514 293
304 3300005441 Ga0070700_100035933 Ga0070700_1000359334 293
305 3300005444 Ga0070694_100001913 Ga0070694_10000191310 293
306 3300005445 Ga0070708_100019278 Ga0070708_1000192782 293
307 3300005455 Ga0070663_100017829 Ga0070663_1000178295 293
308 3300005455 Ga0070663_100021364 Ga0070663_1000213642 293
309 3300005455 Ga0070663_100401338 Ga0070663_1004013382 293
310 3300005455 Ga0070663_100438002 Ga0070663_1004380022 293
311 3300005456 Ga0070678_100015278 Ga0070678_1000152783 293
312 3300005456 Ga0070678_100034483 Ga0070678_1000344832 293
313 3300005456 Ga0070678_100122904 Ga0070678_1001229042 293
314 3300005458 Ga0070681_10006973 Ga0070681_1000697310 293
315 3300005458 Ga0070681_10019175 Ga0070681_100191754 293
316 3300005458 Ga0070681_10021379 Ga0070681_100213795 293
317 3300005458 Ga0070681_10037074 Ga0070681_100370745 293
318 3300005459 Ga0068867_100032997 Ga0068867_1000329975 293
319 3300005459 Ga0068867_100036282 Ga0068867_1000362824 293
320 3300005466 Ga0070685_10013164 Ga0070685_100131643 293
321 3300005466 Ga0070685_10020314 Ga0070685_100203144 293
322 3300005518 Ga0070699_100002214 Ga0070699_1000022148 293
323 3300005518 Ga0070699_100249741 Ga0070699_1002497412 293
324 3300005530 Ga0070679_100045743 Ga0070679_1000457435 293
325 3300005530 Ga0070679_100090727 Ga0070679_1000907272 293
326 3300005530 Ga0070679_100098937 Ga0070679_1000989373 293
327 3300005530 Ga0070679_100195835 Ga0070679_1001958352 293
328 3300005535 Ga0070684_100021722 Ga0070684_1000217225 293
329 3300005536 Ga0070697_100004654 Ga0070697_1000046545 293
330 3300005536 Ga0070697_100297716 Ga0070697_1002977162 293
331 3300005539 Ga0068853_100001878 Ga0068853_10000187810 293
332 3300005543 Ga0070672_100171918 Ga0070672_1001719182 293
333 3300005544 Ga0070686_100017153 Ga0070686_1000171533 293
334 3300005544 Ga0070686_100168685 Ga0070686_1001686852 293
335 3300005545 Ga0070695_100000160 Ga0070695_10000016024 293
336 3300005547 Ga0070693_100032047 Ga0070693_1000320474 293
337 3300005547 Ga0070693_100060169 Ga0070693_1000601693 293
338 3300005549 Ga0070704_100016986 Ga0070704_1000169862 293
339 3300005549 Ga0070704_100289452 Ga0070704_1002894522 293
340 3300005563 Ga0068855_100111876 Ga0068855_1001118763 293
341 3300005563 Ga0068855_100395816 Ga0068855_1003958162 293
342 3300005564 Ga0070664_100025168 Ga0070664_1000251684 293
343 3300005564 Ga0070664_100033488 Ga0070664_1000334882 293
344 3300005577 Ga0068857_100003866 Ga0068857_10000386614 293
345 3300005577 Ga0068857_100057660 Ga0068857_1000576603 293
346 3300005578 Ga0068854_100008558 Ga0068854_1000085582 293
347 3300005578 Ga0068854_100202033 Ga0068854_1002020333 293
348 3300005614 Ga0068856_100061788 Ga0068856_1000617882 293
349 3300005614 Ga0068856_100086050 Ga0068856_1000860504 293
350 3300005615 Ga0070702_100037215 Ga0070702_1000372154 293
351 3300005617 Ga0068859_100003957 Ga0068859_1000039573 293
352 3300005617 Ga0068859_100078377 Ga0068859_1000783774 293
353 3300005617 Ga0068859_100301684 Ga0068859_1003016842 293
354 3300005618 Ga0068864_100003430 Ga0068864_10000343015 293
355 3300005618 Ga0068864_100057124 Ga0068864_1000571242 293
356 3300005718 Ga0068866_10011424 Ga0068866_100114244 293
357 3300005718 Ga0068866_10206396 Ga0068866_102063961 293
358 3300005719 Ga0068861_100061076 Ga0068861_1000610762 293
359 3300005719 Ga0068861_100280561 Ga0068861_1002805612 293
360 3300005841 Ga0068863_100003702 Ga0068863_10000370213 293
361 3300005842 Ga0068858_100010330 Ga0068858_10001033010 293
362 3300005842 Ga0068858_100237366 Ga0068858_1002373662 293
363 3300005843 Ga0068860_100004938 Ga0068860_1000049388 293
364 3300005843 Ga0068860_100076084 Ga0068860_1000760843 293
365 3300005843 Ga0068860_100136419 Ga0068860_1001364192 293
366 3300005843 Ga0068860_100464997 Ga0068860_1004649972 293
367 3300005844 Ga0068862_100000814 Ga0068862_10000081414 293
368 3300005844 Ga0068862_100087829 Ga0068862_1000878292 293
369 3300005844 Ga0068862_100320396 Ga0068862_1003203962 293
370 3300005981 Ga0081538_10019318 Ga0081538_100193184 293
371 3300005981 Ga0081538_10046977 Ga0081538_100469773 293
372 3300005983 Ga0081540_1000869 Ga0081540_10008693 293
373 3300006028 Ga0070717_10070194 Ga0070717_100701943 293
