F482139
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 392 | 818 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300046678|Ga0495599_0103831|Ga0495599_0103831_103_1041 |
| Length | 312 |
| Sequence | LAGHDTVVGGEVSHVNIGFVGLGAMGALIVPRLMAAGHKVTGWNRSREKAEPLIAAGMAFAATPRAVAEASNIVFSIVTDSAAVKAVALGPDSIVSGLRKGGIYIDMSTIEPDASRAIAVQFAKAGSIMLDGPLSGSPVTVKAGQASVMIGGDTDAFERAKPVLLAIGPKVTRIGGNGLACQMKIAVNLLLMVEVVCFGEAVALAEKGGVSREAAVDAILKSVAASPVLGYRGPFILDGKMPQVPLADVTLQQKDMVLALNLARQLGSPTPLAAAANEMMNACRGLGIDGNDFVVAHEVYRRLGGQDSGGQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 217 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 255 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 256 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 257 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 258 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 261 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 387 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.01 |
| Nodule | 0 |
| Rhizoplane | 7.46 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_101096 | 3300001430 | Bacteria | 1242 |
| 2 | JGI24739J22299_10002121 | 3300001989 | Bacteria | 7595 |
| 3 | JGI24737J22298_10052069 | 3300001990 | Bacteria | 1242 |
| 4 | JGI24738J21930_10000603 | 3300002075 | Bacteria | 10284 |
| 5 | JGI24744J21845_10021141 | 3300002077 | Bacteria | 1281 |
| 6 | JGI24742J22300_10000182 | 3300002244 | Bacteria | 9344 |
| 7 | JGI25153J46596_10001830 | 3300003215 | Bacteria | 12615 |
| 8 | JGI25404J52841_10001497 | 3300003659 | Bacteria | 4129 |
| 9 | Ga0065712_10073712 | 3300005290 | Bacteria | 4301 |
| 10 | Ga0065715_10033142 | 3300005293 | Bacteria | 1333 |
| 11 | Ga0065715_10038806 | 3300005293 | Bacteria | 1302 |
| 12 | Ga0065715_10105333 | 3300005293 | Bacteria | 2888 |
| 13 | Ga0070658_10008341 | 3300005327 | Bacteria | 8334 |
| 14 | Ga0070676_10051418 | 3300005328 | Bacteria | 2419 |
| 15 | Ga0070676_10064937 | 3300005328 | Bacteria | 2178 |
| 16 | Ga0070676_10131434 | 3300005328 | Bacteria | 1583 |
| 17 | Ga0070683_100112237 | 3300005329 | Bacteria | 2572 |
| 18 | Ga0070683_100179942 | 3300005329 | Bacteria | 2007 |
| 19 | Ga0070690_100009488 | 3300005330 | Bacteria | 5639 |
| 20 | Ga0070690_100061022 | 3300005330 | Bacteria | 2428 |
| 21 | Ga0070690_100065647 | 3300005330 | Bacteria | 2346 |
| 22 | Ga0070690_100070519 | 3300005330 | Bacteria | 2270 |
| 23 | Ga0070690_100078035 | 3300005330 | Bacteria | 2163 |
| 24 | Ga0070670_100003446 | 3300005331 | Bacteria | 13127 |
| 25 | Ga0070670_100253137 | 3300005331 | Bacteria | 1534 |
| 26 | Ga0070677_10000850 | 3300005333 | Bacteria | 10051 |
| 27 | Ga0070677_10005124 | 3300005333 | Bacteria | 4307 |
| 28 | Ga0068869_100068955 | 3300005334 | Bacteria | 2613 |
| 29 | Ga0070666_10035891 | 3300005335 | Bacteria | 3288 |
| 30 | Ga0070680_100002046 | 3300005336 | Bacteria | 14868 |
| 31 | Ga0070680_100029747 | 3300005336 | Bacteria | 4385 |
| 32 | Ga0070680_100148328 | 3300005336 | Bacteria | 1969 |
| 33 | Ga0070680_100295800 | 3300005336 | Bacteria | 1372 |
| 34 | Ga0070682_100051160 | 3300005337 | Bacteria | 2581 |
| 35 | Ga0070682_100097231 | 3300005337 | Bacteria | 1937 |
| 36 | Ga0068868_100007860 | 3300005338 | Bacteria | 7613 |
| 37 | Ga0068868_100068138 | 3300005338 | Bacteria | 2833 |
| 38 | Ga0070660_100014760 | 3300005339 | Bacteria | 5635 |
| 39 | Ga0070660_100057652 | 3300005339 | Bacteria | 3009 |
| 40 | Ga0070660_100067823 | 3300005339 | Bacteria | 2780 |
| 41 | Ga0070689_100032584 | 3300005340 | Bacteria | 3965 |
| 42 | Ga0070691_10015311 | 3300005341 | Bacteria | 3523 |
| 43 | Ga0070691_10079341 | 3300005341 | Bacteria | 1604 |
| 44 | Ga0070691_10087488 | 3300005341 | Bacteria | 1532 |
| 45 | Ga0070687_100074678 | 3300005343 | Bacteria | 1831 |
| 46 | Ga0070661_100034503 | 3300005344 | Bacteria | 3669 |
| 47 | Ga0070692_10014667 | 3300005345 | Bacteria | 3688 |
| 48 | Ga0070669_100134924 | 3300005353 | Bacteria | 1898 |
| 49 | Ga0070675_100031240 | 3300005354 | Bacteria | 4304 |
| 50 | Ga0070671_100031396 | 3300005355 | Bacteria | 4387 |
| 51 | Ga0070671_100048924 | 3300005355 | Bacteria | 3518 |
| 52 | Ga0070671_100088793 | 3300005355 | Bacteria | 2587 |
| 53 | Ga0070671_100109517 | 3300005355 | Bacteria | 2320 |
| 54 | Ga0070674_100004085 | 3300005356 | Bacteria | 8293 |
| 55 | Ga0070674_100044083 | 3300005356 | Bacteria | 3039 |
| 56 | Ga0070674_100468251 | 3300005356 | Bacteria | 1043 |
| 57 | Ga0070673_100024056 | 3300005364 | Bacteria | 4459 |
| 58 | Ga0070673_100074134 | 3300005364 | Bacteria | 2742 |
| 59 | Ga0070688_100217271 | 3300005365 | Bacteria | 1345 |
| 60 | Ga0070667_100179532 | 3300005367 | Bacteria | 1872 |
| 61 | Ga0070667_100245963 | 3300005367 | Bacteria | 1598 |
| 62 | Ga0070703_10000581 | 3300005406 | Bacteria | 13211 |
| 63 | Ga0070703_10056791 | 3300005406 | Bacteria | 1269 |
| 64 | Ga0070709_10015619 | 3300005434 | Bacteria | 4323 |
| 65 | Ga0070709_10047996 | 3300005434 | Bacteria | 2662 |
| 66 | Ga0070713_100009134 | 3300005436 | Bacteria | 7073 |
| 67 | Ga0070710_10042196 | 3300005437 | Bacteria | 2521 |
| 68 | Ga0070710_10071345 | 3300005437 | Bacteria | 2003 |
| 69 | Ga0070701_10004158 | 3300005438 | Bacteria | 5819 |
| 70 | Ga0070701_10016834 | 3300005438 | Bacteria | 3406 |
| 71 | Ga0070711_100040118 | 3300005439 | Bacteria | 3156 |
| 72 | Ga0070711_100110934 | 3300005439 | Bacteria | 2013 |
| 73 | Ga0070705_100000029 | 3300005440 | Bacteria | 74892 |
| 74 | Ga0070705_100046450 | 3300005440 | Bacteria | 2503 |
| 75 | Ga0070700_100006751 | 3300005441 | Bacteria | 6149 |
| 76 | Ga0070700_100035933 | 3300005441 | Bacteria | 3002 |
| 77 | Ga0070694_100001913 | 3300005444 | Bacteria | 12326 |
| 78 | Ga0070708_100019278 | 3300005445 | Bacteria | 5729 |
| 79 | Ga0070663_100017829 | 3300005455 | Bacteria | 4641 |
| 80 | Ga0070663_100021364 | 3300005455 | Bacteria | 4304 |
| 81 | Ga0070663_100401338 | 3300005455 | Bacteria | 1121 |
| 82 | Ga0070663_100438002 | 3300005455 | Bacteria | 1075 |
| 83 | Ga0070678_100015278 | 3300005456 | Bacteria | 4875 |
| 84 | Ga0070678_100034483 | 3300005456 | Bacteria | 3525 |
| 85 | Ga0070678_100122904 | 3300005456 | Bacteria | 2050 |
| 86 | Ga0070681_10006973 | 3300005458 | Bacteria | 10994 |
| 87 | Ga0070681_10019175 | 3300005458 | Bacteria | 6845 |
| 88 | Ga0070681_10021379 | 3300005458 | Bacteria | 6488 |
| 89 | Ga0070681_10037074 | 3300005458 | Bacteria | 4893 |
| 90 | Ga0068867_100032997 | 3300005459 | Bacteria | 3746 |
| 91 | Ga0068867_100036282 | 3300005459 | Bacteria | 3578 |
| 92 | Ga0070685_10013164 | 3300005466 | Bacteria | 4356 |
| 93 | Ga0070685_10020314 | 3300005466 | Bacteria | 3594 |
| 94 | Ga0070685_10064762 | 3300005466 | Bacteria | 2150 |
| 95 | Ga0070699_100002214 | 3300005518 | Bacteria | 17577 |
| 96 | Ga0070699_100249741 | 3300005518 | Bacteria | 1585 |
| 97 | Ga0070679_100045743 | 3300005530 | Bacteria | 4361 |
| 98 | Ga0070679_100058074 | 3300005530 | Bacteria | 3856 |
| 99 | Ga0070679_100090727 | 3300005530 | Bacteria | 3044 |
| 100 | Ga0070679_100098937 | 3300005530 | Bacteria | 2904 |
| 101 | Ga0070679_100195835 | 3300005530 | Bacteria | 1988 |
| 102 | Ga0070679_100217549 | 3300005530 | Bacteria | 1872 |
| 103 | Ga0070684_100021722 | 3300005535 | Bacteria | 5346 |
| 104 | Ga0070684_100277916 | 3300005535 | Bacteria | 1534 |
| 105 | Ga0070697_100004654 | 3300005536 | Bacteria | 10530 |
| 106 | Ga0070697_100297716 | 3300005536 | Bacteria | 1386 |
| 107 | Ga0068853_100001878 | 3300005539 | Bacteria | 15466 |
| 108 | Ga0070672_100171918 | 3300005543 | Bacteria | 1802 |
| 109 | Ga0070672_100225401 | 3300005543 | Bacteria | 1573 |
| 110 | Ga0070686_100017153 | 3300005544 | Bacteria | 4226 |
| 111 | Ga0070686_100168685 | 3300005544 | Unclassified | 1546 |
| 112 | Ga0070695_100000160 | 3300005545 | Bacteria | 32049 |
| 113 | Ga0070693_100032047 | 3300005547 | Bacteria | 2886 |
| 114 | Ga0070693_100060169 | 3300005547 | Bacteria | 2204 |
| 115 | Ga0070665_100515242 | 3300005548 | Bacteria | 1208 |
| 116 | Ga0070704_100016986 | 3300005549 | Bacteria | 4615 |
| 117 | Ga0070704_100289452 | 3300005549 | Bacteria | 1360 |
| 118 | Ga0068855_100111876 | 3300005563 | Bacteria | 3134 |
| 119 | Ga0068855_100395816 | 3300005563 | Bacteria | 1515 |
| 120 | Ga0070664_100025168 | 3300005564 | Bacteria | 4931 |
| 121 | Ga0070664_100033488 | 3300005564 | Bacteria | 4304 |
| 122 | Ga0068857_100003866 | 3300005577 | Bacteria | 12607 |
| 123 | Ga0068857_100057660 | 3300005577 | Bacteria | 3447 |
| 124 | Ga0068857_100361934 | 3300005577 | Bacteria | 1345 |
| 125 | Ga0068854_100008558 | 3300005578 | Bacteria | 6584 |
| 126 | Ga0068854_100202033 | 3300005578 | Unclassified | 1563 |
| 127 | Ga0068856_100061788 | 3300005614 | Bacteria | 3701 |
| 128 | Ga0068856_100086050 | 3300005614 | Bacteria | 3123 |
| 129 | Ga0070702_100037215 | 3300005615 | Bacteria | 2702 |
| 130 | Ga0068852_100045885 | 3300005616 | Bacteria | 3720 |
| 131 | Ga0068859_100003957 | 3300005617 | Bacteria | 15121 |
| 132 | Ga0068859_100048711 | 3300005617 | Bacteria | 4256 |
| 133 | Ga0068859_100078377 | 3300005617 | Bacteria | 3344 |
| 134 | Ga0068859_100301684 | 3300005617 | Bacteria | 1695 |
| 135 | Ga0068864_100003430 | 3300005618 | Bacteria | 13111 |
| 136 | Ga0068864_100057124 | 3300005618 | Bacteria | 3372 |
| 137 | Ga0068866_10011424 | 3300005718 | Bacteria | 3841 |
| 138 | Ga0068866_10206396 | 3300005718 | Bacteria | 1177 |
| 139 | Ga0068861_100061076 | 3300005719 | Bacteria | 2891 |
| 140 | Ga0068861_100186890 | 3300005719 | Bacteria | 1729 |
| 141 | Ga0068861_100280561 | 3300005719 | Bacteria | 1434 |
| 142 | Ga0068863_100003702 | 3300005841 | Bacteria | 15115 |
| 143 | Ga0068858_100010330 | 3300005842 | Bacteria | 8845 |
| 144 | Ga0068858_100237366 | 3300005842 | Bacteria | 1729 |
| 145 | Ga0068860_100004938 | 3300005843 | Bacteria | 13591 |
| 146 | Ga0068860_100058980 | 3300005843 | Bacteria | 3650 |
| 147 | Ga0068860_100076084 | 3300005843 | Bacteria | 3192 |
| 148 | Ga0068860_100136419 | 3300005843 | Bacteria | 2356 |
| 149 | Ga0068860_100464997 | 3300005843 | Bacteria | 1259 |
| 150 | Ga0068862_100000814 | 3300005844 | Bacteria | 30885 |
| 151 | Ga0068862_100087829 | 3300005844 | Bacteria | 2704 |
| 152 | Ga0068862_100320396 | 3300005844 | Bacteria | 1431 |
| 153 | Ga0081538_10019318 | 3300005981 | Bacteria | 5070 |
| 154 | Ga0081538_10046977 | 3300005981 | Bacteria | 2654 |
| 155 | Ga0081540_1000869 | 3300005983 | Bacteria | 27365 |
| 156 | Ga0070717_10070194 | 3300006028 | Bacteria | 2919 |
| 157 | Ga0075365_10018339 | 3300006038 | Bacteria | 4302 |
| 158 | Ga0075365_10131953 | 3300006038 | Bacteria | 1729 |
| 159 | Ga0075368_10028739 | 3300006042 | Bacteria | 2149 |
| 160 | Ga0075364_10009379 | 3300006051 | Bacteria | 5868 |
| 161 | Ga0075364_10173526 | 3300006051 | Bacteria | 1458 |
| 162 | Ga0070712_100004896 | 3300006175 | Bacteria | 8281 |
| 163 | Ga0070712_100070696 | 3300006175 | Bacteria | 2495 |
| 164 | Ga0075362_10025889 | 3300006177 | Bacteria | 2502 |
| 165 | Ga0075362_10056957 | 3300006177 | Bacteria | 1760 |
| 166 | Ga0075367_10001375 | 3300006178 | Bacteria | 10378 |
| 167 | Ga0075369_10013818 | 3300006186 | Bacteria | 3213 |
| 168 | Ga0075366_10027627 | 3300006195 | Bacteria | 3330 |
| 169 | Ga0075366_10030441 | 3300006195 | Bacteria | 3173 |
| 170 | Ga0075366_10110707 | 3300006195 | Bacteria | 1651 |
| 171 | Ga0097621_100004664 | 3300006237 | Bacteria | 9574 |
| 172 | Ga0075370_10246697 | 3300006353 | Bacteria | 1058 |
| 173 | Ga0068871_100001982 | 3300006358 | Bacteria | 13874 |
| 174 | Ga0075430_100124411 | 3300006846 | Bacteria | 2150 |
| 175 | Ga0075431_100064079 | 3300006847 | Bacteria | 3794 |
| 176 | Ga0075431_100326322 | 3300006847 | Bacteria | 1547 |
| 177 | Ga0075431_100459746 | 3300006847 | Bacteria | 1267 |
| 178 | Ga0075433_10069775 | 3300006852 | Bacteria | 3087 |
| 179 | Ga0075434_100074529 | 3300006871 | Bacteria | 3387 |
| 180 | Ga0075434_100160183 | 3300006871 | Bacteria | 2270 |
| 181 | Ga0075429_100258159 | 3300006880 | Bacteria | 1526 |
| 182 | Ga0075429_100303409 | 3300006880 | Bacteria | 1398 |
| 183 | Ga0068865_100014555 | 3300006881 | Bacteria | 5001 |
| 184 | Ga0068865_100176589 | 3300006881 | Bacteria | 1642 |
| 185 | Ga0068865_100176733 | 3300006881 | Bacteria | 1641 |
| 186 | Ga0068865_100298447 | 3300006881 | Bacteria | 1289 |
| 187 | Ga0097620_100003957 | 3300006931 | Bacteria | 15121 |
| 188 | Ga0097620_100048710 | 3300006931 | Bacteria | 4256 |
| 189 | Ga0097620_100078378 | 3300006931 | Bacteria | 3344 |
| 190 | Ga0097620_100301689 | 3300006931 | Bacteria | 1695 |
| 191 | Ga0075435_100411321 | 3300007076 | Bacteria | 1164 |
| 192 | Ga0105244_10046414 | 3300009036 | Bacteria | 2232 |
| 193 | Ga0105250_10025315 | 3300009092 | Bacteria | 2391 |
| 194 | Ga0105240_10018034 | 3300009093 | Bacteria | 9492 |
| 195 | Ga0105240_10037984 | 3300009093 | Bacteria | 6183 |
| 196 | Ga0105240_10096089 | 3300009093 | Bacteria | 3612 |
| 197 | Ga0111539_10046029 | 3300009094 | Bacteria | 5221 |
| 198 | Ga0111539_10118849 | 3300009094 | Bacteria | 3098 |
| 199 | Ga0105245_10005456 | 3300009098 | Bacteria | 11171 |
| 200 | Ga0105245_10021701 | 3300009098 | Bacteria | 5637 |
| 201 | Ga0105245_10105815 | 3300009098 | Bacteria | 2610 |
| 202 | Ga0105247_10010633 | 3300009101 | Bacteria | 5557 |
| 203 | Ga0105247_10022193 | 3300009101 | Bacteria | 3822 |
| 204 | Ga0105247_10177358 | 3300009101 | Bacteria | 1420 |
| 205 | Ga0114129_10008798 | 3300009147 | Bacteria | 14405 |
| 206 | Ga0114129_10173116 | 3300009147 | Bacteria | 2942 |
| 207 | Ga0105243_10017609 | 3300009148 | Bacteria | 5403 |
| 208 | Ga0105243_10062943 | 3300009148 | Bacteria | 2972 |
| 209 | Ga0105243_10481139 | 3300009148 | Bacteria | 1172 |
| 210 | Ga0105241_10023596 | 3300009174 | Bacteria | 4562 |
| 211 | Ga0105241_10075162 | 3300009174 | Bacteria | 2632 |
| 212 | Ga0105242_10036922 | 3300009176 | Bacteria | 3922 |
| 213 | Ga0105242_10114216 | 3300009176 | Bacteria | 2307 |
| 214 | Ga0105242_10387107 | 3300009176 | Bacteria | 1301 |
