F482114

General Info

Members Datasets Scaffolds Average Seq Length
817 254 1634 228

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0107486|Ga0501073_0107486_725_1528
Length 267
Sequence MALSETTSASSRWAQATSSDEGFKFEEGDGNVSLLFHWVIVKPQLLHVGNSQSPVVIVDDFLGSLDEVLRLASELAPYPEHTNYYPGVRRVITPADGAANIYVEKACRTAAQFIGGAFDVKRFDLLEASFSMVTRAPEDLEPPQRAPHFDTTDQKHLALLHYLRVPEGSGTAFYRQRSTGIERVTDANVDQFVATARADGARLPSTSGYITGSNDFFEEIGAVEAVPDRLVIYQGSLLHSGIIPEGMALSADPQKGRLTANLFVLGH

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 1.71
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0107486 3300049589 Unclassified 1936
2 MBSR1b_contig_1955286 2162886012 Bacteria 859
3 JGI24736J21556_1007331 3300001904 Bacteria 1854
4 JGI24740J21852_10003447 3300001979 Bacteria 6950
5 JGI24740J21852_10006633 3300001979 Bacteria 4773
6 JGI24739J22299_10025283 3300001989 Bacteria 2088
7 JGI24737J22298_10002423 3300001990 Bacteria 6648
8 JGI24743J22301_10002878 3300001991 Bacteria 2654
9 JGI24743J22301_10011156 3300001991 Unclassified 1613
10 JGI24735J21928_10002689 3300002067 Bacteria 6142
11 JGI24735J21928_10005766 3300002067 Bacteria 4096
12 JGI24735J21928_10010751 3300002067 Unclassified 2909
13 JGI24735J21928_10023113 3300002067 Bacteria 1887
14 JGI24735J21928_10059336 3300002067 Unclassified 1100
15 JGI24738J21930_10016857 3300002075 Bacteria 1539
16 JGI24744J21845_10001257 3300002077 Unclassified 4994
17 JGI24744J21845_10042363 3300002077 Bacteria 850
18 JGI24034J26672_10009447 3300002239 Unclassified 1439
19 rootL2_10046054 3300003322 Bacteria 5679
20 Ga0065165_1004225 3300005262 Bacteria 9136
21 Ga0065165_1034054 3300005262 Bacteria 1579
22 Ga0065712_10209248 3300005290 Bacteria 1079
23 Ga0065715_10108411 3300005293 Bacteria 2720
24 Ga0070658_10009344 3300005327 Bacteria 7877
25 Ga0070658_10016255 3300005327 Bacteria 5954
26 Ga0070658_10400027 3300005327 Bacteria 1180
27 Ga0070658_10745542 3300005327 Bacteria 850
28 Ga0070676_10014001 3300005328 Bacteria 4402
29 Ga0070676_10021446 3300005328 Bacteria 3617
30 Ga0070676_10084651 3300005328 Bacteria 1931
31 Ga0070683_100008831 3300005329 Bacteria 8575
32 Ga0070683_100366649 3300005329 Bacteria 1372
33 Ga0070690_100000372 3300005330 Bacteria 22887
34 Ga0070670_100108264 3300005331 Bacteria 2395
35 Ga0070677_10002874 3300005333 Bacteria 5531
36 Ga0070677_10007618 3300005333 Bacteria 3621
37 Ga0068869_100026910 3300005334 Bacteria 4005
38 Ga0068869_100249548 3300005334 Bacteria 1417
39 Ga0068869_100504221 3300005334 Unclassified 1011
40 Ga0070666_10001322 3300005335 Bacteria 15028
41 Ga0070666_10007280 3300005335 Bacteria 6817
42 Ga0070666_10075877 3300005335 Bacteria 2292
43 Ga0070680_100020430 3300005336 Bacteria 5257
44 Ga0070680_100022919 3300005336 Bacteria 4975
45 Ga0070682_100013505 3300005337 Bacteria 4700
46 Ga0068868_100006105 3300005338 Bacteria 8511
47 Ga0068868_100314638 3300005338 Unclassified 1333
48 Ga0070660_100009503 3300005339 Bacteria 6842
49 Ga0070660_100019072 3300005339 Bacteria 5021
50 Ga0070660_100050624 3300005339 Bacteria 3197
51 Ga0070660_100097707 3300005339 Bacteria 2323
52 Ga0070660_100122554 3300005339 Bacteria 2075
53 Ga0070660_100156338 3300005339 Bacteria 1835
54 Ga0070660_100462048 3300005339 Bacteria 1054
55 Ga0070660_100607184 3300005339 Bacteria 915
56 Ga0070691_10000591 3300005341 Bacteria 13903
57 Ga0070687_100092717 3300005343 Bacteria 1674
58 Ga0070661_100001639 3300005344 Bacteria 15491
59 Ga0070661_100017339 3300005344 Bacteria 5108
60 Ga0070661_100022749 3300005344 Bacteria 4488
61 Ga0070661_100023434 3300005344 Bacteria 4424
62 Ga0070661_100071793 3300005344 Bacteria 2547
63 Ga0070661_100251005 3300005344 Unclassified 1365
64 Ga0070661_100289215 3300005344 Bacteria 1273
65 Ga0070692_10003378 3300005345 Bacteria 6464
66 Ga0070692_10016051 3300005345 Bacteria 3556
67 Ga0070692_10245853 3300005345 Unclassified 1068
68 Ga0070668_100003039 3300005347 Bacteria 12415
69 Ga0070668_100014575 3300005347 Bacteria 5875
70 Ga0070668_100015118 3300005347 Bacteria 5768
71 Ga0070669_100046643 3300005353 Bacteria 3160
72 Ga0070669_100053866 3300005353 Bacteria 2945
73 Ga0070669_100090386 3300005353 Bacteria 2295
74 Ga0070669_100186020 3300005353 Bacteria 1627
75 Ga0070669_100257328 3300005353 Bacteria 1392
76 Ga0070669_100384037 3300005353 Unclassified 1146
77 Ga0070675_100001540 3300005354 Bacteria 17065
78 Ga0070675_100094997 3300005354 Bacteria 2502
79 Ga0070675_100123526 3300005354 Bacteria 2201
80 Ga0070675_100226222 3300005354 Bacteria 1631
81 Ga0070671_100000133 3300005355 Bacteria 47555
82 Ga0070671_100006845 3300005355 Bacteria 9122
83 Ga0070671_100022387 3300005355 Bacteria 5161
84 Ga0070671_100033997 3300005355 Bacteria 4219
85 Ga0070671_100093459 3300005355 Bacteria 2520
86 Ga0070671_100146142 3300005355 Bacteria 1996
87 Ga0070671_100186403 3300005355 Bacteria 1758
88 Ga0070671_100227043 3300005355 Bacteria 1584
89 Ga0070674_100017773 3300005356 Bacteria 4481
90 Ga0070674_100023135 3300005356 Bacteria 4017
91 Ga0070674_100046396 3300005356 Bacteria 2972
92 Ga0070673_100011495 3300005364 Bacteria 6043
93 Ga0070673_100013139 3300005364 Bacteria 5716
94 Ga0070673_100017434 3300005364 Bacteria 5107
95 Ga0070673_100022869 3300005364 Bacteria 4559
96 Ga0070673_100214633 3300005364 Bacteria 1663
97 Ga0070673_100311562 3300005364 Bacteria 1388
98 Ga0070673_100571865 3300005364 Bacteria 1028
99 Ga0070673_100597799 3300005364 Bacteria 1006
100 Ga0070659_100001395 3300005366 Bacteria 17434
101 Ga0070659_100002985 3300005366 Bacteria 12048
102 Ga0070659_100016088 3300005366 Bacteria 5612
103 Ga0070659_100018443 3300005366 Bacteria 5267
104 Ga0070659_100023508 3300005366 Bacteria 4717
105 Ga0070659_100025237 3300005366 Bacteria 4562
106 Ga0070659_100031021 3300005366 Bacteria 4138
107 Ga0070659_100068563 3300005366 Bacteria 2814
108 Ga0070659_100079825 3300005366 Bacteria 2612
109 Ga0070659_100108353 3300005366 Bacteria 2241
110 Ga0070659_100148411 3300005366 Bacteria 1912
111 Ga0070667_100002695 3300005367 Bacteria 15377
112 Ga0070667_100002716 3300005367 Bacteria 15316
113 Ga0070667_100023262 3300005367 Bacteria 5140
114 Ga0070667_100084742 3300005367 Bacteria 2717
115 Ga0070667_100224089 3300005367 Bacteria 1674
116 Ga0070667_100334131 3300005367 Bacteria 1369
117 Ga0070667_100514996 3300005367 Bacteria 1097
118 Ga0070714_100003912 3300005435 Bacteria 11195
119 Ga0070714_100013317 3300005435 Bacteria 6589
120 Ga0070714_100090727 3300005435 Bacteria 2676
121 Ga0070714_100511554 3300005435 Bacteria 1146
122 Ga0070713_100030952 3300005436 Unclassified 4256
123 Ga0070713_100117799 3300005436 Unclassified 2324
124 Ga0070713_100176764 3300005436 Bacteria 1916
125 Ga0070713_100418127 3300005436 Bacteria 1254
126 Ga0070663_100003732 3300005455 Bacteria 8832
127 Ga0070663_100012048 3300005455 Bacteria 5455
128 Ga0070663_100143547 3300005455 Bacteria 1825
129 Ga0070663_100239619 3300005455 Bacteria 1431
130 Ga0070678_100002264 3300005456 Bacteria 10481
131 Ga0070678_100007584 3300005456 Bacteria 6445
132 Ga0070678_100008234 3300005456 Bacteria 6234
133 Ga0070678_100453841 3300005456 Unclassified 1123
134 Ga0070678_100533831 3300005456 Bacteria 1039
135 Ga0070678_100689410 3300005456 Bacteria 919
136 Ga0070678_100851276 3300005456 Bacteria 831
137 Ga0070662_100005556 3300005457 Bacteria 8058
138 Ga0070662_100015830 3300005457 Bacteria 5058
139 Ga0070662_100016108 3300005457 Bacteria 5014
140 Ga0070662_100022680 3300005457 Bacteria 4300
141 Ga0070662_100028677 3300005457 Bacteria 3875
142 Ga0070662_100057314 3300005457 Bacteria 2831
143 Ga0070662_100081721 3300005457 Bacteria 2408
144 Ga0070662_100109166 3300005457 Bacteria 2105
145 Ga0070662_100119509 3300005457 Unclassified 2018