374 3300006038 Ga0075365_10018339 Ga0075365_100183392 293
375 3300006038 Ga0075365_10131953 Ga0075365_101319532 293
376 3300006042 Ga0075368_10028739 Ga0075368_100287393 293
377 3300006051 Ga0075364_10009379 Ga0075364_100093795 293
378 3300006051 Ga0075364_10173526 Ga0075364_101735262 293
379 3300006175 Ga0070712_100070696 Ga0070712_1000706962 293
380 3300006177 Ga0075362_10025889 Ga0075362_100258894 293
381 3300006177 Ga0075362_10056957 Ga0075362_100569572 293
382 3300006178 Ga0075367_10001375 Ga0075367_100013755 293
383 3300006186 Ga0075369_10013818 Ga0075369_100138185 293
384 3300006195 Ga0075366_10027627 Ga0075366_100276273 293
385 3300006195 Ga0075366_10030441 Ga0075366_100304412 293
386 3300006195 Ga0075366_10110707 Ga0075366_101107071 293
387 3300006237 Ga0097621_100004664 Ga0097621_1000046644 293
388 3300006353 Ga0075370_10246697 Ga0075370_102466971 293
389 3300006358 Ga0068871_100001982 Ga0068871_10000198214 293
390 3300006846 Ga0075430_100124411 Ga0075430_1001244113 293
391 3300006847 Ga0075431_100064079 Ga0075431_1000640795 293
392 3300006847 Ga0075431_100326322 Ga0075431_1003263222 293
393 3300006847 Ga0075431_100459746 Ga0075431_1004597461 293
394 3300006852 Ga0075433_10069775 Ga0075433_100697753 293
395 3300006871 Ga0075434_100074529 Ga0075434_1000745293 293
396 3300006871 Ga0075434_100160183 Ga0075434_1001601833 293
397 3300006880 Ga0075429_100258159 Ga0075429_1002581592 293
398 3300006880 Ga0075429_100303409 Ga0075429_1003034092 293
399 3300006881 Ga0068865_100014555 Ga0068865_1000145555 293
400 3300006881 Ga0068865_100176589 Ga0068865_1001765892 293
401 3300006881 Ga0068865_100176733 Ga0068865_1001767332 293
402 3300006881 Ga0068865_100298447 Ga0068865_1002984472 293
403 3300006931 Ga0097620_100003957 Ga0097620_1000039573 293
404 3300006931 Ga0097620_100078378 Ga0097620_1000783784 293
405 3300006931 Ga0097620_100301689 Ga0097620_1003016892 293
406 3300007076 Ga0075435_100411321 Ga0075435_1004113212 293
407 3300009036 Ga0105244_10046414 Ga0105244_100464143 293
408 3300009094 Ga0111539_10046029 Ga0111539_100460292 293
409 3300009098 Ga0105245_10021701 Ga0105245_100217012 293
410 3300009098 Ga0105245_10105815 Ga0105245_101058153 293
411 3300009147 Ga0114129_10008798 Ga0114129_100087989 293
412 3300009147 Ga0114129_10173116 Ga0114129_101731164 293
413 3300009148 Ga0105243_10481139 Ga0105243_104811392 293
414 3300009174 Ga0105241_10075162 Ga0105241_100751623 293
415 3300009176 Ga0105242_10036922 Ga0105242_100369223 293
416 3300009177 Ga0105248_10018134 Ga0105248_100181344 293
417 3300009177 Ga0105248_10077990 Ga0105248_100779902 293
418 3300009551 Ga0105238_10042427 Ga0105238_100424275 293
419 3300009551 Ga0105238_10309892 Ga0105238_103098922 293
420 3300009553 Ga0105249_10000961 Ga0105249_1000096116 293
421 3300010375 Ga0105239_10027540 Ga0105239_100275402 293
422 3300010375 Ga0105239_10578783 Ga0105239_105787832 293
423 3300013104 Ga0157370_10302121 Ga0157370_103021212 293
424 3300013105 Ga0157369_10202355 Ga0157369_102023552 293
425 3300013105 Ga0157369_10765283 Ga0157369_107652831 293
426 3300013297 Ga0157378_10070619 Ga0157378_100706192 293
427 3300013297 Ga0157378_10613459 Ga0157378_106134592 293
428 3300013306 Ga0163162_10140638 Ga0163162_101406382 293
429 3300013306 Ga0163162_10235538 Ga0163162_102355382 293
430 3300013307 Ga0157372_10185734 Ga0157372_101857342 293
431 3300013307 Ga0157372_10215503 Ga0157372_102155032 293
432 3300014325 Ga0163163_10755232 Ga0163163_107552321 293
433 3300014326 Ga0157380_10397726 Ga0157380_103977262 293
434 3300014968 Ga0157379_10095739 Ga0157379_100957392 293
435 3300014968 Ga0157379_10537301 Ga0157379_105373011 293
436 3300014969 Ga0157376_10159259 Ga0157376_101592592 293
437 3300017792 Ga0163161_10000941 Ga0163161_1000094112 293
438 3300017792 Ga0163161_10216051 Ga0163161_102160512 293
439 3300020081 Ga0206354_10355791 Ga0206354_103557913 293
440 3300021384 Ga0213876_10006322 Ga0213876_100063222 293
441 3300025315 Ga0207697_10002352 Ga0207697_1000235210 293
442 3300025885 Ga0207653_10000445 Ga0207653_1000044514 293
443 3300025885 Ga0207653_10006154 Ga0207653_100061544 293
444 3300025893 Ga0207682_10000293 Ga0207682_1000029318 293