| 215 | Ga0105248_10001504 | 3300009177 | Bacteria | 25935 |
| 216 | Ga0105248_10018134 | 3300009177 | Bacteria | 7772 |
| 217 | Ga0105248_10035902 | 3300009177 | Bacteria | 5544 |
| 218 | Ga0105248_10071786 | 3300009177 | Bacteria | 3890 |
| 219 | Ga0105248_10077990 | 3300009177 | Bacteria | 3725 |
| 220 | Ga0105237_10065342 | 3300009545 | Bacteria | 3635 |
| 221 | Ga0105238_10005215 | 3300009551 | Bacteria | 12837 |
| 222 | Ga0105238_10020403 | 3300009551 | Bacteria | 6746 |
| 223 | Ga0105238_10042427 | 3300009551 | Bacteria | 4606 |
| 224 | Ga0105238_10309892 | 3300009551 | Bacteria | 1563 |
| 225 | Ga0105249_10000961 | 3300009553 | Bacteria | 25470 |
| 226 | Ga0105239_10027540 | 3300010375 | Bacteria | 6255 |
| 227 | Ga0105239_10347400 | 3300010375 | Bacteria | 1675 |
| 228 | Ga0105239_10578783 | 3300010375 | Bacteria | 1280 |
| 229 | Ga0157373_10045521 | 3300013100 | Bacteria | 3132 |
| 230 | Ga0157371_10025553 | 3300013102 | Bacteria | 4302 |
| 231 | Ga0157371_10065389 | 3300013102 | Bacteria | 2576 |
| 232 | Ga0157370_10094886 | 3300013104 | Bacteria | 2798 |
| 233 | Ga0157370_10302121 | 3300013104 | Bacteria | 1477 |
| 234 | Ga0157369_10202355 | 3300013105 | Bacteria | 2084 |
| 235 | Ga0157369_10538050 | 3300013105 | Bacteria | 1208 |
| 236 | Ga0157369_10765283 | 3300013105 | Bacteria | 993 |
| 237 | Ga0157374_10018784 | 3300013296 | Bacteria | 6109 |
| 238 | Ga0157378_10070619 | 3300013297 | Bacteria | 3136 |
| 239 | Ga0157378_10613459 | 3300013297 | Bacteria | 1100 |
| 240 | Ga0163162_10062793 | 3300013306 | Bacteria | 3755 |
| 241 | Ga0163162_10140638 | 3300013306 | Bacteria | 2527 |
| 242 | Ga0163162_10235538 | 3300013306 | Bacteria | 1961 |
| 243 | Ga0157372_10014878 | 3300013307 | Bacteria | 8329 |
| 244 | Ga0157372_10185734 | 3300013307 | Bacteria | 2407 |
| 245 | Ga0157372_10215503 | 3300013307 | Bacteria | 2225 |
| 246 | Ga0157372_10280924 | 3300013307 | Bacteria | 1936 |
| 247 | Ga0157375_10070481 | 3300013308 | Bacteria | 3506 |
| 248 | Ga0157375_10306592 | 3300013308 | Bacteria | 1752 |
| 249 | Ga0163163_10041560 | 3300014325 | Bacteria | 4497 |
| 250 | Ga0163163_10083757 | 3300014325 | Bacteria | 3194 |
| 251 | Ga0163163_10755232 | 3300014325 | Bacteria | 1036 |
| 252 | Ga0157380_10247840 | 3300014326 | Bacteria | 1610 |
| 253 | Ga0157380_10397726 | 3300014326 | Bacteria | 1306 |
| 254 | Ga0157377_10010239 | 3300014745 | Bacteria | 4631 |
| 255 | Ga0157379_10049595 | 3300014968 | Bacteria | 3749 |
| 256 | Ga0157379_10095739 | 3300014968 | Bacteria | 2664 |
| 257 | Ga0157379_10537301 | 3300014968 | Bacteria | 1087 |
| 258 | Ga0157376_10002979 | 3300014969 | Bacteria | 11611 |
| 259 | Ga0157376_10159259 | 3300014969 | Bacteria | 2044 |
| 260 | Ga0163161_10000941 | 3300017792 | Bacteria | 22395 |
| 261 | Ga0163161_10216051 | 3300017792 | Bacteria | 1483 |
| 262 | Ga0163161_10220971 | 3300017792 | Bacteria | 1467 |
| 263 | Ga0206354_10355791 | 3300020081 | Bacteria | 1902 |
| 264 | Ga0206353_11753873 | 3300020082 | Bacteria | 1075 |
| 265 | Ga0213876_10006322 | 3300021384 | Bacteria | 6455 |
| 266 | Ga0209758_1000428 | 3300025297 | Bacteria | 71178 |
| 267 | Ga0207697_10002352 | 3300025315 | Bacteria | 9849 |
| 268 | Ga0207697_10019741 | 3300025315 | Bacteria | 2761 |
| 269 | Ga0207653_10000445 | 3300025885 | Bacteria | 16882 |
| 270 | Ga0207653_10006154 | 3300025885 | Bacteria | 3740 |
| 271 | Ga0207682_10000293 | 3300025893 | Bacteria | 22550 |
| 272 | Ga0207682_10000391 | 3300025893 | Bacteria | 20145 |
| 273 | Ga0207682_10032321 | 3300025893 | Bacteria | 2103 |
| 274 | Ga0207692_10056116 | 3300025898 | Bacteria | 2019 |
| 275 | Ga0207692_10094419 | 3300025898 | Bacteria | 1629 |
| 276 | Ga0207642_10154074 | 3300025899 | Unclassified | 1227 |
| 277 | Ga0207710_10006497 | 3300025900 | Bacteria | 4986 |
| 278 | Ga0207710_10018896 | 3300025900 | Bacteria | 2935 |
| 279 | Ga0207710_10170202 | 3300025900 | Bacteria | 1065 |
| 280 | Ga0207688_10000070 | 3300025901 | Bacteria | 38023 |
| 281 | Ga0207688_10291995 | 3300025901 | Bacteria | 995 |
| 282 | Ga0207680_10101877 | 3300025903 | Bacteria | 1846 |
| 283 | Ga0207647_10048930 | 3300025904 | Bacteria | 2624 |
| 284 | Ga0207699_10071795 | 3300025906 | Bacteria | 2118 |
| 285 | Ga0207645_10041285 | 3300025907 | Bacteria | 2953 |
| 286 | Ga0207645_10085916 | 3300025907 | Bacteria | 2020 |
| 287 | Ga0207645_10112775 | 3300025907 | Bacteria | 1761 |
| 288 | Ga0207643_10000123 | 3300025908 | Bacteria | 53091 |
| 289 | Ga0207643_10114919 | 3300025908 | Bacteria | 1589 |
| 290 | Ga0207705_10124153 | 3300025909 | Bacteria | 1917 |
| 291 | Ga0207707_10004337 | 3300025912 | Bacteria | 12553 |
| 292 | Ga0207707_10011032 | 3300025912 | Bacteria | 7863 |
| 293 | Ga0207707_10012557 | 3300025912 | Bacteria | 7362 |
| 294 | Ga0207707_10060483 | 3300025912 | Bacteria | 3295 |
| 295 | Ga0207707_10346084 | 3300025912 | Bacteria | 1281 |
| 296 | Ga0207695_10134638 | 3300025913 | Bacteria | 2425 |
| 297 | Ga0207695_10220917 | 3300025913 | Bacteria | 1802 |
| 298 | Ga0207693_10004569 | 3300025915 | Bacteria | 11683 |
| 299 | Ga0207693_10010674 | 3300025915 | Bacteria | 7456 |
| 300 | Ga0207693_10045608 | 3300025915 | Bacteria | 3444 |
| 301 | Ga0207663_10030224 | 3300025916 | Bacteria | 3193 |
| 302 | Ga0207663_10070522 | 3300025916 | Bacteria | 2252 |
| 303 | Ga0207663_10089629 | 3300025916 | Bacteria | 2037 |
| 304 | Ga0207660_10002992 | 3300025917 | Bacteria | 11072 |
| 305 | Ga0207660_10004649 | 3300025917 | Bacteria | 8948 |
| 306 | Ga0207660_10029631 | 3300025917 | Bacteria | 3757 |
| 307 | Ga0207660_10093782 | 3300025917 | Bacteria | 2231 |
| 308 | Ga0207660_10227006 | 3300025917 | Bacteria | 1467 |
| 309 | Ga0207662_10015158 | 3300025918 | Bacteria | 4333 |
| 310 | Ga0207657_10008644 | 3300025919 | Bacteria | 10309 |
| 311 | Ga0207657_10009786 | 3300025919 | Bacteria | 9610 |
| 312 | Ga0207657_10048246 | 3300025919 | Bacteria | 3719 |
| 313 | Ga0207657_10240437 | 3300025919 | Bacteria | 1446 |
| 314 | Ga0207649_10029754 | 3300025920 | Bacteria | 3228 |
| 315 | Ga0207649_10167301 | 3300025920 | Bacteria | 1528 |
| 316 | Ga0207652_10015347 | 3300025921 | Bacteria | 6220 |
| 317 | Ga0207652_10016117 | 3300025921 | Bacteria | 6095 |
| 318 | Ga0207652_10033952 | 3300025921 | Bacteria | 4297 |
| 319 | Ga0207652_10066903 | 3300025921 | Bacteria | 3115 |
| 320 | Ga0207652_10234136 | 3300025921 | Bacteria | 1655 |
| 321 | Ga0207652_10364349 | 3300025921 | Bacteria | 1304 |
| 322 | Ga0207681_10011037 | 3300025923 | Bacteria | 5548 |
| 323 | Ga0207694_10062629 | 3300025924 | Bacteria | 2896 |
| 324 | Ga0207694_10099955 | 3300025924 | Bacteria | 2298 |
| 325 | Ga0207650_10002345 | 3300025925 | Bacteria | 13152 |
| 326 | Ga0207659_10011847 | 3300025926 | Bacteria | 5522 |
| 327 | Ga0207687_10086721 | 3300025927 | Bacteria | 2274 |
| 328 | Ga0207687_10297796 | 3300025927 | Bacteria | 1298 |
| 329 | Ga0207700_10011773 | 3300025928 | Bacteria | 5598 |
| 330 | Ga0207664_10016757 | 3300025929 | Bacteria | 5353 |
| 331 | Ga0207644_10015103 | 3300025931 | Bacteria | 5180 |
| 332 | Ga0207644_10016369 | 3300025931 | Bacteria | 4989 |
| 333 | Ga0207690_10113766 | 3300025932 | Bacteria | 1953 |
| 334 | Ga0207706_10002469 | 3300025933 | Bacteria | 18019 |
| 335 | Ga0207686_10002206 | 3300025934 | Bacteria | 10719 |
| 336 | Ga0207686_10042645 | 3300025934 | Bacteria | 2775 |
| 337 | Ga0207686_10215374 | 3300025934 | Bacteria | 1383 |
| 338 | Ga0207709_10008232 | 3300025935 | Bacteria | 5776 |
| 339 | Ga0207709_10037345 | 3300025935 | Bacteria | 2886 |
| 340 | Ga0207709_10052962 | 3300025935 | Bacteria | 2495 |
| 341 | Ga0207709_10120711 | 3300025935 | Bacteria | 1769 |
| 342 | Ga0207670_10002470 | 3300025936 | Bacteria | 9703 |
| 343 | Ga0207670_10012750 | 3300025936 | Bacteria | 4929 |
| 344 | Ga0207670_10332602 | 3300025936 | Archaea | 1198 |
| 345 | Ga0207669_10007077 | 3300025937 | Bacteria | 5164 |
| 346 | Ga0207669_10194838 | 3300025937 | Bacteria | 1465 |
| 347 | Ga0207704_10138250 | 3300025938 | Bacteria | 1699 |
| 348 | Ga0207704_10141154 | 3300025938 | Bacteria | 1685 |
| 349 | Ga0207704_10258892 | 3300025938 | Bacteria | 1311 |
| 350 | Ga0207665_10066777 | 3300025939 | Bacteria | 2448 |
| 351 | Ga0207691_10001015 | 3300025940 | Bacteria | 27838 |
| 352 | Ga0207691_10004072 | 3300025940 | Bacteria | 14179 |
| 353 | Ga0207691_10141859 | 3300025940 | Bacteria | 2117 |
| 354 | Ga0207691_10230051 | 3300025940 | Bacteria | 1606 |
| 355 | Ga0207711_10015167 | 3300025941 | Bacteria | 6400 |
| 356 | Ga0207711_10039695 | 3300025941 | Bacteria | 4004 |
| 357 | Ga0207711_10045937 | 3300025941 | Bacteria | 3732 |
| 358 | Ga0207711_10103861 | 3300025941 | Bacteria | 2517 |
| 359 | Ga0207711_10436593 | 3300025941 | Bacteria | 1218 |
| 360 | Ga0207689_10007859 | 3300025942 | Bacteria | 9317 |
| 361 | Ga0207689_10090789 | 3300025942 | Bacteria | 2510 |
| 362 | Ga0207661_10022343 | 3300025944 | Bacteria | 4762 |
| 363 | Ga0207661_10075558 | 3300025944 | Bacteria | 2765 |
| 364 | Ga0207667_10030658 | 3300025949 | Bacteria | 5814 |
| 365 | Ga0207667_10135727 | 3300025949 | Bacteria | 2533 |
| 366 | Ga0207667_10195824 | 3300025949 | Bacteria | 2073 |
| 367 | Ga0207651_10050097 | 3300025960 | Bacteria | 2834 |
| 368 | Ga0207651_10123352 | 3300025960 | Bacteria | 1969 |
| 369 | Ga0207651_10133205 | 3300025960 | Bacteria | 1906 |
| 370 | Ga0207712_10001153 | 3300025961 | Bacteria | 18408 |
| 371 | Ga0207712_10213862 | 3300025961 | Bacteria | 1537 |
| 372 | Ga0207658_10023467 | 3300025986 | Bacteria | 4306 |
| 373 | Ga0207658_10199650 | 3300025986 | Bacteria | 1669 |
| 374 | Ga0207658_10432633 | 3300025986 | Bacteria | 1162 |
| 375 | Ga0207677_10019295 | 3300026023 | Bacteria | 4115 |
| 376 | Ga0207677_10119426 | 3300026023 | Bacteria | 1980 |
| 377 | Ga0207703_10076901 | 3300026035 | Bacteria | 2769 |
| 378 | Ga0207703_10091104 | 3300026035 | Bacteria | 2564 |
| 379 | Ga0207639_10057698 | 3300026041 | Bacteria | 2982 |
| 380 | Ga0207639_10102153 | 3300026041 | Bacteria | 2320 |
| 381 | Ga0207678_10000688 | 3300026067 | Bacteria | 30961 |
| 382 | Ga0207678_10031385 | 3300026067 | Bacteria | 4634 |
| 383 | Ga0207678_10296910 | 3300026067 | Bacteria | 1388 |
| 384 | Ga0207708_10007349 | 3300026075 | Bacteria | 8140 |
| 385 | Ga0207702_10274011 | 3300026078 | Bacteria | 1593 |
| 386 | Ga0207648_10002850 | 3300026089 | Bacteria | 18308 |
| 387 | Ga0207648_10062381 | 3300026089 | Bacteria | 3249 |
| 388 | Ga0207676_10001647 | 3300026095 | Bacteria | 16445 |
| 389 | Ga0207676_10045488 | 3300026095 | Bacteria | 3392 |
| 390 | Ga0207676_10063875 | 3300026095 | Bacteria | 2925 |
| 391 | Ga0207676_10102860 | 3300026095 | Bacteria | 2372 |
| 392 | Ga0207674_10010786 | 3300026116 | Bacteria | 10306 |
| 393 | Ga0207674_10015583 | 3300026116 | Bacteria | 8347 |
| 394 | Ga0207674_10034544 | 3300026116 | Bacteria | 5283 |
| 395 | Ga0207675_100075881 | 3300026118 | Bacteria | 3147 |
| 396 | Ga0207675_100174468 | 3300026118 | Bacteria | 2056 |
| 397 | Ga0207675_100314555 | 3300026118 | Bacteria | 1528 |
| 398 | Ga0207683_10032865 | 3300026121 | Bacteria | 4507 |
| 399 | Ga0207683_10071264 | 3300026121 | Bacteria | 3072 |
| 400 | Ga0207683_10288703 | 3300026121 | Bacteria | 1500 |
| 401 | Ga0207698_10098028 | 3300026142 | Bacteria | 2421 |
| 402 | Ga0207698_10102424 | 3300026142 | Bacteria | 2377 |
| 403 | Ga0207698_10129801 | 3300026142 | Bacteria | 2151 |
| 404 | Ga0210002_1000422 | 3300027617 | Bacteria | 5737 |
| 405 | Ga0209983_1001018 | 3300027665 | Bacteria | 6206 |
| 406 | Ga0209971_1001863 | 3300027682 | Bacteria | 5161 |
| 407 | Ga0209966_1001831 | 3300027695 | Bacteria | 3601 |
| 408 | Ga0209998_10002702 | 3300027717 | Bacteria | 4002 |
| 409 | Ga0209974_10018690 | 3300027876 | Bacteria | 2299 |
| 410 | Ga0207428_10034736 | 3300027907 | Bacteria | 4128 |
| 411 | Ga0268266_10118273 | 3300028379 | Bacteria | 2356 |
| 412 | Ga0268265_10001430 | 3300028380 | Bacteria | 20132 |
| 413 | Ga0268265_10154089 | 3300028380 | Bacteria | 1942 |
| 414 | Ga0268264_10085414 | 3300028381 | Bacteria | 2709 |
| 415 | Ga0268264_10117817 | 3300028381 | Bacteria | 2336 |
| 416 | Ga0268264_10254174 | 3300028381 | Bacteria | 1634 |
| 417 | Ga0265318_10007557 | 3300028577 | Bacteria | 4901 |
| 418 | Ga0265338_10133447 | 3300028800 | Bacteria | 1956 |
| 419 | Ga0265330_10022924 | 3300031235 | Bacteria | 2837 |
| 420 | Ga0265332_10033062 | 3300031238 | Bacteria | 2252 |
| 421 | Ga0265320_10030967 | 3300031240 | Bacteria | 2753 |
| 422 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 423 | Ga0265325_10000637 | 3300031241 | Bacteria | 25504 |
| 424 | Ga0265325_10000671 | 3300031241 | Bacteria | 24941 |
| 425 | Ga0265325_10006661 | 3300031241 | Bacteria | 6988 |
| 426 | Ga0265325_10015673 | 3300031241 | Bacteria | 4257 |
| 427 | Ga0265325_10018972 | 3300031241 | Bacteria | 3809 |
| 428 | Ga0265325_10048143 | 3300031241 | Bacteria | 2204 |
| 429 | Ga0265340_10038400 | 3300031247 | Bacteria | 2368 |
| 430 | Ga0265340_10043763 | 3300031247 | Bacteria | 2193 |
| 431 | Ga0265339_10009785 | 3300031249 | Bacteria | 5992 |
| 432 | Ga0265339_10012548 | 3300031249 | Bacteria | 5170 |
| 433 | Ga0265316_10009607 | 3300031344 | Bacteria | 8887 |
| 434 | Ga0265316_10127728 | 3300031344 | Bacteria | 1916 |
| 435 | Ga0265313_10000118 | 3300031595 | Bacteria | 79605 |
| 436 | Ga0265313_10005881 | 3300031595 | Bacteria | 8894 |
| 437 | Ga0265313_10010184 | 3300031595 | Bacteria | 5996 |
| 438 | Ga0265313_10010448 | 3300031595 | Bacteria | 5867 |
| 439 | Ga0265314_10012846 | 3300031711 | Bacteria | 6803 |
| 440 | Ga0265314_10085898 | 3300031711 | Bacteria | 2062 |
| 441 | Ga0265342_10000674 | 3300031712 | Bacteria | 35642 |
| 442 | Ga0265342_10013532 | 3300031712 | Bacteria | 5468 |
| 443 | Ga0265342_10019918 | 3300031712 | Bacteria | 4315 |
| 444 | Ga0316576_10005448 | 3300031727 | Bacteria | 7777 |
| 445 | Ga0316578_10000852 | 3300031728 | Bacteria | 11447 |
| 446 | Ga0307416_100439397 | 3300032002 | Bacteria | 1354 |
| 447 | Ga0307415_100347008 | 3300032126 | Bacteria | 1248 |