146 Ga0070662_100509176 3300005457 Bacteria 1005
147 Ga0070681_10180135 3300005458 Bacteria 2035
148 Ga0068867_100010238 3300005459 Bacteria 6615
149 Ga0068867_100157728 3300005459 Bacteria 1787
150 Ga0068867_100315326 3300005459 Bacteria 1294
151 Ga0070679_100088733 3300005530 Unclassified 3079
152 Ga0070679_100123063 3300005530 Bacteria 2577
153 Ga0070684_100015548 3300005535 Bacteria 6201
154 Ga0068853_100011005 3300005539 Bacteria 7337
155 Ga0068853_100030553 3300005539 Bacteria 4552
156 Ga0068853_100047732 3300005539 Bacteria 3675
157 Ga0068853_100071057 3300005539 Bacteria 3030
158 Ga0068853_100255442 3300005539 Bacteria 1610
159 Ga0068853_100384556 3300005539 Unclassified 1311
160 Ga0068853_100615215 3300005539 Unclassified 1032
161 Ga0070672_100000508 3300005543 Bacteria 22754
162 Ga0070672_100015904 3300005543 Bacteria 5373
163 Ga0070672_100020325 3300005543 Bacteria 4841
164 Ga0070672_100030737 3300005543 Bacteria 4038
165 Ga0070672_100093613 3300005543 Bacteria 2428
166 Ga0070672_100110670 3300005543 Bacteria 2238
167 Ga0070672_100112369 3300005543 Bacteria 2222
168 Ga0070686_100011597 3300005544 Bacteria 5003
169 Ga0070686_100289090 3300005544 Bacteria 1212
170 Ga0070695_100045757 3300005545 Bacteria 2791
171 Ga0070693_100032881 3300005547 Bacteria 2857
172 Ga0070665_100001570 3300005548 Bacteria 26346
173 Ga0070665_100007276 3300005548 Bacteria 11250
174 Ga0070665_100017434 3300005548 Bacteria 7211
175 Ga0070665_100039949 3300005548 Bacteria 4717
176 Ga0070665_100281972 3300005548 Bacteria 1663
177 Ga0070665_100471067 3300005548 Bacteria 1266
178 Ga0070665_100617301 3300005548 Unclassified 1097
179 Ga0070704_100276634 3300005549 Bacteria 1389
180 Ga0068855_100018311 3300005563 Bacteria 8413
181 Ga0068855_100028204 3300005563 Bacteria 6715
182 Ga0068855_100075768 3300005563 Bacteria 3905
183 Ga0068855_100082104 3300005563 Bacteria 3736
184 Ga0068855_100217252 3300005563 Bacteria 2145
185 Ga0070664_100021628 3300005564 Bacteria 5303
186 Ga0070664_100076526 3300005564 Bacteria 2876
187 Ga0070664_100196724 3300005564 Bacteria 1797
188 Ga0068857_100006194 3300005577 Bacteria 10226
189 Ga0068857_100010908 3300005577 Bacteria 7910
190 Ga0068857_100012406 3300005577 Bacteria 7419
191 Ga0068857_100120528 3300005577 Bacteria 2361
192 Ga0068857_100201239 3300005577 Bacteria 1816
193 Ga0068857_100864862 3300005577 Bacteria 866
194 Ga0068854_100002562 3300005578 Bacteria 11248
195 Ga0068854_100017512 3300005578 Bacteria 4794
196 Ga0068854_100027817 3300005578 Bacteria 3901
197 Ga0068854_100042407 3300005578 Bacteria 3221
198 Ga0068854_100042640 3300005578 Bacteria 3212
199 Ga0068854_100357164 3300005578 Bacteria 1198
200 Ga0068854_100363845 3300005578 Bacteria 1187
201 Ga0068854_100394008 3300005578 Unclassified 1144
202 Ga0068856_100039475 3300005614 Bacteria 4635
203 Ga0068856_100084651 3300005614 Bacteria 3150
204 Ga0068856_100167035 3300005614 Bacteria 2211
205 Ga0068856_100169841 3300005614 Bacteria 2193
206 Ga0068852_100002719 3300005616 Bacteria 12221
207 Ga0068852_100004368 3300005616 Bacteria 9987
208 Ga0068852_100027526 3300005616 Bacteria 4634
209 Ga0068852_100123940 3300005616 Bacteria 2370
210 Ga0068852_100378341 3300005616 Bacteria 1388
211 Ga0068852_100505077 3300005616 Bacteria 1204
212 Ga0068859_100007797 3300005617 Bacteria 10866
213 Ga0068859_100021403 3300005617 Bacteria 6489
214 Ga0068859_100065596 3300005617 Bacteria 3664
215 Ga0068859_100240011 3300005617 Bacteria 1901
216 Ga0068859_100745419 3300005617 Unclassified 1068
217 Ga0068864_100024621 3300005618 Bacteria 5064
218 Ga0068864_100036187 3300005618 Bacteria 4206
219 Ga0068864_100052464 3300005618 Bacteria 3515
220 Ga0068864_100628455 3300005618 Bacteria 1044
221 Ga0068866_10008601 3300005718 Bacteria 4310
222 Ga0068866_10362256 3300005718 Bacteria 924
223 Ga0068861_100202201 3300005719 Bacteria 1668
224 Ga0068861_100330725 3300005719 Bacteria 1330
225 Ga0068851_10004880 3300005834 Bacteria 6073
226 Ga0068851_10007677 3300005834 Bacteria 4962
227 Ga0068851_10013107 3300005834 Bacteria 3922
228 Ga0068870_10075501 3300005840 Bacteria 1849
229 Ga0068863_100004250 3300005841 Bacteria 14143
230 Ga0068863_100021580 3300005841 Bacteria 6142
231 Ga0068863_100024464 3300005841 Bacteria 5759
232 Ga0068863_100059669 3300005841 Bacteria 3609
233 Ga0068863_100070676 3300005841 Bacteria 3301
234 Ga0068858_100027749 3300005842 Bacteria 5260
235 Ga0068858_100031270 3300005842 Bacteria 4942
236 Ga0068858_100034598 3300005842 Bacteria 4686
237 Ga0068860_100002940 3300005843 Bacteria 17612
238 Ga0068860_100007433 3300005843 Bacteria 10956
239 Ga0068860_100020269 3300005843 Bacteria 6441
240 Ga0068860_100059454 3300005843 Bacteria 3633
241 Ga0068860_100065596 3300005843 Bacteria 3447
242 Ga0068860_100225499 3300005843 Bacteria 1820
243 Ga0068862_100001236 3300005844 Bacteria 24103
244 Ga0068862_100019700 3300005844 Bacteria 5632
245 Ga0068862_100040582 3300005844 Unclassified 3956
246 Ga0068862_100057085 3300005844 Bacteria 3347
247 Ga0068862_100663402 3300005844 Bacteria 1007
248 Ga0070717_10017489 3300006028 Bacteria 5580
249 Ga0070717_10369018 3300006028 Unclassified 1286
250 Ga0075362_10008159 3300006177 Bacteria 3997
251 Ga0097621_100001066 3300006237 Bacteria 19201
252 Ga0097621_100020516 3300006237 Bacteria 5092
253 Ga0097621_100034112 3300006237 Bacteria 4057
254 Ga0097621_100053301 3300006237 Bacteria 3297
255 Ga0097621_100056167 3300006237 Bacteria 3216
256 Ga0068871_100013369 3300006358 Bacteria 6090
257 Ga0068871_100062010 3300006358 Bacteria 3055
258 Ga0068871_100145712 3300006358 Bacteria 2016
259 Ga0068871_100417489 3300006358 Bacteria 1198
260 Ga0068871_100435882 3300006358 Bacteria 1172
261 Ga0068865_100009419 3300006881 Bacteria 6056
262 Ga0068865_100022889 3300006881 Bacteria 4084
263 Ga0068865_100024532 3300006881 Bacteria 3957
264 Ga0097620_100007797 3300006931 Bacteria 10866
265 Ga0097620_100021403 3300006931 Bacteria 6489
266 Ga0097620_100065596 3300006931 Bacteria 3664
267 Ga0097620_100239998 3300006931 Bacteria 1901
268 Ga0097620_100745447 3300006931 Unclassified 1068
269 Ga0099795_10000012 3300007788 Bacteria 71748
270 Ga0105250_10013670 3300009092 Bacteria 3344
271 Ga0105240_10025052 3300009093 Bacteria 7853
272 Ga0105240_10097729 3300009093 Bacteria 3577
273 Ga0105240_10431890 3300009093 Bacteria 1478
274 Ga0105245_10006189 3300009098 Bacteria 10534
275 Ga0105245_10024409 3300009098 Bacteria 5309
276 Ga0105245_10263773 3300009098 Bacteria 1677
277 Ga0105247_10070455 3300009101 Bacteria 2184
278 Ga0105247_10336126 3300009101 Bacteria 1058
279 Ga0105243_10130874 3300009148 Bacteria 2128
280 Ga0105243_10268008 3300009148 Bacteria 1532
281 Ga0105241_10779060 3300009174 Bacteria 879
282 Ga0105242_10012652 3300009176 Bacteria 6498
283 Ga0105242_10074694 3300009176 Bacteria 2821
284 Ga0105248_10005539 3300009177 Bacteria 13870
285 Ga0105248_10041825 3300009177 Bacteria 5139
286 Ga0105248_10127095 3300009177 Bacteria 2876
287 Ga0105248_10297826 3300009177 Bacteria 1816
288 Ga0105248_10947608 3300009177 Bacteria 972
289 Ga0105237_10002966 3300009545 Bacteria 20537
290 Ga0105238_10015009 3300009551 Bacteria 7843
291 Ga0105238_10066153 3300009551 Bacteria 3616
292 Ga0105249_10000736 3300009553 Bacteria 29619
293 Ga0105249_10029343 3300009553 Bacteria 4967
294 Ga0105249_10382629 3300009553 Bacteria 1433
295 Ga0099796_10000083 3300010159 Bacteria 15962
296 Ga0105239_10055279 3300010375 Bacteria 4354
297 Ga0105239_10108221 3300010375 Bacteria 3080
298 Ga0105239_10218052 3300010375 Unclassified 2139
299 Ga0105246_10172669 3300011119 Bacteria 1657
300 Ga0157373_10012285 3300013100 Bacteria 6295