445 3300025893 Ga0207682_10000391 Ga0207682_1000039120 293
446 3300025893 Ga0207682_10032321 Ga0207682_100323213 293
447 3300025898 Ga0207692_10094419 Ga0207692_100944192 293
448 3300025899 Ga0207642_10154074 Ga0207642_101540742 293
449 3300025900 Ga0207710_10006497 Ga0207710_100064972 293
450 3300025900 Ga0207710_10018896 Ga0207710_100188963 293
451 3300025900 Ga0207710_10170202 Ga0207710_101702022 293
452 3300025901 Ga0207688_10000070 Ga0207688_1000007033 293
453 3300025903 Ga0207680_10101877 Ga0207680_101018773 293
454 3300025904 Ga0207647_10048930 Ga0207647_100489304 293
455 3300025906 Ga0207699_10071795 Ga0207699_100717952 293
456 3300025907 Ga0207645_10041285 Ga0207645_100412853 293
457 3300025908 Ga0207643_10000123 Ga0207643_1000012340 293
458 3300025908 Ga0207643_10114919 Ga0207643_101149191 293
459 3300025909 Ga0207705_10124153 Ga0207705_101241532 293
460 3300025912 Ga0207707_10011032 Ga0207707_100110328 293
461 3300025912 Ga0207707_10012557 Ga0207707_100125573 293
462 3300025912 Ga0207707_10060483 Ga0207707_100604832 293
463 3300025912 Ga0207707_10346084 Ga0207707_103460842 293
464 3300025913 Ga0207695_10134638 Ga0207695_101346383 293
465 3300025915 Ga0207693_10004569 Ga0207693_100045697 293
466 3300025915 Ga0207693_10045608 Ga0207693_100456082 293
467 3300025916 Ga0207663_10030224 Ga0207663_100302242 293
468 3300025916 Ga0207663_10070522 Ga0207663_100705222 293
469 3300025916 Ga0207663_10089629 Ga0207663_100896292 293
470 3300025917 Ga0207660_10002992 Ga0207660_1000299212 293
471 3300025917 Ga0207660_10004649 Ga0207660_100046493 293
472 3300025917 Ga0207660_10029631 Ga0207660_100296315 293
473 3300025917 Ga0207660_10093782 Ga0207660_100937822 293
474 3300025917 Ga0207660_10227006 Ga0207660_102270062 293
475 3300025918 Ga0207662_10015158 Ga0207662_100151584 293
476 3300025919 Ga0207657_10008644 Ga0207657_1000864410 293
477 3300025919 Ga0207657_10009786 Ga0207657_100097864 293
478 3300025919 Ga0207657_10048246 Ga0207657_100482464 293
479 3300025919 Ga0207657_10240437 Ga0207657_102404372 293
480 3300025920 Ga0207649_10029754 Ga0207649_100297541 293
481 3300025920 Ga0207649_10167301 Ga0207649_101673011 293
482 3300025921 Ga0207652_10016117 Ga0207652_100161175 293
483 3300025921 Ga0207652_10033952 Ga0207652_100339522 293
484 3300025921 Ga0207652_10066903 Ga0207652_100669032 293
485 3300025921 Ga0207652_10234136 Ga0207652_102341362 293
486 3300025921 Ga0207652_10364349 Ga0207652_103643492 293
487 3300025923 Ga0207681_10011037 Ga0207681_100110376 293
488 3300025924 Ga0207694_10062629 Ga0207694_100626292 293
489 3300025924 Ga0207694_10099955 Ga0207694_100999551 293
490 3300025925 Ga0207650_10002345 Ga0207650_100023452 293
491 3300025926 Ga0207659_10011847 Ga0207659_100118476 293
492 3300025927 Ga0207687_10086721 Ga0207687_100867212 293
493 3300025928 Ga0207700_10011773 Ga0207700_100117736 293
494 3300025929 Ga0207664_10016757 Ga0207664_100167574 293
495 3300025931 Ga0207644_10015103 Ga0207644_100151033 293
496 3300025931 Ga0207644_10016369 Ga0207644_100163694 293
497 3300025932 Ga0207690_10113766 Ga0207690_101137663 293
498 3300025933 Ga0207706_10002469 Ga0207706_1000246916 293
499 3300025934 Ga0207686_10002206 Ga0207686_1000220612 293
500 3300025934 Ga0207686_10042645 Ga0207686_100426452 293
501 3300025935 Ga0207709_10008232 Ga0207709_100082326 293
502 3300025935 Ga0207709_10037345 Ga0207709_100373453 293
503 3300025935 Ga0207709_10120711 Ga0207709_101207112 293
504 3300025936 Ga0207670_10012750 Ga0207670_100127505 293
505 3300025936 Ga0207670_10332602 Ga0207670_103326022 293
506 3300025937 Ga0207669_10007077 Ga0207669_100070774 293
507 3300025937 Ga0207669_10194838 Ga0207669_101948383 293
508 3300025938 Ga0207704_10138250 Ga0207704_101382503 293
509 3300025938 Ga0207704_10141154 Ga0207704_101411542 293
510 3300025938 Ga0207704_10258892 Ga0207704_102588922 293
511 3300025939 Ga0207665_10066777 Ga0207665_100667772 293
512 3300025940 Ga0207691_10001015 Ga0207691_100010155 293
513 3300025940 Ga0207691_10004072 Ga0207691_1000407212 293
514 3300025940 Ga0207691_10141859 Ga0207691_101418591 293
515 3300025941 Ga0207711_10015167 Ga0207711_100151674 293