| 448 | Ga0316583_10016641 | 3300032133 | Bacteria | 2645 |
| 449 | Ga0373930_0005799 | 3300034816 | Bacteria | 2066 |
| 450 | Ga0373958_0017723 | 3300034819 | Bacteria | 1284 |
| 451 | Ga0373938_0003020 | 3300034957 | Bacteria | 2731 |
| 452 | Ga0373928_0031699 | 3300035084 | Bacteria | 1175 |
| 453 | Ga0373934_0019984 | 3300035086 | Bacteria | 2574 |
| 454 | Ga0373949_0005787 | 3300035090 | Bacteria | 2750 |
| 455 | Ga0373952_0004789 | 3300035092 | Bacteria | 2462 |
| 456 | Ga0373952_0014494 | 3300035092 | Bacteria | 1579 |
| 457 | Ga0373952_0031509 | 3300035092 | Bacteria | 1179 |
| 458 | Ga0373936_0012370 | 3300035113 | Bacteria | 3246 |
| 459 | Ga0373939_0022407 | 3300035114 | Unclassified | 1741 |
| 460 | Ga0373939_0026565 | 3300035114 | Bacteria | 1633 |
| 461 | Ga0373941_0007639 | 3300035115 | Bacteria | 2653 |
| 462 | Ga0373945_0013554 | 3300035116 | Bacteria | 2722 |
| 463 | Ga0373953_0008276 | 3300035117 | Bacteria | 3525 |
| 464 | Ga0373953_0055621 | 3300035117 | Bacteria | 1607 |
| 465 | Ga0373954_0009161 | 3300035118 | Bacteria | 4355 |
| 466 | Ga0373954_0133203 | 3300035118 | Bacteria | 1211 |
| 467 | Ga0373956_0007281 | 3300035119 | Bacteria | 4456 |
| 468 | Ga0373957_0030808 | 3300035120 | Bacteria | 1967 |
| 469 | Ga0373943_0012011 | 3300035170 | Bacteria | 3898 |
| 470 | Ga0373943_0014642 | 3300035170 | Bacteria | 3555 |
| 471 | Ga0373946_0074127 | 3300035171 | Bacteria | 1477 |
| 472 | Ga0373946_0082989 | 3300035171 | Unclassified | 1406 |
| 473 | Ga0373955_0006492 | 3300035172 | Bacteria | 5329 |
| 474 | Ga0373955_0032412 | 3300035172 | Bacteria | 2742 |
| 475 | Ga0373942_0039300 | 3300035207 | Bacteria | 1286 |
| 476 | Ga0373961_0009231 | 3300035241 | Bacteria | 2410 |
| 477 | Ga0373961_0063400 | 3300035241 | Bacteria | 1127 |
| 478 | Ga0373962_0002525 | 3300035242 | Bacteria | 4343 |
| 479 | Ga0316574_0003805 | 3300035398 | Bacteria | 7826 |
| 480 | Ga0373924_0164112 | 3300035410 | Bacteria | 975 |
| 481 | Ga0373931_0003778 | 3300035691 | Bacteria | 6851 |
| 482 | Ga0373931_0024303 | 3300035691 | Bacteria | 3068 |
| 483 | Ga0373931_0165701 | 3300035691 | Bacteria | 1298 |
| 484 | Ga0373935_0017861 | 3300035692 | Bacteria | 4309 |
| 485 | Ga0373935_0046414 | 3300035692 | Bacteria | 2744 |
| 486 | Ga0373935_0559082 | 3300035692 | Bacteria | 834 |
| 487 | Ga0373927_0031014 | 3300035695 | Bacteria | 3487 |
| 488 | Ga0373927_0299325 | 3300035695 | Bacteria | 1058 |
| 489 | Ga0373933_0003561 | 3300035724 | Bacteria | 8656 |
| 490 | Ga0373947_0030379 | 3300035725 | Bacteria | 3174 |
| 491 | Ga0373937_0002015 | 3300036401 | Bacteria | 16944 |
| 492 | Ga0373937_0025551 | 3300036401 | Bacteria | 5333 |
| 493 | Ga0373937_0391092 | 3300036401 | Bacteria | 1319 |
| 494 | Ga0373937_0653894 | 3300036401 | Bacteria | 997 |
| 495 | Ga0316584_0533536 | 3300036712 | Unclassified | 821 |
| 496 | Ga0373925_0030165 | 3300037068 | Bacteria | 3979 |
| 497 | Ga0373925_0134357 | 3300037068 | Bacteria | 1932 |
| 498 | Ga0373925_0137764 | 3300037068 | Bacteria | 1908 |
| 499 | Ga0395899_0089309 | 3300037312 | Bacteria | 2235 |
| 500 | Ga0395899_0341462 | 3300037312 | Unclassified | 1004 |
| 501 | Ga0395900_0016731 | 3300037418 | Bacteria | 7480 |
| 502 | Ga0395900_0049091 | 3300037418 | Bacteria | 4347 |
| 503 | Ga0395898_0006493 | 3300037466 | Bacteria | 12490 |
| 504 | Ga0395898_0012187 | 3300037466 | Bacteria | 8894 |
| 505 | Ga0395901_0076786 | 3300038443 | Bacteria | 3485 |
| 506 | Ga0395901_0153652 | 3300038443 | Bacteria | 2417 |
| 507 | Ga0395901_0449982 | 3300038443 | Bacteria | 1317 |
| 508 | Ga0436365_0368495 | 3300039437 | Bacteria | 2520 |
| 509 | Ga0436365_0940061 | 3300039437 | Bacteria | 15467 |
| 510 | Ga0436365_1063276 | 3300039437 | Bacteria | 1888 |
| 511 | Ga0436365_1065374 | 3300039437 | Bacteria | 2648 |
| 512 | Ga0436365_1497092 | 3300039437 | Bacteria | 975 |
| 513 | Ga0436360_0713145 | 3300039438 | Bacteria | 1693 |
| 514 | Ga0439453_0002540 | 3300041408 | Bacteria | 2530 |
| 515 | Ga0439450_040575 | 3300042008 | Bacteria | 1079 |
| 516 | Ga0439455_0006154 | 3300042012 | Bacteria | 2477 |
| 517 | Ga0439463_019687 | 3300042016 | Bacteria | 1681 |
| 518 | Ga0450909_016028 | 3300042185 | Bacteria | 1106 |
| 519 | Ga0439435_0059131 | 3300042436 | Bacteria | 1113 |
| 520 | Ga0439464_0044445 | 3300042439 | Bacteria | 1272 |
| 521 | Ga0439460_0034896 | 3300042461 | Bacteria | 1452 |
| 522 | Ga0466961_0056701 | 3300044693 | Bacteria | 2496 |
| 523 | Ga0466963_0028079 | 3300044694 | Bacteria | 3609 |
| 524 | Ga0466963_0097736 | 3300044694 | Bacteria | 2006 |
| 525 | Ga0466957_0020555 | 3300044842 | Bacteria | 3885 |
| 526 | Ga0466959_0366817 | 3300045049 | Bacteria | 981 |
| 527 | Ga0466958_0040706 | 3300045836 | Bacteria | 2793 |
| 528 | Ga0466967_0026063 | 3300045976 | Bacteria | 4835 |
| 529 | Ga0466967_0034563 | 3300045976 | Bacteria | 4292 |
| 530 | Ga0466967_0327322 | 3300045976 | Bacteria | 1479 |
| 531 | Ga0495592_0037989 | 3300046454 | Bacteria | 3623 |
| 532 | Ga0495603_0014815 | 3300046455 | Bacteria | 4715 |
| 533 | Ga0495603_0047868 | 3300046455 | Bacteria | 2546 |
| 534 | Ga0495629_0166533 | 3300046459 | Bacteria | 1530 |
| 535 | Ga0495638_0093024 | 3300046460 | Bacteria | 1814 |
| 536 | Ga0495638_0174943 | 3300046460 | Bacteria | 1229 |
| 537 | Ga0495641_0023441 | 3300046461 | Bacteria | 3065 |
| 538 | Ga0495651_0020442 | 3300046462 | Bacteria | 5140 |
| 539 | Ga0495653_0000751 | 3300046463 | Bacteria | 24812 |
| 540 | Ga0495580_0312123 | 3300046472 | Bacteria | 1069 |
| 541 | Ga0495582_0011728 | 3300046473 | Bacteria | 4830 |
| 542 | Ga0495605_0033157 | 3300046474 | Bacteria | 2624 |
| 543 | Ga0495639_0041542 | 3300046475 | Bacteria | 2071 |
| 544 | Ga0495662_0008327 | 3300046476 | Bacteria | 5099 |
| 545 | Ga0495664_0014023 | 3300046477 | Bacteria | 4540 |
| 546 | Ga0495664_0032905 | 3300046477 | Bacteria | 3045 |
| 547 | Ga0495594_0080736 | 3300046499 | Unclassified | 1815 |
| 548 | Ga0495608_0008056 | 3300046511 | Bacteria | 7405 |
| 549 | Ga0495618_0007287 | 3300046514 | Bacteria | 6694 |
| 550 | Ga0495618_0038175 | 3300046514 | Bacteria | 3017 |
| 551 | Ga0495628_0004433 | 3300046516 | Bacteria | 12452 |
| 552 | Ga0495628_0074254 | 3300046516 | Bacteria | 2649 |
| 553 | Ga0495630_0032173 | 3300046517 | Bacteria | 3907 |
| 554 | Ga0495630_0169219 | 3300046517 | Unclassified | 1664 |
| 555 | Ga0495652_0003050 | 3300046529 | Bacteria | 16791 |
| 556 | Ga0495652_0013600 | 3300046529 | Bacteria | 7325 |
| 557 | Ga0495652_0042670 | 3300046529 | Bacteria | 3910 |
| 558 | Ga0495652_0239581 | 3300046529 | Bacteria | 1351 |
| 559 | Ga0495640_0024383 | 3300046533 | Bacteria | 4402 |
| 560 | Ga0495640_0072843 | 3300046533 | Bacteria | 2300 |
| 561 | Ga0495587_0004793 | 3300046536 | Bacteria | 8882 |
| 562 | Ga0495587_0027469 | 3300046536 | Bacteria | 3465 |
| 563 | Ga0495598_0001166 | 3300046537 | Bacteria | 5078 |
| 564 | Ga0495645_0000362 | 3300046543 | Bacteria | 31574 |
| 565 | Ga0495667_0008809 | 3300046559 | Bacteria | 6861 |
| 566 | Ga0495667_0043814 | 3300046559 | Bacteria | 2964 |
| 567 | Ga0495656_0128624 | 3300046615 | Bacteria | 1203 |
| 568 | Ga0495634_0043895 | 3300046642 | Bacteria | 3028 |
| 569 | Ga0495635_0018844 | 3300046663 | Bacteria | 4817 |
| 570 | Ga0495635_0023357 | 3300046663 | Bacteria | 4310 |
| 571 | Ga0495635_0079835 | 3300046663 | Bacteria | 2239 |
| 572 | Ga0495588_0027130 | 3300046674 | Bacteria | 2862 |
| 573 | Ga0495657_0005082 | 3300046675 | Bacteria | 10450 |
| 574 | Ga0495657_0026388 | 3300046675 | Bacteria | 4113 |
| 575 | Ga0495599_0055185 | 3300046678 | Bacteria | 2488 |
| 576 | Ga0495599_0061128 | 3300046678 | Bacteria | 2354 |
| 577 | Ga0495599_0103831 | 3300046678 | Bacteria | 1771 |
| 578 | Ga0495623_0042547 | 3300046679 | Bacteria | 2893 |
| 579 | Ga0495646_0095916 | 3300046680 | Bacteria | 1706 |
| 580 | Ga0495646_0115692 | 3300046680 | Bacteria | 1522 |
| 581 | Ga0495647_0057327 | 3300046681 | Bacteria | 1529 |
| 582 | Ga0495647_0098963 | 3300046681 | Bacteria | 1205 |
| 583 | Ga0495658_0056265 | 3300046683 | Bacteria | 2242 |
| 584 | Ga0495669_0009448 | 3300046684 | Bacteria | 4113 |
| 585 | Ga0495624_0035632 | 3300046690 | Bacteria | 3212 |
| 586 | Ga0495600_0002228 | 3300046809 | Bacteria | 11036 |
| 587 | Ga0495604_0002960 | 3300047317 | Bacteria | 13601 |
| 588 | Ga0495604_0094303 | 3300047317 | Bacteria | 2213 |
| 589 | Ga0495604_0146254 | 3300047317 | Bacteria | 1684 |
| 590 | Ga0495674_0020696 | 3300047319 | Bacteria | 6092 |
| 591 | Ga0495674_0053171 | 3300047319 | Bacteria | 3561 |
| 592 | Ga0495676_0058839 | 3300047321 | Bacteria | 3021 |
| 593 | Ga0495680_0008230 | 3300047322 | Bacteria | 9499 |
| 594 | Ga0495680_0033364 | 3300047322 | Bacteria | 4169 |
| 595 | Ga0495675_0012940 | 3300047444 | Bacteria | 5259 |
| 596 | Ga0495675_0085333 | 3300047444 | Bacteria | 1985 |
| 597 | Ga0495675_0117824 | 3300047444 | Bacteria | 1655 |
| 598 | Ga0495677_0122042 | 3300047445 | Bacteria | 994 |
| 599 | Ga0495685_026971 | 3300047447 | Bacteria | 1976 |
| 600 | Ga0495681_0139167 | 3300047470 | Bacteria | 1027 |
| 601 | Ga0495684_0154548 | 3300047471 | Bacteria | 1714 |
| 602 | Ga0495593_0149527 | 3300047673 | Bacteria | 1181 |
| 603 | Ga0495593_0162320 | 3300047673 | Bacteria | 1128 |
| 604 | Ga0495602_0003618 | 3300048088 | Bacteria | 16007 |
| 605 | Ga0495602_0012504 | 3300048088 | Bacteria | 8717 |
| 606 | Ga0495602_0094183 | 3300048088 | Bacteria | 2476 |
| 607 | Ga0495615_0019781 | 3300048090 | Bacteria | 1499 |
| 608 | Ga0496100_0029999 | 3300048903 | Bacteria | 3369 |
| 609 | Ga0496100_0096611 | 3300048903 | Bacteria | 2027 |
| 610 | Ga0496100_0177586 | 3300048903 | Bacteria | 1538 |
| 611 | Ga0496100_0299312 | 3300048903 | Bacteria | 1204 |
| 612 | Ga0496101_0018116 | 3300048904 | Bacteria | 4782 |
| 613 | Ga0496101_0025685 | 3300048904 | Bacteria | 4088 |
| 614 | Ga0496102_0008005 | 3300048905 | Bacteria | 9033 |
| 615 | Ga0496102_0010790 | 3300048905 | Bacteria | 7868 |
| 616 | Ga0496102_0058812 | 3300048905 | Bacteria | 3513 |
| 617 | Ga0496102_0116302 | 3300048905 | Bacteria | 2495 |
| 618 | Ga0496102_0152153 | 3300048905 | Bacteria | 2174 |
| 619 | Ga0496102_0329100 | 3300048905 | Bacteria | 1439 |
| 620 | Ga0496103_0016769 | 3300048906 | Bacteria | 4375 |
| 621 | Ga0496103_0016949 | 3300048906 | Bacteria | 4352 |
| 622 | Ga0496103_0058138 | 3300048906 | Bacteria | 2402 |
| 623 | Ga0496104_0000827 | 3300048907 | Bacteria | 26682 |
| 624 | Ga0496104_0003340 | 3300048907 | Bacteria | 13851 |
| 625 | Ga0496104_0008871 | 3300048907 | Bacteria | 8938 |
| 626 | Ga0496104_0082139 | 3300048907 | Bacteria | 3073 |
| 627 | Ga0496104_0331835 | 3300048907 | Bacteria | 1434 |
| 628 | Ga0496105_0002816 | 3300048908 | Bacteria | 12715 |
| 629 | Ga0496105_0004588 | 3300048908 | Bacteria | 10405 |
| 630 | Ga0496106_0000691 | 3300048909 | Bacteria | 24224 |
| 631 | Ga0496106_0039341 | 3300048909 | Bacteria | 3541 |
| 632 | Ga0496106_0047139 | 3300048909 | Bacteria | 3242 |
| 633 | Ga0496106_0084989 | 3300048909 | Bacteria | 2435 |
| 634 | Ga0496107_0004871 | 3300048910 | Bacteria | 9120 |
| 635 | Ga0496107_0051145 | 3300048910 | Bacteria | 2979 |
| 636 | Ga0496107_0061808 | 3300048910 | Bacteria | 2712 |
| 637 | Ga0496108_0007809 | 3300048911 | Bacteria | 8668 |
| 638 | Ga0496108_0028673 | 3300048911 | Bacteria | 4606 |
| 639 | Ga0496108_0087996 | 3300048911 | Bacteria | 2639 |
| 640 | Ga0496108_0151059 | 3300048911 | Bacteria | 2004 |
| 641 | Ga0496108_0228304 | 3300048911 | Bacteria | 1618 |
| 642 | Ga0496108_0334005 | 3300048911 | Bacteria | 1322 |
| 643 | Ga0496109_0007061 | 3300048912 | Bacteria | 9476 |
| 644 | Ga0496109_0020039 | 3300048912 | Bacteria | 5906 |
| 645 | Ga0496109_0037747 | 3300048912 | Bacteria | 4365 |
| 646 | Ga0496109_0322353 | 3300048912 | Bacteria | 1458 |
| 647 | Ga0496110_0023803 | 3300048913 | Bacteria | 5212 |
| 648 | Ga0496110_0061326 | 3300048913 | Bacteria | 3319 |
| 649 | Ga0496110_0091910 | 3300048913 | Bacteria | 2715 |
| 650 | Ga0496110_0105732 | 3300048913 | Bacteria | 2525 |
| 651 | Ga0496110_0295722 | 3300048913 | Bacteria | 1475 |
| 652 | Ga0496110_0356901 | 3300048913 | Bacteria | 1332 |
| 653 | Ga0496111_0005954 | 3300048914 | Bacteria | 7867 |
| 654 | Ga0496111_0168288 | 3300048914 | Bacteria | 1628 |
| 655 | Ga0496111_0241384 | 3300048914 | Bacteria | 1342 |
| 656 | Ga0496112_0070199 | 3300048915 | Bacteria | 3462 |
| 657 | Ga0496112_0133992 | 3300048915 | Bacteria | 2448 |
| 658 | Ga0496112_0176317 | 3300048915 | Bacteria | 2102 |
| 659 | Ga0496112_0367973 | 3300048915 | Bacteria | 1379 |
| 660 | Ga0496113_0006670 | 3300048916 | Bacteria | 7345 |
| 661 | Ga0496113_0060134 | 3300048916 | Bacteria | 2863 |
| 662 | Ga0496113_0234602 | 3300048916 | Bacteria | 1463 |
| 663 | Ga0496114_0007484 | 3300048917 | Bacteria | 8632 |
| 664 | Ga0496114_0070788 | 3300048917 | Bacteria | 2930 |
| 665 | Ga0496114_0197915 | 3300048917 | Bacteria | 1759 |
| 666 | Ga0496115_0003882 | 3300048918 | Bacteria | 10775 |
| 667 | Ga0496115_0056660 | 3300048918 | Bacteria | 3150 |
| 668 | Ga0496115_0058141 | 3300048918 | Bacteria | 3111 |
| 669 | Ga0501031_0012832 | 3300049568 | Bacteria | 5474 |
| 670 | Ga0501031_0015920 | 3300049568 | Bacteria | 4882 |
| 671 | Ga0501032_0079651 | 3300049569 | Bacteria | 2181 |
| 672 | Ga0501033_0009055 | 3300049570 | Bacteria | 7680 |
| 673 | Ga0501033_0019159 | 3300049570 | Bacteria | 5174 |
| 674 | Ga0501033_0043734 | 3300049570 | Bacteria | 3335 |
| 675 | Ga0501034_0000319 | 3300049571 | Bacteria | 84488 |
| 676 | Ga0501034_0006473 | 3300049571 | Bacteria | 12613 |
| 677 | Ga0501034_0042869 | 3300049571 | Bacteria | 4580 |
| 678 | Ga0501034_0073408 | 3300049571 | Bacteria | 3430 |
| 679 | Ga0501034_0099042 | 3300049571 | Bacteria | 2910 |
| 680 | Ga0501034_0178057 | 3300049571 | Bacteria | 2092 |
| 681 | Ga0501036_0019093 | 3300049572 | Bacteria | 5752 |
| 682 | Ga0501036_0200179 | 3300049572 | Bacteria | 1680 |
| 683 | Ga0501038_0008825 | 3300049574 | Bacteria | 9247 |
| 684 | Ga0501038_0074431 | 3300049574 | Bacteria | 2873 |