301 Ga0157373_10025795 3300013100 Bacteria 4248
302 Ga0157373_10027382 3300013100 Bacteria 4111
303 Ga0157373_10065984 3300013100 Bacteria 2561
304 Ga0157373_10330552 3300013100 Bacteria 1085
305 Ga0157373_10350335 3300013100 Bacteria 1053
306 Ga0157371_10012732 3300013102 Bacteria 6413
307 Ga0157371_10013291 3300013102 Bacteria 6260
308 Ga0157371_10013865 3300013102 Bacteria 6106
309 Ga0157371_10018111 3300013102 Bacteria 5214
310 Ga0157371_10046221 3300013102 Bacteria 3096
311 Ga0157371_10051550 3300013102 Bacteria 2924
312 Ga0157371_10085902 3300013102 Bacteria 2229
313 Ga0157371_10109730 3300013102 Unclassified 1958
314 Ga0157371_10132754 3300013102 Bacteria 1772
315 Ga0157371_10265548 3300013102 Bacteria 1238
316 Ga0157370_10005251 3300013104 Bacteria 14565
317 Ga0157370_10006964 3300013104 Bacteria 12349
318 Ga0157370_10029303 3300013104 Bacteria 5405
319 Ga0157370_10045194 3300013104 Bacteria 4227
320 Ga0157370_10089549 3300013104 Bacteria 2890
321 Ga0157370_10429350 3300013104 Bacteria 1215
322 Ga0157369_10009651 3300013105 Bacteria 11038
323 Ga0157369_10019504 3300013105 Bacteria 7589
324 Ga0157369_10022068 3300013105 Bacteria 7113
325 Ga0157369_10029230 3300013105 Bacteria 6092
326 Ga0157369_10099614 3300013105 Bacteria 3098
327 Ga0157374_10034435 3300013296 Bacteria 4626
328 Ga0157374_10182447 3300013296 Bacteria 2051
329 Ga0157378_10012800 3300013297 Bacteria 7344
330 Ga0157378_10039291 3300013297 Bacteria 4197
331 Ga0157378_10050685 3300013297 Bacteria 3694
332 Ga0157378_10085830 3300013297 Bacteria 2852
333 Ga0163162_10026950 3300013306 Bacteria 5683
334 Ga0163162_10027173 3300013306 Bacteria 5658
335 Ga0163162_10035343 3300013306 Bacteria 4977
336 Ga0163162_10347447 3300013306 Bacteria 1616
337 Ga0157372_10002170 3300013307 Bacteria 21361
338 Ga0157372_10028152 3300013307 Bacteria 6131
339 Ga0157372_10443577 3300013307 Bacteria 1513
340 Ga0157375_10064313 3300013308 Bacteria 3652
341 Ga0157375_10586987 3300013308 Bacteria 1274
342 Ga0163163_10002278 3300014325 Bacteria 16185
343 Ga0163163_10028183 3300014325 Bacteria 5389
344 Ga0157380_10063649 3300014326 Bacteria 2958
345 Ga0157377_10014652 3300014745 Bacteria 3992
346 Ga0157379_10015040 3300014968 Bacteria 6787
347 Ga0157379_10178394 3300014968 Bacteria 1919
348 Ga0157379_10184972 3300014968 Bacteria 1882
349 Ga0157379_10263435 3300014968 Bacteria 1567
350 Ga0157376_10003691 3300014969 Bacteria 10574
351 Ga0183365_10003 3300015684 Bacteria 414944
352 Ga0163161_10104527 3300017792 Bacteria 2111
353 Ga0163161_10217426 3300017792 Bacteria 1478
354 Ga0209148_1001472 3300025254 Bacteria 11850
355 Ga0209455_1000715 3300025272 Bacteria 19244
356 Ga0207697_10074365 3300025315 Bacteria 1427
357 Ga0207656_10002175 3300025321 Bacteria 6555
358 Ga0207656_10006429 3300025321 Bacteria 4223
359 Ga0207656_10029384 3300025321 Bacteria 2263
360 Ga0207696_1013078 3300025711 Bacteria 2909
361 Ga0207682_10000432 3300025893 Bacteria 19371
362 Ga0207682_10017332 3300025893 Bacteria 2813
363 Ga0207642_10042367 3300025899 Bacteria 2000
364 Ga0207642_10062800 3300025899 Bacteria 1734
365 Ga0207688_10016493 3300025901 Bacteria 4007
366 Ga0207688_10053551 3300025901 Bacteria 2263
367 Ga0207680_10002498 3300025903 Bacteria 8577
368 Ga0207680_10004188 3300025903 Bacteria 6825
369 Ga0207680_10301945 3300025903 Bacteria 1116
370 Ga0207647_10000679 3300025904 Bacteria 26722
371 Ga0207647_10000863 3300025904 Bacteria 23506
372 Ga0207647_10002147 3300025904 Bacteria 15070
373 Ga0207647_10039118 3300025904 Bacteria 2995
374 Ga0207647_10102250 3300025904 Bacteria 1699
375 Ga0207647_10149302 3300025904 Unclassified 1367
376 Ga0207699_10061343 3300025906 Bacteria 2262
377 Ga0207645_10018089 3300025907 Bacteria 4645
378 Ga0207645_10019269 3300025907 Bacteria 4475
379 Ga0207645_10051952 3300025907 Bacteria 2619
380 Ga0207645_10090500 3300025907 Bacteria 1967
381 Ga0207645_10100028 3300025907 Bacteria 1870
382 Ga0207705_10000030 3300025909 Bacteria 239341
383 Ga0207705_10002081 3300025909 Bacteria 15563
384 Ga0207705_10002682 3300025909 Bacteria 13631
385 Ga0207705_10014671 3300025909 Bacteria 5637
386 Ga0207705_10051467 3300025909 Unclassified 2964
387 Ga0207705_10114818 3300025909 Bacteria 1992
388 Ga0207705_10151875 3300025909 Bacteria 1736
389 Ga0207707_10185595 3300025912 Bacteria 1815
390 Ga0207695_10009193 3300025913 Bacteria 12256
391 Ga0207695_10009479 3300025913 Bacteria 12041
392 Ga0207695_10082441 3300025913 Bacteria 3251
393 Ga0207695_10181857 3300025913 Bacteria 2023
394 Ga0207695_10219895 3300025913 Bacteria 1807
395 Ga0207693_10089561 3300025915 Bacteria 2412
396 Ga0207693_10105906 3300025915 Bacteria 2205
397 Ga0207660_10035374 3300025917 Bacteria 3468
398 Ga0207660_10550875 3300025917 Bacteria 938
399 Ga0207657_10001393 3300025919 Bacteria 25775
400 Ga0207657_10002144 3300025919 Bacteria 21379
401 Ga0207657_10009627 3300025919 Bacteria 9695
402 Ga0207657_10013449 3300025919 Bacteria 8028
403 Ga0207657_10016365 3300025919 Bacteria 7154
404 Ga0207657_10020045 3300025919 Bacteria 6334
405 Ga0207657_10112200 3300025919 Bacteria 2250
406 Ga0207657_10209774 3300025919 Bacteria 1564
407 Ga0207649_10000152 3300025920 Bacteria 56840
408 Ga0207649_10010791 3300025920 Bacteria 5022
409 Ga0207649_10044864 3300025920 Unclassified 2708
410 Ga0207649_10051361 3300025920 Bacteria 2553
411 Ga0207652_10073659 3300025921 Unclassified 2972
412 Ga0207681_10021582 3300025923 Bacteria 4096
413 Ga0207681_10050042 3300025923 Bacteria 2826
414 Ga0207681_10086245 3300025923 Bacteria 2230
415 Ga0207681_10088176 3300025923 Bacteria 2209
416 Ga0207681_10277546 3300025923 Bacteria 1318
417 Ga0207681_10330759 3300025923 Bacteria 1214
418 Ga0207694_10063850 3300025924 Bacteria 2869
419 Ga0207694_10067081 3300025924 Bacteria 2800
420 Ga0207694_10068541 3300025924 Bacteria 2770
421 Ga0207694_10153647 3300025924 Bacteria 1855
422 Ga0207650_10386974 3300025925 Bacteria 1156
423 Ga0207650_10593617 3300025925 Bacteria 931
424 Ga0207659_10171066 3300025926 Bacteria 1714
425 Ga0207687_10006558 3300025927 Bacteria 7681
426 Ga0207700_10021955 3300025928 Bacteria 4371
427 Ga0207700_10398503 3300025928 Bacteria 1206
428 Ga0207664_10012958 3300025929 Bacteria 5974
429 Ga0207664_10040626 3300025929 Bacteria 3619
430 Ga0207664_10153157 3300025929 Bacteria 1960
431 Ga0207644_10000256 3300025931 Bacteria 35858
432 Ga0207644_10000612 3300025931 Bacteria 22729
433 Ga0207644_10001341 3300025931 Bacteria 15808
434 Ga0207644_10004030 3300025931 Bacteria 9532
435 Ga0207644_10034737 3300025931 Bacteria 3529
436 Ga0207644_10227177 3300025931 Unclassified 1482
437 Ga0207644_10628796 3300025931 Bacteria 892
438 Ga0207690_10001622 3300025932 Bacteria 13977
439 Ga0207690_10002791 3300025932 Bacteria 10534
440 Ga0207690_10014408 3300025932 Bacteria 4776
441 Ga0207690_10014923 3300025932 Bacteria 4703
442 Ga0207690_10020577 3300025932 Bacteria 4080
443 Ga0207690_10047280 3300025932 Bacteria 2854
444 Ga0207690_10173191 3300025932 Bacteria 1618
445 Ga0207690_10257462 3300025932 Bacteria 1351
446 Ga0207690_10319985 3300025932 Bacteria 1219
447 Ga0207706_10004341 3300025933 Bacteria 13312
448 Ga0207706_10006433 3300025933 Bacteria 10909
449 Ga0207706_10029148 3300025933 Bacteria 4928
450 Ga0207706_10043488 3300025933 Bacteria 3980
451 Ga0207706_10061601 3300025933 Bacteria 3304
452 Ga0207706_10072096 3300025933 Bacteria 3038
453 Ga0207706_10072514 3300025933 Bacteria 3028
454 Ga0207706_10114718 3300025933 Bacteria 2370
455 Ga0207686_10466356 3300025934 Bacteria 974
456 Ga0207709_10016828 3300025935 Bacteria 4073
457 Ga0207669_10040202 3300025937 Bacteria 2711
458 Ga0207669_10275344 3300025937 Bacteria 1266
459 Ga0207704_10051128 3300025938 Bacteria 2497