516 3300025941 Ga0207711_10039695 Ga0207711_100396952 293
517 3300025941 Ga0207711_10045937 Ga0207711_100459372 293
518 3300025941 Ga0207711_10436593 Ga0207711_104365932 293
519 3300025942 Ga0207689_10007859 Ga0207689_100078592 293
520 3300025942 Ga0207689_10090789 Ga0207689_100907892 293
521 3300025944 Ga0207661_10022343 Ga0207661_100223435 293
522 3300025949 Ga0207667_10195824 Ga0207667_101958242 293
523 3300025960 Ga0207651_10123352 Ga0207651_101233522 293
524 3300025960 Ga0207651_10133205 Ga0207651_101332053 293
525 3300025961 Ga0207712_10001153 Ga0207712_100011533 293
526 3300025961 Ga0207712_10213862 Ga0207712_102138622 293
527 3300025986 Ga0207658_10023467 Ga0207658_100234672 293
528 3300025986 Ga0207658_10199650 Ga0207658_101996502 293
529 3300025986 Ga0207658_10432633 Ga0207658_104326332 293
530 3300026023 Ga0207677_10019295 Ga0207677_100192952 293
531 3300026023 Ga0207677_10119426 Ga0207677_101194262 293
532 3300026035 Ga0207703_10076901 Ga0207703_100769012 293
533 3300026035 Ga0207703_10091104 Ga0207703_100911042 293
534 3300026041 Ga0207639_10057698 Ga0207639_100576982 293
535 3300026041 Ga0207639_10102153 Ga0207639_101021532 293
536 3300026067 Ga0207678_10000688 Ga0207678_1000068834 293
537 3300026067 Ga0207678_10031385 Ga0207678_100313854 293
538 3300026067 Ga0207678_10296910 Ga0207678_102969102 293
539 3300026075 Ga0207708_10007349 Ga0207708_100073494 293
540 3300026078 Ga0207702_10274011 Ga0207702_102740112 293
541 3300026089 Ga0207648_10002850 Ga0207648_1000285011 293
542 3300026089 Ga0207648_10062381 Ga0207648_100623812 293
543 3300026095 Ga0207676_10001647 Ga0207676_100016473 293
544 3300026095 Ga0207676_10045488 Ga0207676_100454882 293
545 3300026095 Ga0207676_10102860 Ga0207676_101028603 293
546 3300026116 Ga0207674_10010786 Ga0207674_100107862 293
547 3300026116 Ga0207674_10015583 Ga0207674_100155837 293
548 3300026116 Ga0207674_10034544 Ga0207674_100345446 293
549 3300026118 Ga0207675_100174468 Ga0207675_1001744683 293
550 3300026118 Ga0207675_100314555 Ga0207675_1003145552 293
551 3300026121 Ga0207683_10032865 Ga0207683_100328653 293
552 3300026121 Ga0207683_10071264 Ga0207683_100712642 293
553 3300026142 Ga0207698_10098028 Ga0207698_100980283 293
554 3300027617 Ga0210002_1000422 Ga0210002_10004222 293
555 3300027665 Ga0209983_1001018 Ga0209983_10010184 293
556 3300027682 Ga0209971_1001863 Ga0209971_10018634 293
557 3300027695 Ga0209966_1001831 Ga0209966_10018314 293
558 3300027717 Ga0209998_10002702 Ga0209998_100027024 293
559 3300027876 Ga0209974_10018690 Ga0209974_100186902 293
560 3300027907 Ga0207428_10034736 Ga0207428_100347364 293
561 3300028379 Ga0268266_10118273 Ga0268266_101182733 293
562 3300028380 Ga0268265_10001430 Ga0268265_1000143014 293
563 3300028381 Ga0268264_10085414 Ga0268264_100854143 293
564 3300028381 Ga0268264_10117817 Ga0268264_101178172 293
565 3300028381 Ga0268264_10254174 Ga0268264_102541742 293
566 3300028577 Ga0265318_10007557 Ga0265318_100075574 293
567 3300028800 Ga0265338_10133447 Ga0265338_101334471 293
568 3300031238 Ga0265332_10033062 Ga0265332_100330622 293
569 3300031240 Ga0265320_10030967 Ga0265320_100309674 293
570 3300031241 Ga0265325_10000004 Ga0265325_1000000469 293
571 3300031241 Ga0265325_10000637 Ga0265325_100006379 293
572 3300031241 Ga0265325_10000671 Ga0265325_100006712 293
573 3300031241 Ga0265325_10006661 Ga0265325_100066614 293
574 3300031241 Ga0265325_10015673 Ga0265325_100156733 293
575 3300031247 Ga0265340_10038400 Ga0265340_100384003 293
576 3300031247 Ga0265340_10043763 Ga0265340_100437631 293
577 3300031249 Ga0265339_10009785 Ga0265339_100097857 293
578 3300031344 Ga0265316_10127728 Ga0265316_101277282 293
579 3300031595 Ga0265313_10000118 Ga0265313_1000011860 293
580 3300031595 Ga0265313_10005881 Ga0265313_100058813 293
581 3300031595 Ga0265313_10010184 Ga0265313_100101842 293
582 3300031595 Ga0265313_10010448 Ga0265313_100104484 293
583 3300031711 Ga0265314_10012846 Ga0265314_100128462 293
584 3300031711 Ga0265314_10085898 Ga0265314_100858982 293
585 3300031712 Ga0265342_10000674 Ga0265342_1000067423 293
586 3300031712 Ga0265342_10019918 Ga0265342_100199182 293
587 3300031727 Ga0316576_10005448 Ga0316576_100054489 293