| 685 | Ga0501038_0123920 | 3300049574 | Bacteria | 2128 |
| 686 | Ga0501038_0151507 | 3300049574 | Bacteria | 1890 |
| 687 | Ga0501039_0010144 | 3300049575 | Bacteria | 7177 |
| 688 | Ga0501039_0145115 | 3300049575 | Bacteria | 1865 |
| 689 | Ga0501039_0244502 | 3300049575 | Bacteria | 1411 |
| 690 | Ga0501040_0094811 | 3300049576 | Bacteria | 2077 |
| 691 | Ga0501042_0066804 | 3300049578 | Bacteria | 2571 |
| 692 | Ga0501042_0124335 | 3300049578 | Bacteria | 1857 |
| 693 | Ga0501046_0061644 | 3300049580 | Bacteria | 2931 |
| 694 | Ga0501046_0067556 | 3300049580 | Bacteria | 2784 |
| 695 | Ga0501047_0004229 | 3300049581 | Bacteria | 13514 |
| 696 | Ga0501047_0032947 | 3300049581 | Bacteria | 5003 |
| 697 | Ga0501047_0065145 | 3300049581 | Bacteria | 3513 |
| 698 | Ga0501047_0071043 | 3300049581 | Bacteria | 3351 |
| 699 | Ga0501047_0243430 | 3300049581 | Bacteria | 1648 |
| 700 | Ga0501048_0019705 | 3300049582 | Bacteria | 4947 |
| 701 | Ga0501067_0020479 | 3300049583 | Bacteria | 3661 |
| 702 | Ga0501067_0043246 | 3300049583 | Bacteria | 2501 |
| 703 | Ga0501068_0012758 | 3300049584 | Bacteria | 4772 |
| 704 | Ga0501068_0147326 | 3300049584 | Bacteria | 1478 |
| 705 | Ga0501069_0002514 | 3300049585 | Bacteria | 9362 |
| 706 | Ga0501069_0010152 | 3300049585 | Bacteria | 4981 |
| 707 | Ga0501069_0015088 | 3300049585 | Bacteria | 4139 |
| 708 | Ga0501069_0037545 | 3300049585 | Bacteria | 2673 |
| 709 | Ga0501069_0117473 | 3300049585 | Bacteria | 1518 |
| 710 | Ga0501070_0007456 | 3300049586 | Bacteria | 9293 |
| 711 | Ga0501070_0020970 | 3300049586 | Bacteria | 5481 |
| 712 | Ga0501070_0028420 | 3300049586 | Bacteria | 4690 |
| 713 | Ga0501070_0059878 | 3300049586 | Bacteria | 3156 |
| 714 | Ga0501071_0018829 | 3300049587 | Bacteria | 4787 |
| 715 | Ga0501071_0167455 | 3300049587 | Bacteria | 1645 |
| 716 | Ga0501072_0026931 | 3300049588 | Bacteria | 4486 |
| 717 | Ga0501072_0076081 | 3300049588 | Bacteria | 2656 |
| 718 | Ga0501072_0139840 | 3300049588 | Bacteria | 1930 |
| 719 | Ga0501072_0268011 | 3300049588 | Bacteria | 1359 |
| 720 | Ga0501072_0393328 | 3300049588 | Bacteria | 1100 |
| 721 | Ga0501073_0010312 | 3300049589 | Bacteria | 6858 |
| 722 | Ga0501073_0012418 | 3300049589 | Bacteria | 6216 |
| 723 | Ga0501073_0066027 | 3300049589 | Bacteria | 2522 |
| 724 | Ga0501074_0007397 | 3300049590 | Bacteria | 7942 |
| 725 | Ga0501074_0028981 | 3300049590 | Bacteria | 4010 |
| 726 | Ga0501075_0092049 | 3300049591 | Bacteria | 2301 |
| 727 | Ga0501075_0101143 | 3300049591 | Bacteria | 2189 |
| 728 | Ga0501075_0296529 | 3300049591 | Bacteria | 1232 |
| 729 | Ga0501076_0181826 | 3300049592 | Bacteria | 1714 |
| 730 | Ga0501076_0289733 | 3300049592 | Bacteria | 1341 |
| 731 | Ga0501077_0010632 | 3300049593 | Bacteria | 5731 |
| 732 | Ga0501077_0155522 | 3300049593 | Bacteria | 1451 |
| 733 | Ga0501077_0227813 | 3300049593 | Bacteria | 1185 |
| 734 | Ga0501079_0030249 | 3300049741 | Bacteria | 4161 |
| 735 | Ga0501079_0046847 | 3300049741 | Bacteria | 3336 |
| 736 | Ga0501079_0228077 | 3300049741 | Bacteria | 1455 |
| 737 | Ga0501079_0305614 | 3300049741 | Bacteria | 1244 |
| 738 | Ga0501079_0377270 | 3300049741 | Unclassified | 1112 |
| 739 | Ga0501079_0600855 | 3300049741 | Bacteria | 866 |
| 740 | Ga0501080_0030118 | 3300049742 | Bacteria | 5055 |
| 741 | Ga0501080_0120725 | 3300049742 | Bacteria | 2429 |
| 742 | Ga0501080_0184895 | 3300049742 | Bacteria | 1916 |
| 743 | Ga0501083_0031289 | 3300049744 | Bacteria | 3653 |
| 744 | Ga0501083_0149539 | 3300049744 | Bacteria | 1529 |
| 745 | Ga0501035_0001744 | 3300049822 | Bacteria | 21967 |
| 746 | Ga0501035_0387870 | 3300049822 | Bacteria | 1164 |
| 747 | Ga0501035_0413721 | 3300049822 | Bacteria | 1120 |
| 748 | Ga0501044_0000243 | 3300049823 | Bacteria | 68966 |
| 749 | Ga0501044_0025222 | 3300049823 | Bacteria | 6304 |
| 750 | Ga0501044_0033688 | 3300049823 | Bacteria | 5380 |
| 751 | Ga0501044_0255750 | 3300049823 | Bacteria | 1691 |
| 752 | Ga0501044_0420061 | 3300049823 | Bacteria | 1247 |
| 753 | Ga0501045_0133890 | 3300049824 | Bacteria | 1843 |
| 754 | nmdc:mga03683_16047_c1 | 3300050489 | Bacteria | 2806 |
| 755 | nmdc:mga03683_18029_c1 | 3300050489 | Bacteria | 2679 |
| 756 | nmdc:mga03683_55912_c1 | 3300050489 | Bacteria | 1658 |
| 757 | nmdc:mga00v17_193875_c1 | 3300050491 | Bacteria | 1313 |
| 758 | nmdc:mga0yw44_238713_c1 | 3300050492 | Bacteria | 1208 |
| 759 | nmdc:mga0k408_30511_c1 | 3300050493 | Bacteria | 3074 |
| 760 | nmdc:mga0k408_6984_c1 | 3300050493 | Bacteria | 5398 |
| 761 | nmdc:mga06z11_23082_c1 | 3300050494 | Bacteria | 2916 |
| 762 | nmdc:mga06z11_25944_c1 | 3300050494 | Bacteria | 2784 |
| 763 | nmdc:mga07m45_190474_c1 | 3300050496 | Bacteria | 1193 |
| 764 | nmdc:mga07m45_232941_c1 | 3300050496 | Bacteria | 1072 |
| 765 | nmdc:mga07m45_81689_c1 | 3300050496 | Bacteria | 1845 |
| 766 | nmdc:mga05p37_135088_c1 | 3300050507 | Bacteria | 3026 |
| 767 | nmdc:mga05p37_517672_c1 | 3300050507 | Bacteria | 1365 |
| 768 | nmdc:mga05p37_657760_c1 | 3300050507 | Bacteria | 1172 |
| 769 | nmdc:mga06r32_194571_c1 | 3300050510 | Bacteria | 2015 |
| 770 | nmdc:mga06r32_586727_c1 | 3300050510 | Bacteria | 1086 |
| 771 | nmdc:mga06r32_6250_c1 | 3300050510 | Bacteria | 10690 |
| 772 | nmdc:mga08y16_107681_c1 | 3300050511 | Bacteria | 2902 |
| 773 | nmdc:mga08y16_202474_c1 | 3300050511 | Bacteria | 2057 |
| 774 | nmdc:mga08y16_621396_c1 | 3300050511 | Bacteria | 1087 |
| 775 | nmdc:mga0n895_374977_c1 | 3300050512 | Bacteria | 1440 |
| 776 | nmdc:mga0n895_82205_c1 | 3300050512 | Bacteria | 3210 |
| 777 | nmdc:mga08x19_216209_c1 | 3300050514 | Bacteria | 1316 |
| 778 | nmdc:mga0a205_139884_c1 | 3300050515 | Bacteria | 2321 |
| 779 | nmdc:mga0sz30_3009_c1 | 3300050516 | Bacteria | 6043 |
| 780 | Ga0495601_0000520 | 3300053077 | Bacteria | 20314 |
| 781 | Ga0495601_0013675 | 3300053077 | Bacteria | 4881 |
| 782 | Ga0495601_0013873 | 3300053077 | Bacteria | 4851 |
| 783 | Ga0495601_0023318 | 3300053077 | Bacteria | 3802 |
| 784 | Ga0495601_0058824 | 3300053077 | Bacteria | 2436 |
| 785 | Ga0495601_0186908 | 3300053077 | Bacteria | 1354 |
| 786 | Ga0495612_0006426 | 3300053078 | Bacteria | 4831 |
| 787 | Ga0495612_0010707 | 3300053078 | Bacteria | 3705 |
| 788 | Ga0495612_0011713 | 3300053078 | Bacteria | 3534 |
| 789 | Ga0495655_0009033 | 3300053083 | Bacteria | 1917 |
| 790 | Ga0495595_0001335 | 3300053084 | Bacteria | 9585 |
| 791 | Ga0495595_0001933 | 3300053084 | Bacteria | 8041 |
| 792 | Ga0495595_0082279 | 3300053084 | Bacteria | 1535 |
| 793 | Ga0495619_0000888 | 3300053085 | Bacteria | 19654 |
| 794 | Ga0495619_0017366 | 3300053085 | Bacteria | 4556 |
| 795 | Ga0495619_0025991 | 3300053085 | Bacteria | 3763 |
| 796 | Ga0495619_0086273 | 3300053085 | Bacteria | 2121 |
| 797 | Ga0500643_005044 | 3300053087 | Bacteria | 5776 |
| 798 | Ga0500644_0000501 | 3300053088 | Bacteria | 16934 |
| 799 | Ga0500641_0000893 | 3300053096 | Bacteria | 10671 |
| 800 | Ga0500641_0031920 | 3300053096 | Bacteria | 2080 |
| 801 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 802 | Ga0500595_045320 | 3300053119 | Bacteria | 1389 |
| 803 | Ga0500597_050641 | 3300053120 | Bacteria | 1769 |
| 804 | Ga0500618_022359 | 3300053125 | Bacteria | 1537 |
| 805 | Ga0500652_011719 | 3300053131 | Bacteria | 3049 |
| 806 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 807 | Ga0500616_0066835 | 3300053153 | Bacteria | 1844 |
| 808 | Ga0500616_0073169 | 3300053153 | Bacteria | 1741 |
| 809 | Ga0500645_000050 | 3300053730 | Bacteria | 99596 |
| 810 | Ga0501084_0052522 | 3300054114 | Bacteria | 3410 |
| 811 | Ga0501082_0023544 | 3300060353 | Bacteria | 5313 |
| 812 | Ga0501082_0052919 | 3300060353 | Bacteria | 3500 |
| 813 | Ga0501082_0085209 | 3300060353 | Bacteria | 2726 |
| 814 | Ga0501082_0220619 | 3300060353 | Bacteria | 1650 |
| 815 | Ga0501082_0334218 | 3300060353 | Bacteria | 1320 |
| 816 | Ga0466962_0115012 | 3300061719 | Bacteria | 1296 |
| 817 | Ga0530510_0009146 | 3300061734 | Bacteria | 6941 |
| 818 | Ga0530510_0055716 | 3300061734 | Bacteria | 2856 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0341462 | Ga0395899_0341462_25_849 | 248 |
| 2 | 3300035171 | Ga0373946_0082989 | Ga0373946_0082989_614_1366 | 250 |
| 3 | 3300035692 | Ga0373935_0046414 | Ga0373935_0046414_1961_2713 | 250 |
| 4 | 3300036401 | Ga0373937_0653894 | Ga0373937_0653894_187_939 | 250 |
| 5 | 3300036712 | Ga0316584_0533536 | Ga0316584_0533536_49_804 | 250 |
| 6 | 3300039437 | Ga0436365_1497092 | Ga0436365_1497092_11_850 | 250 |
| 7 | 3300042439 | Ga0439464_0044445 | Ga0439464_0044445_482_1234 | 250 |
| 8 | 3300046517 | Ga0495630_0169219 | Ga0495630_0169219_41_793 | 250 |
| 9 | 3300047444 | Ga0495675_0085333 | Ga0495675_0085333_1210_1962 | 250 |
| 10 | 3300047445 | Ga0495677_0122042 | Ga0495677_0122042_228_980 | 250 |
| 11 | 3300049581 | Ga0501047_0065145 | Ga0501047_0065145_1401_2153 | 250 |
| 12 | 3300049588 | Ga0501072_0393328 | Ga0501072_0393328_289_1044 | 250 |
| 13 | 3300049592 | Ga0501076_0289733 | Ga0501076_0289733_543_1295 | 250 |
| 14 | 3300049741 | Ga0501079_0600855 | Ga0501079_0600855_47_799 | 250 |
| 15 | 3300005616 | Ga0068852_100045885 | Ga0068852_1000458852 | 254 |
| 16 | 3300025949 | Ga0207667_10135727 | Ga0207667_101357273 | 254 |
| 17 | 3300026142 | Ga0207698_10102424 | Ga0207698_101024242 | 254 |
| 18 | 3300035692 | Ga0373935_0559082 | Ga0373935_0559082_44_823 | 255 |
| 19 | 3300047317 | Ga0495604_0146254 | Ga0495604_0146254_222_1103 | 255 |
| 20 | 3300025907 | Ga0207645_10112775 | Ga0207645_101127752 | 256 |
| 21 | 3300013104 | Ga0157370_10094886 | Ga0157370_100948863 | 259 |
| 22 | 3300039437 | Ga0436365_0940061 | Ga0436365_0940061_10692_11588 | 262 |
| 23 | 3300026121 | Ga0207683_10288703 | Ga0207683_102887032 | 266 |
| 24 | 3300005336 | Ga0070680_100295800 | Ga0070680_1002958002 | 267 |
| 25 | 3300013307 | Ga0157372_10280924 | Ga0157372_102809242 | 267 |
| 26 | 3300037312 | Ga0395899_0089309 | Ga0395899_0089309_407_1288 | 267 |
| 27 | 3300037418 | Ga0395900_0016731 | Ga0395900_0016731_5607_6488 | 267 |
| 28 | 3300037466 | Ga0395898_0012187 | Ga0395898_0012187_7049_7930 | 267 |
| 29 | 3300038443 | Ga0395901_0153652 | Ga0395901_0153652_969_1850 | 267 |
| 30 | 3300038443 | Ga0395901_0449982 | Ga0395901_0449982_202_1167 | 267 |
| 31 | 3300044694 | Ga0466963_0097736 | Ga0466963_0097736_261_1136 | 267 |
| 32 | 3300044842 | Ga0466957_0020555 | Ga0466957_0020555_2293_3168 | 267 |
| 33 | 3300045836 | Ga0466958_0040706 | Ga0466958_0040706_1624_2499 | 267 |
| 34 | 3300044694 | Ga0466963_0028079 | Ga0466963_0028079_695_1624 | 269 |
| 35 | 3300045976 | Ga0466967_0034563 | Ga0466967_0034563_3310_4239 | 269 |
| 36 | 3300048903 | Ga0496100_0029999 | Ga0496100_0029999_1610_2491 | 269 |
| 37 | 3300005530 | Ga0070679_100217549 | Ga0070679_1002175493 | 270 |
| 38 | 3300009093 | Ga0105240_10018034 | Ga0105240_1001803411 | 270 |
| 39 | 3300013102 | Ga0157371_10065389 | Ga0157371_100653892 | 270 |
| 40 | 3300020082 | Ga0206353_11753873 | Ga0206353_117538731 | 270 |
| 41 | 3300025912 | Ga0207707_10004337 | Ga0207707_100043378 | 270 |
| 42 | 3300025921 | Ga0207652_10015347 | Ga0207652_100153473 | 270 |
| 43 | 3300053730 | Ga0500645_000050 | Ga0500645_000050_32855_33715 | 270 |
| 44 | 3300025913 | Ga0207695_10220917 | Ga0207695_102209172 | 274 |
| 45 | 3300036401 | Ga0373937_0391092 | Ga0373937_0391092_480_1304 | 274 |
| 46 | 3300045049 | Ga0466959_0366817 | Ga0466959_0366817_136_960 | 274 |
| 47 | 3300049593 | Ga0501077_0227813 | Ga0501077_0227813_14_838 | 274 |
| 48 | 3300049741 | Ga0501079_0228077 | Ga0501079_0228077_22_849 | 274 |
| 49 | 3300053119 | Ga0500595_045320 | Ga0500595_045320_549_1373 | 274 |
| 50 | 3300061719 | Ga0466962_0115012 | Ga0466962_0115012_11_835 | 274 |
| 51 | 3300037418 | Ga0395900_0049091 | Ga0395900_0049091_1031_1912 | 276 |
| 52 | 3300037466 | Ga0395898_0006493 | Ga0395898_0006493_10786_11667 | 276 |
| 53 | 3300038443 | Ga0395901_0076786 | Ga0395901_0076786_56_937 | 276 |
| 54 | 3300035114 | Ga0373939_0026565 | Ga0373939_0026565_260_1141 | 278 |
| 55 | 3300046460 | Ga0495638_0174943 | Ga0495638_0174943_294_1175 | 280 |
| 56 | 3300031235 | Ga0265330_10022924 | Ga0265330_100229243 | 282 |
| 57 | 3300005328 | Ga0070676_10064937 | Ga0070676_100649372 | 283 |
| 58 | 3300005330 | Ga0070690_100009488 | Ga0070690_1000094885 | 283 |
| 59 | 3300005355 | Ga0070671_100109517 | Ga0070671_1001095173 | 283 |
| 60 | 3300005364 | Ga0070673_100074134 | Ga0070673_1000741343 | 283 |
| 61 | 3300005434 | Ga0070709_10015619 | Ga0070709_100156193 | 283 |
| 62 | 3300005436 | Ga0070713_100009134 | Ga0070713_1000091344 | 283 |
| 63 | 3300005466 | Ga0070685_10064762 | Ga0070685_100647622 | 283 |
| 64 | 3300005535 | Ga0070684_100277916 | Ga0070684_1002779162 | 283 |
| 65 | 3300005543 | Ga0070672_100225401 | Ga0070672_1002254012 | 283 |
| 66 | 3300005548 | Ga0070665_100515242 | Ga0070665_1005152422 | 283 |
| 67 | 3300005617 | Ga0068859_100048711 | Ga0068859_1000487115 | 283 |
| 68 | 3300005719 | Ga0068861_100186890 | Ga0068861_1001868902 | 283 |
| 69 | 3300005843 | Ga0068860_100058980 | Ga0068860_1000589802 | 283 |
| 70 | 3300006931 | Ga0097620_100048710 | Ga0097620_1000487102 | 283 |
| 71 | 3300009092 | Ga0105250_10025315 | Ga0105250_100253154 | 283 |
| 72 | 3300009093 | Ga0105240_10037984 | Ga0105240_100379845 | 283 |
| 73 | 3300009093 | Ga0105240_10096089 | Ga0105240_100960894 | 283 |
| 74 | 3300009094 | Ga0111539_10118849 | Ga0111539_101188494 | 283 |
| 75 | 3300009098 | Ga0105245_10005456 | Ga0105245_100054562 | 283 |
| 76 | 3300009101 | Ga0105247_10010633 | Ga0105247_100106333 | 283 |
| 77 | 3300009101 | Ga0105247_10022193 | Ga0105247_100221934 | 283 |
| 78 | 3300009101 | Ga0105247_10177358 | Ga0105247_101773582 | 283 |
| 79 | 3300009148 | Ga0105243_10017609 | Ga0105243_100176095 | 283 |
| 80 | 3300009148 | Ga0105243_10062943 | Ga0105243_100629434 | 283 |
| 81 | 3300009174 | Ga0105241_10023596 | Ga0105241_100235963 | 283 |
| 82 | 3300009176 | Ga0105242_10114216 | Ga0105242_101142163 | 283 |