460 Ga0207704_10206382 3300025938 Bacteria 1442
461 Ga0207665_10036251 3300025939 Bacteria 3279
462 Ga0207691_10004927 3300025940 Bacteria 12883
463 Ga0207691_10010277 3300025940 Bacteria 8977
464 Ga0207691_10049217 3300025940 Bacteria 3862
465 Ga0207691_10096332 3300025940 Bacteria 2645
466 Ga0207691_10192329 3300025940 Bacteria 1779
467 Ga0207691_10200753 3300025940 Bacteria 1736
468 Ga0207711_10000786 3300025941 Bacteria 31183
469 Ga0207711_10006833 3300025941 Bacteria 9590
470 Ga0207711_10010887 3300025941 Bacteria 7559
471 Ga0207711_10014076 3300025941 Bacteria 6646
472 Ga0207711_10152825 3300025941 Bacteria 2084
473 Ga0207689_10006523 3300025942 Bacteria 10297
474 Ga0207689_10024680 3300025942 Bacteria 5040
475 Ga0207661_10111180 3300025944 Bacteria 2317
476 Ga0207661_10194271 3300025944 Bacteria 1781
477 Ga0207679_10098839 3300025945 Bacteria 2277
478 Ga0207679_10127558 3300025945 Bacteria 2036
479 Ga0207679_10166577 3300025945 Bacteria 1810
480 Ga0207667_10003910 3300025949 Bacteria 18327
481 Ga0207667_10005076 3300025949 Bacteria 16084
482 Ga0207667_10315987 3300025949 Bacteria 1595
483 Ga0207667_10360397 3300025949 Archaea 1482
484 Ga0207667_10507943 3300025949 Bacteria 1222
485 Ga0207651_10002692 3300025960 Bacteria 8507
486 Ga0207651_10005188 3300025960 Bacteria 6654
487 Ga0207651_10010105 3300025960 Bacteria 5210
488 Ga0207651_10270023 3300025960 Bacteria 1400
489 Ga0207651_10538977 3300025960 Bacteria 1013
490 Ga0207651_10629788 3300025960 Bacteria 940
491 Ga0207712_10001041 3300025961 Bacteria 19563
492 Ga0207712_10001197 3300025961 Bacteria 17933
493 Ga0207712_10046315 3300025961 Bacteria 3015
494 Ga0207712_11004192 3300025961 Bacteria 740
495 Ga0207668_10000150 3300025972 Bacteria 48022
496 Ga0207668_10017819 3300025972 Bacteria 4457
497 Ga0207668_10035320 3300025972 Bacteria 3327
498 Ga0207668_10202079 3300025972 Bacteria 1583
499 Ga0207668_10274784 3300025972 Bacteria 1379
500 Ga0207640_10010982 3300025981 Bacteria 5112
501 Ga0207640_10038621 3300025981 Bacteria 3015
502 Ga0207640_10058990 3300025981 Unclassified 2531
503 Ga0207640_10063719 3300025981 Bacteria 2451
504 Ga0207640_10127815 3300025981 Bacteria 1832
505 Ga0207640_10322069 3300025981 Bacteria 1231
506 Ga0207640_10393879 3300025981 Bacteria 1126
507 Ga0207658_10009569 3300025986 Bacteria 6577
508 Ga0207658_10010086 3300025986 Bacteria 6416
509 Ga0207658_10023979 3300025986 Bacteria 4263
510 Ga0207658_10029542 3300025986 Bacteria 3872
511 Ga0207658_10076034 3300025986 Bacteria 2557
512 Ga0207658_10205252 3300025986 Bacteria 1648
513 Ga0207658_10351152 3300025986 Bacteria 1284
514 Ga0207658_10868658 3300025986 Unclassified 820
515 Ga0207677_10005504 3300026023 Bacteria 6879
516 Ga0207677_10015993 3300026023 Bacteria 4430
517 Ga0207677_10028779 3300026023 Bacteria 3521
518 Ga0207677_10616686 3300026023 Unclassified 954
519 Ga0207703_10002851 3300026035 Bacteria 14738
520 Ga0207703_10004952 3300026035 Bacteria 10812
521 Ga0207703_10008173 3300026035 Bacteria 8267
522 Ga0207703_10011191 3300026035 Bacteria 6980
523 Ga0207639_10065987 3300026041 Bacteria 2811
524 Ga0207639_10066387 3300026041 Bacteria 2804
525 Ga0207639_10069081 3300026041 Bacteria 2755
526 Ga0207639_10315518 3300026041 Unclassified 1386
527 Ga0207678_10000357 3300026067 Bacteria 41546
528 Ga0207678_10005235 3300026067 Bacteria 11617
529 Ga0207678_10037186 3300026067 Bacteria 4236
530 Ga0207678_10141934 3300026067 Bacteria 2050
531 Ga0207678_10187647 3300026067 Unclassified 1766
532 Ga0207678_10383557 3300026067 Bacteria 1215
533 Ga0207678_10401343 3300026067 Bacteria 1187
534 Ga0207702_10019249 3300026078 Bacteria 5647
535 Ga0207702_10029914 3300026078 Bacteria 4535
536 Ga0207641_10008369 3300026088 Bacteria 8548
537 Ga0207641_10024248 3300026088 Bacteria 5001
538 Ga0207641_10049987 3300026088 Bacteria 3535
539 Ga0207641_10272238 3300026088 Bacteria 1589
540 Ga0207648_10001898 3300026089 Bacteria 22839
541 Ga0207648_10004044 3300026089 Bacteria 15225
542 Ga0207648_10012040 3300026089 Bacteria 8114
543 Ga0207648_10133209 3300026089 Bacteria 2188
544 Ga0207676_10001863 3300026095 Bacteria 15429
545 Ga0207676_10023976 3300026095 Bacteria 4510
546 Ga0207676_10707215 3300026095 Bacteria 977
547 Ga0207674_10006838 3300026116 Bacteria 13376
548 Ga0207674_10018116 3300026116 Bacteria 7662
549 Ga0207674_10039515 3300026116 Bacteria 4890
550 Ga0207674_10172015 3300026116 Bacteria 2119
551 Ga0207675_100139271 3300026118 Bacteria 2304
552 Ga0207683_10003703 3300026121 Bacteria 13269
553 Ga0207683_10005306 3300026121 Bacteria 11052
554 Ga0207683_10005914 3300026121 Bacteria 10484
555 Ga0207683_10015690 3300026121 Bacteria 6448
556 Ga0207683_10382617 3300026121 Bacteria 1294
557 Ga0207698_10001925 3300026142 Bacteria 12173
558 Ga0207698_10006257 3300026142 Bacteria 7407
559 Ga0207698_10009430 3300026142 Bacteria 6225
560 Ga0207698_10109780 3300026142 Bacteria 2309
561 Ga0207698_10351859 3300026142 Bacteria 1392
562 Ga0207698_10561082 3300026142 Bacteria 1121
563 Ga0207698_10752368 3300026142 Bacteria 973
564 Ga0209179_1000002 3300027512 Bacteria 124932
565 Ga0268266_10002617 3300028379 Bacteria 19055
566 Ga0268266_10006044 3300028379 Bacteria 11158
567 Ga0268266_10011239 3300028379 Bacteria 7791
568 Ga0268266_10071724 3300028379 Bacteria 3002
569 Ga0268266_10112682 3300028379 Bacteria 2411
570 Ga0268266_10120020 3300028379 Bacteria 2339
571 Ga0268265_10001717 3300028380 Bacteria 17736
572 Ga0268265_10001931 3300028380 Bacteria 16450
573 Ga0268264_10001663 3300028381 Bacteria 20498
574 Ga0268264_10002751 3300028381 Bacteria 15360
575 Ga0268264_10011672 3300028381 Bacteria 7245
576 Ga0268264_10020009 3300028381 Bacteria 5468
577 Ga0268264_10054206 3300028381 Bacteria 3348
578 Ga0268264_10467466 3300028381 Unclassified 1225
579 Ga0307515_10270976 3300028794 Bacteria 1419
580 Ga0307408_100073332 3300031548 Bacteria 2537
581 Ga0307408_100306099 3300031548 Bacteria 1333
582 Ga0307408_100347373 3300031548 Bacteria 1258
583 Ga0307405_10052500 3300031731 Bacteria 2535
584 Ga0307405_10098607 3300031731 Bacteria 1954
585 Ga0307405_10325013 3300031731 Bacteria 1177
586 Ga0307413_10004513 3300031824 Bacteria 6069
587 Ga0307413_10016044 3300031824 Bacteria 3856
588 Ga0307413_10033457 3300031824 Unclassified 2927
589 Ga0307413_10210685 3300031824 Bacteria 1411
590 Ga0307410_10000301 3300031852 Bacteria 19232
591 Ga0307410_10003678 3300031852 Bacteria 7750
592 Ga0307410_10007204 3300031852 Bacteria 6070
593 Ga0307410_10058216 3300031852 Bacteria 2634
594 Ga0307410_10133606 3300031852 Unclassified 1826
595 Ga0307410_10275792 3300031852 Bacteria 1317
596 Ga0307410_10612827 3300031852 Bacteria 909
597 Ga0307406_10048229 3300031901 Bacteria 2688
598 Ga0307406_10154996 3300031901 Bacteria 1639
599 Ga0307406_10627663 3300031901 Unclassified 889
600 Ga0307407_10018510 3300031903 Bacteria 3524
601 Ga0307407_10038050 3300031903 Bacteria 2663
602 Ga0307407_10128067 3300031903 Bacteria 1620
603 Ga0307407_10182478 3300031903 Bacteria 1392
604 Ga0307407_10249091 3300031903 Bacteria 1216
605 Ga0307412_10302312 3300031911 Bacteria 1265
606 Ga0307412_10319136 3300031911 Bacteria 1235
607 Ga0307412_10506615 3300031911 Bacteria 1006
608 Ga0307409_100108544 3300031995 Bacteria 2321
609 Ga0307409_100321058 3300031995 Bacteria 1449
610 Ga0307409_100371767 3300031995 Bacteria 1356
611 Ga0307416_100053462 3300032002 Bacteria 3240
612 Ga0307416_100100351 3300032002 Bacteria 2517
613 Ga0307416_100107166 3300032002 Bacteria 2451
614 Ga0307414_10010376 3300032004 Bacteria 5401
615 Ga0307414_10061573 3300032004 Bacteria 2659
616 Ga0307414_10088111 3300032004 Bacteria 2296
617 Ga0307414_10243276 3300032004 Bacteria 1491