588 3300031728 Ga0316578_10000852 Ga0316578_1000085211 293
589 3300032002 Ga0307416_100439397 Ga0307416_1004393971 293
590 3300032126 Ga0307415_100347008 Ga0307415_1003470082 293
591 3300032133 Ga0316583_10016641 Ga0316583_100166412 293
592 3300034819 Ga0373958_0017723 Ga0373958_0017723_33_914 293
593 3300035086 Ga0373934_0019984 Ga0373934_0019984_1542_2423 293
594 3300035113 Ga0373936_0012370 Ga0373936_0012370_844_1725 293
595 3300035114 Ga0373939_0022407 Ga0373939_0022407_221_1102 293
596 3300035116 Ga0373945_0013554 Ga0373945_0013554_1137_2018 293
597 3300035117 Ga0373953_0008276 Ga0373953_0008276_1479_2360 293
598 3300035117 Ga0373953_0055621 Ga0373953_0055621_277_1200 293
599 3300035118 Ga0373954_0009161 Ga0373954_0009161_1229_2110 293
600 3300035119 Ga0373956_0007281 Ga0373956_0007281_2983_3864 293
601 3300035120 Ga0373957_0030808 Ga0373957_0030808_509_1390 293
602 3300035170 Ga0373943_0012011 Ga0373943_0012011_1435_2316 293
603 3300035170 Ga0373943_0014642 Ga0373943_0014642_838_1740 293
604 3300035172 Ga0373955_0006492 Ga0373955_0006492_2162_3043 293
605 3300035172 Ga0373955_0032412 Ga0373955_0032412_626_1549 293
606 3300035241 Ga0373961_0009231 Ga0373961_0009231_1319_2215 293
607 3300035241 Ga0373961_0063400 Ga0373961_0063400_194_1075 293
608 3300035398 Ga0316574_0003805 Ga0316574_0003805_4413_5300 293
609 3300035410 Ga0373924_0164112 Ga0373924_0164112_29_910 293
610 3300035692 Ga0373935_0017861 Ga0373935_0017861_2036_2917 293
611 3300035695 Ga0373927_0031014 Ga0373927_0031014_34_936 293
612 3300035695 Ga0373927_0299325 Ga0373927_0299325_29_910 293
613 3300035724 Ga0373933_0003561 Ga0373933_0003561_1568_2449 293
614 3300035725 Ga0373947_0030379 Ga0373947_0030379_849_1730 293
615 3300036401 Ga0373937_0002015 Ga0373937_0002015_9249_10172 293
616 3300036401 Ga0373937_0025551 Ga0373937_0025551_1352_2233 293
617 3300037068 Ga0373925_0030165 Ga0373925_0030165_339_1262 293
618 3300037068 Ga0373925_0137764 Ga0373925_0137764_77_958 293
619 3300039437 Ga0436365_0368495 Ga0436365_0368495_1052_1936 293
620 3300039437 Ga0436365_1065374 Ga0436365_1065374_550_1431 293
621 3300039438 Ga0436360_0713145 Ga0436360_0713145_58_942 293
622 3300042012 Ga0439455_0006154 Ga0439455_0006154_1496_2398 293
623 3300042185 Ga0450909_016028 Ga0450909_016028_47_943 293
624 3300042436 Ga0439435_0059131 Ga0439435_0059131_62_943 293
625 3300045976 Ga0466967_0327322 Ga0466967_0327322_516_1397 293
626 3300046454 Ga0495592_0037989 Ga0495592_0037989_2050_2931 293
627 3300046455 Ga0495603_0014815 Ga0495603_0014815_1893_2774 293
628 3300046455 Ga0495603_0047868 Ga0495603_0047868_715_1626 293
629 3300046459 Ga0495629_0166533 Ga0495629_0166533_203_1084 293
630 3300046461 Ga0495641_0023441 Ga0495641_0023441_2146_3027 293
631 3300046462 Ga0495651_0020442 Ga0495651_0020442_968_1891 293
632 3300046463 Ga0495653_0000751 Ga0495653_0000751_19649_20530 293
633 3300046472 Ga0495580_0312123 Ga0495580_0312123_75_956 293
634 3300046473 Ga0495582_0011728 Ga0495582_0011728_1205_2086 293
635 3300046474 Ga0495605_0033157 Ga0495605_0033157_593_1474 293
636 3300046475 Ga0495639_0041542 Ga0495639_0041542_943_1824 293
637 3300046476 Ga0495662_0008327 Ga0495662_0008327_1301_2182 293
638 3300046477 Ga0495664_0014023 Ga0495664_0014023_1981_2862 293
639 3300046477 Ga0495664_0032905 Ga0495664_0032905_2132_3013 293
640 3300046499 Ga0495594_0080736 Ga0495594_0080736_918_1799 293
641 3300046511 Ga0495608_0008056 Ga0495608_0008056_1352_2233 293
642 3300046514 Ga0495618_0007287 Ga0495618_0007287_251_1132 293
643 3300046514 Ga0495618_0038175 Ga0495618_0038175_1657_2538 293
644 3300046516 Ga0495628_0004433 Ga0495628_0004433_2456_3379 293
645 3300046517 Ga0495630_0032173 Ga0495630_0032173_2527_3408 293
646 3300046529 Ga0495652_0003050 Ga0495652_0003050_2534_3457 293
647 3300046529 Ga0495652_0013600 Ga0495652_0013600_5118_5999 293
648 3300046529 Ga0495652_0042670 Ga0495652_0042670_2577_3458 293
649 3300046533 Ga0495640_0024383 Ga0495640_0024383_162_1043 293
650 3300046533 Ga0495640_0072843 Ga0495640_0072843_1249_2130 293
651 3300046536 Ga0495587_0004793 Ga0495587_0004793_5952_6833 293
652 3300046536 Ga0495587_0027469 Ga0495587_0027469_2391_3314 293