| 83 | 3300009176 | Ga0105242_10387107 | Ga0105242_103871071 | 283 |
| 84 | 3300009177 | Ga0105248_10001504 | Ga0105248_1000150425 | 283 |
| 85 | 3300009177 | Ga0105248_10035902 | Ga0105248_100359022 | 283 |
| 86 | 3300009177 | Ga0105248_10071786 | Ga0105248_100717864 | 283 |
| 87 | 3300009545 | Ga0105237_10065342 | Ga0105237_100653423 | 283 |
| 88 | 3300009551 | Ga0105238_10005215 | Ga0105238_100052156 | 283 |
| 89 | 3300010375 | Ga0105239_10347400 | Ga0105239_103474002 | 283 |
| 90 | 3300013100 | Ga0157373_10045521 | Ga0157373_100455214 | 283 |
| 91 | 3300013102 | Ga0157371_10025553 | Ga0157371_100255532 | 283 |
| 92 | 3300013105 | Ga0157369_10538050 | Ga0157369_105380501 | 283 |
| 93 | 3300013296 | Ga0157374_10018784 | Ga0157374_100187848 | 283 |
| 94 | 3300013306 | Ga0163162_10062793 | Ga0163162_100627932 | 283 |
| 95 | 3300013307 | Ga0157372_10014878 | Ga0157372_100148785 | 283 |
| 96 | 3300013308 | Ga0157375_10070481 | Ga0157375_100704814 | 283 |
| 97 | 3300013308 | Ga0157375_10306592 | Ga0157375_103065922 | 283 |
| 98 | 3300014325 | Ga0163163_10041560 | Ga0163163_100415605 | 283 |
| 99 | 3300014325 | Ga0163163_10083757 | Ga0163163_100837572 | 283 |
| 100 | 3300014326 | Ga0157380_10247840 | Ga0157380_102478402 | 283 |
| 101 | 3300014745 | Ga0157377_10010239 | Ga0157377_100102393 | 283 |
| 102 | 3300014968 | Ga0157379_10049595 | Ga0157379_100495953 | 283 |
| 103 | 3300014969 | Ga0157376_10002979 | Ga0157376_1000297912 | 283 |
| 104 | 3300017792 | Ga0163161_10220971 | Ga0163161_102209712 | 283 |
| 105 | 3300025297 | Ga0209758_1000428 | Ga0209758_100042866 | 283 |
| 106 | 3300025315 | Ga0207697_10019741 | Ga0207697_100197413 | 283 |
| 107 | 3300025901 | Ga0207688_10291995 | Ga0207688_102919951 | 283 |
| 108 | 3300025907 | Ga0207645_10085916 | Ga0207645_100859163 | 283 |
| 109 | 3300025927 | Ga0207687_10297796 | Ga0207687_102977962 | 283 |
| 110 | 3300025934 | Ga0207686_10215374 | Ga0207686_102153742 | 283 |
| 111 | 3300025935 | Ga0207709_10052962 | Ga0207709_100529622 | 283 |
| 112 | 3300025936 | Ga0207670_10002470 | Ga0207670_100024705 | 283 |
| 113 | 3300025940 | Ga0207691_10230051 | Ga0207691_102300512 | 283 |
| 114 | 3300025941 | Ga0207711_10103861 | Ga0207711_101038612 | 283 |
| 115 | 3300025960 | Ga0207651_10050097 | Ga0207651_100500973 | 283 |
| 116 | 3300026095 | Ga0207676_10063875 | Ga0207676_100638752 | 283 |
| 117 | 3300026118 | Ga0207675_100075881 | Ga0207675_1000758813 | 283 |
| 118 | 3300028380 | Ga0268265_10154089 | Ga0268265_101540892 | 283 |
| 119 | 3300031241 | Ga0265325_10018972 | Ga0265325_100189723 | 283 |
| 120 | 3300031241 | Ga0265325_10048143 | Ga0265325_100481432 | 283 |
| 121 | 3300031344 | Ga0265316_10009607 | Ga0265316_100096072 | 283 |
| 122 | 3300034816 | Ga0373930_0005799 | Ga0373930_0005799_499_1365 | 283 |
| 123 | 3300034957 | Ga0373938_0003020 | Ga0373938_0003020_1475_2326 | 283 |
| 124 | 3300035084 | Ga0373928_0031699 | Ga0373928_0031699_277_1128 | 283 |
| 125 | 3300035090 | Ga0373949_0005787 | Ga0373949_0005787_340_1191 | 283 |
| 126 | 3300035092 | Ga0373952_0004789 | Ga0373952_0004789_1493_2344 | 283 |
| 127 | 3300035092 | Ga0373952_0014494 | Ga0373952_0014494_337_1191 | 283 |
| 128 | 3300035092 | Ga0373952_0031509 | Ga0373952_0031509_272_1138 | 283 |
| 129 | 3300035115 | Ga0373941_0007639 | Ga0373941_0007639_601_1452 | 283 |
| 130 | 3300035118 | Ga0373954_0133203 | Ga0373954_0133203_98_949 | 283 |
| 131 | 3300035171 | Ga0373946_0074127 | Ga0373946_0074127_478_1344 | 283 |
| 132 | 3300035207 | Ga0373942_0039300 | Ga0373942_0039300_134_985 | 283 |
| 133 | 3300035242 | Ga0373962_0002525 | Ga0373962_0002525_1868_2719 | 283 |
| 134 | 3300035691 | Ga0373931_0003778 | Ga0373931_0003778_2219_3085 | 283 |
| 135 | 3300035691 | Ga0373931_0024303 | Ga0373931_0024303_1807_2658 | 283 |
| 136 | 3300035691 | Ga0373931_0165701 | Ga0373931_0165701_313_1179 | 283 |
| 137 | 3300037068 | Ga0373925_0134357 | Ga0373925_0134357_1069_1920 | 283 |
| 138 | 3300039437 | Ga0436365_1063276 | Ga0436365_1063276_751_1602 | 283 |
| 139 | 3300041408 | Ga0439453_0002540 | Ga0439453_0002540_878_1729 | 283 |
| 140 | 3300042008 | Ga0439450_040575 | Ga0439450_040575_38_889 | 283 |
| 141 | 3300042016 | Ga0439463_019687 | Ga0439463_019687_38_889 | 283 |
| 142 | 3300042461 | Ga0439460_0034896 | Ga0439460_0034896_44_895 | 283 |
| 143 | 3300046460 | Ga0495638_0093024 | Ga0495638_0093024_359_1210 | 283 |
| 144 | 3300046516 | Ga0495628_0074254 | Ga0495628_0074254_715_1581 | 283 |
| 145 | 3300046529 | Ga0495652_0239581 | Ga0495652_0239581_324_1190 | 283 |
| 146 | 3300046680 | Ga0495646_0095916 | Ga0495646_0095916_56_922 | 283 |
| 147 | 3300046684 | Ga0495669_0009448 | Ga0495669_0009448_1262_2113 | 283 |
| 148 | 3300047470 | Ga0495681_0139167 | Ga0495681_0139167_145_996 | 283 |
| 149 | 3300048903 | Ga0496100_0096611 | Ga0496100_0096611_495_1346 | 283 |
| 150 | 3300048904 | Ga0496101_0025685 | Ga0496101_0025685_2695_3561 | 283 |
| 151 | 3300048905 | Ga0496102_0010790 | Ga0496102_0010790_4474_5340 | 283 |
| 152 | 3300048905 | Ga0496102_0152153 | Ga0496102_0152153_494_1345 | 283 |
| 153 | 3300048906 | Ga0496103_0016769 | Ga0496103_0016769_77_943 | 283 |
| 154 | 3300048907 | Ga0496104_0003340 | Ga0496104_0003340_11322_12188 | 283 |
| 155 | 3300048907 | Ga0496104_0082139 | Ga0496104_0082139_1583_2434 | 283 |
| 156 | 3300048907 | Ga0496104_0331835 | Ga0496104_0331835_251_1102 | 283 |
| 157 | 3300048908 | Ga0496105_0004588 | Ga0496105_0004588_8473_9339 | 283 |
| 158 | 3300048909 | Ga0496106_0039341 | Ga0496106_0039341_752_1603 | 283 |
| 159 | 3300048910 | Ga0496107_0004871 | Ga0496107_0004871_5667_6533 | 283 |
| 160 | 3300048911 | Ga0496108_0007809 | Ga0496108_0007809_6195_7046 | 283 |
| 161 | 3300048911 | Ga0496108_0028673 | Ga0496108_0028673_2296_3162 | 283 |
| 162 | 3300048911 | Ga0496108_0151059 | Ga0496108_0151059_326_1192 | 283 |
| 163 | 3300048911 | Ga0496108_0228304 | Ga0496108_0228304_399_1250 | 283 |
| 164 | 3300048912 | Ga0496109_0007061 | Ga0496109_0007061_6501_7367 | 283 |
| 165 | 3300048912 | Ga0496109_0020039 | Ga0496109_0020039_4139_4990 | 283 |
| 166 | 3300048912 | Ga0496109_0037747 | Ga0496109_0037747_172_1023 | 283 |
| 167 | 3300048913 | Ga0496110_0023803 | Ga0496110_0023803_259_1110 | 283 |
| 168 | 3300048913 | Ga0496110_0091910 | Ga0496110_0091910_741_1592 | 283 |
| 169 | 3300048913 | Ga0496110_0105732 | Ga0496110_0105732_884_1750 | 283 |
| 170 | 3300048914 | Ga0496111_0005954 | Ga0496111_0005954_2722_3588 | 283 |
| 171 | 3300048914 | Ga0496111_0168288 | Ga0496111_0168288_688_1539 | 283 |
| 172 | 3300048915 | Ga0496112_0133992 | Ga0496112_0133992_845_1711 | 283 |
| 173 | 3300048915 | Ga0496112_0176317 | Ga0496112_0176317_91_957 | 283 |
| 174 | 3300048915 | Ga0496112_0367973 | Ga0496112_0367973_333_1184 | 283 |
| 175 | 3300048916 | Ga0496113_0006670 | Ga0496113_0006670_2579_3430 | 283 |
| 176 | 3300048916 | Ga0496113_0060134 | Ga0496113_0060134_1804_2670 | 283 |
| 177 | 3300048916 | Ga0496113_0234602 | Ga0496113_0234602_183_1049 | 283 |
| 178 | 3300048917 | Ga0496114_0007484 | Ga0496114_0007484_2654_3520 | 283 |
| 179 | 3300048918 | Ga0496115_0003882 | Ga0496115_0003882_2545_3411 | 283 |
| 180 | 3300049568 | Ga0501031_0012832 | Ga0501031_0012832_2564_3415 | 283 |
| 181 | 3300049570 | Ga0501033_0019159 | Ga0501033_0019159_3917_4768 | 283 |
| 182 | 3300049571 | Ga0501034_0042869 | Ga0501034_0042869_426_1277 | 283 |
| 183 | 3300049571 | Ga0501034_0099042 | Ga0501034_0099042_1002_1853 | 283 |
| 184 | 3300049572 | Ga0501036_0019093 | Ga0501036_0019093_2732_3583 | 283 |
| 185 | 3300049574 | Ga0501038_0008825 | Ga0501038_0008825_4518_5369 | 283 |
| 186 | 3300049574 | Ga0501038_0151507 | Ga0501038_0151507_719_1570 | 283 |
| 187 | 3300049575 | Ga0501039_0010144 | Ga0501039_0010144_2657_3508 | 283 |
| 188 | 3300049576 | Ga0501040_0094811 | Ga0501040_0094811_23_877 | 283 |
| 189 | 3300049578 | Ga0501042_0066804 | Ga0501042_0066804_780_1631 | 283 |
| 190 | 3300049580 | Ga0501046_0061644 | Ga0501046_0061644_60_911 | 283 |
| 191 | 3300049582 | Ga0501048_0019705 | Ga0501048_0019705_1599_2450 | 283 |
| 192 | 3300049583 | Ga0501067_0020479 | Ga0501067_0020479_1680_2531 | 283 |
| 193 | 3300049584 | Ga0501068_0012758 | Ga0501068_0012758_1313_2164 | 283 |
| 194 | 3300049585 | Ga0501069_0002514 | Ga0501069_0002514_2727_3578 | 283 |
| 195 | 3300049585 | Ga0501069_0117473 | Ga0501069_0117473_642_1493 | 283 |
| 196 | 3300049586 | Ga0501070_0020970 | Ga0501070_0020970_1544_2395 | 283 |
| 197 | 3300049587 | Ga0501071_0018829 | Ga0501071_0018829_1972_2823 | 283 |
| 198 | 3300049589 | Ga0501073_0010312 | Ga0501073_0010312_3932_4783 | 283 |
| 199 | 3300049590 | Ga0501074_0007397 | Ga0501074_0007397_407_1258 | 283 |
| 200 | 3300049593 | Ga0501077_0010632 | Ga0501077_0010632_2297_3148 | 283 |
| 201 | 3300049741 | Ga0501079_0046847 | Ga0501079_0046847_2028_2879 | 283 |
| 202 | 3300049742 | Ga0501080_0030118 | Ga0501080_0030118_3798_4649 | 283 |
| 203 | 3300049744 | Ga0501083_0031289 | Ga0501083_0031289_1731_2582 | 283 |
| 204 | 3300049822 | Ga0501035_0413721 | Ga0501035_0413721_163_1014 | 283 |
| 205 | 3300049823 | Ga0501044_0000243 | Ga0501044_0000243_3336_4187 | 283 |
| 206 | 3300049823 | Ga0501044_0033688 | Ga0501044_0033688_1599_2450 | 283 |
| 207 | 3300050489 | nmdc:mga03683_16047_c1 | nmdc:mga03683_16047_c1_1492_2343 | 283 |
| 208 | 3300050496 | nmdc:mga07m45_190474_c1 | nmdc:mga07m45_190474_c1_251_1132 | 283 |
| 209 | 3300050511 | nmdc:mga08y16_107681_c1 | nmdc:mga08y16_107681_c1_1109_1960 | 283 |
| 210 | 3300050515 | nmdc:mga0a205_139884_c1 | nmdc:mga0a205_139884_c1_590_1441 | 283 |
| 211 | 3300053077 | Ga0495601_0013675 | Ga0495601_0013675_1244_2110 | 283 |
| 212 | 3300053078 | Ga0495612_0010707 | Ga0495612_0010707_592_1458 | 283 |
| 213 | 3300053083 | Ga0495655_0009033 | Ga0495655_0009033_10_861 | 283 |
| 214 | 3300053084 | Ga0495595_0082279 | Ga0495595_0082279_43_909 | 283 |
| 215 | 3300053085 | Ga0495619_0086273 | Ga0495619_0086273_707_1573 | 283 |
| 216 | 3300053087 | Ga0500643_005044 | Ga0500643_005044_1941_2792 | 283 |
| 217 | 3300053088 | Ga0500644_0000501 | Ga0500644_0000501_9644_10495 | 283 |
| 218 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_178420_179271 | 283 |
| 219 | 3300053120 | Ga0500597_050641 | Ga0500597_050641_209_1075 | 283 |
| 220 | 3300053153 | Ga0500616_0073169 | Ga0500616_0073169_501_1352 | 283 |
| 221 | 3300060353 | Ga0501082_0085209 | Ga0501082_0085209_503_1354 | 283 |
| 222 | 3300045976 | Ga0466967_0026063 | Ga0466967_0026063_2723_3604 | 284 |
| 223 | 3300031249 | Ga0265339_10012548 | Ga0265339_100125482 | 285 |
| 224 | 3300031712 | Ga0265342_10013532 | Ga0265342_100135325 | 285 |
| 225 | 3300005437 | Ga0070710_10071345 | Ga0070710_100713451 | 286 |
| 226 | 3300006175 | Ga0070712_100004896 | Ga0070712_1000048968 | 286 |
| 227 | 3300025898 | Ga0207692_10056116 | Ga0207692_100561162 | 286 |
| 228 | 3300025915 | Ga0207693_10010674 | Ga0207693_100106743 | 286 |
| 229 | 3300044693 | Ga0466961_0056701 | Ga0466961_0056701_1572_2447 | 291 |
| 230 | 3300005329 | Ga0070683_100179942 | Ga0070683_1001799422 | 292 |
| 231 | 3300005530 | Ga0070679_100058074 | Ga0070679_1000580747 | 292 |
| 232 | 3300005577 | Ga0068857_100361934 | Ga0068857_1003619342 | 292 |
| 233 | 3300009551 | Ga0105238_10020403 | Ga0105238_100204039 | 292 |
| 234 | 3300025944 | Ga0207661_10075558 | Ga0207661_100755583 | 292 |
| 235 | 3300025949 | Ga0207667_10030658 | Ga0207667_100306587 | 292 |
| 236 | 3300026142 | Ga0207698_10129801 | Ga0207698_101298012 | 292 |
| 237 | 3300048903 | Ga0496100_0177586 | Ga0496100_0177586_382_1260 | 292 |
| 238 | 3300001430 | JGI24032J14994_101096 | JGI24032J14994_1010961 | 293 |
| 239 | 3300001989 | JGI24739J22299_10002121 | JGI24739J22299_100021214 | 293 |
| 240 | 3300001990 | JGI24737J22298_10052069 | JGI24737J22298_100520691 | 293 |
| 241 | 3300002075 | JGI24738J21930_10000603 | JGI24738J21930_100006037 | 293 |
| 242 | 3300002077 | JGI24744J21845_10021141 | JGI24744J21845_100211411 | 293 |
| 243 | 3300002244 | JGI24742J22300_10000182 | JGI24742J22300_100001823 | 293 |
| 244 | 3300003215 | JGI25153J46596_10001830 | JGI25153J46596_100018305 | 293 |
| 245 | 3300003659 | JGI25404J52841_10001497 | JGI25404J52841_100014972 | 293 |
| 246 | 3300005290 | Ga0065712_10073712 | Ga0065712_100737122 | 293 |
| 247 | 3300005293 | Ga0065715_10033142 | Ga0065715_100331422 | 293 |
| 248 | 3300005293 | Ga0065715_10038806 | Ga0065715_100388062 | 293 |
| 249 | 3300005293 | Ga0065715_10105333 | Ga0065715_101053333 | 293 |
| 250 | 3300005327 | Ga0070658_10008341 | Ga0070658_1000834110 | 293 |
| 251 | 3300005328 | Ga0070676_10051418 | Ga0070676_100514183 | 293 |
| 252 | 3300005328 | Ga0070676_10131434 | Ga0070676_101314341 | 293 |
| 253 | 3300005329 | Ga0070683_100112237 | Ga0070683_1001122372 | 293 |
| 254 | 3300005330 | Ga0070690_100061022 | Ga0070690_1000610222 | 293 |
| 255 | 3300005330 | Ga0070690_100065647 | Ga0070690_1000656471 | 293 |
| 256 | 3300005330 | Ga0070690_100070519 | Ga0070690_1000705192 | 293 |
| 257 | 3300005330 | Ga0070690_100078035 | Ga0070690_1000780352 | 293 |
| 258 | 3300005331 | Ga0070670_100003446 | Ga0070670_1000034462 | 293 |
| 259 | 3300005331 | Ga0070670_100253137 | Ga0070670_1002531372 | 293 |
| 260 | 3300005333 | Ga0070677_10000850 | Ga0070677_100008502 | 293 |
| 261 | 3300005333 | Ga0070677_10005124 | Ga0070677_100051243 | 293 |
| 262 | 3300005334 | Ga0068869_100068955 | Ga0068869_1000689554 | 293 |
| 263 | 3300005335 | Ga0070666_10035891 | Ga0070666_100358912 | 293 |
| 264 | 3300005336 | Ga0070680_100002046 | Ga0070680_1000020468 | 293 |
| 265 | 3300005336 | Ga0070680_100029747 | Ga0070680_1000297473 | 293 |
| 266 | 3300005336 | Ga0070680_100148328 | Ga0070680_1001483283 | 293 |
| 267 | 3300005337 | Ga0070682_100051160 | Ga0070682_1000511602 | 293 |
| 268 | 3300005337 | Ga0070682_100097231 | Ga0070682_1000972312 | 293 |
| 269 | 3300005338 | Ga0068868_100007860 | Ga0068868_1000078609 | 293 |
| 270 | 3300005338 | Ga0068868_100068138 | Ga0068868_1000681382 | 293 |