618 Ga0307411_10006353 3300032005 Bacteria 5908
619 Ga0307411_10010937 3300032005 Bacteria 4867
620 Ga0307411_10018508 3300032005 Bacteria 3998
621 Ga0307411_10074673 3300032005 Bacteria 2311
622 Ga0307411_10112833 3300032005 Bacteria 1949
623 Ga0307415_100269977 3300032126 Bacteria 1393
624 Ga0373958_0019735 3300034819 Bacteria 1235
625 Ga0373957_0050393 3300035120 Bacteria 1591
626 Ga0373955_0004706 3300035172 Bacteria 6065
627 Ga0373931_0018334 3300035691 Bacteria 3480
628 Ga0373937_0011592 3300036401 Bacteria 7741
629 Ga0395899_0013125 3300037312 Bacteria 6336
630 Ga0395899_0017627 3300037312 Bacteria 5438
631 Ga0395899_0021199 3300037312 Bacteria 4929
632 Ga0395899_0025462 3300037312 Bacteria 4467
633 Ga0395899_0029770 3300037312 Bacteria 4107
634 Ga0395899_0060542 3300037312 Unclassified 2790
635 Ga0395899_0095888 3300037312 Bacteria 2145
636 Ga0395899_0287891 3300037312 Bacteria 1115
637 Ga0395899_0359173 3300037312 Bacteria 972
638 Ga0395900_0012282 3300037418 Bacteria 8758
639 Ga0395900_0015879 3300037418 Bacteria 7670
640 Ga0395900_0018035 3300037418 Bacteria 7206
641 Ga0395900_0020127 3300037418 Bacteria 6807
642 Ga0395900_0023861 3300037418 Bacteria 6258
643 Ga0395900_0030696 3300037418 Bacteria 5519
644 Ga0395900_0034692 3300037418 Bacteria 5197
645 Ga0395900_0038715 3300037418 Bacteria 4914
646 Ga0395900_0039516 3300037418 Bacteria 4861
647 Ga0395900_0048587 3300037418 Bacteria 4371
648 Ga0395900_0053718 3300037418 Bacteria 4147
649 Ga0395900_0068396 3300037418 Bacteria 3649
650 Ga0395900_0080765 3300037418 Bacteria 3341
651 Ga0395900_0200490 3300037418 Bacteria 2019
652 Ga0395900_0215893 3300037418 Bacteria 1935
653 Ga0395900_0234664 3300037418 Bacteria 1843
654 Ga0395900_0243468 3300037418 Bacteria 1803
655 Ga0395900_0303396 3300037418 Bacteria 1582
656 Ga0395900_0330183 3300037418 Bacteria 1503
657 Ga0395898_0002665 3300037466 Bacteria 20700
658 Ga0395898_0022272 3300037466 Bacteria 6418
659 Ga0395898_0023301 3300037466 Bacteria 6257
660 Ga0395898_0034986 3300037466 Bacteria 4999
661 Ga0395898_0040872 3300037466 Bacteria 4583
662 Ga0395898_0073643 3300037466 Bacteria 3300
663 Ga0395898_0110291 3300037466 Bacteria 2638
664 Ga0395898_0129186 3300037466 Bacteria 2420
665 Ga0395898_0147322 3300037466 Unclassified 2253
666 Ga0395898_0170441 3300037466 Bacteria 2081
667 Ga0395898_0562902 3300037466 Bacteria 1082
668 Ga0395905_0001093 3300037471 Bacteria 34106
669 Ga0395905_0005271 3300037471 Bacteria 13220
670 Ga0395905_0017553 3300037471 Bacteria 6793
671 Ga0395905_0018553 3300037471 Bacteria 6602
672 Ga0395905_0018844 3300037471 Bacteria 6546
673 Ga0395905_0025511 3300037471 Bacteria 5574
674 Ga0395905_0026132 3300037471 Bacteria 5507
675 Ga0395905_0031892 3300037471 Bacteria 4957
676 Ga0395905_0037161 3300037471 Bacteria 4573
677 Ga0395905_0056409 3300037471 Bacteria 3675
678 Ga0395905_0057443 3300037471 Bacteria 3640
679 Ga0395905_0065348 3300037471 Bacteria 3406
680 Ga0395905_0113337 3300037471 Bacteria 2547
681 Ga0395905_0129958 3300037471 Bacteria 2369
682 Ga0395905_0132873 3300037471 Bacteria 2341
683 Ga0395905_0136248 3300037471 Bacteria 2310
684 Ga0395905_0146487 3300037471 Bacteria 2222
685 Ga0395905_0159097 3300037471 Bacteria 2123
686 Ga0395905_0204847 3300037471 Bacteria 1849
687 Ga0395905_0290571 3300037471 Bacteria 1521
688 Ga0395905_0306372 3300037471 Unclassified 1476
689 Ga0395905_0335169 3300037471 Bacteria 1403
690 Ga0395905_0350853 3300037471 Unclassified 1367
691 Ga0395905_0702360 3300037471 Unclassified 914
692 Ga0395905_0728261 3300037471 Bacteria 894
693 Ga0395905_0794128 3300037471 Unclassified 849
694 Ga0395901_0009677 3300038443 Bacteria 9775
695 Ga0395901_0011036 3300038443 Bacteria 9151
696 Ga0395901_0015349 3300038443 Bacteria 7795
697 Ga0395901_0015868 3300038443 Bacteria 7676
698 Ga0395901_0017881 3300038443 Bacteria 7236
699 Ga0395901_0017909 3300038443 Bacteria 7229
700 Ga0395901_0040652 3300038443 Bacteria 4817
701 Ga0395901_0046264 3300038443 Bacteria 4519
702 Ga0395901_0087050 3300038443 Unclassified 3266
703 Ga0395901_0090914 3300038443 Bacteria 3195
704 Ga0395901_0148043 3300038443 Bacteria 2467
705 Ga0395901_0171718 3300038443 Bacteria 2275
706 Ga0395901_0212263 3300038443 Bacteria 2026
707 Ga0395901_0265473 3300038443 Bacteria 1786
708 Ga0395901_0290119 3300038443 Bacteria 1698
709 Ga0395901_0434077 3300038443 Bacteria 1345
710 Ga0395901_1109594 3300038443 Bacteria 761
711 Ga0436365_0233970 3300039437 Bacteria 1104
712 Ga0436365_0379266 3300039437 Bacteria 6784
713 Ga0450920_004160 3300042122 Bacteria 2534
714 Ga0439464_0011549 3300042439 Bacteria 2341
715 Ga0451577_0236677 3300042876 Bacteria 1652
716 Ga0466969_0000552 3300044656 Bacteria 20563
717 Ga0466965_0057262 3300044683 Bacteria 1942
718 Ga0466965_0309357 3300044683 Bacteria 859
719 Ga0466966_0000577 3300044684 Bacteria 23336
720 Ga0466966_0003890 3300044684 Bacteria 9866
721 Ga0466961_0000938 3300044693 Bacteria 18062
722 Ga0466961_0023719 3300044693 Bacteria 3948
723 Ga0466961_0040098 3300044693 Unclassified 3002
724 Ga0466963_0021581 3300044694 Bacteria 4065
725 Ga0466963_0133166 3300044694 Bacteria 1718
726 Ga0466963_0197556 3300044694 Bacteria 1406
727 Ga0466964_0002936 3300044706 Bacteria 6158
728 Ga0466971_0000322 3300044719 Bacteria 18467
729 Ga0466971_0008098 3300044719 Bacteria 4583
730 Ga0466968_0006271 3300044735 Bacteria 4474
731 Ga0466970_0002098 3300044765 Bacteria 9625
732 Ga0466970_0018032 3300044765 Bacteria 3653
733 Ga0466957_0000540 3300044842 Bacteria 19108
734 Ga0466957_0006543 3300044842 Bacteria 6583
735 Ga0466957_0076155 3300044842 Bacteria 2083
736 Ga0466959_0000477 3300045049 Bacteria 23340
737 Ga0466959_0045464 3300045049 Bacteria 3233
738 Ga0466959_0091899 3300045049 Bacteria 2179
739 Ga0466959_0098762 3300045049 Bacteria 2091
740 Ga0466958_0000536 3300045836 Bacteria 16104
741 Ga0466958_0002844 3300045836 Bacteria 8812
742 Ga0466958_0006275 3300045836 Bacteria 6458
743 Ga0466958_0050838 3300045836 Bacteria 2509
744 Ga0466967_0008409 3300045976 Bacteria 7557
745 Ga0466967_0013733 3300045976 Bacteria 6274
746 Ga0466967_0042502 3300045976 Bacteria 3928
747 Ga0466967_0210301 3300045976 Bacteria 1845
748 Ga0495585_0083041 3300046492 Bacteria 1734
749 Ga0495583_0000693 3300046506 Bacteria 43601
750 Ga0495606_0000390 3300046507 Bacteria 74253
751 Ga0495631_0019051 3300046518 Bacteria 3223
752 Ga0495643_0012556 3300046522 Bacteria 5106
753 Ga0495663_0030251 3300046525 Unclassified 1604
754 Ga0495663_0115740 3300046525 Bacteria 894
755 Ga0495598_0038804 3300046537 Bacteria 1381
756 Ga0495621_0000913 3300046539 Bacteria 7503
757 Ga0495633_0000813 3300046558 Bacteria 27626
758 Ga0495633_0006629 3300046558 Bacteria 6831
759 Ga0495633_0076897 3300046558 Bacteria 1554
760 Ga0495633_0088491 3300046558 Bacteria 1440
761 Ga0495668_0004299 3300046616 Bacteria 10202
762 Ga0495668_0081025 3300046616 Bacteria 1781
763 Ga0495625_0033191 3300046660 Bacteria 3820
764 Ga0495661_0063743 3300046665 Bacteria 2178
765 Ga0495623_0024821 3300046679 Bacteria 3862
766 Ga0495669_0000727 3300046684 Bacteria 14311
767 Ga0495669_0004376 3300046684 Bacteria 5829
768 Ga0495669_0014834 3300046684 Bacteria 3333
769 Ga0495669_0033167 3300046684 Bacteria 2272
770 Ga0495669_0036247 3300046684 Bacteria 2180
771 Ga0495669_0040030 3300046684 Bacteria 2077
772 Ga0495669_0061629 3300046684 Bacteria 1698
773 Ga0495669_0096677 3300046684 Bacteria 1368
774 Ga0495669_0208921 3300046684 Bacteria 934
775 Ga0495669_0261035 3300046684 Bacteria 832
776 Ga0495670_0000005 3300046691 Bacteria 289725
777 Ga0495670_0009238 3300046691 Bacteria 4850
778 Ga0495670_0053266 3300046691 Bacteria 2026
779 Ga0495687_000293 3300047443 Bacteria 65650