653 3300046537 Ga0495598_0001166 Ga0495598_0001166_3002_3883 293
654 3300046543 Ga0495645_0000362 Ga0495645_0000362_7566_8489 293
655 3300046559 Ga0495667_0008809 Ga0495667_0008809_2305_3228 293
656 3300046559 Ga0495667_0043814 Ga0495667_0043814_693_1574 293
657 3300046615 Ga0495656_0128624 Ga0495656_0128624_70_951 293
658 3300046642 Ga0495634_0043895 Ga0495634_0043895_1564_2445 293
659 3300046663 Ga0495635_0018844 Ga0495635_0018844_1885_2808 293
660 3300046663 Ga0495635_0023357 Ga0495635_0023357_1542_2423 293
661 3300046663 Ga0495635_0079835 Ga0495635_0079835_40_921 293
662 3300046674 Ga0495588_0027130 Ga0495588_0027130_931_1812 293
663 3300046675 Ga0495657_0005082 Ga0495657_0005082_5410_6291 293
664 3300046675 Ga0495657_0026388 Ga0495657_0026388_1071_1994 293
665 3300046678 Ga0495599_0055185 Ga0495599_0055185_1480_2361 293
666 3300046678 Ga0495599_0061128 Ga0495599_0061128_214_1137 293
667 3300046678 Ga0495599_0103831 Ga0495599_0103831_103_1041 293
668 3300046679 Ga0495623_0042547 Ga0495623_0042547_242_1123 293
669 3300046680 Ga0495646_0115692 Ga0495646_0115692_517_1398 293
670 3300046681 Ga0495647_0057327 Ga0495647_0057327_633_1514 293
671 3300046681 Ga0495647_0098963 Ga0495647_0098963_259_1140 293
672 3300046683 Ga0495658_0056265 Ga0495658_0056265_1061_1942 293
673 3300046690 Ga0495624_0035632 Ga0495624_0035632_179_1060 293
674 3300046809 Ga0495600_0002228 Ga0495600_0002228_5133_6014 293
675 3300047317 Ga0495604_0002960 Ga0495604_0002960_6958_7839 293
676 3300047317 Ga0495604_0094303 Ga0495604_0094303_495_1418 293
677 3300047319 Ga0495674_0020696 Ga0495674_0020696_4629_5510 293
678 3300047319 Ga0495674_0053171 Ga0495674_0053171_2194_3075 293
679 3300047321 Ga0495676_0058839 Ga0495676_0058839_143_1024 293
680 3300047322 Ga0495680_0008230 Ga0495680_0008230_3482_4363 293
681 3300047322 Ga0495680_0033364 Ga0495680_0033364_2200_3123 293
682 3300047444 Ga0495675_0012940 Ga0495675_0012940_2854_3735 293
683 3300047444 Ga0495675_0117824 Ga0495675_0117824_30_914 293
684 3300047447 Ga0495685_026971 Ga0495685_026971_663_1544 293
685 3300047471 Ga0495684_0154548 Ga0495684_0154548_123_1007 293
686 3300047673 Ga0495593_0149527 Ga0495593_0149527_14_895 293
687 3300047673 Ga0495593_0162320 Ga0495593_0162320_202_1083 293
688 3300048088 Ga0495602_0003618 Ga0495602_0003618_14343_15224 293
689 3300048088 Ga0495602_0012504 Ga0495602_0012504_7465_8388 293
690 3300048088 Ga0495602_0094183 Ga0495602_0094183_1009_1893 293
691 3300048090 Ga0495615_0019781 Ga0495615_0019781_215_1096 293
692 3300048903 Ga0496100_0299312 Ga0496100_0299312_281_1165 293
693 3300048904 Ga0496101_0018116 Ga0496101_0018116_2628_3509 293
694 3300048905 Ga0496102_0008005 Ga0496102_0008005_394_1278 293
695 3300048905 Ga0496102_0058812 Ga0496102_0058812_1241_2122 293
696 3300048905 Ga0496102_0116302 Ga0496102_0116302_269_1150 293
697 3300048905 Ga0496102_0329100 Ga0496102_0329100_82_966 293
698 3300048906 Ga0496103_0016949 Ga0496103_0016949_2400_3281 293
699 3300048906 Ga0496103_0058138 Ga0496103_0058138_398_1282 293
700 3300048907 Ga0496104_0000827 Ga0496104_0000827_14448_15371 293
701 3300048907 Ga0496104_0008871 Ga0496104_0008871_2618_3499 293
702 3300048908 Ga0496105_0002816 Ga0496105_0002816_2971_3894 293
703 3300048909 Ga0496106_0000691 Ga0496106_0000691_2478_3362 293
704 3300048909 Ga0496106_0047139 Ga0496106_0047139_519_1415 293
705 3300048909 Ga0496106_0084989 Ga0496106_0084989_684_1565 293
706 3300048910 Ga0496107_0051145 Ga0496107_0051145_505_1389 293
707 3300048910 Ga0496107_0061808 Ga0496107_0061808_1575_2456 293
708 3300048911 Ga0496108_0087996 Ga0496108_0087996_1628_2509 293
709 3300048911 Ga0496108_0334005 Ga0496108_0334005_109_1005 293
710 3300048912 Ga0496109_0322353 Ga0496109_0322353_528_1412 293
711 3300048913 Ga0496110_0061326 Ga0496110_0061326_681_1562 293
712 3300048913 Ga0496110_0295722 Ga0496110_0295722_147_1070 293
713 3300048913 Ga0496110_0356901 Ga0496110_0356901_154_1068 293
714 3300048914 Ga0496111_0241384 Ga0496111_0241384_210_1091 293
715 3300048915 Ga0496112_0070199 Ga0496112_0070199_724_1605 293
716 3300048917 Ga0496114_0070788 Ga0496114_0070788_1291_2172 293
717 3300048917 Ga0496114_0197915 Ga0496114_0197915_122_1045 293