| 271 | 3300005339 | Ga0070660_100014760 | Ga0070660_1000147607 | 293 |
| 272 | 3300005339 | Ga0070660_100057652 | Ga0070660_1000576523 | 293 |
| 273 | 3300005339 | Ga0070660_100067823 | Ga0070660_1000678232 | 293 |
| 274 | 3300005340 | Ga0070689_100032584 | Ga0070689_1000325844 | 293 |
| 275 | 3300005341 | Ga0070691_10015311 | Ga0070691_100153113 | 293 |
| 276 | 3300005341 | Ga0070691_10079341 | Ga0070691_100793412 | 293 |
| 277 | 3300005341 | Ga0070691_10087488 | Ga0070691_100874881 | 293 |
| 278 | 3300005343 | Ga0070687_100074678 | Ga0070687_1000746782 | 293 |
| 279 | 3300005344 | Ga0070661_100034503 | Ga0070661_1000345034 | 293 |
| 280 | 3300005345 | Ga0070692_10014667 | Ga0070692_100146673 | 293 |
| 281 | 3300005353 | Ga0070669_100134924 | Ga0070669_1001349242 | 293 |
| 282 | 3300005354 | Ga0070675_100031240 | Ga0070675_1000312402 | 293 |
| 283 | 3300005355 | Ga0070671_100031396 | Ga0070671_1000313964 | 293 |
| 284 | 3300005355 | Ga0070671_100048924 | Ga0070671_1000489244 | 293 |
| 285 | 3300005355 | Ga0070671_100088793 | Ga0070671_1000887933 | 293 |
| 286 | 3300005356 | Ga0070674_100004085 | Ga0070674_1000040856 | 293 |
| 287 | 3300005356 | Ga0070674_100044083 | Ga0070674_1000440833 | 293 |
| 288 | 3300005356 | Ga0070674_100468251 | Ga0070674_1004682511 | 293 |
| 289 | 3300005364 | Ga0070673_100024056 | Ga0070673_1000240565 | 293 |
| 290 | 3300005365 | Ga0070688_100217271 | Ga0070688_1002172711 | 293 |
| 291 | 3300005367 | Ga0070667_100179532 | Ga0070667_1001795322 | 293 |
| 292 | 3300005367 | Ga0070667_100245963 | Ga0070667_1002459632 | 293 |
| 293 | 3300005406 | Ga0070703_10000581 | Ga0070703_100005812 | 293 |
| 294 | 3300005406 | Ga0070703_10056791 | Ga0070703_100567912 | 293 |
| 295 | 3300005434 | Ga0070709_10047996 | Ga0070709_100479963 | 293 |
| 296 | 3300005437 | Ga0070710_10042196 | Ga0070710_100421962 | 293 |
| 297 | 3300005438 | Ga0070701_10004158 | Ga0070701_100041585 | 293 |
| 298 | 3300005438 | Ga0070701_10016834 | Ga0070701_100168343 | 293 |
| 299 | 3300005439 | Ga0070711_100040118 | Ga0070711_1000401184 | 293 |
| 300 | 3300005439 | Ga0070711_100110934 | Ga0070711_1001109342 | 293 |
| 301 | 3300005440 | Ga0070705_100000029 | Ga0070705_10000002939 | 293 |
| 302 | 3300005440 | Ga0070705_100046450 | Ga0070705_1000464504 | 293 |
| 303 | 3300005441 | Ga0070700_100006751 | Ga0070700_1000067514 | 293 |
| 304 | 3300005441 | Ga0070700_100035933 | Ga0070700_1000359334 | 293 |
| 305 | 3300005444 | Ga0070694_100001913 | Ga0070694_10000191310 | 293 |
| 306 | 3300005445 | Ga0070708_100019278 | Ga0070708_1000192782 | 293 |
| 307 | 3300005455 | Ga0070663_100017829 | Ga0070663_1000178295 | 293 |
| 308 | 3300005455 | Ga0070663_100021364 | Ga0070663_1000213642 | 293 |
| 309 | 3300005455 | Ga0070663_100401338 | Ga0070663_1004013382 | 293 |
| 310 | 3300005455 | Ga0070663_100438002 | Ga0070663_1004380022 | 293 |
| 311 | 3300005456 | Ga0070678_100015278 | Ga0070678_1000152783 | 293 |
| 312 | 3300005456 | Ga0070678_100034483 | Ga0070678_1000344832 | 293 |
| 313 | 3300005456 | Ga0070678_100122904 | Ga0070678_1001229042 | 293 |
| 314 | 3300005458 | Ga0070681_10006973 | Ga0070681_1000697310 | 293 |
| 315 | 3300005458 | Ga0070681_10019175 | Ga0070681_100191754 | 293 |
| 316 | 3300005458 | Ga0070681_10021379 | Ga0070681_100213795 | 293 |
| 317 | 3300005458 | Ga0070681_10037074 | Ga0070681_100370745 | 293 |
| 318 | 3300005459 | Ga0068867_100032997 | Ga0068867_1000329975 | 293 |
| 319 | 3300005459 | Ga0068867_100036282 | Ga0068867_1000362824 | 293 |
| 320 | 3300005466 | Ga0070685_10013164 | Ga0070685_100131643 | 293 |
| 321 | 3300005466 | Ga0070685_10020314 | Ga0070685_100203144 | 293 |
| 322 | 3300005518 | Ga0070699_100002214 | Ga0070699_1000022148 | 293 |
| 323 | 3300005518 | Ga0070699_100249741 | Ga0070699_1002497412 | 293 |
| 324 | 3300005530 | Ga0070679_100045743 | Ga0070679_1000457435 | 293 |
| 325 | 3300005530 | Ga0070679_100090727 | Ga0070679_1000907272 | 293 |
| 326 | 3300005530 | Ga0070679_100098937 | Ga0070679_1000989373 | 293 |
| 327 | 3300005530 | Ga0070679_100195835 | Ga0070679_1001958352 | 293 |
| 328 | 3300005535 | Ga0070684_100021722 | Ga0070684_1000217225 | 293 |
| 329 | 3300005536 | Ga0070697_100004654 | Ga0070697_1000046545 | 293 |
| 330 | 3300005536 | Ga0070697_100297716 | Ga0070697_1002977162 | 293 |
| 331 | 3300005539 | Ga0068853_100001878 | Ga0068853_10000187810 | 293 |
| 332 | 3300005543 | Ga0070672_100171918 | Ga0070672_1001719182 | 293 |
| 333 | 3300005544 | Ga0070686_100017153 | Ga0070686_1000171533 | 293 |
| 334 | 3300005544 | Ga0070686_100168685 | Ga0070686_1001686852 | 293 |
| 335 | 3300005545 | Ga0070695_100000160 | Ga0070695_10000016024 | 293 |
| 336 | 3300005547 | Ga0070693_100032047 | Ga0070693_1000320474 | 293 |
| 337 | 3300005547 | Ga0070693_100060169 | Ga0070693_1000601693 | 293 |
| 338 | 3300005549 | Ga0070704_100016986 | Ga0070704_1000169862 | 293 |
| 339 | 3300005549 | Ga0070704_100289452 | Ga0070704_1002894522 | 293 |
| 340 | 3300005563 | Ga0068855_100111876 | Ga0068855_1001118763 | 293 |
| 341 | 3300005563 | Ga0068855_100395816 | Ga0068855_1003958162 | 293 |
| 342 | 3300005564 | Ga0070664_100025168 | Ga0070664_1000251684 | 293 |
| 343 | 3300005564 | Ga0070664_100033488 | Ga0070664_1000334882 | 293 |
| 344 | 3300005577 | Ga0068857_100003866 | Ga0068857_10000386614 | 293 |
| 345 | 3300005577 | Ga0068857_100057660 | Ga0068857_1000576603 | 293 |
| 346 | 3300005578 | Ga0068854_100008558 | Ga0068854_1000085582 | 293 |
| 347 | 3300005578 | Ga0068854_100202033 | Ga0068854_1002020333 | 293 |
| 348 | 3300005614 | Ga0068856_100061788 | Ga0068856_1000617882 | 293 |
| 349 | 3300005614 | Ga0068856_100086050 | Ga0068856_1000860504 | 293 |
| 350 | 3300005615 | Ga0070702_100037215 | Ga0070702_1000372154 | 293 |
| 351 | 3300005617 | Ga0068859_100003957 | Ga0068859_1000039573 | 293 |
| 352 | 3300005617 | Ga0068859_100078377 | Ga0068859_1000783774 | 293 |
| 353 | 3300005617 | Ga0068859_100301684 | Ga0068859_1003016842 | 293 |
| 354 | 3300005618 | Ga0068864_100003430 | Ga0068864_10000343015 | 293 |
| 355 | 3300005618 | Ga0068864_100057124 | Ga0068864_1000571242 | 293 |
| 356 | 3300005718 | Ga0068866_10011424 | Ga0068866_100114244 | 293 |
| 357 | 3300005718 | Ga0068866_10206396 | Ga0068866_102063961 | 293 |
| 358 | 3300005719 | Ga0068861_100061076 | Ga0068861_1000610762 | 293 |
| 359 | 3300005719 | Ga0068861_100280561 | Ga0068861_1002805612 | 293 |
| 360 | 3300005841 | Ga0068863_100003702 | Ga0068863_10000370213 | 293 |
| 361 | 3300005842 | Ga0068858_100010330 | Ga0068858_10001033010 | 293 |
| 362 | 3300005842 | Ga0068858_100237366 | Ga0068858_1002373662 | 293 |
| 363 | 3300005843 | Ga0068860_100004938 | Ga0068860_1000049388 | 293 |
| 364 | 3300005843 | Ga0068860_100076084 | Ga0068860_1000760843 | 293 |
| 365 | 3300005843 | Ga0068860_100136419 | Ga0068860_1001364192 | 293 |
| 366 | 3300005843 | Ga0068860_100464997 | Ga0068860_1004649972 | 293 |
| 367 | 3300005844 | Ga0068862_100000814 | Ga0068862_10000081414 | 293 |
| 368 | 3300005844 | Ga0068862_100087829 | Ga0068862_1000878292 | 293 |
| 369 | 3300005844 | Ga0068862_100320396 | Ga0068862_1003203962 | 293 |
| 370 | 3300005981 | Ga0081538_10019318 | Ga0081538_100193184 | 293 |
| 371 | 3300005981 | Ga0081538_10046977 | Ga0081538_100469773 | 293 |
| 372 | 3300005983 | Ga0081540_1000869 | Ga0081540_10008693 | 293 |
| 373 | 3300006028 | Ga0070717_10070194 | Ga0070717_100701943 | 293 |
| 374 | 3300006038 | Ga0075365_10018339 | Ga0075365_100183392 | 293 |
| 375 | 3300006038 | Ga0075365_10131953 | Ga0075365_101319532 | 293 |
| 376 | 3300006042 | Ga0075368_10028739 | Ga0075368_100287393 | 293 |
| 377 | 3300006051 | Ga0075364_10009379 | Ga0075364_100093795 | 293 |
| 378 | 3300006051 | Ga0075364_10173526 | Ga0075364_101735262 | 293 |
| 379 | 3300006175 | Ga0070712_100070696 | Ga0070712_1000706962 | 293 |
| 380 | 3300006177 | Ga0075362_10025889 | Ga0075362_100258894 | 293 |
| 381 | 3300006177 | Ga0075362_10056957 | Ga0075362_100569572 | 293 |
| 382 | 3300006178 | Ga0075367_10001375 | Ga0075367_100013755 | 293 |
| 383 | 3300006186 | Ga0075369_10013818 | Ga0075369_100138185 | 293 |
| 384 | 3300006195 | Ga0075366_10027627 | Ga0075366_100276273 | 293 |
| 385 | 3300006195 | Ga0075366_10030441 | Ga0075366_100304412 | 293 |
| 386 | 3300006195 | Ga0075366_10110707 | Ga0075366_101107071 | 293 |
| 387 | 3300006237 | Ga0097621_100004664 | Ga0097621_1000046644 | 293 |
| 388 | 3300006353 | Ga0075370_10246697 | Ga0075370_102466971 | 293 |
| 389 | 3300006358 | Ga0068871_100001982 | Ga0068871_10000198214 | 293 |
| 390 | 3300006846 | Ga0075430_100124411 | Ga0075430_1001244113 | 293 |
| 391 | 3300006847 | Ga0075431_100064079 | Ga0075431_1000640795 | 293 |
| 392 | 3300006847 | Ga0075431_100326322 | Ga0075431_1003263222 | 293 |
| 393 | 3300006847 | Ga0075431_100459746 | Ga0075431_1004597461 | 293 |
| 394 | 3300006852 | Ga0075433_10069775 | Ga0075433_100697753 | 293 |
| 395 | 3300006871 | Ga0075434_100074529 | Ga0075434_1000745293 | 293 |
| 396 | 3300006871 | Ga0075434_100160183 | Ga0075434_1001601833 | 293 |
| 397 | 3300006880 | Ga0075429_100258159 | Ga0075429_1002581592 | 293 |
| 398 | 3300006880 | Ga0075429_100303409 | Ga0075429_1003034092 | 293 |
| 399 | 3300006881 | Ga0068865_100014555 | Ga0068865_1000145555 | 293 |
| 400 | 3300006881 | Ga0068865_100176589 | Ga0068865_1001765892 | 293 |
| 401 | 3300006881 | Ga0068865_100176733 | Ga0068865_1001767332 | 293 |
| 402 | 3300006881 | Ga0068865_100298447 | Ga0068865_1002984472 | 293 |
| 403 | 3300006931 | Ga0097620_100003957 | Ga0097620_1000039573 | 293 |
| 404 | 3300006931 | Ga0097620_100078378 | Ga0097620_1000783784 | 293 |
| 405 | 3300006931 | Ga0097620_100301689 | Ga0097620_1003016892 | 293 |
| 406 | 3300007076 | Ga0075435_100411321 | Ga0075435_1004113212 | 293 |
| 407 | 3300009036 | Ga0105244_10046414 | Ga0105244_100464143 | 293 |
| 408 | 3300009094 | Ga0111539_10046029 | Ga0111539_100460292 | 293 |
| 409 | 3300009098 | Ga0105245_10021701 | Ga0105245_100217012 | 293 |
| 410 | 3300009098 | Ga0105245_10105815 | Ga0105245_101058153 | 293 |
| 411 | 3300009147 | Ga0114129_10008798 | Ga0114129_100087989 | 293 |
| 412 | 3300009147 | Ga0114129_10173116 | Ga0114129_101731164 | 293 |
| 413 | 3300009148 | Ga0105243_10481139 | Ga0105243_104811392 | 293 |
| 414 | 3300009174 | Ga0105241_10075162 | Ga0105241_100751623 | 293 |
| 415 | 3300009176 | Ga0105242_10036922 | Ga0105242_100369223 | 293 |
| 416 | 3300009177 | Ga0105248_10018134 | Ga0105248_100181344 | 293 |
| 417 | 3300009177 | Ga0105248_10077990 | Ga0105248_100779902 | 293 |
| 418 | 3300009551 | Ga0105238_10042427 | Ga0105238_100424275 | 293 |
| 419 | 3300009551 | Ga0105238_10309892 | Ga0105238_103098922 | 293 |
| 420 | 3300009553 | Ga0105249_10000961 | Ga0105249_1000096116 | 293 |
| 421 | 3300010375 | Ga0105239_10027540 | Ga0105239_100275402 | 293 |
| 422 | 3300010375 | Ga0105239_10578783 | Ga0105239_105787832 | 293 |
| 423 | 3300013104 | Ga0157370_10302121 | Ga0157370_103021212 | 293 |
| 424 | 3300013105 | Ga0157369_10202355 | Ga0157369_102023552 | 293 |
| 425 | 3300013105 | Ga0157369_10765283 | Ga0157369_107652831 | 293 |
| 426 | 3300013297 | Ga0157378_10070619 | Ga0157378_100706192 | 293 |
| 427 | 3300013297 | Ga0157378_10613459 | Ga0157378_106134592 | 293 |
| 428 | 3300013306 | Ga0163162_10140638 | Ga0163162_101406382 | 293 |
| 429 | 3300013306 | Ga0163162_10235538 | Ga0163162_102355382 | 293 |
| 430 | 3300013307 | Ga0157372_10185734 | Ga0157372_101857342 | 293 |
| 431 | 3300013307 | Ga0157372_10215503 | Ga0157372_102155032 | 293 |
| 432 | 3300014325 | Ga0163163_10755232 | Ga0163163_107552321 | 293 |
| 433 | 3300014326 | Ga0157380_10397726 | Ga0157380_103977262 | 293 |
| 434 | 3300014968 | Ga0157379_10095739 | Ga0157379_100957392 | 293 |
| 435 | 3300014968 | Ga0157379_10537301 | Ga0157379_105373011 | 293 |
| 436 | 3300014969 | Ga0157376_10159259 | Ga0157376_101592592 | 293 |
| 437 | 3300017792 | Ga0163161_10000941 | Ga0163161_1000094112 | 293 |
| 438 | 3300017792 | Ga0163161_10216051 | Ga0163161_102160512 | 293 |
| 439 | 3300020081 | Ga0206354_10355791 | Ga0206354_103557913 | 293 |
| 440 | 3300021384 | Ga0213876_10006322 | Ga0213876_100063222 | 293 |
| 441 | 3300025315 | Ga0207697_10002352 | Ga0207697_1000235210 | 293 |
| 442 | 3300025885 | Ga0207653_10000445 | Ga0207653_1000044514 | 293 |
| 443 | 3300025885 | Ga0207653_10006154 | Ga0207653_100061544 | 293 |
| 444 | 3300025893 | Ga0207682_10000293 | Ga0207682_1000029318 | 293 |
| 445 | 3300025893 | Ga0207682_10000391 | Ga0207682_1000039120 | 293 |
| 446 | 3300025893 | Ga0207682_10032321 | Ga0207682_100323213 | 293 |
| 447 | 3300025898 | Ga0207692_10094419 | Ga0207692_100944192 | 293 |
| 448 | 3300025899 | Ga0207642_10154074 | Ga0207642_101540742 | 293 |
| 449 | 3300025900 | Ga0207710_10006497 | Ga0207710_100064972 | 293 |
| 450 | 3300025900 | Ga0207710_10018896 | Ga0207710_100188963 | 293 |
| 451 | 3300025900 | Ga0207710_10170202 | Ga0207710_101702022 | 293 |
| 452 | 3300025901 | Ga0207688_10000070 | Ga0207688_1000007033 | 293 |
| 453 | 3300025903 | Ga0207680_10101877 | Ga0207680_101018773 | 293 |
| 454 | 3300025904 | Ga0207647_10048930 | Ga0207647_100489304 | 293 |
| 455 | 3300025906 | Ga0207699_10071795 | Ga0207699_100717952 | 293 |
| 456 | 3300025907 | Ga0207645_10041285 | Ga0207645_100412853 | 293 |
| 457 | 3300025908 | Ga0207643_10000123 | Ga0207643_1000012340 | 293 |
| 458 | 3300025908 | Ga0207643_10114919 | Ga0207643_101149191 | 293 |
| 459 | 3300025909 | Ga0207705_10124153 | Ga0207705_101241532 | 293 |
| 460 | 3300025912 | Ga0207707_10011032 | Ga0207707_100110328 | 293 |
| 461 | 3300025912 | Ga0207707_10012557 | Ga0207707_100125573 | 293 |
| 462 | 3300025912 | Ga0207707_10060483 | Ga0207707_100604832 | 293 |
| 463 | 3300025912 | Ga0207707_10346084 | Ga0207707_103460842 | 293 |
| 464 | 3300025913 | Ga0207695_10134638 | Ga0207695_101346383 | 293 |
| 465 | 3300025915 | Ga0207693_10004569 | Ga0207693_100045697 | 293 |
| 466 | 3300025915 | Ga0207693_10045608 | Ga0207693_100456082 | 293 |
| 467 | 3300025916 | Ga0207663_10030224 | Ga0207663_100302242 | 293 |