780 Ga0495677_0056061 3300047445 Bacteria 1455
781 Ga0495685_067037 3300047447 Bacteria 1205
782 Ga0495681_0003704 3300047470 Bacteria 10601
783 Ga0495681_0109247 3300047470 Bacteria 1200
784 Ga0495686_0001255 3300047472 Bacteria 28821
785 Ga0495686_0432739 3300047472 Bacteria 701
786 Ga0496102_0246036 3300048905 Bacteria 1686
787 Ga0496106_0455334 3300048909 Bacteria 1028
788 Ga0496106_0754184 3300048909 Unclassified 774
789 Ga0496107_0003676 3300048910 Bacteria 10310
790 Ga0496107_0019551 3300048910 Bacteria 4778
791 Ga0496108_0049033 3300048911 Bacteria 3532
792 Ga0496109_0001322 3300048912 Bacteria 20436
793 Ga0496109_0183147 3300048912 Bacteria 1968
794 Ga0496109_0337189 3300048912 Bacteria 1424
795 Ga0496110_0046852 3300048913 Bacteria 3783
796 Ga0496110_0153752 3300048913 Bacteria 2084
797 Ga0496111_0001747 3300048914 Bacteria 12714
798 Ga0496112_0001301 3300048915 Bacteria 18983
799 Ga0496113_0047786 3300048916 Bacteria 3181
800 Ga0501296_037873 3300049519 Unclassified 671
801 Ga0501071_0326478 3300049587 Bacteria 1166
802 Ga0501074_0070914 3300049590 Bacteria 2505
803 Ga0501080_0085601 3300049742 Unclassified 2929
804 Ga0501035_0001965 3300049822 Bacteria 20572
805 nmdc:mga0n895_303511_c1 3300050512 Bacteria 1618
806 nmdc:mga0a205_7043_c1 3300050515 Bacteria 10158
807 Ga0500594_0039246 3300053118 Bacteria 1287
808 Ga0500595_001175 3300053119 Bacteria 14475
809 Ga0500608_000083 3300053122 Bacteria 39042
810 Ga0500658_0000037 3300053134 Bacteria 84326
811 Ga0500658_0003662 3300053134 Bacteria 5794
812 Ga0500588_0160161 3300053146 Bacteria 819
813 Ga0500636_0025644 3300053177 Bacteria 3484
814 Ga0466962_0000291 3300061719 Bacteria 21315
815 Ga0466962_0084934 3300061719 Bacteria 1515
816 2830076058 2830075706 Bacteria 3855215
817 2830078166 2830075706 Bacteria 3855215
818 Ga0501073_0107486
819 MBSR1b_contig_1955286
820 JGI24736J21556_1007331
821 JGI24740J21852_10003447
822 JGI24740J21852_10006633
823 JGI24739J22299_10025283
824 JGI24737J22298_10002423
825 JGI24743J22301_10002878
826 JGI24743J22301_10011156
827 JGI24735J21928_10002689
828 JGI24735J21928_10005766
829 JGI24735J21928_10010751
830 JGI24735J21928_10023113
831 JGI24735J21928_10059336
832 JGI24738J21930_10016857
833 JGI24744J21845_10001257
834 JGI24744J21845_10042363
835 JGI24034J26672_10009447
836 rootL2_10046054
837 Ga0065165_1004225
838 Ga0065165_1034054
839 Ga0065712_10209248
840 Ga0065715_10108411
841 Ga0070658_10009344
842 Ga0070658_10016255
843 Ga0070658_10400027
844 Ga0070658_10745542
845 Ga0070676_10014001
846 Ga0070676_10021446
847 Ga0070676_10084651
848 Ga0070683_100008831
849 Ga0070683_100366649
850 Ga0070690_100000372
851 Ga0070670_100108264
852 Ga0070677_10002874
853 Ga0070677_10007618
854 Ga0068869_100026910
855 Ga0068869_100249548
856 Ga0068869_100504221
857 Ga0070666_10001322
858 Ga0070666_10007280
859 Ga0070666_10075877
860 Ga0070680_100020430
861 Ga0070680_100022919
862 Ga0070682_100013505
863 Ga0068868_100006105
864 Ga0068868_100314638
865 Ga0070660_100009503
866 Ga0070660_100019072
867 Ga0070660_100050624
868 Ga0070660_100097707
869 Ga0070660_100122554
870 Ga0070660_100156338
871 Ga0070660_100462048
872 Ga0070660_100607184
873 Ga0070691_10000591
874 Ga0070687_100092717
875 Ga0070661_100001639
876 Ga0070661_100017339
877 Ga0070661_100022749
878 Ga0070661_100023434
879 Ga0070661_100071793
880 Ga0070661_100251005
881 Ga0070661_100289215
882 Ga0070692_10003378
883 Ga0070692_10016051
884 Ga0070692_10245853
885 Ga0070668_100003039
886 Ga0070668_100014575
887 Ga0070668_100015118
888 Ga0070669_100046643
889 Ga0070669_100053866
890 Ga0070669_100090386
891 Ga0070669_100186020
892 Ga0070669_100257328
893 Ga0070669_100384037
894 Ga0070675_100001540
895 Ga0070675_100094997
896 Ga0070675_100123526
897 Ga0070675_100226222
898 Ga0070671_100000133
899 Ga0070671_100006845
900 Ga0070671_100022387
901 Ga0070671_100033997
902 Ga0070671_100093459
903 Ga0070671_100146142
904 Ga0070671_100186403
905 Ga0070671_100227043
906 Ga0070674_100017773
907 Ga0070674_100023135
908 Ga0070674_100046396
909 Ga0070673_100011495
910 Ga0070673_100013139
911 Ga0070673_100017434
912 Ga0070673_100022869
913 Ga0070673_100214633
914 Ga0070673_100311562
915 Ga0070673_100571865
916 Ga0070673_100597799
917 Ga0070659_100001395
918 Ga0070659_100002985
919 Ga0070659_100016088
920 Ga0070659_100018443
921 Ga0070659_100023508
922 Ga0070659_100025237
923 Ga0070659_100031021
924 Ga0070659_100068563
925 Ga0070659_100079825
926 Ga0070659_100108353
927 Ga0070659_100148411
928 Ga0070667_100002695
929 Ga0070667_100002716
930 Ga0070667_100023262
931 Ga0070667_100084742
932 Ga0070667_100224089
933 Ga0070667_100334131
934 Ga0070667_100514996
935 Ga0070714_100003912
936 Ga0070714_100013317
937 Ga0070714_100090727
938 Ga0070714_100511554
939 Ga0070713_100030952
940 Ga0070713_100117799
941 Ga0070713_100176764
942 Ga0070713_100418127
943 Ga0070663_100003732
944 Ga0070663_100012048
945 Ga0070663_100143547
946 Ga0070663_100239619
947 Ga0070678_100002264
948 Ga0070678_100007584
949 Ga0070678_100008234
950 Ga0070678_100453841
951 Ga0070678_100533831
952 Ga0070678_100689410
953 Ga0070678_100851276
954 Ga0070662_100005556
955 Ga0070662_100015830
956 Ga0070662_100016108
957 Ga0070662_100022680
958 Ga0070662_100028677
959 Ga0070662_100057314
960 Ga0070662_100081721
961 Ga0070662_100109166
962 Ga0070662_100119509
963 Ga0070662_100509176
964 Ga0070681_10180135
965 Ga0068867_100010238
966 Ga0068867_100157728
967 Ga0068867_100315326
968 Ga0070679_100088733
969 Ga0070679_100123063
970 Ga0070684_100015548
971 Ga0068853_100011005
972 Ga0068853_100030553
973 Ga0068853_100047732
974 Ga0068853_100071057
975 Ga0068853_100255442
976 Ga0068853_100384556
977 Ga0068853_100615215
978 Ga0070672_100000508
979 Ga0070672_100015904
980 Ga0070672_100020325
981 Ga0070672_100030737
982 Ga0070672_100093613
983 Ga0070672_100110670
984 Ga0070672_100112369
985 Ga0070686_100011597
986 Ga0070686_100289090
987 Ga0070695_100045757
988 Ga0070693_100032881
989 Ga0070665_100001570
990 Ga0070665_100007276
991 Ga0070665_100017434
992 Ga0070665_100039949
993 Ga0070665_100281972
994 Ga0070665_100471067
995 Ga0070665_100617301
996 Ga0070704_100276634
997 Ga0068855_100018311
998 Ga0068855_100028204
999 Ga0068855_100075768
1000 Ga0068855_100082104
1001 Ga0068855_100217252
1002 Ga0070664_100021628
1003 Ga0070664_100076526
1004 Ga0070664_100196724
1005 Ga0068857_100006194
1006 Ga0068857_100010908
1007 Ga0068857_100012406
1008 Ga0068857_100120528
1009 Ga0068857_100201239
1010 Ga0068857_100864862
1011 Ga0068854_100002562
1012 Ga0068854_100017512
1013 Ga0068854_100027817
1014 Ga0068854_100042407
1015 Ga0068854_100042640
1016 Ga0068854_100357164
1017 Ga0068854_100363845
1018 Ga0068854_100394008
1019 Ga0068856_100039475
1020 Ga0068856_100084651
1021 Ga0068856_100167035
1022 Ga0068856_100169841
1023 Ga0068852_100002719
1024 Ga0068852_100004368
1025 Ga0068852_100027526
1026 Ga0068852_100123940
1027 Ga0068852_100378341
1028 Ga0068852_100505077
1029 Ga0068859_100007797
1030 Ga0068859_100021403
1031 Ga0068859_100065596
1032 Ga0068859_100240011
1033 Ga0068859_100745419
1034 Ga0068864_100024621
1035 Ga0068864_100036187
1036 Ga0068864_100052464
1037 Ga0068864_100628455
1038 Ga0068866_10008601
1039 Ga0068866_10362256
1040 Ga0068861_100202201
1041 Ga0068861_100330725
1042 Ga0068851_10004880
1043 Ga0068851_10007677
1044 Ga0068851_10013107
1045 Ga0068870_10075501
1046 Ga0068863_100004250
1047 Ga0068863_100021580
1048 Ga0068863_100024464
1049 Ga0068863_100059669
1050 Ga0068863_100070676
1051 Ga0068858_100027749
1052 Ga0068858_100031270
1053 Ga0068858_100034598
1054 Ga0068860_100002940
1055 Ga0068860_100007433
1056 Ga0068860_100020269