718 3300048918 Ga0496115_0056660 Ga0496115_0056660_471_1352 293
719 3300048918 Ga0496115_0058141 Ga0496115_0058141_602_1498 293
720 3300049568 Ga0501031_0015920 Ga0501031_0015920_204_1085 293
721 3300049569 Ga0501032_0079651 Ga0501032_0079651_1282_2163 293
722 3300049570 Ga0501033_0009055 Ga0501033_0009055_5073_5954 293
723 3300049570 Ga0501033_0043734 Ga0501033_0043734_2420_3304 293
724 3300049571 Ga0501034_0000319 Ga0501034_0000319_1967_2848 293
725 3300049571 Ga0501034_0006473 Ga0501034_0006473_9275_10156 293
726 3300049571 Ga0501034_0073408 Ga0501034_0073408_22_903 293
727 3300049571 Ga0501034_0178057 Ga0501034_0178057_656_1537 293
728 3300049572 Ga0501036_0200179 Ga0501036_0200179_83_964 293
729 3300049574 Ga0501038_0074431 Ga0501038_0074431_582_1466 293
730 3300049574 Ga0501038_0123920 Ga0501038_0123920_540_1421 293
731 3300049575 Ga0501039_0145115 Ga0501039_0145115_831_1715 293
732 3300049575 Ga0501039_0244502 Ga0501039_0244502_114_998 293
733 3300049578 Ga0501042_0124335 Ga0501042_0124335_495_1379 293
734 3300049580 Ga0501046_0067556 Ga0501046_0067556_266_1150 293
735 3300049581 Ga0501047_0004229 Ga0501047_0004229_2428_3309 293
736 3300049581 Ga0501047_0032947 Ga0501047_0032947_2844_3725 293
737 3300049581 Ga0501047_0071043 Ga0501047_0071043_466_1347 293
738 3300049581 Ga0501047_0243430 Ga0501047_0243430_361_1242 293
739 3300049583 Ga0501067_0043246 Ga0501067_0043246_1347_2228 293
740 3300049584 Ga0501068_0147326 Ga0501068_0147326_512_1393 293
741 3300049585 Ga0501069_0010152 Ga0501069_0010152_2667_3548 293
742 3300049585 Ga0501069_0015088 Ga0501069_0015088_625_1506 293
743 3300049585 Ga0501069_0037545 Ga0501069_0037545_1057_1938 293
744 3300049586 Ga0501070_0007456 Ga0501070_0007456_948_1829 293
745 3300049586 Ga0501070_0028420 Ga0501070_0028420_2838_3719 293
746 3300049586 Ga0501070_0059878 Ga0501070_0059878_2128_3009 293
747 3300049587 Ga0501071_0167455 Ga0501071_0167455_444_1325 293
748 3300049588 Ga0501072_0026931 Ga0501072_0026931_2378_3259 293
749 3300049588 Ga0501072_0076081 Ga0501072_0076081_1079_1975 293
750 3300049588 Ga0501072_0139840 Ga0501072_0139840_662_1546 293
751 3300049588 Ga0501072_0268011 Ga0501072_0268011_348_1229 293
752 3300049589 Ga0501073_0012418 Ga0501073_0012418_72_953 293
753 3300049589 Ga0501073_0066027 Ga0501073_0066027_1090_1971 293
754 3300049590 Ga0501074_0028981 Ga0501074_0028981_1229_2110 293
755 3300049591 Ga0501075_0092049 Ga0501075_0092049_1395_2279 293
756 3300049591 Ga0501075_0101143 Ga0501075_0101143_133_1017 293
757 3300049591 Ga0501075_0296529 Ga0501075_0296529_44_928 293
758 3300049592 Ga0501076_0181826 Ga0501076_0181826_793_1677 293
759 3300049593 Ga0501077_0155522 Ga0501077_0155522_98_982 293
760 3300049741 Ga0501079_0030249 Ga0501079_0030249_366_1250 293
761 3300049741 Ga0501079_0305614 Ga0501079_0305614_248_1132 293
762 3300049741 Ga0501079_0377270 Ga0501079_0377270_56_937 293
763 3300049742 Ga0501080_0120725 Ga0501080_0120725_476_1372 293
764 3300049742 Ga0501080_0184895 Ga0501080_0184895_835_1716 293
765 3300049744 Ga0501083_0149539 Ga0501083_0149539_231_1112 293
766 3300049822 Ga0501035_0001744 Ga0501035_0001744_474_1355 293
767 3300049822 Ga0501035_0387870 Ga0501035_0387870_153_1034 293
768 3300049823 Ga0501044_0025222 Ga0501044_0025222_1588_2469 293
769 3300049823 Ga0501044_0255750 Ga0501044_0255750_569_1450 293
770 3300049823 Ga0501044_0420061 Ga0501044_0420061_216_1097 293
771 3300049824 Ga0501045_0133890 Ga0501045_0133890_599_1483 293
772 3300050489 nmdc:mga03683_18029_c1 nmdc:mga03683_18029_c1_234_1151 293
773 3300050489 nmdc:mga03683_55912_c1 nmdc:mga03683_55912_c1_378_1262 293
774 3300050491 nmdc:mga00v17_193875_c1 nmdc:mga00v17_193875_c1_293_1177 293
775 3300050492 nmdc:mga0yw44_238713_c1 nmdc:mga0yw44_238713_c1_293_1177 293
776 3300050493 nmdc:mga0k408_30511_c1 nmdc:mga0k408_30511_c1_1538_2419 293
777 3300050493 nmdc:mga0k408_6984_c1 nmdc:mga0k408_6984_c1_491_1372 293
778 3300050494 nmdc:mga06z11_23082_c1 nmdc:mga06z11_23082_c1_1640_2521 293
779 3300050494 nmdc:mga06z11_25944_c1 nmdc:mga06z11_25944_c1_1741_2625 293
780 3300050496 nmdc:mga07m45_232941_c1 nmdc:mga07m45_232941_c1_158_1060 293
781 3300050496 nmdc:mga07m45_81689_c1 nmdc:mga07m45_81689_c1_440_1321 293