| 468 | 3300025916 | Ga0207663_10070522 | Ga0207663_100705222 | 293 |
| 469 | 3300025916 | Ga0207663_10089629 | Ga0207663_100896292 | 293 |
| 470 | 3300025917 | Ga0207660_10002992 | Ga0207660_1000299212 | 293 |
| 471 | 3300025917 | Ga0207660_10004649 | Ga0207660_100046493 | 293 |
| 472 | 3300025917 | Ga0207660_10029631 | Ga0207660_100296315 | 293 |
| 473 | 3300025917 | Ga0207660_10093782 | Ga0207660_100937822 | 293 |
| 474 | 3300025917 | Ga0207660_10227006 | Ga0207660_102270062 | 293 |
| 475 | 3300025918 | Ga0207662_10015158 | Ga0207662_100151584 | 293 |
| 476 | 3300025919 | Ga0207657_10008644 | Ga0207657_1000864410 | 293 |
| 477 | 3300025919 | Ga0207657_10009786 | Ga0207657_100097864 | 293 |
| 478 | 3300025919 | Ga0207657_10048246 | Ga0207657_100482464 | 293 |
| 479 | 3300025919 | Ga0207657_10240437 | Ga0207657_102404372 | 293 |
| 480 | 3300025920 | Ga0207649_10029754 | Ga0207649_100297541 | 293 |
| 481 | 3300025920 | Ga0207649_10167301 | Ga0207649_101673011 | 293 |
| 482 | 3300025921 | Ga0207652_10016117 | Ga0207652_100161175 | 293 |
| 483 | 3300025921 | Ga0207652_10033952 | Ga0207652_100339522 | 293 |
| 484 | 3300025921 | Ga0207652_10066903 | Ga0207652_100669032 | 293 |
| 485 | 3300025921 | Ga0207652_10234136 | Ga0207652_102341362 | 293 |
| 486 | 3300025921 | Ga0207652_10364349 | Ga0207652_103643492 | 293 |
| 487 | 3300025923 | Ga0207681_10011037 | Ga0207681_100110376 | 293 |
| 488 | 3300025924 | Ga0207694_10062629 | Ga0207694_100626292 | 293 |
| 489 | 3300025924 | Ga0207694_10099955 | Ga0207694_100999551 | 293 |
| 490 | 3300025925 | Ga0207650_10002345 | Ga0207650_100023452 | 293 |
| 491 | 3300025926 | Ga0207659_10011847 | Ga0207659_100118476 | 293 |
| 492 | 3300025927 | Ga0207687_10086721 | Ga0207687_100867212 | 293 |
| 493 | 3300025928 | Ga0207700_10011773 | Ga0207700_100117736 | 293 |
| 494 | 3300025929 | Ga0207664_10016757 | Ga0207664_100167574 | 293 |
| 495 | 3300025931 | Ga0207644_10015103 | Ga0207644_100151033 | 293 |
| 496 | 3300025931 | Ga0207644_10016369 | Ga0207644_100163694 | 293 |
| 497 | 3300025932 | Ga0207690_10113766 | Ga0207690_101137663 | 293 |
| 498 | 3300025933 | Ga0207706_10002469 | Ga0207706_1000246916 | 293 |
| 499 | 3300025934 | Ga0207686_10002206 | Ga0207686_1000220612 | 293 |
| 500 | 3300025934 | Ga0207686_10042645 | Ga0207686_100426452 | 293 |
| 501 | 3300025935 | Ga0207709_10008232 | Ga0207709_100082326 | 293 |
| 502 | 3300025935 | Ga0207709_10037345 | Ga0207709_100373453 | 293 |
| 503 | 3300025935 | Ga0207709_10120711 | Ga0207709_101207112 | 293 |
| 504 | 3300025936 | Ga0207670_10012750 | Ga0207670_100127505 | 293 |
| 505 | 3300025936 | Ga0207670_10332602 | Ga0207670_103326022 | 293 |
| 506 | 3300025937 | Ga0207669_10007077 | Ga0207669_100070774 | 293 |
| 507 | 3300025937 | Ga0207669_10194838 | Ga0207669_101948383 | 293 |
| 508 | 3300025938 | Ga0207704_10138250 | Ga0207704_101382503 | 293 |
| 509 | 3300025938 | Ga0207704_10141154 | Ga0207704_101411542 | 293 |
| 510 | 3300025938 | Ga0207704_10258892 | Ga0207704_102588922 | 293 |
| 511 | 3300025939 | Ga0207665_10066777 | Ga0207665_100667772 | 293 |
| 512 | 3300025940 | Ga0207691_10001015 | Ga0207691_100010155 | 293 |
| 513 | 3300025940 | Ga0207691_10004072 | Ga0207691_1000407212 | 293 |
| 514 | 3300025940 | Ga0207691_10141859 | Ga0207691_101418591 | 293 |
| 515 | 3300025941 | Ga0207711_10015167 | Ga0207711_100151674 | 293 |
| 516 | 3300025941 | Ga0207711_10039695 | Ga0207711_100396952 | 293 |
| 517 | 3300025941 | Ga0207711_10045937 | Ga0207711_100459372 | 293 |
| 518 | 3300025941 | Ga0207711_10436593 | Ga0207711_104365932 | 293 |
| 519 | 3300025942 | Ga0207689_10007859 | Ga0207689_100078592 | 293 |
| 520 | 3300025942 | Ga0207689_10090789 | Ga0207689_100907892 | 293 |
| 521 | 3300025944 | Ga0207661_10022343 | Ga0207661_100223435 | 293 |
| 522 | 3300025949 | Ga0207667_10195824 | Ga0207667_101958242 | 293 |
| 523 | 3300025960 | Ga0207651_10123352 | Ga0207651_101233522 | 293 |
| 524 | 3300025960 | Ga0207651_10133205 | Ga0207651_101332053 | 293 |
| 525 | 3300025961 | Ga0207712_10001153 | Ga0207712_100011533 | 293 |
| 526 | 3300025961 | Ga0207712_10213862 | Ga0207712_102138622 | 293 |
| 527 | 3300025986 | Ga0207658_10023467 | Ga0207658_100234672 | 293 |
| 528 | 3300025986 | Ga0207658_10199650 | Ga0207658_101996502 | 293 |
| 529 | 3300025986 | Ga0207658_10432633 | Ga0207658_104326332 | 293 |
| 530 | 3300026023 | Ga0207677_10019295 | Ga0207677_100192952 | 293 |
| 531 | 3300026023 | Ga0207677_10119426 | Ga0207677_101194262 | 293 |
| 532 | 3300026035 | Ga0207703_10076901 | Ga0207703_100769012 | 293 |
| 533 | 3300026035 | Ga0207703_10091104 | Ga0207703_100911042 | 293 |
| 534 | 3300026041 | Ga0207639_10057698 | Ga0207639_100576982 | 293 |
| 535 | 3300026041 | Ga0207639_10102153 | Ga0207639_101021532 | 293 |
| 536 | 3300026067 | Ga0207678_10000688 | Ga0207678_1000068834 | 293 |
| 537 | 3300026067 | Ga0207678_10031385 | Ga0207678_100313854 | 293 |
| 538 | 3300026067 | Ga0207678_10296910 | Ga0207678_102969102 | 293 |
| 539 | 3300026075 | Ga0207708_10007349 | Ga0207708_100073494 | 293 |
| 540 | 3300026078 | Ga0207702_10274011 | Ga0207702_102740112 | 293 |
| 541 | 3300026089 | Ga0207648_10002850 | Ga0207648_1000285011 | 293 |
| 542 | 3300026089 | Ga0207648_10062381 | Ga0207648_100623812 | 293 |
| 543 | 3300026095 | Ga0207676_10001647 | Ga0207676_100016473 | 293 |
| 544 | 3300026095 | Ga0207676_10045488 | Ga0207676_100454882 | 293 |
| 545 | 3300026095 | Ga0207676_10102860 | Ga0207676_101028603 | 293 |
| 546 | 3300026116 | Ga0207674_10010786 | Ga0207674_100107862 | 293 |
| 547 | 3300026116 | Ga0207674_10015583 | Ga0207674_100155837 | 293 |
| 548 | 3300026116 | Ga0207674_10034544 | Ga0207674_100345446 | 293 |
| 549 | 3300026118 | Ga0207675_100174468 | Ga0207675_1001744683 | 293 |
| 550 | 3300026118 | Ga0207675_100314555 | Ga0207675_1003145552 | 293 |
| 551 | 3300026121 | Ga0207683_10032865 | Ga0207683_100328653 | 293 |
| 552 | 3300026121 | Ga0207683_10071264 | Ga0207683_100712642 | 293 |
| 553 | 3300026142 | Ga0207698_10098028 | Ga0207698_100980283 | 293 |
| 554 | 3300027617 | Ga0210002_1000422 | Ga0210002_10004222 | 293 |
| 555 | 3300027665 | Ga0209983_1001018 | Ga0209983_10010184 | 293 |
| 556 | 3300027682 | Ga0209971_1001863 | Ga0209971_10018634 | 293 |
| 557 | 3300027695 | Ga0209966_1001831 | Ga0209966_10018314 | 293 |
| 558 | 3300027717 | Ga0209998_10002702 | Ga0209998_100027024 | 293 |
| 559 | 3300027876 | Ga0209974_10018690 | Ga0209974_100186902 | 293 |
| 560 | 3300027907 | Ga0207428_10034736 | Ga0207428_100347364 | 293 |
| 561 | 3300028379 | Ga0268266_10118273 | Ga0268266_101182733 | 293 |
| 562 | 3300028380 | Ga0268265_10001430 | Ga0268265_1000143014 | 293 |
| 563 | 3300028381 | Ga0268264_10085414 | Ga0268264_100854143 | 293 |
| 564 | 3300028381 | Ga0268264_10117817 | Ga0268264_101178172 | 293 |
| 565 | 3300028381 | Ga0268264_10254174 | Ga0268264_102541742 | 293 |
| 566 | 3300028577 | Ga0265318_10007557 | Ga0265318_100075574 | 293 |
| 567 | 3300028800 | Ga0265338_10133447 | Ga0265338_101334471 | 293 |
| 568 | 3300031238 | Ga0265332_10033062 | Ga0265332_100330622 | 293 |
| 569 | 3300031240 | Ga0265320_10030967 | Ga0265320_100309674 | 293 |
| 570 | 3300031241 | Ga0265325_10000004 | Ga0265325_1000000469 | 293 |
| 571 | 3300031241 | Ga0265325_10000637 | Ga0265325_100006379 | 293 |
| 572 | 3300031241 | Ga0265325_10000671 | Ga0265325_100006712 | 293 |
| 573 | 3300031241 | Ga0265325_10006661 | Ga0265325_100066614 | 293 |
| 574 | 3300031241 | Ga0265325_10015673 | Ga0265325_100156733 | 293 |
| 575 | 3300031247 | Ga0265340_10038400 | Ga0265340_100384003 | 293 |
| 576 | 3300031247 | Ga0265340_10043763 | Ga0265340_100437631 | 293 |
| 577 | 3300031249 | Ga0265339_10009785 | Ga0265339_100097857 | 293 |
| 578 | 3300031344 | Ga0265316_10127728 | Ga0265316_101277282 | 293 |
| 579 | 3300031595 | Ga0265313_10000118 | Ga0265313_1000011860 | 293 |
| 580 | 3300031595 | Ga0265313_10005881 | Ga0265313_100058813 | 293 |
| 581 | 3300031595 | Ga0265313_10010184 | Ga0265313_100101842 | 293 |
| 582 | 3300031595 | Ga0265313_10010448 | Ga0265313_100104484 | 293 |
| 583 | 3300031711 | Ga0265314_10012846 | Ga0265314_100128462 | 293 |
| 584 | 3300031711 | Ga0265314_10085898 | Ga0265314_100858982 | 293 |
| 585 | 3300031712 | Ga0265342_10000674 | Ga0265342_1000067423 | 293 |
| 586 | 3300031712 | Ga0265342_10019918 | Ga0265342_100199182 | 293 |
| 587 | 3300031727 | Ga0316576_10005448 | Ga0316576_100054489 | 293 |
| 588 | 3300031728 | Ga0316578_10000852 | Ga0316578_1000085211 | 293 |
| 589 | 3300032002 | Ga0307416_100439397 | Ga0307416_1004393971 | 293 |
| 590 | 3300032126 | Ga0307415_100347008 | Ga0307415_1003470082 | 293 |
| 591 | 3300032133 | Ga0316583_10016641 | Ga0316583_100166412 | 293 |
| 592 | 3300034819 | Ga0373958_0017723 | Ga0373958_0017723_33_914 | 293 |
| 593 | 3300035086 | Ga0373934_0019984 | Ga0373934_0019984_1542_2423 | 293 |
| 594 | 3300035113 | Ga0373936_0012370 | Ga0373936_0012370_844_1725 | 293 |
| 595 | 3300035114 | Ga0373939_0022407 | Ga0373939_0022407_221_1102 | 293 |
| 596 | 3300035116 | Ga0373945_0013554 | Ga0373945_0013554_1137_2018 | 293 |
| 597 | 3300035117 | Ga0373953_0008276 | Ga0373953_0008276_1479_2360 | 293 |
| 598 | 3300035117 | Ga0373953_0055621 | Ga0373953_0055621_277_1200 | 293 |
| 599 | 3300035118 | Ga0373954_0009161 | Ga0373954_0009161_1229_2110 | 293 |
| 600 | 3300035119 | Ga0373956_0007281 | Ga0373956_0007281_2983_3864 | 293 |
| 601 | 3300035120 | Ga0373957_0030808 | Ga0373957_0030808_509_1390 | 293 |
| 602 | 3300035170 | Ga0373943_0012011 | Ga0373943_0012011_1435_2316 | 293 |
| 603 | 3300035170 | Ga0373943_0014642 | Ga0373943_0014642_838_1740 | 293 |
| 604 | 3300035172 | Ga0373955_0006492 | Ga0373955_0006492_2162_3043 | 293 |
| 605 | 3300035172 | Ga0373955_0032412 | Ga0373955_0032412_626_1549 | 293 |
| 606 | 3300035241 | Ga0373961_0009231 | Ga0373961_0009231_1319_2215 | 293 |
| 607 | 3300035241 | Ga0373961_0063400 | Ga0373961_0063400_194_1075 | 293 |
| 608 | 3300035398 | Ga0316574_0003805 | Ga0316574_0003805_4413_5300 | 293 |
| 609 | 3300035410 | Ga0373924_0164112 | Ga0373924_0164112_29_910 | 293 |
| 610 | 3300035692 | Ga0373935_0017861 | Ga0373935_0017861_2036_2917 | 293 |
| 611 | 3300035695 | Ga0373927_0031014 | Ga0373927_0031014_34_936 | 293 |
| 612 | 3300035695 | Ga0373927_0299325 | Ga0373927_0299325_29_910 | 293 |
| 613 | 3300035724 | Ga0373933_0003561 | Ga0373933_0003561_1568_2449 | 293 |
| 614 | 3300035725 | Ga0373947_0030379 | Ga0373947_0030379_849_1730 | 293 |
| 615 | 3300036401 | Ga0373937_0002015 | Ga0373937_0002015_9249_10172 | 293 |
| 616 | 3300036401 | Ga0373937_0025551 | Ga0373937_0025551_1352_2233 | 293 |
| 617 | 3300037068 | Ga0373925_0030165 | Ga0373925_0030165_339_1262 | 293 |
| 618 | 3300037068 | Ga0373925_0137764 | Ga0373925_0137764_77_958 | 293 |
| 619 | 3300039437 | Ga0436365_0368495 | Ga0436365_0368495_1052_1936 | 293 |
| 620 | 3300039437 | Ga0436365_1065374 | Ga0436365_1065374_550_1431 | 293 |
| 621 | 3300039438 | Ga0436360_0713145 | Ga0436360_0713145_58_942 | 293 |
| 622 | 3300042012 | Ga0439455_0006154 | Ga0439455_0006154_1496_2398 | 293 |
| 623 | 3300042185 | Ga0450909_016028 | Ga0450909_016028_47_943 | 293 |
| 624 | 3300042436 | Ga0439435_0059131 | Ga0439435_0059131_62_943 | 293 |
| 625 | 3300045976 | Ga0466967_0327322 | Ga0466967_0327322_516_1397 | 293 |
| 626 | 3300046454 | Ga0495592_0037989 | Ga0495592_0037989_2050_2931 | 293 |
| 627 | 3300046455 | Ga0495603_0014815 | Ga0495603_0014815_1893_2774 | 293 |
| 628 | 3300046455 | Ga0495603_0047868 | Ga0495603_0047868_715_1626 | 293 |
| 629 | 3300046459 | Ga0495629_0166533 | Ga0495629_0166533_203_1084 | 293 |
| 630 | 3300046461 | Ga0495641_0023441 | Ga0495641_0023441_2146_3027 | 293 |
| 631 | 3300046462 | Ga0495651_0020442 | Ga0495651_0020442_968_1891 | 293 |
| 632 | 3300046463 | Ga0495653_0000751 | Ga0495653_0000751_19649_20530 | 293 |
| 633 | 3300046472 | Ga0495580_0312123 | Ga0495580_0312123_75_956 | 293 |
| 634 | 3300046473 | Ga0495582_0011728 | Ga0495582_0011728_1205_2086 | 293 |
| 635 | 3300046474 | Ga0495605_0033157 | Ga0495605_0033157_593_1474 | 293 |
| 636 | 3300046475 | Ga0495639_0041542 | Ga0495639_0041542_943_1824 | 293 |
| 637 | 3300046476 | Ga0495662_0008327 | Ga0495662_0008327_1301_2182 | 293 |
| 638 | 3300046477 | Ga0495664_0014023 | Ga0495664_0014023_1981_2862 | 293 |
| 639 | 3300046477 | Ga0495664_0032905 | Ga0495664_0032905_2132_3013 | 293 |
| 640 | 3300046499 | Ga0495594_0080736 | Ga0495594_0080736_918_1799 | 293 |
| 641 | 3300046511 | Ga0495608_0008056 | Ga0495608_0008056_1352_2233 | 293 |
| 642 | 3300046514 | Ga0495618_0007287 | Ga0495618_0007287_251_1132 | 293 |
| 643 | 3300046514 | Ga0495618_0038175 | Ga0495618_0038175_1657_2538 | 293 |
| 644 | 3300046516 | Ga0495628_0004433 | Ga0495628_0004433_2456_3379 | 293 |
| 645 | 3300046517 | Ga0495630_0032173 | Ga0495630_0032173_2527_3408 | 293 |
| 646 | 3300046529 | Ga0495652_0003050 | Ga0495652_0003050_2534_3457 | 293 |
| 647 | 3300046529 | Ga0495652_0013600 | Ga0495652_0013600_5118_5999 | 293 |
| 648 | 3300046529 | Ga0495652_0042670 | Ga0495652_0042670_2577_3458 | 293 |
| 649 | 3300046533 | Ga0495640_0024383 | Ga0495640_0024383_162_1043 | 293 |
| 650 | 3300046533 | Ga0495640_0072843 | Ga0495640_0072843_1249_2130 | 293 |
| 651 | 3300046536 | Ga0495587_0004793 | Ga0495587_0004793_5952_6833 | 293 |
| 652 | 3300046536 | Ga0495587_0027469 | Ga0495587_0027469_2391_3314 | 293 |
| 653 | 3300046537 | Ga0495598_0001166 | Ga0495598_0001166_3002_3883 | 293 |
| 654 | 3300046543 | Ga0495645_0000362 | Ga0495645_0000362_7566_8489 | 293 |
| 655 | 3300046559 | Ga0495667_0008809 | Ga0495667_0008809_2305_3228 | 293 |
| 656 | 3300046559 | Ga0495667_0043814 | Ga0495667_0043814_693_1574 | 293 |
| 657 | 3300046615 | Ga0495656_0128624 | Ga0495656_0128624_70_951 | 293 |
| 658 | 3300046642 | Ga0495634_0043895 | Ga0495634_0043895_1564_2445 | 293 |
| 659 | 3300046663 | Ga0495635_0018844 | Ga0495635_0018844_1885_2808 | 293 |
| 660 | 3300046663 | Ga0495635_0023357 | Ga0495635_0023357_1542_2423 | 293 |
| 661 | 3300046663 | Ga0495635_0079835 | Ga0495635_0079835_40_921 | 293 |