1057 Ga0068860_100059454
1058 Ga0068860_100065596
1059 Ga0068860_100225499
1060 Ga0068862_100001236
1061 Ga0068862_100019700
1062 Ga0068862_100040582
1063 Ga0068862_100057085
1064 Ga0068862_100663402
1065 Ga0070717_10017489
1066 Ga0070717_10369018
1067 Ga0075362_10008159
1068 Ga0097621_100001066
1069 Ga0097621_100020516
1070 Ga0097621_100034112
1071 Ga0097621_100053301
1072 Ga0097621_100056167
1073 Ga0068871_100013369
1074 Ga0068871_100062010
1075 Ga0068871_100145712
1076 Ga0068871_100417489
1077 Ga0068871_100435882
1078 Ga0068865_100009419
1079 Ga0068865_100022889
1080 Ga0068865_100024532
1081 Ga0097620_100007797
1082 Ga0097620_100021403
1083 Ga0097620_100065596
1084 Ga0097620_100239998
1085 Ga0097620_100745447
1086 Ga0099795_10000012
1087 Ga0105250_10013670
1088 Ga0105240_10025052
1089 Ga0105240_10097729
1090 Ga0105240_10431890
1091 Ga0105245_10006189
1092 Ga0105245_10024409
1093 Ga0105245_10263773
1094 Ga0105247_10070455
1095 Ga0105247_10336126
1096 Ga0105243_10130874
1097 Ga0105243_10268008
1098 Ga0105241_10779060
1099 Ga0105242_10012652
1100 Ga0105242_10074694
1101 Ga0105248_10005539
1102 Ga0105248_10041825
1103 Ga0105248_10127095
1104 Ga0105248_10297826
1105 Ga0105248_10947608
1106 Ga0105237_10002966
1107 Ga0105238_10015009
1108 Ga0105238_10066153
1109 Ga0105249_10000736
1110 Ga0105249_10029343
1111 Ga0105249_10382629
1112 Ga0099796_10000083
1113 Ga0105239_10055279
1114 Ga0105239_10108221
1115 Ga0105239_10218052
1116 Ga0105246_10172669
1117 Ga0157373_10012285
1118 Ga0157373_10025795
1119 Ga0157373_10027382
1120 Ga0157373_10065984
1121 Ga0157373_10330552
1122 Ga0157373_10350335
1123 Ga0157371_10012732
1124 Ga0157371_10013291
1125 Ga0157371_10013865
1126 Ga0157371_10018111
1127 Ga0157371_10046221
1128 Ga0157371_10051550
1129 Ga0157371_10085902
1130 Ga0157371_10109730
1131 Ga0157371_10132754
1132 Ga0157371_10265548
1133 Ga0157370_10005251
1134 Ga0157370_10006964
1135 Ga0157370_10029303
1136 Ga0157370_10045194
1137 Ga0157370_10089549
1138 Ga0157370_10429350
1139 Ga0157369_10009651
1140 Ga0157369_10019504
1141 Ga0157369_10022068
1142 Ga0157369_10029230
1143 Ga0157369_10099614
1144 Ga0157374_10034435
1145 Ga0157374_10182447
1146 Ga0157378_10012800
1147 Ga0157378_10039291
1148 Ga0157378_10050685
1149 Ga0157378_10085830
1150 Ga0163162_10026950
1151 Ga0163162_10027173
1152 Ga0163162_10035343
1153 Ga0163162_10347447
1154 Ga0157372_10002170
1155 Ga0157372_10028152
1156 Ga0157372_10443577
1157 Ga0157375_10064313
1158 Ga0157375_10586987
1159 Ga0163163_10002278
1160 Ga0163163_10028183
1161 Ga0157380_10063649
1162 Ga0157377_10014652
1163 Ga0157379_10015040
1164 Ga0157379_10178394
1165 Ga0157379_10184972
1166 Ga0157379_10263435
1167 Ga0157376_10003691
1168 Ga0183365_10003
1169 Ga0163161_10104527
1170 Ga0163161_10217426
1171 Ga0209148_1001472
1172 Ga0209455_1000715
1173 Ga0207697_10074365
1174 Ga0207656_10002175
1175 Ga0207656_10006429
1176 Ga0207656_10029384
1177 Ga0207696_1013078
1178 Ga0207682_10000432
1179 Ga0207682_10017332
1180 Ga0207642_10042367
1181 Ga0207642_10062800
1182 Ga0207688_10016493
1183 Ga0207688_10053551
1184 Ga0207680_10002498
1185 Ga0207680_10004188
1186 Ga0207680_10301945
1187 Ga0207647_10000679
1188 Ga0207647_10000863
1189 Ga0207647_10002147
1190 Ga0207647_10039118
1191 Ga0207647_10102250
1192 Ga0207647_10149302
1193 Ga0207699_10061343
1194 Ga0207645_10018089
1195 Ga0207645_10019269
1196 Ga0207645_10051952
1197 Ga0207645_10090500
1198 Ga0207645_10100028
1199 Ga0207705_10000030
1200 Ga0207705_10002081
1201 Ga0207705_10002682
1202 Ga0207705_10014671
1203 Ga0207705_10051467
1204 Ga0207705_10114818
1205 Ga0207705_10151875
1206 Ga0207707_10185595
1207 Ga0207695_10009193
1208 Ga0207695_10009479
1209 Ga0207695_10082441
1210 Ga0207695_10181857
1211 Ga0207695_10219895
1212 Ga0207693_10089561
1213 Ga0207693_10105906
1214 Ga0207660_10035374
1215 Ga0207660_10550875
1216 Ga0207657_10001393
1217 Ga0207657_10002144
1218 Ga0207657_10009627
1219 Ga0207657_10013449
1220 Ga0207657_10016365
1221 Ga0207657_10020045
1222 Ga0207657_10112200
1223 Ga0207657_10209774
1224 Ga0207649_10000152
1225 Ga0207649_10010791
1226 Ga0207649_10044864
1227 Ga0207649_10051361
1228 Ga0207652_10073659
1229 Ga0207681_10021582
1230 Ga0207681_10050042
1231 Ga0207681_10086245
1232 Ga0207681_10088176
1233 Ga0207681_10277546
1234 Ga0207681_10330759
1235 Ga0207694_10063850
1236 Ga0207694_10067081
1237 Ga0207694_10068541
1238 Ga0207694_10153647
1239 Ga0207650_10386974
1240 Ga0207650_10593617
1241 Ga0207659_10171066
1242 Ga0207687_10006558
1243 Ga0207700_10021955
1244 Ga0207700_10398503
1245 Ga0207664_10012958
1246 Ga0207664_10040626
1247 Ga0207664_10153157
1248 Ga0207644_10000256
1249 Ga0207644_10000612
1250 Ga0207644_10001341
1251 Ga0207644_10004030
1252 Ga0207644_10034737
1253 Ga0207644_10227177
1254 Ga0207644_10628796
1255 Ga0207690_10001622
1256 Ga0207690_10002791
1257 Ga0207690_10014408
1258 Ga0207690_10014923
1259 Ga0207690_10020577
1260 Ga0207690_10047280
1261 Ga0207690_10173191
1262 Ga0207690_10257462
1263 Ga0207690_10319985
1264 Ga0207706_10004341
1265 Ga0207706_10006433
1266 Ga0207706_10029148
1267 Ga0207706_10043488
1268 Ga0207706_10061601
1269 Ga0207706_10072096
1270 Ga0207706_10072514
1271 Ga0207706_10114718
1272 Ga0207686_10466356
1273 Ga0207709_10016828
1274 Ga0207669_10040202
1275 Ga0207669_10275344
1276 Ga0207704_10051128
1277 Ga0207704_10206382
1278 Ga0207665_10036251
1279 Ga0207691_10004927
1280 Ga0207691_10010277
1281 Ga0207691_10049217
1282 Ga0207691_10096332
1283 Ga0207691_10192329
1284 Ga0207691_10200753
1285 Ga0207711_10000786
1286 Ga0207711_10006833
1287 Ga0207711_10010887
1288 Ga0207711_10014076
1289 Ga0207711_10152825
1290 Ga0207689_10006523
1291 Ga0207689_10024680
1292 Ga0207661_10111180
1293 Ga0207661_10194271
1294 Ga0207679_10098839
1295 Ga0207679_10127558
1296 Ga0207679_10166577
1297 Ga0207667_10003910
1298 Ga0207667_10005076
1299 Ga0207667_10315987
1300 Ga0207667_10360397
1301 Ga0207667_10507943
1302 Ga0207651_10002692
1303 Ga0207651_10005188
1304 Ga0207651_10010105
1305 Ga0207651_10270023
1306 Ga0207651_10538977
1307 Ga0207651_10629788
1308 Ga0207712_10001041
1309 Ga0207712_10001197
1310 Ga0207712_10046315
1311 Ga0207712_11004192
1312 Ga0207668_10000150
1313 Ga0207668_10017819
1314 Ga0207668_10035320
1315 Ga0207668_10202079
1316 Ga0207668_10274784
1317 Ga0207640_10010982
1318 Ga0207640_10038621
1319 Ga0207640_10058990
1320 Ga0207640_10063719
1321 Ga0207640_10127815
1322 Ga0207640_10322069
1323 Ga0207640_10393879
1324 Ga0207658_10009569
1325 Ga0207658_10010086
1326 Ga0207658_10023979
1327 Ga0207658_10029542
1328 Ga0207658_10076034
1329 Ga0207658_10205252
1330 Ga0207658_10351152
1331 Ga0207658_10868658
1332 Ga0207677_10005504
1333 Ga0207677_10015993
1334 Ga0207677_10028779
1335 Ga0207677_10616686
1336 Ga0207703_10002851
1337 Ga0207703_10004952
1338 Ga0207703_10008173
1339 Ga0207703_10011191
1340 Ga0207639_10065987
1341 Ga0207639_10066387
1342 Ga0207639_10069081
1343 Ga0207639_10315518
1344 Ga0207678_10000357
1345 Ga0207678_10005235
1346 Ga0207678_10037186
1347 Ga0207678_10141934
1348 Ga0207678_10187647
1349 Ga0207678_10383557
1350 Ga0207678_10401343
1351 Ga0207702_10019249
1352 Ga0207702_10029914
1353 Ga0207641_10008369
1354 Ga0207641_10024248
1355 Ga0207641_10049987
1356 Ga0207641_10272238
1357 Ga0207648_10001898
1358 Ga0207648_10004044
1359 Ga0207648_10012040
1360 Ga0207648_10133209
1361 Ga0207676_10001863
1362 Ga0207676_10023976
1363 Ga0207676_10707215
1364 Ga0207674_10006838
1365 Ga0207674_10018116
1366 Ga0207674_10039515
1367 Ga0207674_10172015
1368 Ga0207675_100139271
1369 Ga0207683_10003703
1370 Ga0207683_10005306
1371 Ga0207683_10005914
1372 Ga0207683_10015690
1373 Ga0207683_10382617
1374 Ga0207698_10001925
1375 Ga0207698_10006257
1376 Ga0207698_10009430
1377 Ga0207698_10109780
1378 Ga0207698_10351859
1379 Ga0207698_10561082
1380 Ga0207698_10752368
1381 Ga0209179_1000002
1382 Ga0268266_10002617
1383 Ga0268266_10006044
1384 Ga0268266_10011239
1385 Ga0268266_10071724
1386 Ga0268266_10112682
1387 Ga0268266_10120020
1388 Ga0268265_10001717
1389 Ga0268265_10001931
1390 Ga0268264_10001663
1391 Ga0268264_10002751
1392 Ga0268264_10011672
1393 Ga0268264_10020009
1394 Ga0268264_10054206
1395 Ga0268264_10467466
1396 Ga0307515_10270976
1397 Ga0307408_100073332
1398 Ga0307408_100306099
1399 Ga0307408_100347373
1400 Ga0307405_10052500
1401 Ga0307405_10098607
1402 Ga0307405_10325013
1403 Ga0307413_10004513
1404 Ga0307413_10016044
1405 Ga0307413_10033457
1406 Ga0307413_10210685
1407 Ga0307410_10000301
1408 Ga0307410_10003678
1409 Ga0307410_10007204
1410 Ga0307410_10058216
1411 Ga0307410_10133606
1412 Ga0307410_10275792
1413 Ga0307410_10612827
1414 Ga0307406_10048229
1415 Ga0307406_10154996
1416 Ga0307406_10627663
1417 Ga0307407_10018510
1418 Ga0307407_10038050
1419 Ga0307407_10128067
1420 Ga0307407_10182478
1421 Ga0307407_10249091
1422 Ga0307412_10302312
1423 Ga0307412_10319136
1424 Ga0307412_10506615
1425 Ga0307409_100108544
1426 Ga0307409_100321058
1427 Ga0307409_100371767
1428 Ga0307416_100053462
1429 Ga0307416_100100351
1430 Ga0307416_100107166
1431 Ga0307414_10010376
1432 Ga0307414_10061573
1433 Ga0307414_10088111
1434 Ga0307414_10243276
1435 Ga0307411_10006353
1436 Ga0307411_10010937
1437 Ga0307411_10018508
1438 Ga0307411_10074673
1439 Ga0307411_10112833
1440 Ga0307415_100269977
1441 Ga0373958_0019735
1442 Ga0373957_0050393
1443 Ga0373955_0004706
1444 Ga0373931_0018334
1445 Ga0373937_0011592
1446 Ga0395899_0013125
1447 Ga0395899_0017627
1448 Ga0395899_0021199
1449 Ga0395899_0025462
1450 Ga0395899_0029770
1451 Ga0395899_0060542
1452 Ga0395899_0095888
1453 Ga0395899_0287891
1454 Ga0395899_0359173
1455 Ga0395900_0012282
1456 Ga0395900_0015879
1457 Ga0395900_0018035
1458 Ga0395900_0020127
1459 Ga0395900_0023861
1460 Ga0395900_0030696
1461 Ga0395900_0034692
1462 Ga0395900_0038715
1463 Ga0395900_0039516
1464 Ga0395900_0048587
1465 Ga0395900_0053718
1466 Ga0395900_0068396
1467 Ga0395900_0080765
1468 Ga0395900_0200490
1469 Ga0395900_0215893
1470 Ga0395900_0234664
1471 Ga0395900_0243468
1472 Ga0395900_0303396
1473 Ga0395900_0330183
1474 Ga0395898_0002665
1475 Ga0395898_0022272
1476 Ga0395898_0023301
1477 Ga0395898_0034986
1478 Ga0395898_0040872
1479 Ga0395898_0073643
1480 Ga0395898_0110291
1481 Ga0395898_0129186
1482 Ga0395898_0147322
1483 Ga0395898_0170441
1484 Ga0395898_0562902
1485 Ga0395905_0001093
1486 Ga0395905_0005271
1487 Ga0395905_0017553
1488 Ga0395905_0018553
1489 Ga0395905_0018844
1490 Ga0395905_0025511
1491 Ga0395905_0026132
1492 Ga0395905_0031892
1493 Ga0395905_0037161
1494 Ga0395905_0056409
1495 Ga0395905_0057443
1496 Ga0395905_0065348
1497 Ga0395905_0113337
1498 Ga0395905_0129958
1499 Ga0395905_0132873
1500 Ga0395905_0136248
1501 Ga0395905_0146487
1502 Ga0395905_0159097
1503 Ga0395905_0204847
1504 Ga0395905_0290571
1505 Ga0395905_0306372
1506 Ga0395905_0335169
1507 Ga0395905_0350853
1508 Ga0395905_0702360
1509 Ga0395905_0728261
1510 Ga0395905_0794128
1511 Ga0395901_0009677
1512 Ga0395901_0011036
1513 Ga0395901_0015349
1514 Ga0395901_0015868
1515 Ga0395901_0017881
1516 Ga0395901_0017909
1517 Ga0395901_0040652
1518 Ga0395901_0046264
1519 Ga0395901_0087050
1520 Ga0395901_0090914
1521 Ga0395901_0148043
1522 Ga0395901_0171718
1523 Ga0395901_0212263
1524 Ga0395901_0265473
1525 Ga0395901_0290119
1526 Ga0395901_0434077
1527 Ga0395901_1109594
1528 Ga0436365_0233970
1529 Ga0436365_0379266
1530 Ga0450920_004160
1531 Ga0439464_0011549
1532 Ga0451577_0236677
1533 Ga0466969_0000552
1534 Ga0466965_0057262
1535 Ga0466965_0309357
1536 Ga0466966_0000577
1537 Ga0466966_0003890
1538 Ga0466961_0000938
1539 Ga0466961_0023719
1540 Ga0466961_0040098
1541 Ga0466963_0021581
1542 Ga0466963_0133166
1543 Ga0466963_0197556
1544 Ga0466964_0002936
1545 Ga0466971_0000322
1546 Ga0466971_0008098
1547 Ga0466968_0006271
1548 Ga0466970_0002098
1549 Ga0466970_0018032
1550 Ga0466957_0000540
1551 Ga0466957_0006543
1552 Ga0466957_0076155
1553 Ga0466959_0000477
1554 Ga0466959_0045464
1555 Ga0466959_0091899
1556 Ga0466959_0098762
1557 Ga0466958_0000536
1558 Ga0466958_0002844
1559 Ga0466958_0006275
1560 Ga0466958_0050838
1561 Ga0466967_0008409
1562 Ga0466967_0013733
1563 Ga0466967_0042502
1564 Ga0466967_0210301
1565 Ga0495585_0083041
1566 Ga0495583_0000693
1567 Ga0495606_0000390
1568 Ga0495631_0019051
1569 Ga0495643_0012556
1570 Ga0495663_0030251
1571 Ga0495663_0115740
1572 Ga0495598_0038804
1573 Ga0495621_0000913
1574 Ga0495633_0000813
1575 Ga0495633_0006629
1576 Ga0495633_0076897
1577 Ga0495633_0088491
1578 Ga0495668_0004299
1579 Ga0495668_0081025
1580 Ga0495625_0033191
1581 Ga0495661_0063743
1582 Ga0495623_0024821
1583 Ga0495669_0000727
1584 Ga0495669_0004376
1585 Ga0495669_0014834
1586 Ga0495669_0033167
1587 Ga0495669_0036247
1588 Ga0495669_0040030
1589 Ga0495669_0061629
1590 Ga0495669_0096677
1591 Ga0495669_0208921
1592 Ga0495669_0261035
1593 Ga0495670_0000005
1594 Ga0495670_0009238
1595 Ga0495670_0053266
1596 Ga0495687_000293
1597 Ga0495677_0056061
1598 Ga0495685_067037
1599 Ga0495681_0003704
1600 Ga0495681_0109247
1601 Ga0495686_0001255
1602 Ga0495686_0432739
1603 Ga0496102_0246036
1604 Ga0496106_0455334
1605 Ga0496106_0754184
1606 Ga0496107_0003676
1607 Ga0496107_0019551
1608 Ga0496108_0049033
1609 Ga0496109_0001322
1610 Ga0496109_0183147
1611 Ga0496109_0337189
1612 Ga0496110_0046852
1613 Ga0496110_0153752
1614 Ga0496111_0001747
1615 Ga0496112_0001301
1616 Ga0496113_0047786
1617 Ga0501296_037873
1618 Ga0501071_0326478
1619 Ga0501074_0070914
1620 Ga0501080_0085601
1621 Ga0501035_0001965
1622 nmdc:mga0n895_303511_c1
1623 nmdc:mga0a205_7043_c1
1624 Ga0500594_0039246
1625 Ga0500595_001175
1626 Ga0500608_000083
1627 Ga0500658_0000037
1628 Ga0500658_0003662
1629 Ga0500588_0160161
1630 Ga0500636_0025644
1631 Ga0466962_0000291
1632 Ga0466962_0084934
1633 2830076058
1634 2830078166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20043

DUF6445

Family of unknown function (DUF6445)

40

264

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ey1-assembly1.cif.gz_A prolyl hydroxylase from trichoplax adhaerens 0.6959 11 227
4nhx-assembly1.cif.gz_A crystal structure of human ogfod1, 2-oxoglutarate and iron-dependent oxygenase domain containing 1, in complex with n-oxalylglycine (nog) 0.6626 8 227
6nmq-assembly1.cif.gz_A hypoxia-inducible factor (hif) prolyl hydroxylase 2 (phd2) in complex with the carboxamide analog jnj43058171 0.6583 11 226
1gqh-assembly1.cif.gz_B quercetin 2,3-dioxygenase in complex with the inhibitor kojic acid 0.6583 83 227
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.6545 13 227
ID Description Score Start End Superfamily
af_Q9I7H9_57_285_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6792 8 228 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6545 13 227 2.60.120.620
5zm2D00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6331 7 227 2.60.120.620
af_D4ACB4_24_245_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6303 8 227 2.60.120.620
5c5tB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6301 15 228 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A7G9S9Z0-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9895 2 228
AF-A0A5B8LDS8-F1-model_v4 Methyltransferase 0.9852 1 228
AF-A0A430G683-F1-model_v4 DUF1826 domain-containing protein 0.9833 1 228
AF-A0A7G9S9Z0-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9809 2 228
AF-A0A097EDZ7-F1-model_v4 Uncharacterized protein 0.9803 1 228

Map