782 3300050507 nmdc:mga05p37_135088_c1 nmdc:mga05p37_135088_c1_1741_2622 293
783 3300050507 nmdc:mga05p37_517672_c1 nmdc:mga05p37_517672_c1_223_1134 293
784 3300050507 nmdc:mga05p37_657760_c1 nmdc:mga05p37_657760_c1_147_1034 293
785 3300050510 nmdc:mga06r32_194571_c1 nmdc:mga06r32_194571_c1_24_905 293
786 3300050510 nmdc:mga06r32_586727_c1 nmdc:mga06r32_586727_c1_161_1045 293
787 3300050510 nmdc:mga06r32_6250_c1 nmdc:mga06r32_6250_c1_9371_10255 293
788 3300050511 nmdc:mga08y16_202474_c1 nmdc:mga08y16_202474_c1_893_1789 293
789 3300050511 nmdc:mga08y16_621396_c1 nmdc:mga08y16_621396_c1_77_958 293
790 3300050512 nmdc:mga0n895_374977_c1 nmdc:mga0n895_374977_c1_370_1251 293
791 3300050512 nmdc:mga0n895_82205_c1 nmdc:mga0n895_82205_c1_1091_1972 293
792 3300050514 nmdc:mga08x19_216209_c1 nmdc:mga08x19_216209_c1_357_1238 293
793 3300050516 nmdc:mga0sz30_3009_c1 nmdc:mga0sz30_3009_c1_4831_5715 293
794 3300053077 Ga0495601_0000520 Ga0495601_0000520_9779_10702 293
795 3300053077 Ga0495601_0013873 Ga0495601_0013873_1352_2233 293
796 3300053077 Ga0495601_0023318 Ga0495601_0023318_615_1496 293
797 3300053077 Ga0495601_0058824 Ga0495601_0058824_1012_1896 293
798 3300053077 Ga0495601_0186908 Ga0495601_0186908_384_1268 293
799 3300053078 Ga0495612_0006426 Ga0495612_0006426_2279_3160 293
800 3300053078 Ga0495612_0011713 Ga0495612_0011713_1708_2589 293
801 3300053084 Ga0495595_0001335 Ga0495595_0001335_965_1888 293
802 3300053084 Ga0495595_0001933 Ga0495595_0001933_4815_5696 293
803 3300053085 Ga0495619_0000888 Ga0495619_0000888_13952_14875 293
804 3300053085 Ga0495619_0017366 Ga0495619_0017366_2544_3428 293
805 3300053085 Ga0495619_0025991 Ga0495619_0025991_2243_3124 293
806 3300053096 Ga0500641_0000893 Ga0500641_0000893_8098_8982 293
807 3300053096 Ga0500641_0031920 Ga0500641_0031920_774_1655 293
808 3300053125 Ga0500618_022359 Ga0500618_022359_338_1219 293
809 3300053131 Ga0500652_011719 Ga0500652_011719_906_1787 293
810 3300053153 Ga0500616_0000001 Ga0500616_0000001_1805135_1806016 293
811 3300053153 Ga0500616_0066835 Ga0500616_0066835_759_1640 293
812 3300054114 Ga0501084_0052522 Ga0501084_0052522_1345_2229 293
813 3300060353 Ga0501082_0023544 Ga0501082_0023544_1951_2847 293
814 3300060353 Ga0501082_0052919 Ga0501082_0052919_723_1607 293
815 3300060353 Ga0501082_0220619 Ga0501082_0220619_184_1068 293
816 3300060353 Ga0501082_0334218 Ga0501082_0334218_345_1229 293
817 3300061734 Ga0530510_0009146 Ga0530510_0009146_5034_5918 293
818 3300061734 Ga0530510_0055716 Ga0530510_0055716_781_1665 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

16

176

0.98

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

178

300

0.92

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

17

86

0.86

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

2

88

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

16

109

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9376 1 30
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9294 1 291
5x6r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9275 2 30
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9266 1 32
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9263 1 291
ID Description Score Start End Superfamily
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9833 2 162 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9832 1 161 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9788 2 161 3.40.50.720
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9737 3 158 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9735 4 162 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1R1BDY8-F1-model_v4 6-phosphogluconate dehydrogenase 0.9855 1 104 GO:0016491
GO:0050661
AF-A0A2V7HW24-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9835 1 119 GO:0016616
GO:0050661
AF-A0A3B5LQV3-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9832 1 125 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A4U3BX88-F1-model_v4 deleted 0.9823 2 80
AF-A0A7S1MGW9-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.982 1 114 GO:0050661

Feature Viewer

pLDDT pTM Quality
92.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map