| 662 | 3300046674 | Ga0495588_0027130 | Ga0495588_0027130_931_1812 | 293 |
| 663 | 3300046675 | Ga0495657_0005082 | Ga0495657_0005082_5410_6291 | 293 |
| 664 | 3300046675 | Ga0495657_0026388 | Ga0495657_0026388_1071_1994 | 293 |
| 665 | 3300046678 | Ga0495599_0055185 | Ga0495599_0055185_1480_2361 | 293 |
| 666 | 3300046678 | Ga0495599_0061128 | Ga0495599_0061128_214_1137 | 293 |
| 667 | 3300046678 | Ga0495599_0103831 | Ga0495599_0103831_103_1041 | 293 |
| 668 | 3300046679 | Ga0495623_0042547 | Ga0495623_0042547_242_1123 | 293 |
| 669 | 3300046680 | Ga0495646_0115692 | Ga0495646_0115692_517_1398 | 293 |
| 670 | 3300046681 | Ga0495647_0057327 | Ga0495647_0057327_633_1514 | 293 |
| 671 | 3300046681 | Ga0495647_0098963 | Ga0495647_0098963_259_1140 | 293 |
| 672 | 3300046683 | Ga0495658_0056265 | Ga0495658_0056265_1061_1942 | 293 |
| 673 | 3300046690 | Ga0495624_0035632 | Ga0495624_0035632_179_1060 | 293 |
| 674 | 3300046809 | Ga0495600_0002228 | Ga0495600_0002228_5133_6014 | 293 |
| 675 | 3300047317 | Ga0495604_0002960 | Ga0495604_0002960_6958_7839 | 293 |
| 676 | 3300047317 | Ga0495604_0094303 | Ga0495604_0094303_495_1418 | 293 |
| 677 | 3300047319 | Ga0495674_0020696 | Ga0495674_0020696_4629_5510 | 293 |
| 678 | 3300047319 | Ga0495674_0053171 | Ga0495674_0053171_2194_3075 | 293 |
| 679 | 3300047321 | Ga0495676_0058839 | Ga0495676_0058839_143_1024 | 293 |
| 680 | 3300047322 | Ga0495680_0008230 | Ga0495680_0008230_3482_4363 | 293 |
| 681 | 3300047322 | Ga0495680_0033364 | Ga0495680_0033364_2200_3123 | 293 |
| 682 | 3300047444 | Ga0495675_0012940 | Ga0495675_0012940_2854_3735 | 293 |
| 683 | 3300047444 | Ga0495675_0117824 | Ga0495675_0117824_30_914 | 293 |
| 684 | 3300047447 | Ga0495685_026971 | Ga0495685_026971_663_1544 | 293 |
| 685 | 3300047471 | Ga0495684_0154548 | Ga0495684_0154548_123_1007 | 293 |
| 686 | 3300047673 | Ga0495593_0149527 | Ga0495593_0149527_14_895 | 293 |
| 687 | 3300047673 | Ga0495593_0162320 | Ga0495593_0162320_202_1083 | 293 |
| 688 | 3300048088 | Ga0495602_0003618 | Ga0495602_0003618_14343_15224 | 293 |
| 689 | 3300048088 | Ga0495602_0012504 | Ga0495602_0012504_7465_8388 | 293 |
| 690 | 3300048088 | Ga0495602_0094183 | Ga0495602_0094183_1009_1893 | 293 |
| 691 | 3300048090 | Ga0495615_0019781 | Ga0495615_0019781_215_1096 | 293 |
| 692 | 3300048903 | Ga0496100_0299312 | Ga0496100_0299312_281_1165 | 293 |
| 693 | 3300048904 | Ga0496101_0018116 | Ga0496101_0018116_2628_3509 | 293 |
| 694 | 3300048905 | Ga0496102_0008005 | Ga0496102_0008005_394_1278 | 293 |
| 695 | 3300048905 | Ga0496102_0058812 | Ga0496102_0058812_1241_2122 | 293 |
| 696 | 3300048905 | Ga0496102_0116302 | Ga0496102_0116302_269_1150 | 293 |
| 697 | 3300048905 | Ga0496102_0329100 | Ga0496102_0329100_82_966 | 293 |
| 698 | 3300048906 | Ga0496103_0016949 | Ga0496103_0016949_2400_3281 | 293 |
| 699 | 3300048906 | Ga0496103_0058138 | Ga0496103_0058138_398_1282 | 293 |
| 700 | 3300048907 | Ga0496104_0000827 | Ga0496104_0000827_14448_15371 | 293 |
| 701 | 3300048907 | Ga0496104_0008871 | Ga0496104_0008871_2618_3499 | 293 |
| 702 | 3300048908 | Ga0496105_0002816 | Ga0496105_0002816_2971_3894 | 293 |
| 703 | 3300048909 | Ga0496106_0000691 | Ga0496106_0000691_2478_3362 | 293 |
| 704 | 3300048909 | Ga0496106_0047139 | Ga0496106_0047139_519_1415 | 293 |
| 705 | 3300048909 | Ga0496106_0084989 | Ga0496106_0084989_684_1565 | 293 |
| 706 | 3300048910 | Ga0496107_0051145 | Ga0496107_0051145_505_1389 | 293 |
| 707 | 3300048910 | Ga0496107_0061808 | Ga0496107_0061808_1575_2456 | 293 |
| 708 | 3300048911 | Ga0496108_0087996 | Ga0496108_0087996_1628_2509 | 293 |
| 709 | 3300048911 | Ga0496108_0334005 | Ga0496108_0334005_109_1005 | 293 |
| 710 | 3300048912 | Ga0496109_0322353 | Ga0496109_0322353_528_1412 | 293 |
| 711 | 3300048913 | Ga0496110_0061326 | Ga0496110_0061326_681_1562 | 293 |
| 712 | 3300048913 | Ga0496110_0295722 | Ga0496110_0295722_147_1070 | 293 |
| 713 | 3300048913 | Ga0496110_0356901 | Ga0496110_0356901_154_1068 | 293 |
| 714 | 3300048914 | Ga0496111_0241384 | Ga0496111_0241384_210_1091 | 293 |
| 715 | 3300048915 | Ga0496112_0070199 | Ga0496112_0070199_724_1605 | 293 |
| 716 | 3300048917 | Ga0496114_0070788 | Ga0496114_0070788_1291_2172 | 293 |
| 717 | 3300048917 | Ga0496114_0197915 | Ga0496114_0197915_122_1045 | 293 |
| 718 | 3300048918 | Ga0496115_0056660 | Ga0496115_0056660_471_1352 | 293 |
| 719 | 3300048918 | Ga0496115_0058141 | Ga0496115_0058141_602_1498 | 293 |
| 720 | 3300049568 | Ga0501031_0015920 | Ga0501031_0015920_204_1085 | 293 |
| 721 | 3300049569 | Ga0501032_0079651 | Ga0501032_0079651_1282_2163 | 293 |
| 722 | 3300049570 | Ga0501033_0009055 | Ga0501033_0009055_5073_5954 | 293 |
| 723 | 3300049570 | Ga0501033_0043734 | Ga0501033_0043734_2420_3304 | 293 |
| 724 | 3300049571 | Ga0501034_0000319 | Ga0501034_0000319_1967_2848 | 293 |
| 725 | 3300049571 | Ga0501034_0006473 | Ga0501034_0006473_9275_10156 | 293 |
| 726 | 3300049571 | Ga0501034_0073408 | Ga0501034_0073408_22_903 | 293 |
| 727 | 3300049571 | Ga0501034_0178057 | Ga0501034_0178057_656_1537 | 293 |
| 728 | 3300049572 | Ga0501036_0200179 | Ga0501036_0200179_83_964 | 293 |
| 729 | 3300049574 | Ga0501038_0074431 | Ga0501038_0074431_582_1466 | 293 |
| 730 | 3300049574 | Ga0501038_0123920 | Ga0501038_0123920_540_1421 | 293 |
| 731 | 3300049575 | Ga0501039_0145115 | Ga0501039_0145115_831_1715 | 293 |
| 732 | 3300049575 | Ga0501039_0244502 | Ga0501039_0244502_114_998 | 293 |
| 733 | 3300049578 | Ga0501042_0124335 | Ga0501042_0124335_495_1379 | 293 |
| 734 | 3300049580 | Ga0501046_0067556 | Ga0501046_0067556_266_1150 | 293 |
| 735 | 3300049581 | Ga0501047_0004229 | Ga0501047_0004229_2428_3309 | 293 |
| 736 | 3300049581 | Ga0501047_0032947 | Ga0501047_0032947_2844_3725 | 293 |
| 737 | 3300049581 | Ga0501047_0071043 | Ga0501047_0071043_466_1347 | 293 |
| 738 | 3300049581 | Ga0501047_0243430 | Ga0501047_0243430_361_1242 | 293 |
| 739 | 3300049583 | Ga0501067_0043246 | Ga0501067_0043246_1347_2228 | 293 |
| 740 | 3300049584 | Ga0501068_0147326 | Ga0501068_0147326_512_1393 | 293 |
| 741 | 3300049585 | Ga0501069_0010152 | Ga0501069_0010152_2667_3548 | 293 |
| 742 | 3300049585 | Ga0501069_0015088 | Ga0501069_0015088_625_1506 | 293 |
| 743 | 3300049585 | Ga0501069_0037545 | Ga0501069_0037545_1057_1938 | 293 |
| 744 | 3300049586 | Ga0501070_0007456 | Ga0501070_0007456_948_1829 | 293 |
| 745 | 3300049586 | Ga0501070_0028420 | Ga0501070_0028420_2838_3719 | 293 |
| 746 | 3300049586 | Ga0501070_0059878 | Ga0501070_0059878_2128_3009 | 293 |
| 747 | 3300049587 | Ga0501071_0167455 | Ga0501071_0167455_444_1325 | 293 |
| 748 | 3300049588 | Ga0501072_0026931 | Ga0501072_0026931_2378_3259 | 293 |
| 749 | 3300049588 | Ga0501072_0076081 | Ga0501072_0076081_1079_1975 | 293 |
| 750 | 3300049588 | Ga0501072_0139840 | Ga0501072_0139840_662_1546 | 293 |
| 751 | 3300049588 | Ga0501072_0268011 | Ga0501072_0268011_348_1229 | 293 |
| 752 | 3300049589 | Ga0501073_0012418 | Ga0501073_0012418_72_953 | 293 |
| 753 | 3300049589 | Ga0501073_0066027 | Ga0501073_0066027_1090_1971 | 293 |
| 754 | 3300049590 | Ga0501074_0028981 | Ga0501074_0028981_1229_2110 | 293 |
| 755 | 3300049591 | Ga0501075_0092049 | Ga0501075_0092049_1395_2279 | 293 |
| 756 | 3300049591 | Ga0501075_0101143 | Ga0501075_0101143_133_1017 | 293 |
| 757 | 3300049591 | Ga0501075_0296529 | Ga0501075_0296529_44_928 | 293 |
| 758 | 3300049592 | Ga0501076_0181826 | Ga0501076_0181826_793_1677 | 293 |
| 759 | 3300049593 | Ga0501077_0155522 | Ga0501077_0155522_98_982 | 293 |
| 760 | 3300049741 | Ga0501079_0030249 | Ga0501079_0030249_366_1250 | 293 |
| 761 | 3300049741 | Ga0501079_0305614 | Ga0501079_0305614_248_1132 | 293 |
| 762 | 3300049741 | Ga0501079_0377270 | Ga0501079_0377270_56_937 | 293 |
| 763 | 3300049742 | Ga0501080_0120725 | Ga0501080_0120725_476_1372 | 293 |
| 764 | 3300049742 | Ga0501080_0184895 | Ga0501080_0184895_835_1716 | 293 |
| 765 | 3300049744 | Ga0501083_0149539 | Ga0501083_0149539_231_1112 | 293 |
| 766 | 3300049822 | Ga0501035_0001744 | Ga0501035_0001744_474_1355 | 293 |
| 767 | 3300049822 | Ga0501035_0387870 | Ga0501035_0387870_153_1034 | 293 |
| 768 | 3300049823 | Ga0501044_0025222 | Ga0501044_0025222_1588_2469 | 293 |
| 769 | 3300049823 | Ga0501044_0255750 | Ga0501044_0255750_569_1450 | 293 |
| 770 | 3300049823 | Ga0501044_0420061 | Ga0501044_0420061_216_1097 | 293 |
| 771 | 3300049824 | Ga0501045_0133890 | Ga0501045_0133890_599_1483 | 293 |
| 772 | 3300050489 | nmdc:mga03683_18029_c1 | nmdc:mga03683_18029_c1_234_1151 | 293 |
| 773 | 3300050489 | nmdc:mga03683_55912_c1 | nmdc:mga03683_55912_c1_378_1262 | 293 |
| 774 | 3300050491 | nmdc:mga00v17_193875_c1 | nmdc:mga00v17_193875_c1_293_1177 | 293 |
| 775 | 3300050492 | nmdc:mga0yw44_238713_c1 | nmdc:mga0yw44_238713_c1_293_1177 | 293 |
| 776 | 3300050493 | nmdc:mga0k408_30511_c1 | nmdc:mga0k408_30511_c1_1538_2419 | 293 |
| 777 | 3300050493 | nmdc:mga0k408_6984_c1 | nmdc:mga0k408_6984_c1_491_1372 | 293 |
| 778 | 3300050494 | nmdc:mga06z11_23082_c1 | nmdc:mga06z11_23082_c1_1640_2521 | 293 |
| 779 | 3300050494 | nmdc:mga06z11_25944_c1 | nmdc:mga06z11_25944_c1_1741_2625 | 293 |
| 780 | 3300050496 | nmdc:mga07m45_232941_c1 | nmdc:mga07m45_232941_c1_158_1060 | 293 |
| 781 | 3300050496 | nmdc:mga07m45_81689_c1 | nmdc:mga07m45_81689_c1_440_1321 | 293 |
| 782 | 3300050507 | nmdc:mga05p37_135088_c1 | nmdc:mga05p37_135088_c1_1741_2622 | 293 |
| 783 | 3300050507 | nmdc:mga05p37_517672_c1 | nmdc:mga05p37_517672_c1_223_1134 | 293 |
| 784 | 3300050507 | nmdc:mga05p37_657760_c1 | nmdc:mga05p37_657760_c1_147_1034 | 293 |
| 785 | 3300050510 | nmdc:mga06r32_194571_c1 | nmdc:mga06r32_194571_c1_24_905 | 293 |
| 786 | 3300050510 | nmdc:mga06r32_586727_c1 | nmdc:mga06r32_586727_c1_161_1045 | 293 |
| 787 | 3300050510 | nmdc:mga06r32_6250_c1 | nmdc:mga06r32_6250_c1_9371_10255 | 293 |
| 788 | 3300050511 | nmdc:mga08y16_202474_c1 | nmdc:mga08y16_202474_c1_893_1789 | 293 |
| 789 | 3300050511 | nmdc:mga08y16_621396_c1 | nmdc:mga08y16_621396_c1_77_958 | 293 |
| 790 | 3300050512 | nmdc:mga0n895_374977_c1 | nmdc:mga0n895_374977_c1_370_1251 | 293 |
| 791 | 3300050512 | nmdc:mga0n895_82205_c1 | nmdc:mga0n895_82205_c1_1091_1972 | 293 |
| 792 | 3300050514 | nmdc:mga08x19_216209_c1 | nmdc:mga08x19_216209_c1_357_1238 | 293 |
| 793 | 3300050516 | nmdc:mga0sz30_3009_c1 | nmdc:mga0sz30_3009_c1_4831_5715 | 293 |
| 794 | 3300053077 | Ga0495601_0000520 | Ga0495601_0000520_9779_10702 | 293 |
| 795 | 3300053077 | Ga0495601_0013873 | Ga0495601_0013873_1352_2233 | 293 |
| 796 | 3300053077 | Ga0495601_0023318 | Ga0495601_0023318_615_1496 | 293 |
| 797 | 3300053077 | Ga0495601_0058824 | Ga0495601_0058824_1012_1896 | 293 |
| 798 | 3300053077 | Ga0495601_0186908 | Ga0495601_0186908_384_1268 | 293 |
| 799 | 3300053078 | Ga0495612_0006426 | Ga0495612_0006426_2279_3160 | 293 |
| 800 | 3300053078 | Ga0495612_0011713 | Ga0495612_0011713_1708_2589 | 293 |
| 801 | 3300053084 | Ga0495595_0001335 | Ga0495595_0001335_965_1888 | 293 |
| 802 | 3300053084 | Ga0495595_0001933 | Ga0495595_0001933_4815_5696 | 293 |
| 803 | 3300053085 | Ga0495619_0000888 | Ga0495619_0000888_13952_14875 | 293 |
| 804 | 3300053085 | Ga0495619_0017366 | Ga0495619_0017366_2544_3428 | 293 |
| 805 | 3300053085 | Ga0495619_0025991 | Ga0495619_0025991_2243_3124 | 293 |
| 806 | 3300053096 | Ga0500641_0000893 | Ga0500641_0000893_8098_8982 | 293 |
| 807 | 3300053096 | Ga0500641_0031920 | Ga0500641_0031920_774_1655 | 293 |
| 808 | 3300053125 | Ga0500618_022359 | Ga0500618_022359_338_1219 | 293 |
| 809 | 3300053131 | Ga0500652_011719 | Ga0500652_011719_906_1787 | 293 |
| 810 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1805135_1806016 | 293 |
| 811 | 3300053153 | Ga0500616_0066835 | Ga0500616_0066835_759_1640 | 293 |
| 812 | 3300054114 | Ga0501084_0052522 | Ga0501084_0052522_1345_2229 | 293 |
| 813 | 3300060353 | Ga0501082_0023544 | Ga0501082_0023544_1951_2847 | 293 |
| 814 | 3300060353 | Ga0501082_0052919 | Ga0501082_0052919_723_1607 | 293 |
| 815 | 3300060353 | Ga0501082_0220619 | Ga0501082_0220619_184_1068 | 293 |
| 816 | 3300060353 | Ga0501082_0334218 | Ga0501082_0334218_345_1229 | 293 |
| 817 | 3300061734 | Ga0530510_0009146 | Ga0530510_0009146_5034_5918 | 293 |
| 818 | 3300061734 | Ga0530510_0055716 | Ga0530510_0055716_781_1665 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
178
300
0.92
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j36-assembly1.cif.gz_A | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.9376 | 1 | 30 |
| 4dll-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9294 | 1 | 291 |
| 5x6r-assembly1.cif.gz_A | crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 | 0.9275 | 2 | 30 |
| 6pvj-assembly1.cif.gz_A | crystal structure of phqk in complex with malbrancheamide c | 0.9266 | 1 | 32 |
| 4dll-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9263 | 1 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QE62_28_195_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9833 | 2 | 162 | 3.40.50.720 |
| af_Q4DFE2_2_165_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9832 | 1 | 161 | 3.40.50.720 |
| af_Q9C991_11_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9788 | 2 | 161 | 3.40.50.720 |
| af_P0A9V8_1_162_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9737 | 3 | 158 | 3.40.50.720 |
| af_Q9XTI0_3_164_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9735 | 4 | 162 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1R1BDY8-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9855 | 1 | 104 |
GO:0016491
GO:0050661 |
| AF-A0A2V7HW24-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase | 0.9835 | 1 | 119 |
GO:0016616
GO:0050661 |
| AF-A0A3B5LQV3-F1-model_v4 | 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein | 0.9832 | 1 | 125 |
GO:0005739
GO:0006574 GO:0008442 GO:0050661 |
| AF-A0A4U3BX88-F1-model_v4 | deleted | 0.9823 | 2 | 80 |
|
| AF-A0A7S1MGW9-F1-model_v4 | 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein | 0.982 | 1 | 114 |
GO:0050661
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar