F482067

General Info

Members Datasets Scaffolds Average Seq Length
816 268 802 163

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000078|Ga0495585_0000078_13339_13920
Length 193
Sequence LEALQSLRGDNFLKIKQRENVESLYLRRKSMAIDVYLSIDGIKGESNDNKHPGWMECVSVEWGVIQPRSATASTGGGHTTERAEFEELTFLKHADLASPILMQHCCMGKTLPTAKLEFMRADGQGERVKYFEVELRNVLIGHVQAVIQPGDILAESVGLKFAQIKWRYTQQMISGGASGSTVGSWNLSTNRIE

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
10 2904424332 Duganella sp. 1411 Isolate Rhizosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
113 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
114 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
115 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
236 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 7.11
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 4.78
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001227 3300002738 Bacteria 9658
2 JGI25154J39366_1002256 3300002738 Bacteria 5270
3 Ga0006759J45824_1004575 3300003163 Bacteria 1553
4 Ga0006759J45824_1058350 3300003163 Bacteria 584
5 rootL2_10018128 3300003322 Bacteria 3066
6 Ga0007417J51691_1035307 3300003544 Bacteria 941
7 Ga0007410J51695_1004602 3300003574 Bacteria 2334
8 Ga0007409J51694_1001247 3300003575 Bacteria 1616
9 Ga0007416J51690_1021414 3300003577 Bacteria 1305
10 Ga0007411J51799_115139 3300003611 Bacteria 825
11 Ga0007415J51800_109139 3300003613 Bacteria 860
12 Ga0032354_1093660 3300003693 Bacteria 864
13 Ga0055525_1000047 3300003759 Bacteria 261507
14 Ga0055542_1006888 3300003762 Bacteria 2375
15 Ga0058862_12338473 3300004803 Bacteria 680
16 Ga0065165_1004312 3300005262 Bacteria 8946
17 Ga0070658_10164825 3300005327 Bacteria 1860
18 Ga0070683_100868757 3300005329 Bacteria 865
19 Ga0070683_101350146 3300005329 Bacteria 685
20 Ga0068869_101244878 3300005334 Bacteria 655
21 Ga0070680_100655887 3300005336 Bacteria 902
22 Ga0070660_100079591 3300005339 Bacteria 2571
23 Ga0070660_100257468 3300005339 Bacteria 1424
24 Ga0070661_100076502 3300005344 Bacteria 2467
25 Ga0070661_100206503 3300005344 Bacteria 1502
26 Ga0070675_100465920 3300005354 Bacteria 1135
27 Ga0070675_101659366 3300005354 Bacteria 590
28 Ga0070659_100017089 3300005366 Bacteria 5453
29 Ga0070659_100538701 3300005366 Bacteria 998
30 Ga0070663_100767188 3300005455 Bacteria 825
31 Ga0070663_101021545 3300005455 Bacteria 720
32 Ga0070662_100106878 3300005457 Bacteria 2127
33 Ga0070662_100109380 3300005457 Bacteria 2103
34 Ga0070662_101052524 3300005457 Bacteria 697
35 Ga0068867_100108719 3300005459 Bacteria 2127
36 Ga0068867_100297816 3300005459 Bacteria 1329
37 Ga0068853_100209583 3300005539 Bacteria 1776
38 Ga0068853_100465092 3300005539 Bacteria 1191
39 Ga0070672_100646090 3300005543 Bacteria 924
40 Ga0068855_100235184 3300005563 Bacteria 2049
41 Ga0068855_100661989 3300005563 Bacteria 1120
42 Ga0070664_100015614 3300005564 Bacteria 6214
43 Ga0070664_100076140 3300005564 Bacteria 2882
44 Ga0070664_100202515 3300005564 Bacteria 1772
45 Ga0070664_100652890 3300005564 Bacteria 978
46 Ga0068857_100280478 3300005577 Bacteria 1533
47 Ga0068856_100577814 3300005614 Bacteria 1145
48 Ga0068852_100236859 3300005616 Bacteria 1742
49 Ga0068866_10529984 3300005718 Bacteria 784
50 Ga0068871_101179942 3300006358 Bacteria 718
51 Ga0105244_10001128 3300009036 Bacteria 22199
52 Ga0105244_10006509 3300009036 Bacteria 7538
53 Ga0105244_10327773 3300009036 Bacteria 707
54 Ga0105245_10302010 3300009098 Bacteria 1571
55 Ga0105243_10042231 3300009148 Bacteria 3570
56 Ga0105243_10148481 3300009148 Bacteria 2008
57 Ga0105241_10054249 3300009174 Bacteria 3068
58 Ga0105242_10022993 3300009176 Bacteria 4911
59 Ga0105242_10040850 3300009176 Bacteria 3738
60 Ga0105237_10179199 3300009545 Bacteria 2119
61 Ga0105238_10248316 3300009551 Bacteria 1757
62 Ga0105238_10318576 3300009551 Bacteria 1541
63 Ga0105239_10272689 3300010375 Bacteria 1903
64 Ga0105246_10327566 3300011119 Bacteria 1247
65 Ga0157373_10915246 3300013100 Bacteria 651
66 Ga0157371_10000026 3300013102 Bacteria 274703
67 Ga0157370_10972073 3300013104 Bacteria 769
68 Ga0157374_10198062 3300013296 Bacteria 1966
69 Ga0157374_10568135 3300013296 Bacteria 1143
70 Ga0157378_10313217 3300013297 Bacteria 1523
71 Ga0157372_10555165 3300013307 Bacteria 1339
72 Ga0157372_11098793 3300013307 Bacteria 920
73 Ga0182008_10006642 3300014497 Bacteria 6441
74 Ga0182006_1005953 3300015261 Bacteria 5731
75 Ga0182006_1124213 3300015261 Bacteria 894
76 Ga0182006_1154838 3300015261 Bacteria 775
77 Ga0182007_10021675 3300015262 Bacteria 2278
78 Ga0206355_1410553 3300020076 Bacteria 1172
79 Ga0206351_10397707 3300020077 Bacteria 666
80 Ga0206352_10045834 3300020078 Bacteria 853
81 Ga0206350_10686387 3300020080 Bacteria 1434
82 Ga0206350_11162310 3300020080 Bacteria 704
83 Ga0206353_10473061 3300020082 Bacteria 754
84 Ga0154015_1259593 3300020610 Bacteria 1082
85 Ga0154015_1494823 3300020610 Bacteria 819
86 Ga0224712_10190158 3300022467 Bacteria 929
87 Ga0224712_10582297 3300022467 Bacteria 545
88 Ga0209563_100003 3300025230 Bacteria 1932942
89 Ga0209437_102323 3300025233 Bacteria 3721
90 Ga0209646_1000036 3300025246 Bacteria 358864
91 Ga0209646_1000087 3300025246 Bacteria 193273
92 Ga0209677_107761 3300025253 Bacteria 2204
93 Ga0209148_1000969 3300025254 Bacteria 18698
94 Ga0209148_1001353 3300025254 Bacteria 12872
95 Ga0209564_1000006 3300025295 Bacteria 1100927
96 Ga0207656_10591341 3300025321 Bacteria 566
97 Ga0207655_1006414 3300025728 Bacteria 7800
98 Ga0207655_1017177 3300025728 Bacteria 3914
99 Ga0207655_1160736 3300025728 Bacteria 702
100 Ga0207645_10283041 3300025907 Bacteria 1101
101 Ga0207705_10003924 3300025909 Bacteria 11310
102 Ga0207705_10083064 3300025909 Bacteria 2336
103 Ga0207705_10715932 3300025909 Bacteria 778
104 Ga0207695_10175687 3300025913 Bacteria 2064
105 Ga0207671_10386617 3300025914 Bacteria 1112
106 Ga0207657_10160013 3300025919 Bacteria 1829
107 Ga0207657_10251940 3300025919 Bacteria 1407
108 Ga0207694_10470439 3300025924 Bacteria 1050
109 Ga0207659_11288358 3300025926 Bacteria 627
110 Ga0207687_10132407 3300025927 Bacteria 1881
111 Ga0207690_10316074 3300025932 Bacteria 1226
112 Ga0207690_10830927 3300025932 Bacteria 764
113 Ga0207706_10212096 3300025933 Bacteria 1697
114 Ga0207706_10599267 3300025933 Bacteria 946
115 Ga0207686_10002979 3300025934 Bacteria 9125
116 Ga0207709_10195620 3300025935 Bacteria 1440
117 Ga0207704_10323451 3300025938 Bacteria 1191
118 Ga0207679_10416957 3300025945 Bacteria 1184
119 Ga0207679_10445770 3300025945 Bacteria 1147
120 Ga0207679_10958020 3300025945 Bacteria 784
121 Ga0207679_11115864 3300025945 Bacteria 724
122 Ga0207667_10003392 3300025949 Bacteria 19655
123 Ga0207667_10018225 3300025949 Bacteria 7878
124 Ga0207640_10143660 3300025981 Bacteria 1743
125 Ga0207639_10281620 3300026041 Bacteria 1462
126 Ga0207639_10309219 3300026041 Bacteria 1399
127 Ga0207678_10421310 3300026067 Bacteria 1158
128 Ga0207678_10628605 3300026067 Bacteria 942
129 Ga0207702_10798915 3300026078 Bacteria 932
130 Ga0207702_10831113 3300026078 Bacteria 914
131 Ga0207648_10211601 3300026089 Bacteria 1721
132 Ga0207648_10239546 3300026089 Bacteria 1615
133 Ga0207698_10035453 3300026142 Bacteria 3650
134 Ga0316180_1066585 3300030736 Bacteria 594
135 Ga0316181_1092357 3300030744 Bacteria 3088
136 Ga0316182_1190314 3300030745 Bacteria 721
137 Ga0307408_101229931 3300031548 Bacteria 700
138 Ga0395899_0000163 3300037312 Bacteria 102351
139 Ga0395899_0002155 3300037312 Bacteria 16155
140 Ga0395899_0002576 3300037312 Bacteria 14635
141 Ga0395899_0019441 3300037312 Bacteria 5159
142 Ga0395899_0026709 3300037312 Bacteria 4355
143 Ga0395899_0053077 3300037312 Bacteria 3002
144 Ga0395899_0100441 3300037312 Bacteria 2089
145 Ga0395899_0713707 3300037312 Bacteria 627
146 Ga0395900_0000081 3300037418 Bacteria 174128
147 Ga0395900_0000331 3300037418 Bacteria 69780
148 Ga0395900_0004089 3300037418 Bacteria 15554
149 Ga0395900_0049632 3300037418 Bacteria 4323
150 Ga0395900_0082046 3300037418 Bacteria 3312
151 Ga0395900_0189706 3300037418 Bacteria 2085
152 Ga0395900_0261928 3300037418 Bacteria 1726
153 Ga0395900_0517584 3300037418 Bacteria 1141
154 Ga0395898_0053893 3300037466 Bacteria 3926
155 Ga0395898_0054333 3300037466 Bacteria 3908
156 Ga0395898_0138783 3300037466 Bacteria 2327
157 Ga0395898_0293656 3300037466 Bacteria 1550
158 Ga0395898_0344809 3300037466 Bacteria 1420
159 Ga0395898_0923258 3300037466 Bacteria 810
160 Ga0395905_0040986 3300037471 Bacteria 4344
161 Ga0395905_0041447 3300037471 Bacteria 4320
162 Ga0395905_0062338 3300037471 Bacteria 3488
163 Ga0395905_0153806 3300037471 Bacteria 2163
164 Ga0395905_0190556 3300037471 Bacteria 1923
165 Ga0395905_0260377 3300037471 Bacteria 1619
166 Ga0395905_0409584 3300037471 Bacteria 1251
167 Ga0395905_0934102 3300037471 Bacteria 770
168 Ga0395901_0000083 3300038443 Bacteria 128816
169 Ga0395901_0000097 3300038443 Bacteria 118528
170 Ga0395901_0237319 3300038443 Bacteria 1902
171 Ga0395901_0367226 3300038443 Bacteria 1483
172 Ga0395901_0608981 3300038443 Bacteria 1100
173 Ga0439433_0052689 3300041999 Bacteria 961
174 Ga0439448_0001226 3300042005 Bacteria 6555
175 Ga0439448_0058620 3300042005 Bacteria 1270
176 Ga0439432_063504 3300042006 Bacteria 1135
177 Ga0439449_0036458 3300042007 Bacteria 1829
178 Ga0439450_000716 3300042008 Bacteria 4476
179 Ga0439455_0018708 3300042012 Bacteria 1627
180 Ga0439455_0031376 3300042012 Bacteria 1322
181 Ga0439455_0199423 3300042012 Bacteria 579
182 Ga0450911_010167 3300042115 Bacteria 1304
183 Ga0450904_002179 3300042139 Bacteria 2403
184 Ga0450906_021535 3300042145 Bacteria 1152
185 Ga0439458_0004112 3300042157 Bacteria 3357
186 Ga0439458_0013955 3300042157 Bacteria 1811
187 Ga0439458_0067511 3300042157 Bacteria 899
188 Ga0439458_0067846 3300042157 Bacteria 897
189 Ga0466969_0050303 3300044656 Bacteria 2054
190 Ga0466969_0052939 3300044656 Bacteria 1993
191 Ga0466969_0124989 3300044656 Bacteria 1195
192 Ga0466969_0150502 3300044656 Bacteria 1072
193 Ga0466972_0045896 3300044658 Bacteria 2116
194 Ga0466972_0065993 3300044658 Bacteria 1730
195 Ga0466965_0019800 3300044683 Bacteria 3232
196 Ga0466965_0020523 3300044683 Bacteria 3176
197 Ga0466965_0069500 3300044683 Bacteria 1769
198 Ga0466965_0073684 3300044683 Bacteria 1719
199 Ga0466965_0132450 3300044683 Bacteria 1293
200 Ga0466966_0034248 3300044684 Bacteria 3284
201 Ga0466966_0047895 3300044684 Bacteria 2724
202 Ga0466966_0056131 3300044684 Bacteria 2492
203 Ga0466966_0179095 3300044684 Bacteria 1286
204 Ga0466966_0183916 3300044684 Bacteria 1267
205 Ga0466966_0194709 3300044684 Bacteria 1227
206 Ga0466966_0398966 3300044684 Bacteria 826
207 Ga0466961_0079437 3300044693 Bacteria 2077
208 Ga0466961_0138687 3300044693 Bacteria 1523
209 Ga0466961_0270682 3300044693 Bacteria 1041
210 Ga0466961_0596178 3300044693 Bacteria 664
211 Ga0466963_0010855 3300044694 Bacteria 5531
212 Ga0466963_0157946 3300044694 Bacteria 1577
213 Ga0466964_0000928 3300044706 Bacteria 9655
214 Ga0466964_0001150 3300044706 Bacteria 8935
215 Ga0466964_0040745 3300044706 Bacteria 1876
216 Ga0466964_0045953 3300044706 Bacteria 1778
217 Ga0466971_0035284 3300044719 Bacteria 2242
218 Ga0466971_0045401 3300044719 Bacteria 1973
219 Ga0466971_0111603 3300044719 Bacteria 1262
220 Ga0466968_0011729 3300044735 Bacteria 3418
221 Ga0466968_0146793 3300044735 Bacteria 1082
222 Ga0466968_0193170 3300044735 Bacteria 951
223 Ga0466968_0308359 3300044735 Bacteria 762
224 Ga0466970_0188066 3300044765 Bacteria 1147
225 Ga0466970_0392207 3300044765 Bacteria 791
226 Ga0466957_0000007 3300044842 Bacteria 84513
227 Ga0466957_0022258 3300044842 Bacteria 3737
228 Ga0466957_0022568 3300044842 Bacteria 3715
229 Ga0466957_0078277 3300044842 Bacteria 2055
230 Ga0466957_0100249 3300044842 Bacteria 1825
231 Ga0466957_0203165 3300044842 Bacteria 1302
232 Ga0466957_0778068 3300044842 Bacteria 679
233 Ga0466960_0205664 3300044901 Bacteria 1077
234 Ga0466960_0658629 3300044901 Bacteria 625
235 Ga0466959_0072655 3300045049 Bacteria 2489
236 Ga0466959_0101579 3300045049 Bacteria 2058
237 Ga0466959_0122083 3300045049 Bacteria 1851
238 Ga0466959_0465336 3300045049 Bacteria 856
239 Ga0466958_0242141 3300045836 Bacteria 1153
240 Ga0466958_0409789 3300045836 Bacteria 876
241 Ga0466967_0006229 3300045976 Bacteria 8412
242 Ga0466967_0017323 3300045976 Bacteria 5715
243 Ga0466967_0019086 3300045976 Bacteria 5504
244 Ga0466967_0020210 3300045976 Bacteria 5375
245 Ga0466967_0363056 3300045976 Bacteria 1403
246 Ga0495617_000009 3300046452 Bacteria 312936
247 Ga0495617_000272 3300046452 Bacteria 29946
248 Ga0495617_082273 3300046452 Bacteria 1054
249 Ga0495627_002610 3300046453 Bacteria 8491
250 Ga0495627_023199 3300046453 Bacteria 2035
251 Ga0495627_029600 3300046453 Bacteria 1741
252 Ga0495627_032857 3300046453 Bacteria 1630
253 Ga0495627_161116 3300046453 Unclassified 624
254 Ga0495590_0000080 3300046457 Bacteria 63569
255 Ga0495590_0000253 3300046457 Bacteria 29076
256 Ga0495590_0000256 3300046457 Bacteria 28990
257 Ga0495590_0007337 3300046457 Bacteria 4257
258 Ga0495590_0054040 3300046457 Bacteria 1403
259 Ga0495590_0166441 3300046457 Bacteria 802
260 Ga0495591_000043 3300046458 Bacteria 148885
261 Ga0495591_002168 3300046458 Bacteria 11242
262 Ga0495591_088527 3300046458 Bacteria 780
263 Ga0495638_0483997 3300046460 Unclassified 626
264 Ga0495653_0018525 3300046463 Bacteria 5652
265 Ga0495650_0000358 3300046471 Bacteria 80529
266 Ga0495650_0000382 3300046471 Bacteria 76019
267 Ga0495650_0007541 3300046471 Bacteria 6517
268 Ga0495650_0047171 3300046471 Bacteria 1803
269 Ga0495650_0094363 3300046471 Bacteria 1133
270 Ga0495580_0021570 3300046472 Bacteria 4749
271 Ga0495582_0034710 3300046473 Bacteria 2772
272 Ga0495605_0000024 3300046474 Bacteria 236016
273 Ga0495605_0000236 3300046474 Bacteria 67212
274 Ga0495605_0000381 3300046474 Bacteria 41604
275 Ga0495605_0005418 3300046474 Bacteria 7430
276 Ga0495605_0018745 3300046474 Bacteria 3703
277 Ga0495605_0026741 3300046474 Bacteria 2996
278 Ga0495605_0031694 3300046474 Bacteria 2698
279 Ga0495605_0033892 3300046474 Bacteria 2590
280 Ga0495605_0107888 3300046474 Bacteria 1273
281 Ga0495605_0153637 3300046474 Bacteria 1025
282 Ga0495605_0204913 3300046474 Bacteria 858
283 Ga0495605_0208400 3300046474 Bacteria 849
284 Ga0495605_0243968 3300046474 Bacteria 770
285 Ga0495584_0000003 3300046491 Bacteria 323768
286 Ga0495584_0000092 3300046491 Bacteria 62079
287 Ga0495584_0000107 3300046491 Bacteria 56834
288 Ga0495584_0001712 3300046491 Bacteria 12849
289 Ga0495584_0004180 3300046491 Bacteria 7789
290 Ga0495584_0008977 3300046491 Bacteria 5167
291 Ga0495584_0033433 3300046491 Bacteria 2601
292 Ga0495584_0039582 3300046491 Bacteria 2381
293 Ga0495584_0046822 3300046491 Bacteria 2181
294 Ga0495584_0052319 3300046491 Bacteria 2055
295 Ga0495584_0052340 3300046491 Bacteria 2055
296 Ga0495584_0055174 3300046491 Bacteria 2000
297 Ga0495584_0154738 3300046491 Bacteria 1165
298 Ga0495584_0236873 3300046491 Bacteria 928
299 Ga0495585_0000055 3300046492 Bacteria 113899
300 Ga0495585_0000078 3300046492 Bacteria 100168
301 Ga0495585_0000655 3300046492 Bacteria 31822
302 Ga0495585_0001530 3300046492 Bacteria 17961
303 Ga0495585_0003116 3300046492 Bacteria 11381
304 Ga0495585_0006830 3300046492 Bacteria 7038
305 Ga0495585_0008154 3300046492 Bacteria 6364
306 Ga0495585_0023079 3300046492 Bacteria 3570
307 Ga0495585_0045509 3300046492 Bacteria 2449
308 Ga0495585_0053402 3300046492 Bacteria 2236
309 Ga0495585_0068212 3300046492 Bacteria 1943
310 Ga0495585_0068906 3300046492 Bacteria 1931
311 Ga0495585_0081192 3300046492 Bacteria 1756
312 Ga0495585_0081534 3300046492 Bacteria 1752
313 Ga0495585_0180785 3300046492 Bacteria 1084
314 Ga0495594_0025126 3300046499 Bacteria 3202
315 Ga0495594_0079246 3300046499 Bacteria 1833
316 Ga0495594_0184352 3300046499 Bacteria 1188
317 Ga0495596_0000895 3300046500 Bacteria 17878
318 Ga0495596_0009720 3300046500 Bacteria 4220
319 Ga0495596_0014428 3300046500 Bacteria 3330
320 Ga0495596_0015985 3300046500 Bacteria 3124
321 Ga0495596_0022579 3300046500 Bacteria 2561
322 Ga0495596_0031641 3300046500 Bacteria 2112
323 Ga0495596_0048916 3300046500 Bacteria 1657
324 Ga0495596_0066922 3300046500 Bacteria 1396
325 Ga0495607_0001333 3300046501 Bacteria 22039
326 Ga0495607_0002811 3300046501 Bacteria 13834
327 Ga0495607_0008678 3300046501 Bacteria 6928
328 Ga0495607_0008990 3300046501 Bacteria 6796
329 Ga0495607_0035200 3300046501 Bacteria 3031
330 Ga0495607_0036617 3300046501 Bacteria 2954
331 Ga0495607_0058997 3300046501 Bacteria 2191
332 Ga0495607_0075517 3300046501 Bacteria 1867
333 Ga0495607_0109733 3300046501 Bacteria 1464
334 Ga0495607_0166500 3300046501 Bacteria 1116
335 Ga0495607_0192601 3300046501 Bacteria 1014
336 Ga0495607_0234643 3300046501 Bacteria 890
337 Ga0495607_0278969 3300046501 Bacteria 794
338 Ga0495583_0000235 3300046506 Bacteria 91939
339 Ga0495583_0000381 3300046506 Bacteria 68754
340 Ga0495583_0001243 3300046506 Bacteria 27052
341 Ga0495583_0016621 3300046506 Bacteria 3946
342 Ga0495583_0029926 3300046506 Bacteria 2659
343 Ga0495583_0030318 3300046506 Bacteria 2635
344 Ga0495583_0032169 3300046506 Bacteria 2534
345 Ga0495583_0064224 3300046506 Bacteria 1629
346 Ga0495583_0088619 3300046506 Bacteria 1335
347 Ga0495583_0124192 3300046506 Bacteria 1084
348 Ga0495606_0030023 3300046507 Bacteria 3805
349 Ga0495606_0034691 3300046507 Bacteria 3460
350 Ga0495606_0037127 3300046507 Bacteria 3310
351 Ga0495606_0068862 3300046507 Bacteria 2238
352 Ga0495606_0086555 3300046507 Bacteria 1936
353 Ga0495606_0133456 3300046507 Bacteria 1473
354 Ga0495606_0138150 3300046507 Bacteria 1441
355 Ga0495606_0142908 3300046507 Bacteria 1411
356 Ga0495606_0153360 3300046507 Bacteria 1350
357 Ga0495610_0002827 3300046512 Bacteria 14144
358 Ga0495610_0006356 3300046512 Bacteria 8159
359 Ga0495610_0118430 3300046512 Bacteria 1164
360 Ga0495616_0000035 3300046513 Bacteria 128636
361 Ga0495616_0000634 3300046513 Bacteria 26282
362 Ga0495616_0000913 3300046513 Bacteria 21264
363 Ga0495616_0003494 3300046513 Bacteria 10051
364 Ga0495616_0007383 3300046513 Bacteria 6575
365 Ga0495616_0008777 3300046513 Bacteria 5953
366 Ga0495616_0015788 3300046513 Bacteria 4191
367 Ga0495616_0023002 3300046513 Bacteria 3358
368 Ga0495616_0023969 3300046513 Bacteria 3278
369 Ga0495616_0052725 3300046513 Bacteria 2024
370 Ga0495616_0061735 3300046513 Bacteria 1837
371 Ga0495616_0073365 3300046513 Bacteria 1651
372 Ga0495616_0077412 3300046513 Bacteria 1596
373 Ga0495616_0135071 3300046513 Bacteria 1127
374 Ga0495616_0173877 3300046513 Bacteria 961
375 Ga0495616_0300839 3300046513 Bacteria 677
376 Ga0495631_0000172 3300046518 Bacteria 43983
377 Ga0495631_0004377 3300046518 Bacteria 7525
378 Ga0495631_0011619 3300046518 Bacteria 4325
379 Ga0495631_0023447 3300046518 Bacteria 2859
380 Ga0495631_0037749 3300046518 Bacteria 2150
381 Ga0495631_0037921 3300046518 Bacteria 2145
382 Ga0495631_0061009 3300046518 Bacteria 1636
383 Ga0495631_0068046 3300046518 Bacteria 1540
384 Ga0495631_0113604 3300046518 Bacteria 1164
385 Ga0495632_0000073 3300046519 Bacteria 104293
386 Ga0495632_0000203 3300046519 Bacteria 60607
387 Ga0495632_0000225 3300046519 Bacteria 57394
388 Ga0495632_0002818 3300046519 Bacteria 12880
389 Ga0495632_0006271 3300046519 Bacteria 7685
390 Ga0495632_0042230 3300046519 Bacteria 2286
391 Ga0495632_0056351 3300046519 Bacteria 1921
392 Ga0495632_0086780 3300046519 Bacteria 1488
393 Ga0495632_0120233 3300046519 Bacteria 1228
394 Ga0495632_0197982 3300046519 Bacteria 916
395 Ga0495637_0000004 3300046520 Bacteria 589740
396 Ga0495637_0000009 3300046520 Bacteria 402028
397 Ga0495643_0000416 3300046522 Bacteria 55816
398 Ga0495643_0002506 3300046522 Bacteria 14429
399 Ga0495643_0059612 3300046522 Bacteria 2028
400 Ga0495643_0155851 3300046522 Bacteria 1127
401 Ga0495643_0164646 3300046522 Bacteria 1088
402 Ga0495643_0290382 3300046522 Bacteria 749
403 Ga0495644_0002243 3300046523 Bacteria 7731
404 Ga0495644_0010014 3300046523 Bacteria 3652
405 Ga0495644_0012356 3300046523 Bacteria 3283
406 Ga0495644_0012876 3300046523 Bacteria 3215
407 Ga0495644_0046043 3300046523 Bacteria 1639
408 Ga0495644_0064148 3300046523 Bacteria 1380
409 Ga0495644_0075632 3300046523 Unclassified 1268
410 Ga0495644_0233846 3300046523 Bacteria 712
411 Ga0495644_0281808 3300046523 Bacteria 648
412 Ga0495648_0000003 3300046524 Bacteria 386817
413 Ga0495648_0002527 3300046524 Bacteria 16779
414 Ga0495648_0004238 3300046524 Bacteria 12312
415 Ga0495648_0008784 3300046524 Bacteria 7908
416 Ga0495648_0012503 3300046524 Bacteria 6327
417 Ga0495648_0017360 3300046524 Bacteria 5147
418 Ga0495648_0035374 3300046524 Bacteria 3238
419 Ga0495648_0041892 3300046524 Bacteria 2887
420 Ga0495648_0066761 3300046524 Bacteria 2107
421 Ga0495648_0071481 3300046524 Bacteria 2011
422 Ga0495648_0132107 3300046524 Bacteria 1326
423 Ga0495648_0175449 3300046524 Bacteria 1094
424 Ga0495648_0223912 3300046524 Bacteria 926
425 Ga0495663_0005449 3300046525 Bacteria 3529
426 Ga0495663_0048872 3300046525 Bacteria 1305
427 Ga0495663_0292726 3300046525 Unclassified 585
428 Ga0495666_0000106 3300046526 Bacteria 33981
429 Ga0495666_0009385 3300046526 Bacteria 4896
430 Ga0495666_0085512 3300046526 Bacteria 1489
431 Ga0495642_0000065 3300046528 Bacteria 63401
432 Ga0495642_0000125 3300046528 Bacteria 43793
433 Ga0495642_0000186 3300046528 Bacteria 36860
434 Ga0495642_0002169 3300046528 Bacteria 8059
435 Ga0495642_0008926 3300046528 Bacteria 3835
436 Ga0495642_0014691 3300046528 Bacteria 3036
437 Ga0495642_0015558 3300046528 Bacteria 2958
438 Ga0495642_0017676 3300046528 Bacteria 2786
439 Ga0495642_0023334 3300046528 Bacteria 2441
440 Ga0495642_0030208 3300046528 Bacteria 2167
441 Ga0495642_0043220 3300046528 Bacteria 1837
442 Ga0495642_0063820 3300046528 Bacteria 1531
443 Ga0495652_0148240 3300046529 Bacteria 1836
444 Ga0495654_0006281 3300046530 Bacteria 6769
445 Ga0495654_0024731 3300046530 Bacteria 3100
446 Ga0495654_0036106 3300046530 Bacteria 2485
447 Ga0495654_0058248 3300046530 Bacteria 1864
448 Ga0495665_0017816 3300046531 Bacteria 3817
449 Ga0495665_0036444 3300046531 Bacteria 2626
450 Ga0495665_0084581 3300046531 Bacteria 1667
451 Ga0495640_0202345 3300046533 Bacteria 1258
452 Ga0495586_0258349 3300046535 Bacteria 994
453 Ga0495587_0110737 3300046536 Bacteria 1577
454 Ga0495587_0338493 3300046536 Bacteria 839
455 Ga0495587_0538576 3300046536 Bacteria 644
456 Ga0495609_0000030 3300046538 Bacteria 215885
457 Ga0495609_0005589 3300046538 Bacteria 6560
458 Ga0495609_0005876 3300046538 Bacteria 6357
459 Ga0495609_0053399 3300046538 Bacteria 1796
460 Ga0495609_0067293 3300046538 Bacteria 1577
461 Ga0495609_0135382 3300046538 Bacteria 1053
462 Ga0495609_0161242 3300046538 Bacteria 950
463 Ga0495609_0196645 3300046538 Bacteria 844
464 Ga0495597_0007929 3300046542 Bacteria 5351
465 Ga0495597_0021527 3300046542 Bacteria 2996
466 Ga0495597_0021701 3300046542 Bacteria 2984
467 Ga0495597_0022964 3300046542 Bacteria 2888
468 Ga0495597_0026311 3300046542 Bacteria 2673
469 Ga0495597_0030896 3300046542 Bacteria 2438
470 Ga0495597_0037941 3300046542 Bacteria 2161
471 Ga0495597_0048564 3300046542 Bacteria 1877
472 Ga0495645_0046255 3300046543 Bacteria 3172
473 Ga0495622_0006838 3300046557 Bacteria 5294
474 Ga0495622_0379111 3300046557 Bacteria 610
475 Ga0495633_0001558 3300046558 Bacteria 17597
476 Ga0495633_0007336 3300046558 Bacteria 6358
477 Ga0495633_0017787 3300046558 Bacteria 3623
478 Ga0495633_0020014 3300046558 Bacteria 3373
479 Ga0495633_0027253 3300046558 Bacteria 2793
480 Ga0495633_0035244 3300046558 Bacteria 2403
481 Ga0495633_0040980 3300046558 Bacteria 2203
482 Ga0495633_0063553 3300046558 Bacteria 1727
483 Ga0495633_0091203 3300046558 Bacteria 1416
484 Ga0495633_0136973 3300046558 Bacteria 1132
485 Ga0495633_0141588 3300046558 Bacteria 1112
486 Ga0495633_0240295 3300046558 Bacteria 827
487 Ga0495656_0002045 3300046615 Bacteria 6648
488 Ga0495656_0027203 3300046615 Bacteria 2282
489 Ga0495656_0033490 3300046615 Bacteria 2098
490 Ga0495656_0126192 3300046615 Bacteria 1213
491 Ga0495656_0276838 3300046615 Bacteria 854
492 Ga0495668_0000366 3300046616 Bacteria 59612
493 Ga0495668_0005974 3300046616 Bacteria 8089
494 Ga0495668_0010819 3300046616 Bacteria 5500
495 Ga0495668_0022441 3300046616 Bacteria 3607
496 Ga0495668_0031669 3300046616 Bacteria 2980
497 Ga0495668_0049662 3300046616 Bacteria 2326
498 Ga0495668_0056537 3300046616 Bacteria 2165
499 Ga0495668_0056909 3300046616 Bacteria 2157
500 Ga0495668_0063533 3300046616 Bacteria 2033
501 Ga0495668_0064619 3300046616 Bacteria 2014
502 Ga0495668_0131149 3300046616 Bacteria 1372
503 Ga0495634_0011124 3300046642 Bacteria 6563
504 Ga0495611_0000971 3300046648 Bacteria 15303
505 Ga0495611_0002769 3300046648 Bacteria 7863
506 Ga0495611_0005947 3300046648 Bacteria 5206
507 Ga0495611_0021569 3300046648 Bacteria 2782
508 Ga0495611_0027847 3300046648 Bacteria 2473
509 Ga0495611_0030555 3300046648 Bacteria 2369
510 Ga0495625_0025368 3300046660 Bacteria 4497
511 Ga0495625_0056976 3300046660 Bacteria 2780
512 Ga0495625_0102682 3300046660 Bacteria 1962
513 Ga0495625_0112684 3300046660 Bacteria 1858
514 Ga0495625_0121705 3300046660 Bacteria 1775
515 Ga0495625_0174302 3300046660 Bacteria 1434
516 Ga0495625_0216595 3300046660 Bacteria 1256
517 Ga0495625_0266922 3300046660 Bacteria 1106
518 Ga0495625_0581121 3300046660 Bacteria 675
519 Ga0495635_0132121 3300046663 Bacteria 1702
520 Ga0495659_0002783 3300046664 Bacteria 5623
521 Ga0495659_0117281 3300046664 Bacteria 1045
522 Ga0495659_0423298 3300046664 Unclassified 577
523 Ga0495661_0000209 3300046665 Bacteria 67580
524 Ga0495661_0000754 3300046665 Bacteria 31377
525 Ga0495661_0002894 3300046665 Bacteria 12984
526 Ga0495661_0005745 3300046665 Bacteria 8783
527 Ga0495661_0019946 3300046665 Bacteria 4384
528 Ga0495661_0025005 3300046665 Bacteria 3863
529 Ga0495661_0035602 3300046665 Bacteria 3122
530 Ga0495661_0045301 3300046665 Bacteria 2691
531 Ga0495661_0051839 3300046665 Bacteria 2475
532 Ga0495661_0052210 3300046665 Bacteria 2464
533 Ga0495661_0054372 3300046665 Bacteria 2403
534 Ga0495661_0054579 3300046665 Bacteria 2398
535 Ga0495661_0076387 3300046665 Bacteria 1943
536 Ga0495661_0083264 3300046665 Bacteria 1839
537 Ga0495661_0104187 3300046665 Bacteria 1591
538 Ga0495661_0110995 3300046665 Bacteria 1528
539 Ga0495661_0111333 3300046665 Bacteria 1525
540 Ga0495661_0152814 3300046665 Bacteria 1245
541 Ga0495661_0203384 3300046665 Bacteria 1035
542 Ga0495661_0289435 3300046665 Bacteria 823
543 Ga0495661_0356980 3300046665 Bacteria 718
544 Ga0495588_0000062 3300046674 Bacteria 253674
545 Ga0495588_0000201 3300046674 Bacteria 59959
546 Ga0495588_0061245 3300046674 Bacteria 1949
547 Ga0495588_0069554 3300046674 Bacteria 1829
548 Ga0495588_0085559 3300046674 Bacteria 1648
549 Ga0495623_0060310 3300046679 Bacteria 2380
550 Ga0495646_0030797 3300046680 Bacteria 3348
551 Ga0495669_0001393 3300046684 Bacteria 9968
552 Ga0495669_0001810 3300046684 Bacteria 8736
553 Ga0495669_0026859 3300046684 Bacteria 2516
554 Ga0495669_0109172 3300046684 Bacteria 1290
555 Ga0495669_0204924 3300046684 Bacteria 943
556 Ga0495669_0237870 3300046684 Bacteria 874
557 Ga0495624_0013524 3300046690 Bacteria 5564
558 Ga0495670_0005624 3300046691 Bacteria 6147
559 Ga0495670_0025658 3300046691 Bacteria 2915
560 Ga0495670_0034551 3300046691 Bacteria 2518
561 Ga0495670_0038243 3300046691 Bacteria 2392
562 Ga0495670_0040337 3300046691 Bacteria 2328
563 Ga0495670_0192225 3300046691 Bacteria 1079
564 Ga0495670_0256849 3300046691 Bacteria 932
565 Ga0495670_0266572 3300046691 Bacteria 914
566 Ga0495671_0000155 3300046692 Bacteria 59986
567 Ga0495671_0006304 3300046692 Bacteria 6866
568 Ga0495671_0050541 3300046692 Bacteria 2069
569 Ga0495671_0072622 3300046692 Bacteria 1689
570 Ga0495671_0131228 3300046692 Bacteria 1222
571 Ga0495671_0456621 3300046692 Bacteria 610
572 Ga0495649_0000742 3300046694 Bacteria 26389
573 Ga0495649_0039608 3300046694 Bacteria 2583
574 Ga0495649_0067445 3300046694 Bacteria 1919
575 Ga0495649_0111853 3300046694 Bacteria 1448
576 Ga0495649_0128240 3300046694 Bacteria 1339
577 Ga0495589_0000021 3300046794 Bacteria 197941
578 Ga0495589_0001008 3300046794 Bacteria 17087
579 Ga0495589_0006459 3300046794 Bacteria 6181
580 Ga0495589_0010050 3300046794 Bacteria 4917
581 Ga0495589_0013417 3300046794 Bacteria 4227
582 Ga0495589_0029215 3300046794 Bacteria 2779
583 Ga0495589_0038934 3300046794 Bacteria 2377
584 Ga0495589_0040568 3300046794 Bacteria 2324
585 Ga0495589_0045912 3300046794 Bacteria 2169
586 Ga0495589_0060253 3300046794 Bacteria 1864
587 Ga0495589_0089204 3300046794 Bacteria 1497
588 Ga0495589_0143908 3300046794 Bacteria 1140
589 Ga0495589_0237894 3300046794 Bacteria 852
590 Ga0495660_0000079 3300046810 Bacteria 104002
591 Ga0495660_0000173 3300046810 Bacteria 69912
592 Ga0495660_0003880 3300046810 Bacteria 9142
593 Ga0495660_0007814 3300046810 Bacteria 6281
594 Ga0495660_0017202 3300046810 Bacteria 4164
595 Ga0495660_0038726 3300046810 Bacteria 2649
596 Ga0495660_0053167 3300046810 Bacteria 2199
597 Ga0495660_0069066 3300046810 Bacteria 1878
598 Ga0495660_0085272 3300046810 Bacteria 1650
599 Ga0495660_0137311 3300046810 Bacteria 1220
600 Ga0495660_0277685 3300046810 Bacteria 767
601 Ga0495581_0022284 3300047315 Bacteria 3670
602 Ga0495581_0315508 3300047315 Bacteria 913
603 Ga0495604_0022851 3300047317 Bacteria 4991
604 Ga0495604_0081934 3300047317 Bacteria 2414
605 Ga0495636_0143316 3300047318 Bacteria 1068
606 Ga0495636_0195557 3300047318 Bacteria 922
607 Ga0495672_0000055 3300047320 Bacteria 229428
608 Ga0495672_0000169 3300047320 Bacteria 94803
609 Ga0495672_0004528 3300047320 Bacteria 11336
610 Ga0495672_0005516 3300047320 Bacteria 10018
611 Ga0495672_0010792 3300047320 Bacteria 6484
612 Ga0495672_0013967 3300047320 Bacteria 5521
613 Ga0495672_0064775 3300047320 Bacteria 2091
614 Ga0495672_0075317 3300047320 Bacteria 1898
615 Ga0495676_0004145 3300047321 Bacteria 13221
616 Ga0495676_0260710 3300047321 Bacteria 1179
617 Ga0495680_0074677 3300047322 Bacteria 2574
618 Ga0495683_0000240 3300047323 Bacteria 49829
619 Ga0495683_0002144 3300047323 Bacteria 12155
620 Ga0495683_0008918 3300047323 Bacteria 5352
621 Ga0495683_0012631 3300047323 Bacteria 4434
622 Ga0495683_0015027 3300047323 Bacteria 4031
623 Ga0495683_0015773 3300047323 Bacteria 3923
624 Ga0495683_0049427 3300047323 Bacteria 2106
625 Ga0495683_0052302 3300047323 Bacteria 2039
626 Ga0495683_0079674 3300047323 Bacteria 1599
627 Ga0495687_000012 3300047443 Bacteria 391586
628 Ga0495687_000036 3300047443 Bacteria 255427
629 Ga0495687_000276 3300047443 Bacteria 67876
630 Ga0495687_000279 3300047443 Bacteria 67230
631 Ga0495687_000319 3300047443 Bacteria 62530
632 Ga0495687_000534 3300047443 Bacteria 45469
633 Ga0495687_002885 3300047443 Bacteria 13124
634 Ga0495687_004935 3300047443 Bacteria 8731
635 Ga0495687_035045 3300047443 Bacteria 2261
636 Ga0495687_045135 3300047443 Bacteria 1910
637 Ga0495675_0003962 3300047444 Bacteria 8978
638 Ga0495675_0054903 3300047444 Bacteria 2527
639 Ga0495675_0123093 3300047444 Bacteria 1615
640 Ga0495677_0000050 3300047445 Bacteria 67980
641 Ga0495677_0000125 3300047445 Bacteria 37212
642 Ga0495677_0000705 3300047445 Bacteria 13542
643 Ga0495677_0001535 3300047445 Bacteria 9294
644 Ga0495677_0001768 3300047445 Bacteria 8654
645 Ga0495677_0018080 3300047445 Bacteria 2555
646 Ga0495677_0018478 3300047445 Bacteria 2528
647 Ga0495677_0028588 3300047445 Bacteria 2025
648 Ga0495677_0081339 3300047445 Bacteria 1214
649 Ga0495677_0101717 3300047445 Bacteria 1088
650 Ga0495677_0187075 3300047445 Bacteria 803
651 Ga0495679_005955 3300047446 Bacteria 5333
652 Ga0495679_007740 3300047446 Bacteria 4444
653 Ga0495679_011783 3300047446 Bacteria 3358
654 Ga0495679_038015 3300047446 Bacteria 1510
655 Ga0495679_039371 3300047446 Bacteria 1474
656 Ga0495679_084841 3300047446 Bacteria 895
657 Ga0495685_025926 3300047447 Bacteria 2017
658 Ga0495685_080940 3300047447 Bacteria 1081
659 Ga0495681_0001220 3300047470 Bacteria 19572
660 Ga0495681_0001449 3300047470 Bacteria 17784
661 Ga0495681_0029106 3300047470 Bacteria 2831
662 Ga0495681_0030174 3300047470 Bacteria 2764
663 Ga0495681_0040214 3300047470 Bacteria 2278
664 Ga0495681_0052173 3300047470 Bacteria 1920
665 Ga0495681_0185416 3300047470 Bacteria 852
666 Ga0495686_0000474 3300047472 Bacteria 59917
667 Ga0495686_0000495 3300047472 Bacteria 57870
668 Ga0495686_0030672 3300047472 Bacteria 3490
669 Ga0495686_0038138 3300047472 Bacteria 3074
670 Ga0495686_0316640 3300047472 Bacteria 856
671 Ga0495686_0377220 3300047472 Bacteria 766
672 Ga0495593_0189527 3300047673 Bacteria 1035
673 Ga0495602_0018586 3300048088 Bacteria 6933
674 Ga0495614_0173847 3300048089 Bacteria 967
675 Ga0495615_0151273 3300048090 Bacteria 691
676 Ga0495626_0000017 3300048091 Bacteria 231648
677 Ga0495626_0000624 3300048091 Bacteria 34501
678 Ga0495626_0003125 3300048091 Bacteria 10841
679 Ga0495626_0004146 3300048091 Bacteria 8998
680 Ga0495626_0009282 3300048091 Bacteria 5321
681 Ga0495626_0024189 3300048091 Bacteria 2980
682 Ga0495626_0025498 3300048091 Bacteria 2890
683 Ga0495626_0029007 3300048091 Bacteria 2680
684 Ga0495626_0031544 3300048091 Bacteria 2549
685 Ga0495626_0044886 3300048091 Bacteria 2065
686 Ga0495626_0097352 3300048091 Bacteria 1286
687 Ga0495626_0109628 3300048091 Bacteria 1196
688 Ga0495626_0124254 3300048091 Bacteria 1106
689 Ga0495626_0126572 3300048091 Bacteria 1094
690 Ga0495626_0130271 3300048091 Bacteria 1074
691 Ga0496100_0078464 3300048903 Bacteria 2222
692 Ga0496100_0359132 3300048903 Bacteria 1102
693 Ga0496100_0513319 3300048903 Bacteria 924
694 Ga0496101_0078055 3300048904 Bacteria 2441
695 Ga0496101_0091739 3300048904 Bacteria 2261
696 Ga0496101_0128836 3300048904 Bacteria 1920
697 Ga0496102_0000343 3300048905 Bacteria 56826
698 Ga0496102_0057265 3300048905 Bacteria 3558
699 Ga0496102_0129325 3300048905 Bacteria 2362
700 Ga0496102_0169350 3300048905 Bacteria 2056
701 Ga0496102_0224853 3300048905 Bacteria 1769
702 Ga0496103_0001094 3300048906 Bacteria 18866
703 Ga0496103_0005287 3300048906 Bacteria 7746
704 Ga0496103_0011731 3300048906 Bacteria 5199
705 Ga0496103_0128966 3300048906 Bacteria 1614
706 Ga0496103_0198440 3300048906 Bacteria 1290
707 Ga0496103_0433451 3300048906 Bacteria 843
708 Ga0496103_0516802 3300048906 Unclassified 763
709 Ga0496104_0358760 3300048907 Bacteria 1370
710 Ga0496105_0622351 3300048908 Bacteria 836
711 Ga0496106_0000824 3300048909 Bacteria 22499
712 Ga0496106_0018092 3300048909 Bacteria 5210
713 Ga0496106_0111768 3300048909 Bacteria 2128
714 Ga0496107_0024342 3300048910 Bacteria 4284
715 Ga0496107_0102944 3300048910 Bacteria 2094
716 Ga0496107_0125491 3300048910 Bacteria 1893
717 Ga0496109_0030996 3300048912 Bacteria 4795
718 Ga0496109_0432242 3300048912 Bacteria 1244
719 Ga0496110_0009165 3300048913 Bacteria 7994
720 Ga0496110_0463795 3300048913 Bacteria 1154
721 Ga0496110_0715489 3300048913 Bacteria 903
722 Ga0496111_0290177 3300048914 Bacteria 1213
723 Ga0496111_0644112 3300048914 Bacteria 773
724 Ga0496111_0673229 3300048914 Bacteria 754
725 Ga0496113_0092813 3300048916 Bacteria 2329
726 Ga0496114_0251232 3300048917 Bacteria 1556
727 Ga0496114_0375265 3300048917 Bacteria 1259
728 Ga0496115_0213669 3300048918 Bacteria 1593
729 Ga0496115_0258902 3300048918 Bacteria 1431
730 Ga0496121_0149236 3300048924 Bacteria 1723
731 Ga0496121_0166486 3300048924 Bacteria 1606
732 Ga0496121_0268846 3300048924 Bacteria 1173
733 Ga0496122_0000452 3300048925 Bacteria 85514
734 Ga0496122_0004239 3300048925 Bacteria 17986
735 Ga0496123_0000514 3300048926 Bacteria 67374
736 Ga0496123_0001857 3300048926 Bacteria 27725
737 Ga0496124_0006694 3300048927 Bacteria 12474
738 Ga0496124_0009567 3300048927 Bacteria 9958
739 Ga0496124_0010958 3300048927 Bacteria 9116
740 Ga0496124_0035967 3300048927 Bacteria 4326
741 Ga0496124_0313755 3300048927 Bacteria 1126
742 Ga0496125_0000572 3300048928 Bacteria 63057
743 Ga0496126_0148155 3300048929 Bacteria 2014
744 Ga0496126_0410800 3300048929 Bacteria 1096
745 Ga0496126_0714366 3300048929 Bacteria 777
746 Ga0501308_000154 3300049128 Bacteria 3616
747 Ga0501309_034261 3300049129 Bacteria 759
748 Ga0501343_008292 3300049132 Bacteria 829
749 Ga0501304_000831 3300049160 Bacteria 1789
750 Ga0501305_013850 3300049161 Bacteria 1121
751 Ga0501305_037403 3300049161 Bacteria 779
752 Ga0495678_000025 3300049459 Bacteria 227891
753 Ga0495678_000293 3300049459 Bacteria 54963
754 Ga0495678_001760 3300049459 Bacteria 16051
755 Ga0495678_002352 3300049459 Bacteria 12991
756 Ga0495678_004783 3300049459 Bacteria 7710
757 Ga0495678_006034 3300049459 Bacteria 6527
758 Ga0495678_033044 3300049459 Bacteria 2139
759 Ga0495682_0021428 3300049460 Bacteria 2421
760 Ga0495682_0023735 3300049460 Bacteria 2288
761 Ga0501313_003540 3300049529 Bacteria 1559
762 Ga0501315_004991 3300049531 Bacteria 1416
763 Ga0501316_003292 3300049532 Bacteria 1559
764 Ga0501318_020293 3300049534 Bacteria 836
765 Ga0501322_005939 3300049538 Bacteria 858
766 Ga0501323_021399 3300049539 Bacteria 855
767 Ga0501034_0519076 3300049571 Bacteria 1103
768 Ga0501039_0659412 3300049575 Bacteria 819
769 Ga0501206_023412 3300049653 Bacteria 890
770 Ga0501235_039996 3300049669 Bacteria 1071
771 Ga0501249_049064 3300049679 Bacteria 967
772 Ga0501269_000670 3300049766 Bacteria 5797
773 Ga0501035_0001236 3300049822 Bacteria 26534
774 Ga0501035_0003370 3300049822 Bacteria 15295
775 Ga0587066_005571 3300059490 Bacteria 1619
776 Ga0587070_023414 3300059491 Bacteria 1061
777 Ga0587070_127413 3300059491 Bacteria 615
778 Ga0587077_017668 3300059493 Bacteria 1218
779 Ga0587080_015078 3300059503 Bacteria 1204
780 Ga0587082_000446 3300059504 Bacteria 3423
781 Ga0587082_015534 3300059504 Bacteria 1177
782 Ga0587083_0006070 3300059505 Bacteria 1781
783 Ga0587083_0015020 3300059505 Bacteria 1344
784 Ga0587083_0163977 3300059505 Bacteria 610
785 Ga0587088_002890 3300059508 Bacteria 2019
786 Ga0587091_044547 3300059511 Bacteria 889
787 Ga0587098_000942 3300059604 Bacteria 2056
788 Ga0587106_006814 3300059605 Bacteria 1362
789 Ga0587067_005377 3300059640 Bacteria 1732
790 Ga0587067_038066 3300059640 Bacteria 922
791 Ga0587068_000329 3300059641 Bacteria 4029
792 Ga0587068_007735 3300059641 Bacteria 1539
793 Ga0587069_021994 3300059642 Bacteria 965
794 Ga0587072_007236 3300059643 Bacteria 1718
795 Ga0587072_020943 3300059643 Bacteria 1156
796 Ga0587076_014247 3300059645 Bacteria 1221
797 Ga0587076_023388 3300059645 Bacteria 1041
798 Ga0587079_001348 3300059647 Bacteria 2717
799 Ga0587102_009733 3300059649 Bacteria 938
800 Ga0587107_009266 3300059652 Bacteria 1158
801 Ga0466962_0068103 3300061719 Bacteria 1699
802 Ga0466962_0089294 3300061719 Bacteria 1476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0009165 Ga0496110_0009165_6884_7357 157
2 3300046474 Ga0495605_0204913 Ga0495605_0204913_368_847 159
3 3300046501 Ga0495607_0035200 Ga0495607_0035200_614_1093 159
4 3300046665 Ga0495661_0289435 Ga0495661_0289435_333_812 159
5 3300048091 Ga0495626_0044886 Ga0495626_0044886_74_553 159
6 iso_pu_bacteria 2643221556 2643802852 159
7 iso_pu_bacteria 2643221645 2644253169 159
8 iso_pu_bacteria 2643221664 2644355780 159
9 iso_pu_bacteria 2643221684 2644472357 159
10 iso_pu_bacteria 2738541280 2738742158 159
11 iso_pu_bacteria 2738541300 2738841323 159
12 iso_pu_bacteria 2738543018 2739272193 159
13 iso_pu_bacteria 2738543030 2739341237 159
14 iso_pu_bacteria 2808606418 2809142780 159
15 iso_pu_bacteria 2904424332 2904426860 159
16 iso_pu_bacteria 8047673197 8047678545 159
17 iso_pu_bacteria 2643221556 2643798737 160
18 iso_pu_bacteria 2643221684 2644471166 160
19 iso_pu_bacteria 8047673197 8047678305 160
20 3300046691 Ga0495670_0256849 Ga0495670_0256849_294_812 162
21 3300003163 Ga0006759J45824_1004575 Ga0006759J45824_10045752 163
22 3300003163 Ga0006759J45824_1058350 Ga0006759J45824_10583501 163
23 3300003759 Ga0055525_1000047 Ga0055525_100004762 163
24 3300003762 Ga0055542_1006888 Ga0055542_10068883 163
25 3300005262 Ga0065165_1004312 Ga0065165_10043122 163
26 3300005329 Ga0070683_101350146 Ga0070683_1013501462 163
27 3300005339 Ga0070660_100079591 Ga0070660_1000795912 163
28 3300005339 Ga0070660_100257468 Ga0070660_1002574683 163
29 3300005344 Ga0070661_100206503 Ga0070661_1002065032 163
30 3300005354 Ga0070675_100465920 Ga0070675_1004659201 163
31 3300005366 Ga0070659_100538701 Ga0070659_1005387012 163
32 3300005455 Ga0070663_101021545 Ga0070663_1010215451 163
33 3300005457 Ga0070662_100106878 Ga0070662_1001068783 163
34 3300005457 Ga0070662_101052524 Ga0070662_1010525241 163
35 3300005459 Ga0068867_100108719 Ga0068867_1001087193 163
36 3300005539 Ga0068853_100465092 Ga0068853_1004650921 163
37 3300005563 Ga0068855_100235184 Ga0068855_1002351842 163
38 3300005563 Ga0068855_100661989 Ga0068855_1006619892 163
39 3300005564 Ga0070664_100076140 Ga0070664_1000761402 163
40 3300005564 Ga0070664_100202515 Ga0070664_1002025152 163
41 3300005564 Ga0070664_100652890 Ga0070664_1006528902 163
42 3300005616 Ga0068852_100236859 Ga0068852_1002368592 163
43 3300005718 Ga0068866_10529984 Ga0068866_105299841 163
44 3300006358 Ga0068871_101179942 Ga0068871_1011799421 163
45 3300009036 Ga0105244_10006509 Ga0105244_1000650910 163
46 3300009036 Ga0105244_10327773 Ga0105244_103277731 163
47 3300009148 Ga0105243_10042231 Ga0105243_100422313 163
48 3300009174 Ga0105241_10054249 Ga0105241_100542492 163
49 3300009176 Ga0105242_10022993 Ga0105242_100229936 163
50 3300009551 Ga0105238_10318576 Ga0105238_103185762 163
51 3300010375 Ga0105239_10272689 Ga0105239_102726893 163
52 3300013102 Ga0157371_10000026 Ga0157371_10000026241 163
53 3300013296 Ga0157374_10568135 Ga0157374_105681352 163
54 3300013307 Ga0157372_10555165 Ga0157372_105551652 163
55 3300014497 Ga0182008_10006642 Ga0182008_100066426 163
56 3300015261 Ga0182006_1005953 Ga0182006_10059534 163
57 3300015262 Ga0182007_10021675 Ga0182007_100216752 163
58 3300020080 Ga0206350_11162310 Ga0206350_111623102 163
59 3300020610 Ga0154015_1259593 Ga0154015_12595932 163
60 3300022467 Ga0224712_10582297 Ga0224712_105822971 163
61 3300025230 Ga0209563_100003 Ga0209563_100003592 163
62 3300025253 Ga0209677_107761 Ga0209677_1077612 163
63 3300025254 Ga0209148_1001353 Ga0209148_10013539 163
64 3300025295 Ga0209564_1000006 Ga0209564_1000006730 163
65 3300025728 Ga0207655_1006414 Ga0207655_10064144 163
66 3300025728 Ga0207655_1160736 Ga0207655_11607362 163
67 3300025907 Ga0207645_10283041 Ga0207645_102830412 163
68 3300025909 Ga0207705_10083064 Ga0207705_100830642 163
69 3300025909 Ga0207705_10715932 Ga0207705_107159321 163
70 3300025913 Ga0207695_10175687 Ga0207695_101756874 163
71 3300025919 Ga0207657_10160013 Ga0207657_101600133 163
72 3300025919 Ga0207657_10251940 Ga0207657_102519402 163
73 3300025924 Ga0207694_10470439 Ga0207694_104704392 163
74 3300025932 Ga0207690_10316074 Ga0207690_103160741 163
75 3300025932 Ga0207690_10830927 Ga0207690_108309272 163
76 3300025933 Ga0207706_10212096 Ga0207706_102120963 163
77 3300025933 Ga0207706_10599267 Ga0207706_105992672 163
78 3300025934 Ga0207686_10002979 Ga0207686_100029794 163
79 3300025938 Ga0207704_10323451 Ga0207704_103234512 163
80 3300025945 Ga0207679_10445770 Ga0207679_104457701 163
81 3300025945 Ga0207679_10958020 Ga0207679_109580201 163
82 3300025945 Ga0207679_11115864 Ga0207679_111158642 163
83 3300025949 Ga0207667_10018225 Ga0207667_100182256 163
84 3300025981 Ga0207640_10143660 Ga0207640_101436602 163
85 3300026041 Ga0207639_10281620 Ga0207639_102816202 163
86 3300026067 Ga0207678_10421310 Ga0207678_104213102 163
87 3300026078 Ga0207702_10798915 Ga0207702_107989152 163
88 3300026089 Ga0207648_10211601 Ga0207648_102116012 163
89 3300026142 Ga0207698_10035453 Ga0207698_100354535 163
90 3300030736 Ga0316180_1066585 Ga0316180_10665851 163
91 3300030745 Ga0316182_1190314 Ga0316182_11903141 163
92 3300031548 Ga0307408_101229931 Ga0307408_1012299311 163
93 3300037312 Ga0395899_0000163 Ga0395899_0000163_29623_30114 163
94 3300037312 Ga0395899_0002576 Ga0395899_0002576_10606_11097 163
95 3300037312 Ga0395899_0053077 Ga0395899_0053077_1649_2140 163
96 3300037312 Ga0395899_0713707 Ga0395899_0713707_78_569 163
97 3300037418 Ga0395900_0000331 Ga0395900_0000331_58427_58918 163
98 3300037418 Ga0395900_0049632 Ga0395900_0049632_2154_2645 163
99 3300037418 Ga0395900_0189706 Ga0395900_0189706_1489_1980 163
100 3300037418 Ga0395900_0261928 Ga0395900_0261928_175_666 163
101 3300037418 Ga0395900_0517584 Ga0395900_0517584_56_547 163
102 3300037466 Ga0395898_0053893 Ga0395898_0053893_1661_2152 163
103 3300037466 Ga0395898_0923258 Ga0395898_0923258_214_705 163
104 3300037471 Ga0395905_0040986 Ga0395905_0040986_2628_3119 163
105 3300037471 Ga0395905_0062338 Ga0395905_0062338_2081_2572 163
106 3300037471 Ga0395905_0153806 Ga0395905_0153806_910_1401 163
107 3300037471 Ga0395905_0190556 Ga0395905_0190556_744_1235 163
108 3300037471 Ga0395905_0409584 Ga0395905_0409584_695_1186 163
109 3300038443 Ga0395901_0000097 Ga0395901_0000097_92064_92555 163
110 3300038443 Ga0395901_0237319 Ga0395901_0237319_347_838 163
111 3300038443 Ga0395901_0367226 Ga0395901_0367226_525_1016 163
112 3300038443 Ga0395901_0608981 Ga0395901_0608981_33_524 163
113 3300042006 Ga0439432_063504 Ga0439432_063504_624_1115 163
114 3300042012 Ga0439455_0199423 Ga0439455_0199423_12_503 163
115 3300042115 Ga0450911_010167 Ga0450911_010167_527_1018 163
116 3300042139 Ga0450904_002179 Ga0450904_002179_617_1108 163
117 3300042145 Ga0450906_021535 Ga0450906_021535_44_535 163
118 3300042157 Ga0439458_0013955 Ga0439458_0013955_604_1095 163
119 3300042157 Ga0439458_0067846 Ga0439458_0067846_118_609 163
120 3300044656 Ga0466969_0052939 Ga0466969_0052939_762_1253 163
121 3300044656 Ga0466969_0124989 Ga0466969_0124989_653_1144 163
122 3300044656 Ga0466969_0150502 Ga0466969_0150502_454_945 163
123 3300044658 Ga0466972_0065993 Ga0466972_0065993_379_870 163
124 3300044683 Ga0466965_0019800 Ga0466965_0019800_1065_1556 163
125 3300044683 Ga0466965_0069500 Ga0466965_0069500_579_1070 163
126 3300044683 Ga0466965_0073684 Ga0466965_0073684_859_1350 163
127 3300044684 Ga0466966_0047895 Ga0466966_0047895_2125_2616 163
128 3300044684 Ga0466966_0056131 Ga0466966_0056131_1184_1675 163
129 3300044684 Ga0466966_0179095 Ga0466966_0179095_487_978 163
130 3300044684 Ga0466966_0194709 Ga0466966_0194709_254_745 163
131 3300044684 Ga0466966_0398966 Ga0466966_0398966_237_728 163
132 3300044693 Ga0466961_0270682 Ga0466961_0270682_121_612 163
133 3300044693 Ga0466961_0596178 Ga0466961_0596178_90_581 163
134 3300044694 Ga0466963_0157946 Ga0466963_0157946_206_697 163
135 3300044706 Ga0466964_0001150 Ga0466964_0001150_6831_7322 163
136 3300044706 Ga0466964_0040745 Ga0466964_0040745_637_1128 163
137 3300044719 Ga0466971_0045401 Ga0466971_0045401_744_1235 163
138 3300044719 Ga0466971_0111603 Ga0466971_0111603_157_648 163
139 3300044735 Ga0466968_0146793 Ga0466968_0146793_238_729 163
140 3300044735 Ga0466968_0193170 Ga0466968_0193170_270_761 163
141 3300044735 Ga0466968_0308359 Ga0466968_0308359_245_736 163
142 3300044765 Ga0466970_0188066 Ga0466970_0188066_377_868 163
143 3300044765 Ga0466970_0392207 Ga0466970_0392207_162_653 163
144 3300044842 Ga0466957_0000007 Ga0466957_0000007_24134_24625 163
145 3300044842 Ga0466957_0022568 Ga0466957_0022568_2583_3113 163
146 3300044842 Ga0466957_0100249 Ga0466957_0100249_858_1349 163
147 3300044842 Ga0466957_0203165 Ga0466957_0203165_705_1196 163
148 3300044842 Ga0466957_0778068 Ga0466957_0778068_28_519 163
149 3300044901 Ga0466960_0658629 Ga0466960_0658629_91_582 163
150 3300045049 Ga0466959_0072655 Ga0466959_0072655_948_1439 163
151 3300045049 Ga0466959_0101579 Ga0466959_0101579_1208_1699 163
152 3300045049 Ga0466959_0465336 Ga0466959_0465336_276_767 163
153 3300045836 Ga0466958_0409789 Ga0466958_0409789_167_658 163
154 3300045976 Ga0466967_0006229 Ga0466967_0006229_545_1036 163
155 3300045976 Ga0466967_0019086 Ga0466967_0019086_4515_5006 163
156 3300045976 Ga0466967_0363056 Ga0466967_0363056_825_1316 163
157 3300046452 Ga0495617_000009 Ga0495617_000009_208073_208564 163
158 3300046452 Ga0495617_000272 Ga0495617_000272_26048_26539 163
159 3300046452 Ga0495617_082273 Ga0495617_082273_336_827 163
160 3300046453 Ga0495627_002610 Ga0495627_002610_3848_4339 163
161 3300046453 Ga0495627_023199 Ga0495627_023199_519_1010 163
162 3300046453 Ga0495627_029600 Ga0495627_029600_478_969 163
163 3300046453 Ga0495627_161116 Ga0495627_161116_97_588 163
164 3300046457 Ga0495590_0000080 Ga0495590_0000080_16062_16553 163
165 3300046457 Ga0495590_0000253 Ga0495590_0000253_4282_4773 163
166 3300046457 Ga0495590_0000256 Ga0495590_0000256_1617_2108 163
167 3300046457 Ga0495590_0007337 Ga0495590_0007337_3393_3884 163
168 3300046457 Ga0495590_0166441 Ga0495590_0166441_108_599 163
169 3300046458 Ga0495591_000043 Ga0495591_000043_43989_44480 163
170 3300046458 Ga0495591_002168 Ga0495591_002168_1607_2098 163
171 3300046458 Ga0495591_088527 Ga0495591_088527_55_546 163
172 3300046460 Ga0495638_0483997 Ga0495638_0483997_88_579 163
173 3300046463 Ga0495653_0018525 Ga0495653_0018525_4617_5108 163
174 3300046471 Ga0495650_0000358 Ga0495650_0000358_5400_5891 163
175 3300046471 Ga0495650_0000382 Ga0495650_0000382_70996_71487 163
176 3300046471 Ga0495650_0007541 Ga0495650_0007541_371_862 163
177 3300046471 Ga0495650_0047171 Ga0495650_0047171_454_945 163
178 3300046471 Ga0495650_0094363 Ga0495650_0094363_32_523 163
179 3300046472 Ga0495580_0021570 Ga0495580_0021570_362_853 163
180 3300046473 Ga0495582_0034710 Ga0495582_0034710_1445_1936 163
181 3300046474 Ga0495605_0000024 Ga0495605_0000024_130923_131414 163
182 3300046474 Ga0495605_0000236 Ga0495605_0000236_60038_60529 163
183 3300046474 Ga0495605_0005418 Ga0495605_0005418_1103_1594 163
184 3300046474 Ga0495605_0018745 Ga0495605_0018745_1731_2222 163
185 3300046474 Ga0495605_0026741 Ga0495605_0026741_1985_2476 163
186 3300046474 Ga0495605_0031694 Ga0495605_0031694_431_922 163
187 3300046474 Ga0495605_0033892 Ga0495605_0033892_644_1135 163
188 3300046474 Ga0495605_0107888 Ga0495605_0107888_400_891 163
189 3300046474 Ga0495605_0153637 Ga0495605_0153637_101_592 163
190 3300046474 Ga0495605_0208400 Ga0495605_0208400_164_655 163
191 3300046474 Ga0495605_0243968 Ga0495605_0243968_97_588 163
192 3300046491 Ga0495584_0000003 Ga0495584_0000003_303822_304313 163
193 3300046491 Ga0495584_0001712 Ga0495584_0001712_10912_11403 163
194 3300046491 Ga0495584_0004180 Ga0495584_0004180_1995_2486 163
195 3300046491 Ga0495584_0008977 Ga0495584_0008977_353_844 163
196 3300046491 Ga0495584_0033433 Ga0495584_0033433_509_1000 163
197 3300046491 Ga0495584_0046822 Ga0495584_0046822_789_1280 163
198 3300046491 Ga0495584_0052319 Ga0495584_0052319_578_1069 163
199 3300046491 Ga0495584_0052340 Ga0495584_0052340_325_816 163
200 3300046491 Ga0495584_0055174 Ga0495584_0055174_79_570 163
201 3300046491 Ga0495584_0154738 Ga0495584_0154738_570_1061 163
202 3300046491 Ga0495584_0236873 Ga0495584_0236873_67_558 163
203 3300046492 Ga0495585_0000055 Ga0495585_0000055_67190_67681 163
204 3300046492 Ga0495585_0000078 Ga0495585_0000078_13339_13920 163
205 3300046492 Ga0495585_0000655 Ga0495585_0000655_25301_25792 163
206 3300046492 Ga0495585_0001530 Ga0495585_0001530_12152_12643 163
207 3300046492 Ga0495585_0008154 Ga0495585_0008154_1614_2105 163
208 3300046492 Ga0495585_0023079 Ga0495585_0023079_1256_1747 163
209 3300046492 Ga0495585_0045509 Ga0495585_0045509_260_751 163
210 3300046492 Ga0495585_0053402 Ga0495585_0053402_324_815 163
211 3300046492 Ga0495585_0068212 Ga0495585_0068212_266_757 163
212 3300046492 Ga0495585_0068906 Ga0495585_0068906_404_895 163
213 3300046492 Ga0495585_0081192 Ga0495585_0081192_608_1099 163
214 3300046492 Ga0495585_0081534 Ga0495585_0081534_546_1037 163
215 3300046492 Ga0495585_0180785 Ga0495585_0180785_371_862 163
216 3300046499 Ga0495594_0025126 Ga0495594_0025126_302_793 163
217 3300046499 Ga0495594_0079246 Ga0495594_0079246_934_1425 163
218 3300046499 Ga0495594_0184352 Ga0495594_0184352_658_1149 163
219 3300046500 Ga0495596_0000895 Ga0495596_0000895_13498_13989 163
220 3300046500 Ga0495596_0009720 Ga0495596_0009720_3582_4073 163
221 3300046500 Ga0495596_0014428 Ga0495596_0014428_2458_2949 163
222 3300046500 Ga0495596_0015985 Ga0495596_0015985_570_1061 163
223 3300046500 Ga0495596_0022579 Ga0495596_0022579_1630_2121 163
224 3300046500 Ga0495596_0031641 Ga0495596_0031641_611_1102 163
225 3300046500 Ga0495596_0048916 Ga0495596_0048916_896_1387 163
226 3300046500 Ga0495596_0066922 Ga0495596_0066922_404_895 163
227 3300046501 Ga0495607_0001333 Ga0495607_0001333_20274_20765 163
228 3300046501 Ga0495607_0002811 Ga0495607_0002811_6513_7004 163
229 3300046501 Ga0495607_0008678 Ga0495607_0008678_3417_3908 163
230 3300046501 Ga0495607_0008990 Ga0495607_0008990_1579_2070 163
231 3300046501 Ga0495607_0036617 Ga0495607_0036617_117_608 163
232 3300046501 Ga0495607_0075517 Ga0495607_0075517_1043_1534 163
233 3300046501 Ga0495607_0166500 Ga0495607_0166500_295_786 163
234 3300046501 Ga0495607_0234643 Ga0495607_0234643_283_774 163
235 3300046501 Ga0495607_0278969 Ga0495607_0278969_47_538 163
236 3300046506 Ga0495583_0000235 Ga0495583_0000235_16000_16491 163
237 3300046506 Ga0495583_0000381 Ga0495583_0000381_58266_58757 163
238 3300046506 Ga0495583_0001243 Ga0495583_0001243_26107_26598 163
239 3300046506 Ga0495583_0016621 Ga0495583_0016621_510_1001 163
240 3300046506 Ga0495583_0029926 Ga0495583_0029926_1348_1839 163
241 3300046506 Ga0495583_0030318 Ga0495583_0030318_1436_1927 163
242 3300046506 Ga0495583_0032169 Ga0495583_0032169_554_1045 163
243 3300046506 Ga0495583_0064224 Ga0495583_0064224_106_597 163
244 3300046506 Ga0495583_0088619 Ga0495583_0088619_739_1230 163
245 3300046506 Ga0495583_0124192 Ga0495583_0124192_525_1016 163
246 3300046507 Ga0495606_0034691 Ga0495606_0034691_441_932 163
247 3300046507 Ga0495606_0037127 Ga0495606_0037127_1990_2481 163
248 3300046507 Ga0495606_0068862 Ga0495606_0068862_391_882 163
249 3300046507 Ga0495606_0086555 Ga0495606_0086555_513_1004 163
250 3300046507 Ga0495606_0133456 Ga0495606_0133456_346_837 163
251 3300046507 Ga0495606_0138150 Ga0495606_0138150_845_1336 163
252 3300046507 Ga0495606_0142908 Ga0495606_0142908_434_925 163
253 3300046507 Ga0495606_0153360 Ga0495606_0153360_195_686 163
254 3300046512 Ga0495610_0002827 Ga0495610_0002827_8431_8922 163
255 3300046512 Ga0495610_0006356 Ga0495610_0006356_1634_2125 163
256 3300046512 Ga0495610_0118430 Ga0495610_0118430_377_868 163
257 3300046513 Ga0495616_0000634 Ga0495616_0000634_5254_5745 163
258 3300046513 Ga0495616_0000913 Ga0495616_0000913_20703_21194 163
259 3300046513 Ga0495616_0003494 Ga0495616_0003494_3636_4127 163
260 3300046513 Ga0495616_0007383 Ga0495616_0007383_5885_6376 163
261 3300046513 Ga0495616_0008777 Ga0495616_0008777_1382_1873 163
262 3300046513 Ga0495616_0023002 Ga0495616_0023002_266_757 163
263 3300046513 Ga0495616_0023969 Ga0495616_0023969_2672_3163 163
264 3300046513 Ga0495616_0052725 Ga0495616_0052725_437_928 163
265 3300046513 Ga0495616_0061735 Ga0495616_0061735_1204_1695 163
266 3300046513 Ga0495616_0073365 Ga0495616_0073365_483_974 163
267 3300046513 Ga0495616_0077412 Ga0495616_0077412_544_1035 163
268 3300046513 Ga0495616_0135071 Ga0495616_0135071_66_557 163
269 3300046513 Ga0495616_0173877 Ga0495616_0173877_384_875 163
270 3300046513 Ga0495616_0300839 Ga0495616_0300839_116_607 163
271 3300046518 Ga0495631_0000172 Ga0495631_0000172_33937_34428 163
272 3300046518 Ga0495631_0004377 Ga0495631_0004377_1205_1696 163
273 3300046518 Ga0495631_0011619 Ga0495631_0011619_3343_3834 163
274 3300046518 Ga0495631_0037749 Ga0495631_0037749_555_1046 163
275 3300046518 Ga0495631_0037921 Ga0495631_0037921_59_550 163
276 3300046518 Ga0495631_0061009 Ga0495631_0061009_535_1026 163
277 3300046518 Ga0495631_0068046 Ga0495631_0068046_177_668 163
278 3300046518 Ga0495631_0113604 Ga0495631_0113604_418_909 163
279 3300046519 Ga0495632_0000073 Ga0495632_0000073_50428_50919 163
280 3300046519 Ga0495632_0000203 Ga0495632_0000203_6919_7410 163
281 3300046519 Ga0495632_0000225 Ga0495632_0000225_56111_56602 163
282 3300046519 Ga0495632_0002818 Ga0495632_0002818_1521_2012 163
283 3300046519 Ga0495632_0006271 Ga0495632_0006271_1476_1967 163
284 3300046519 Ga0495632_0042230 Ga0495632_0042230_662_1153 163
285 3300046519 Ga0495632_0056351 Ga0495632_0056351_240_731 163
286 3300046519 Ga0495632_0086780 Ga0495632_0086780_579_1070 163
287 3300046519 Ga0495632_0120233 Ga0495632_0120233_514_1005 163
288 3300046520 Ga0495637_0000004 Ga0495637_0000004_366050_366541 163
289 3300046520 Ga0495637_0000009 Ga0495637_0000009_365819_366310 163
290 3300046522 Ga0495643_0000416 Ga0495643_0000416_48385_48876 163
291 3300046522 Ga0495643_0059612 Ga0495643_0059612_1144_1635 163
292 3300046522 Ga0495643_0155851 Ga0495643_0155851_194_685 163
293 3300046522 Ga0495643_0164646 Ga0495643_0164646_272_763 163
294 3300046522 Ga0495643_0290382 Ga0495643_0290382_115_606 163
295 3300046523 Ga0495644_0002243 Ga0495644_0002243_6699_7190 163
296 3300046523 Ga0495644_0010014 Ga0495644_0010014_1622_2113 163
297 3300046523 Ga0495644_0012356 Ga0495644_0012356_841_1332 163
298 3300046523 Ga0495644_0012876 Ga0495644_0012876_683_1174 163
299 3300046523 Ga0495644_0046043 Ga0495644_0046043_791_1282 163
300 3300046523 Ga0495644_0064148 Ga0495644_0064148_410_901 163
301 3300046523 Ga0495644_0075632 Ga0495644_0075632_507_998 163
302 3300046523 Ga0495644_0233846 Ga0495644_0233846_16_507 163
303 3300046524 Ga0495648_0000003 Ga0495648_0000003_362476_362967 163
304 3300046524 Ga0495648_0002527 Ga0495648_0002527_13026_13517 163
305 3300046524 Ga0495648_0008784 Ga0495648_0008784_6584_7075 163
306 3300046524 Ga0495648_0012503 Ga0495648_0012503_5400_5891 163
307 3300046524 Ga0495648_0017360 Ga0495648_0017360_390_881 163
308 3300046524 Ga0495648_0035374 Ga0495648_0035374_1235_1726 163
309 3300046524 Ga0495648_0041892 Ga0495648_0041892_548_1039 163
310 3300046524 Ga0495648_0066761 Ga0495648_0066761_629_1120 163
311 3300046524 Ga0495648_0071481 Ga0495648_0071481_218_709 163
312 3300046524 Ga0495648_0132107 Ga0495648_0132107_135_626 163
313 3300046524 Ga0495648_0175449 Ga0495648_0175449_471_962 163
314 3300046524 Ga0495648_0223912 Ga0495648_0223912_300_791 163
315 3300046525 Ga0495663_0048872 Ga0495663_0048872_77_568 163
316 3300046525 Ga0495663_0292726 Ga0495663_0292726_25_516 163
317 3300046526 Ga0495666_0000106 Ga0495666_0000106_1571_2062 163
318 3300046526 Ga0495666_0085512 Ga0495666_0085512_22_513 163
319 3300046528 Ga0495642_0000065 Ga0495642_0000065_6586_7077 163
320 3300046528 Ga0495642_0000125 Ga0495642_0000125_30159_30650 163
321 3300046528 Ga0495642_0002169 Ga0495642_0002169_5831_6322 163
322 3300046528 Ga0495642_0008926 Ga0495642_0008926_1185_1676 163
323 3300046528 Ga0495642_0014691 Ga0495642_0014691_430_921 163
324 3300046528 Ga0495642_0015558 Ga0495642_0015558_1970_2461 163
325 3300046528 Ga0495642_0017676 Ga0495642_0017676_1367_1858 163
326 3300046528 Ga0495642_0023334 Ga0495642_0023334_1333_1824 163
327 3300046528 Ga0495642_0043220 Ga0495642_0043220_1081_1572 163
328 3300046528 Ga0495642_0063820 Ga0495642_0063820_638_1129 163
329 3300046529 Ga0495652_0148240 Ga0495652_0148240_490_981 163
330 3300046530 Ga0495654_0006281 Ga0495654_0006281_2521_3012 163
331 3300046530 Ga0495654_0024731 Ga0495654_0024731_2211_2702 163
332 3300046530 Ga0495654_0036106 Ga0495654_0036106_1570_2061 163
333 3300046530 Ga0495654_0058248 Ga0495654_0058248_1130_1621 163
334 3300046531 Ga0495665_0036444 Ga0495665_0036444_1425_1916 163
335 3300046531 Ga0495665_0084581 Ga0495665_0084581_923_1414 163
336 3300046533 Ga0495640_0202345 Ga0495640_0202345_448_939 163
337 3300046535 Ga0495586_0258349 Ga0495586_0258349_381_872 163
338 3300046536 Ga0495587_0110737 Ga0495587_0110737_964_1455 163
339 3300046536 Ga0495587_0338493 Ga0495587_0338493_253_744 163
340 3300046536 Ga0495587_0538576 Ga0495587_0538576_36_527 163
341 3300046538 Ga0495609_0000030 Ga0495609_0000030_152387_152878 163
342 3300046538 Ga0495609_0005589 Ga0495609_0005589_669_1160 163
343 3300046538 Ga0495609_0005876 Ga0495609_0005876_5598_6089 163
344 3300046538 Ga0495609_0053399 Ga0495609_0053399_490_981 163
345 3300046538 Ga0495609_0067293 Ga0495609_0067293_120_611 163
346 3300046538 Ga0495609_0135382 Ga0495609_0135382_440_931 163
347 3300046538 Ga0495609_0161242 Ga0495609_0161242_226_717 163
348 3300046538 Ga0495609_0196645 Ga0495609_0196645_141_632 163
349 3300046542 Ga0495597_0021527 Ga0495597_0021527_1457_1948 163
350 3300046542 Ga0495597_0021701 Ga0495597_0021701_1219_1710 163
351 3300046542 Ga0495597_0022964 Ga0495597_0022964_1813_2304 163
352 3300046542 Ga0495597_0026311 Ga0495597_0026311_1938_2429 163
353 3300046542 Ga0495597_0030896 Ga0495597_0030896_410_901 163
354 3300046542 Ga0495597_0037941 Ga0495597_0037941_1039_1530 163
355 3300046542 Ga0495597_0048564 Ga0495597_0048564_1035_1526 163
356 3300046557 Ga0495622_0379111 Ga0495622_0379111_80_571 163
357 3300046558 Ga0495633_0001558 Ga0495633_0001558_15621_16112 163
358 3300046558 Ga0495633_0007336 Ga0495633_0007336_5470_5961 163
359 3300046558 Ga0495633_0017787 Ga0495633_0017787_1341_1832 163
360 3300046558 Ga0495633_0027253 Ga0495633_0027253_742_1233 163
361 3300046558 Ga0495633_0035244 Ga0495633_0035244_545_1036 163
362 3300046558 Ga0495633_0040980 Ga0495633_0040980_384_875 163
363 3300046558 Ga0495633_0063553 Ga0495633_0063553_424_915 163
364 3300046558 Ga0495633_0091203 Ga0495633_0091203_649_1140 163
365 3300046558 Ga0495633_0136973 Ga0495633_0136973_415_906 163
366 3300046558 Ga0495633_0141588 Ga0495633_0141588_350_841 163
367 3300046558 Ga0495633_0240295 Ga0495633_0240295_159_650 163
368 3300046615 Ga0495656_0002045 Ga0495656_0002045_1659_2150 163
369 3300046615 Ga0495656_0033490 Ga0495656_0033490_184_675 163
370 3300046615 Ga0495656_0126192 Ga0495656_0126192_323_814 163
371 3300046615 Ga0495656_0276838 Ga0495656_0276838_217_708 163
372 3300046616 Ga0495668_0000366 Ga0495668_0000366_52822_53313 163
373 3300046616 Ga0495668_0005974 Ga0495668_0005974_4828_5319 163
374 3300046616 Ga0495668_0010819 Ga0495668_0010819_3616_4107 163
375 3300046616 Ga0495668_0022441 Ga0495668_0022441_2780_3271 163
376 3300046616 Ga0495668_0031669 Ga0495668_0031669_744_1235 163
377 3300046616 Ga0495668_0049662 Ga0495668_0049662_1545_2036 163
378 3300046616 Ga0495668_0056909 Ga0495668_0056909_981_1472 163
379 3300046616 Ga0495668_0063533 Ga0495668_0063533_488_979 163
380 3300046616 Ga0495668_0064619 Ga0495668_0064619_1308_1799 163
381 3300046616 Ga0495668_0131149 Ga0495668_0131149_847_1338 163
382 3300046642 Ga0495634_0011124 Ga0495634_0011124_5879_6370 163
383 3300046648 Ga0495611_0000971 Ga0495611_0000971_11893_12384 163
384 3300046648 Ga0495611_0002769 Ga0495611_0002769_2039_2530 163
385 3300046648 Ga0495611_0005947 Ga0495611_0005947_4269_4760 163
386 3300046648 Ga0495611_0021569 Ga0495611_0021569_1428_1919 163
387 3300046648 Ga0495611_0030555 Ga0495611_0030555_1500_1991 163
388 3300046660 Ga0495625_0025368 Ga0495625_0025368_3121_3612 163
389 3300046660 Ga0495625_0056976 Ga0495625_0056976_1851_2342 163
390 3300046660 Ga0495625_0102682 Ga0495625_0102682_985_1476 163
391 3300046660 Ga0495625_0112684 Ga0495625_0112684_883_1374 163
392 3300046660 Ga0495625_0121705 Ga0495625_0121705_1267_1758 163
393 3300046660 Ga0495625_0174302 Ga0495625_0174302_176_667 163
394 3300046660 Ga0495625_0216595 Ga0495625_0216595_497_988 163
395 3300046660 Ga0495625_0266922 Ga0495625_0266922_122_613 163
396 3300046663 Ga0495635_0132121 Ga0495635_0132121_670_1161 163
397 3300046664 Ga0495659_0002783 Ga0495659_0002783_665_1156 163
398 3300046664 Ga0495659_0117281 Ga0495659_0117281_530_1021 163
399 3300046664 Ga0495659_0423298 Ga0495659_0423298_44_535 163
400 3300046665 Ga0495661_0000209 Ga0495661_0000209_61249_61740 163
401 3300046665 Ga0495661_0000754 Ga0495661_0000754_16179_16670 163
402 3300046665 Ga0495661_0005745 Ga0495661_0005745_5707_6198 163
403 3300046665 Ga0495661_0019946 Ga0495661_0019946_1274_1765 163
404 3300046665 Ga0495661_0025005 Ga0495661_0025005_1293_1784 163
405 3300046665 Ga0495661_0035602 Ga0495661_0035602_451_942 163
406 3300046665 Ga0495661_0051839 Ga0495661_0051839_516_1007 163
407 3300046665 Ga0495661_0052210 Ga0495661_0052210_1482_1973 163
408 3300046665 Ga0495661_0054372 Ga0495661_0054372_1619_2110 163
409 3300046665 Ga0495661_0054579 Ga0495661_0054579_1574_2065 163
410 3300046665 Ga0495661_0076387 Ga0495661_0076387_1187_1678 163
411 3300046665 Ga0495661_0083264 Ga0495661_0083264_717_1208 163
412 3300046665 Ga0495661_0104187 Ga0495661_0104187_1047_1538 163
413 3300046665 Ga0495661_0111333 Ga0495661_0111333_768_1259 163
414 3300046665 Ga0495661_0152814 Ga0495661_0152814_638_1129 163
415 3300046665 Ga0495661_0203384 Ga0495661_0203384_399_890 163
416 3300046665 Ga0495661_0356980 Ga0495661_0356980_15_506 163
417 3300046674 Ga0495588_0000062 Ga0495588_0000062_28624_29115 163
418 3300046674 Ga0495588_0061245 Ga0495588_0061245_701_1270 163
419 3300046674 Ga0495588_0069554 Ga0495588_0069554_469_960 163
420 3300046674 Ga0495588_0085559 Ga0495588_0085559_1125_1616 163
421 3300046679 Ga0495623_0060310 Ga0495623_0060310_1286_1777 163
422 3300046680 Ga0495646_0030797 Ga0495646_0030797_671_1162 163
423 3300046684 Ga0495669_0001393 Ga0495669_0001393_4220_4711 163
424 3300046684 Ga0495669_0001810 Ga0495669_0001810_4675_5166 163
425 3300046684 Ga0495669_0026859 Ga0495669_0026859_1526_2017 163
426 3300046684 Ga0495669_0109172 Ga0495669_0109172_343_834 163
427 3300046684 Ga0495669_0237870 Ga0495669_0237870_274_765 163
428 3300046691 Ga0495670_0025658 Ga0495670_0025658_1601_2092 163
429 3300046691 Ga0495670_0034551 Ga0495670_0034551_472_963 163
430 3300046691 Ga0495670_0038243 Ga0495670_0038243_1555_2046 163
431 3300046691 Ga0495670_0040337 Ga0495670_0040337_876_1367 163
432 3300046691 Ga0495670_0192225 Ga0495670_0192225_391_882 163
433 3300046691 Ga0495670_0266572 Ga0495670_0266572_146_637 163
434 3300046692 Ga0495671_0000155 Ga0495671_0000155_843_1334 163
435 3300046692 Ga0495671_0006304 Ga0495671_0006304_5844_6335 163
436 3300046692 Ga0495671_0050541 Ga0495671_0050541_50_541 163
437 3300046692 Ga0495671_0072622 Ga0495671_0072622_265_756 163
438 3300046692 Ga0495671_0131228 Ga0495671_0131228_371_862 163
439 3300046692 Ga0495671_0456621 Ga0495671_0456621_108_599 163
440 3300046694 Ga0495649_0000742 Ga0495649_0000742_20421_20912 163
441 3300046694 Ga0495649_0039608 Ga0495649_0039608_1586_2077 163
442 3300046694 Ga0495649_0067445 Ga0495649_0067445_825_1316 163
443 3300046694 Ga0495649_0128240 Ga0495649_0128240_403_894 163
444 3300046794 Ga0495589_0000021 Ga0495589_0000021_152688_153179 163
445 3300046794 Ga0495589_0006459 Ga0495589_0006459_5297_5788 163
446 3300046794 Ga0495589_0010050 Ga0495589_0010050_2964_3455 163
447 3300046794 Ga0495589_0013417 Ga0495589_0013417_268_759 163
448 3300046794 Ga0495589_0029215 Ga0495589_0029215_1855_2346 163
449 3300046794 Ga0495589_0038934 Ga0495589_0038934_1256_1747 163
450 3300046794 Ga0495589_0040568 Ga0495589_0040568_1556_2047 163
451 3300046794 Ga0495589_0045912 Ga0495589_0045912_885_1376 163
452 3300046794 Ga0495589_0089204 Ga0495589_0089204_445_936 163
453 3300046794 Ga0495589_0143908 Ga0495589_0143908_603_1094 163
454 3300046794 Ga0495589_0237894 Ga0495589_0237894_130_621 163
455 3300046810 Ga0495660_0000173 Ga0495660_0000173_8301_8792 163
456 3300046810 Ga0495660_0003880 Ga0495660_0003880_6701_7192 163
457 3300046810 Ga0495660_0007814 Ga0495660_0007814_83_574 163
458 3300046810 Ga0495660_0017202 Ga0495660_0017202_253_744 163
459 3300046810 Ga0495660_0038726 Ga0495660_0038726_1393_1884 163
460 3300046810 Ga0495660_0053167 Ga0495660_0053167_635_1126 163
461 3300046810 Ga0495660_0069066 Ga0495660_0069066_906_1397 163
462 3300046810 Ga0495660_0085272 Ga0495660_0085272_823_1314 163
463 3300046810 Ga0495660_0137311 Ga0495660_0137311_156_647 163
464 3300046810 Ga0495660_0277685 Ga0495660_0277685_79_570 163
465 3300047315 Ga0495581_0315508 Ga0495581_0315508_260_751 163
466 3300047317 Ga0495604_0022851 Ga0495604_0022851_3988_4479 163
467 3300047317 Ga0495604_0081934 Ga0495604_0081934_1446_1937 163
468 3300047318 Ga0495636_0143316 Ga0495636_0143316_440_931 163
469 3300047318 Ga0495636_0195557 Ga0495636_0195557_12_503 163
470 3300047320 Ga0495672_0000055 Ga0495672_0000055_43816_44307 163
471 3300047320 Ga0495672_0000169 Ga0495672_0000169_30815_31306 163
472 3300047320 Ga0495672_0004528 Ga0495672_0004528_9145_9636 163
473 3300047320 Ga0495672_0005516 Ga0495672_0005516_9140_9631 163
474 3300047320 Ga0495672_0010792 Ga0495672_0010792_533_1024 163
475 3300047320 Ga0495672_0013967 Ga0495672_0013967_829_1320 163
476 3300047320 Ga0495672_0064775 Ga0495672_0064775_1415_1906 163
477 3300047321 Ga0495676_0004145 Ga0495676_0004145_10971_11462 163
478 3300047321 Ga0495676_0260710 Ga0495676_0260710_65_556 163
479 3300047322 Ga0495680_0074677 Ga0495680_0074677_481_972 163
480 3300047323 Ga0495683_0000240 Ga0495683_0000240_5350_5841 163
481 3300047323 Ga0495683_0002144 Ga0495683_0002144_9353_9844 163
482 3300047323 Ga0495683_0008918 Ga0495683_0008918_355_846 163
483 3300047323 Ga0495683_0012631 Ga0495683_0012631_458_949 163
484 3300047323 Ga0495683_0015027 Ga0495683_0015027_842_1333 163
485 3300047323 Ga0495683_0015773 Ga0495683_0015773_2849_3340 163
486 3300047323 Ga0495683_0049427 Ga0495683_0049427_1261_1752 163
487 3300047323 Ga0495683_0052302 Ga0495683_0052302_312_803 163
488 3300047323 Ga0495683_0079674 Ga0495683_0079674_954_1445 163
489 3300047443 Ga0495687_000012 Ga0495687_000012_264014_264505 163
490 3300047443 Ga0495687_000276 Ga0495687_000276_6053_6544 163
491 3300047443 Ga0495687_000279 Ga0495687_000279_6688_7179 163
492 3300047443 Ga0495687_000319 Ga0495687_000319_6741_7232 163
493 3300047443 Ga0495687_002885 Ga0495687_002885_10589_11080 163
494 3300047443 Ga0495687_004935 Ga0495687_004935_5902_6393 163
495 3300047443 Ga0495687_035045 Ga0495687_035045_471_962 163
496 3300047443 Ga0495687_045135 Ga0495687_045135_699_1190 163
497 3300047444 Ga0495675_0003962 Ga0495675_0003962_4858_5349 163
498 3300047444 Ga0495675_0054903 Ga0495675_0054903_1060_1551 163
499 3300047444 Ga0495675_0123093 Ga0495675_0123093_713_1204 163
500 3300047445 Ga0495677_0000050 Ga0495677_0000050_61640_62131 163
501 3300047445 Ga0495677_0000125 Ga0495677_0000125_31133_31624 163
502 3300047445 Ga0495677_0000705 Ga0495677_0000705_11649_12140 163
503 3300047445 Ga0495677_0001535 Ga0495677_0001535_2335_2826 163
504 3300047445 Ga0495677_0001768 Ga0495677_0001768_363_854 163
505 3300047445 Ga0495677_0018080 Ga0495677_0018080_1525_2016 163
506 3300047445 Ga0495677_0081339 Ga0495677_0081339_44_535 163
507 3300047445 Ga0495677_0101717 Ga0495677_0101717_34_525 163
508 3300047445 Ga0495677_0187075 Ga0495677_0187075_240_731 163
509 3300047446 Ga0495679_005955 Ga0495679_005955_1591_2082 163
510 3300047446 Ga0495679_007740 Ga0495679_007740_447_938 163
511 3300047446 Ga0495679_011783 Ga0495679_011783_335_826 163
512 3300047446 Ga0495679_038015 Ga0495679_038015_173_664 163
513 3300047446 Ga0495679_039371 Ga0495679_039371_688_1179 163
514 3300047446 Ga0495679_084841 Ga0495679_084841_200_691 163
515 3300047447 Ga0495685_025926 Ga0495685_025926_812_1303 163
516 3300047447 Ga0495685_080940 Ga0495685_080940_426_917 163
517 3300047470 Ga0495681_0001220 Ga0495681_0001220_2786_3277 163
518 3300047470 Ga0495681_0001449 Ga0495681_0001449_10561_11052 163
519 3300047470 Ga0495681_0029106 Ga0495681_0029106_580_1071 163
520 3300047470 Ga0495681_0030174 Ga0495681_0030174_1033_1524 163
521 3300047470 Ga0495681_0052173 Ga0495681_0052173_386_877 163
522 3300047470 Ga0495681_0185416 Ga0495681_0185416_57_548 163
523 3300047472 Ga0495686_0000474 Ga0495686_0000474_14408_14899 163
524 3300047472 Ga0495686_0000495 Ga0495686_0000495_52002_52493 163
525 3300047472 Ga0495686_0030672 Ga0495686_0030672_1417_1908 163
526 3300047472 Ga0495686_0038138 Ga0495686_0038138_2015_2506 163
527 3300047472 Ga0495686_0316640 Ga0495686_0316640_80_571 163
528 3300047472 Ga0495686_0377220 Ga0495686_0377220_244_735 163
529 3300047673 Ga0495593_0189527 Ga0495593_0189527_200_691 163
530 3300048088 Ga0495602_0018586 Ga0495602_0018586_5697_6188 163
531 3300048089 Ga0495614_0173847 Ga0495614_0173847_169_660 163
532 3300048090 Ga0495615_0151273 Ga0495615_0151273_99_590 163
533 3300048091 Ga0495626_0000017 Ga0495626_0000017_177446_177937 163
534 3300048091 Ga0495626_0000624 Ga0495626_0000624_14420_14911 163
535 3300048091 Ga0495626_0004146 Ga0495626_0004146_5954_6445 163
536 3300048091 Ga0495626_0009282 Ga0495626_0009282_2325_2816 163
537 3300048091 Ga0495626_0024189 Ga0495626_0024189_357_848 163
538 3300048091 Ga0495626_0025498 Ga0495626_0025498_1649_2140 163
539 3300048091 Ga0495626_0029007 Ga0495626_0029007_745_1236 163
540 3300048091 Ga0495626_0031544 Ga0495626_0031544_842_1333 163
541 3300048091 Ga0495626_0097352 Ga0495626_0097352_672_1163 163
542 3300048091 Ga0495626_0109628 Ga0495626_0109628_206_697 163
543 3300048091 Ga0495626_0124254 Ga0495626_0124254_378_869 163
544 3300048091 Ga0495626_0126572 Ga0495626_0126572_466_957 163
545 3300048091 Ga0495626_0130271 Ga0495626_0130271_462_953 163
546 3300048903 Ga0496100_0078464 Ga0496100_0078464_1230_1721 163
547 3300048903 Ga0496100_0359132 Ga0496100_0359132_545_1036 163
548 3300048904 Ga0496101_0078055 Ga0496101_0078055_1501_1992 163
549 3300048904 Ga0496101_0091739 Ga0496101_0091739_398_889 163
550 3300048905 Ga0496102_0000343 Ga0496102_0000343_5353_5844 163
551 3300048905 Ga0496102_0129325 Ga0496102_0129325_385_876 163
552 3300048905 Ga0496102_0169350 Ga0496102_0169350_1201_1692 163
553 3300048905 Ga0496102_0224853 Ga0496102_0224853_1235_1726 163
554 3300048906 Ga0496103_0001094 Ga0496103_0001094_4004_4495 163
555 3300048906 Ga0496103_0005287 Ga0496103_0005287_7117_7638 163
556 3300048906 Ga0496103_0011731 Ga0496103_0011731_124_615 163
557 3300048906 Ga0496103_0128966 Ga0496103_0128966_361_852 163
558 3300048906 Ga0496103_0198440 Ga0496103_0198440_366_857 163
559 3300048906 Ga0496103_0516802 Ga0496103_0516802_224_715 163
560 3300048907 Ga0496104_0358760 Ga0496104_0358760_121_612 163
561 3300048908 Ga0496105_0622351 Ga0496105_0622351_204_695 163
562 3300048909 Ga0496106_0018092 Ga0496106_0018092_3936_4427 163
563 3300048909 Ga0496106_0111768 Ga0496106_0111768_1472_1963 163
564 3300048910 Ga0496107_0024342 Ga0496107_0024342_1941_2432 163
565 3300048910 Ga0496107_0125491 Ga0496107_0125491_1128_1619 163
566 3300048912 Ga0496109_0030996 Ga0496109_0030996_3441_3932 163
567 3300048913 Ga0496110_0463795 Ga0496110_0463795_261_752 163
568 3300048914 Ga0496111_0290177 Ga0496111_0290177_618_1109 163
569 3300048914 Ga0496111_0673229 Ga0496111_0673229_114_605 163
570 3300048916 Ga0496113_0092813 Ga0496113_0092813_1717_2208 163
571 3300048917 Ga0496114_0251232 Ga0496114_0251232_508_999 163
572 3300048918 Ga0496115_0213669 Ga0496115_0213669_1004_1495 163
573 3300048918 Ga0496115_0258902 Ga0496115_0258902_557_1048 163
574 3300048924 Ga0496121_0149236 Ga0496121_0149236_151_642 163
575 3300048924 Ga0496121_0268846 Ga0496121_0268846_419_910 163
576 3300048925 Ga0496122_0000452 Ga0496122_0000452_23695_24186 163
577 3300048925 Ga0496122_0004239 Ga0496122_0004239_6648_7139 163
578 3300048926 Ga0496123_0000514 Ga0496123_0000514_61110_61601 163
579 3300048926 Ga0496123_0001857 Ga0496123_0001857_22463_22954 163
580 3300048927 Ga0496124_0006694 Ga0496124_0006694_8138_8629 163
581 3300048927 Ga0496124_0009567 Ga0496124_0009567_1573_2064 163
582 3300048927 Ga0496124_0010958 Ga0496124_0010958_1164_1655 163
583 3300048927 Ga0496124_0313755 Ga0496124_0313755_440_931 163
584 3300048928 Ga0496125_0000572 Ga0496125_0000572_1450_1941 163
585 3300048929 Ga0496126_0148155 Ga0496126_0148155_916_1407 163
586 3300048929 Ga0496126_0410800 Ga0496126_0410800_506_997 163
587 3300049129 Ga0501309_034261 Ga0501309_034261_142_633 163
588 3300049132 Ga0501343_008292 Ga0501343_008292_183_674 163
589 3300049161 Ga0501305_037403 Ga0501305_037403_90_581 163
590 3300049459 Ga0495678_000025 Ga0495678_000025_45389_45880 163
591 3300049459 Ga0495678_000293 Ga0495678_000293_53259_53750 163
592 3300049459 Ga0495678_001760 Ga0495678_001760_15404_15895 163
593 3300049459 Ga0495678_002352 Ga0495678_002352_5910_6401 163
594 3300049459 Ga0495678_004783 Ga0495678_004783_511_1002 163
595 3300049459 Ga0495678_006034 Ga0495678_006034_2154_2657 163
596 3300049459 Ga0495678_033044 Ga0495678_033044_63_554 163
597 3300049460 Ga0495682_0021428 Ga0495682_0021428_454_945 163
598 3300049460 Ga0495682_0023735 Ga0495682_0023735_741_1232 163
599 3300049529 Ga0501313_003540 Ga0501313_003540_460_951 163
600 3300049531 Ga0501315_004991 Ga0501315_004991_411_902 163
601 3300049532 Ga0501316_003292 Ga0501316_003292_655_1146 163
602 3300049534 Ga0501318_020293 Ga0501318_020293_160_651 163
603 3300049538 Ga0501322_005939 Ga0501322_005939_173_664 163
604 3300049539 Ga0501323_021399 Ga0501323_021399_256_747 163
605 3300049575 Ga0501039_0659412 Ga0501039_0659412_80_571 163
606 3300049653 Ga0501206_023412 Ga0501206_023412_118_609 163
607 3300049669 Ga0501235_039996 Ga0501235_039996_194_685 163
608 3300049679 Ga0501249_049064 Ga0501249_049064_461_952 163
609 3300049766 Ga0501269_000670 Ga0501269_000670_4804_5295 163
610 3300049822 Ga0501035_0003370 Ga0501035_0003370_8246_8737 163
611 3300059504 Ga0587082_015534 Ga0587082_015534_659_1150 163
612 3300059641 Ga0587068_007735 Ga0587068_007735_150_641 163
613 3300061719 Ga0466962_0068103 Ga0466962_0068103_124_615 163
614 3300002738 JGI25154J39366_1001227 JGI25154J39366_10012274 164
615 3300002738 JGI25154J39366_1002256 JGI25154J39366_10022564 164
616 3300003322 rootL2_10018128 rootL2_100181283 164
617 3300003544 Ga0007417J51691_1035307 Ga0007417J51691_10353071 164
618 3300003574 Ga0007410J51695_1004602 Ga0007410J51695_10046022 164
619 3300003575 Ga0007409J51694_1001247 Ga0007409J51694_10012472 164
620 3300003577 Ga0007416J51690_1021414 Ga0007416J51690_10214142 164
621 3300003611 Ga0007411J51799_115139 Ga0007411J51799_1151391 164
622 3300003613 Ga0007415J51800_109139 Ga0007415J51800_1091392 164
623 3300003693 Ga0032354_1093660 Ga0032354_10936601 164
624 3300004803 Ga0058862_12338473 Ga0058862_123384731 164
625 3300005327 Ga0070658_10164825 Ga0070658_101648252 164
626 3300005329 Ga0070683_100868757 Ga0070683_1008687571 164
627 3300005334 Ga0068869_101244878 Ga0068869_1012448781 164
628 3300005336 Ga0070680_100655887 Ga0070680_1006558872 164
629 3300005344 Ga0070661_100076502 Ga0070661_1000765023 164
630 3300005354 Ga0070675_101659366 Ga0070675_1016593661 164
631 3300005366 Ga0070659_100017089 Ga0070659_1000170892 164
632 3300005455 Ga0070663_100767188 Ga0070663_1007671881 164
633 3300005457 Ga0070662_100109380 Ga0070662_1001093802 164
634 3300005459 Ga0068867_100297816 Ga0068867_1002978162 164
635 3300005539 Ga0068853_100209583 Ga0068853_1002095832 164
636 3300005543 Ga0070672_100646090 Ga0070672_1006460902 164
637 3300005564 Ga0070664_100015614 Ga0070664_1000156142 164
638 3300005577 Ga0068857_100280478 Ga0068857_1002804782 164
639 3300005614 Ga0068856_100577814 Ga0068856_1005778143 164
640 3300009036 Ga0105244_10001128 Ga0105244_1000112818 164
641 3300009098 Ga0105245_10302010 Ga0105245_103020103 164
642 3300009148 Ga0105243_10148481 Ga0105243_101484813 164
643 3300009176 Ga0105242_10040850 Ga0105242_100408504 164
644 3300009545 Ga0105237_10179199 Ga0105237_101791992 164
645 3300009551 Ga0105238_10248316 Ga0105238_102483163 164
646 3300011119 Ga0105246_10327566 Ga0105246_103275662 164
647 3300013100 Ga0157373_10915246 Ga0157373_109152462 164
648 3300013104 Ga0157370_10972073 Ga0157370_109720732 164
649 3300013296 Ga0157374_10198062 Ga0157374_101980622 164
650 3300013297 Ga0157378_10313217 Ga0157378_103132173 164
651 3300013307 Ga0157372_11098793 Ga0157372_110987932 164
652 3300015261 Ga0182006_1124213 Ga0182006_11242131 164
653 3300015261 Ga0182006_1154838 Ga0182006_11548381 164
654 3300020076 Ga0206355_1410553 Ga0206355_14105532 164
655 3300020077 Ga0206351_10397707 Ga0206351_103977072 164
656 3300020078 Ga0206352_10045834 Ga0206352_100458342 164
657 3300020080 Ga0206350_10686387 Ga0206350_106863872 164
658 3300020082 Ga0206353_10473061 Ga0206353_104730611 164
659 3300020610 Ga0154015_1494823 Ga0154015_14948231 164
660 3300022467 Ga0224712_10190158 Ga0224712_101901582 164
661 3300025233 Ga0209437_102323 Ga0209437_1023235 164
662 3300025246 Ga0209646_1000036 Ga0209646_1000036245 164
663 3300025246 Ga0209646_1000087 Ga0209646_100008763 164
664 3300025254 Ga0209148_1000969 Ga0209148_10009693 164
665 3300025321 Ga0207656_10591341 Ga0207656_105913411 164
666 3300025728 Ga0207655_1017177 Ga0207655_10171774 164
667 3300025909 Ga0207705_10003924 Ga0207705_100039245 164
668 3300025914 Ga0207671_10386617 Ga0207671_103866172 164
669 3300025926 Ga0207659_11288358 Ga0207659_112883581 164
670 3300025927 Ga0207687_10132407 Ga0207687_101324072 164
671 3300025935 Ga0207709_10195620 Ga0207709_101956202 164
672 3300025945 Ga0207679_10416957 Ga0207679_104169572 164
673 3300025949 Ga0207667_10003392 Ga0207667_1000339210 164
674 3300026041 Ga0207639_10309219 Ga0207639_103092192 164
675 3300026067 Ga0207678_10628605 Ga0207678_106286052 164
676 3300026078 Ga0207702_10831113 Ga0207702_108311132 164
677 3300026089 Ga0207648_10239546 Ga0207648_102395462 164
678 3300030744 Ga0316181_1092357 Ga0316181_10923572 164
679 3300037312 Ga0395899_0002155 Ga0395899_0002155_13198_13692 164
680 3300037312 Ga0395899_0019441 Ga0395899_0019441_1106_1600 164
681 3300037312 Ga0395899_0026709 Ga0395899_0026709_1641_2135 164
682 3300037312 Ga0395899_0100441 Ga0395899_0100441_1051_1545 164
683 3300037418 Ga0395900_0000081 Ga0395900_0000081_132698_133192 164
684 3300037418 Ga0395900_0004089 Ga0395900_0004089_9869_10363 164
685 3300037418 Ga0395900_0082046 Ga0395900_0082046_2002_2496 164
686 3300037466 Ga0395898_0054333 Ga0395898_0054333_1591_2085 164
687 3300037466 Ga0395898_0138783 Ga0395898_0138783_1332_1826 164
688 3300037466 Ga0395898_0293656 Ga0395898_0293656_420_914 164
689 3300037466 Ga0395898_0344809 Ga0395898_0344809_637_1131 164
690 3300037471 Ga0395905_0041447 Ga0395905_0041447_1704_2198 164
691 3300037471 Ga0395905_0260377 Ga0395905_0260377_598_1092 164
692 3300037471 Ga0395905_0934102 Ga0395905_0934102_100_594 164
693 3300038443 Ga0395901_0000083 Ga0395901_0000083_33492_33986 164
694 3300041999 Ga0439433_0052689 Ga0439433_0052689_182_676 164
695 3300042005 Ga0439448_0001226 Ga0439448_0001226_648_1142 164
696 3300042005 Ga0439448_0058620 Ga0439448_0058620_403_897 164
697 3300042007 Ga0439449_0036458 Ga0439449_0036458_776_1270 164
698 3300042008 Ga0439450_000716 Ga0439450_000716_3067_3561 164
699 3300042012 Ga0439455_0018708 Ga0439455_0018708_700_1194 164
700 3300042012 Ga0439455_0031376 Ga0439455_0031376_25_519 164
701 3300042157 Ga0439458_0004112 Ga0439458_0004112_258_752 164
702 3300042157 Ga0439458_0067511 Ga0439458_0067511_45_539 164
703 3300044656 Ga0466969_0050303 Ga0466969_0050303_1048_1542 164
704 3300044658 Ga0466972_0045896 Ga0466972_0045896_1119_1613 164
705 3300044683 Ga0466965_0020523 Ga0466965_0020523_311_805 164
706 3300044683 Ga0466965_0132450 Ga0466965_0132450_241_735 164
707 3300044684 Ga0466966_0034248 Ga0466966_0034248_1875_2369 164
708 3300044684 Ga0466966_0183916 Ga0466966_0183916_705_1199 164
709 3300044693 Ga0466961_0079437 Ga0466961_0079437_240_734 164
710 3300044693 Ga0466961_0138687 Ga0466961_0138687_671_1165 164
711 3300044694 Ga0466963_0010855 Ga0466963_0010855_2985_3479 164
712 3300044706 Ga0466964_0000928 Ga0466964_0000928_8885_9379 164
713 3300044706 Ga0466964_0045953 Ga0466964_0045953_294_788 164
714 3300044719 Ga0466971_0035284 Ga0466971_0035284_222_716 164
715 3300044735 Ga0466968_0011729 Ga0466968_0011729_2025_2519 164
716 3300044842 Ga0466957_0022258 Ga0466957_0022258_2589_3083 164
717 3300044842 Ga0466957_0078277 Ga0466957_0078277_1152_1646 164
718 3300044901 Ga0466960_0205664 Ga0466960_0205664_553_1047 164
719 3300045049 Ga0466959_0122083 Ga0466959_0122083_621_1115 164
720 3300045836 Ga0466958_0242141 Ga0466958_0242141_302_796 164
721 3300045976 Ga0466967_0017323 Ga0466967_0017323_2547_3041 164
722 3300045976 Ga0466967_0020210 Ga0466967_0020210_4287_4781 164
723 3300046453 Ga0495627_032857 Ga0495627_032857_515_1009 164
724 3300046457 Ga0495590_0054040 Ga0495590_0054040_598_1092 164
725 3300046474 Ga0495605_0000381 Ga0495605_0000381_29761_30255 164
726 3300046491 Ga0495584_0000092 Ga0495584_0000092_37978_38472 164
727 3300046491 Ga0495584_0000107 Ga0495584_0000107_51106_51600 164
728 3300046491 Ga0495584_0039582 Ga0495584_0039582_1247_1741 164
729 3300046492 Ga0495585_0003116 Ga0495585_0003116_1739_2233 164
730 3300046492 Ga0495585_0006830 Ga0495585_0006830_851_1345 164
731 3300046501 Ga0495607_0058997 Ga0495607_0058997_313_807 164
732 3300046501 Ga0495607_0109733 Ga0495607_0109733_242_736 164
733 3300046501 Ga0495607_0192601 Ga0495607_0192601_64_558 164
734 3300046507 Ga0495606_0030023 Ga0495606_0030023_1370_1864 164
735 3300046513 Ga0495616_0000035 Ga0495616_0000035_80749_81243 164
736 3300046513 Ga0495616_0015788 Ga0495616_0015788_3259_3753 164
737 3300046518 Ga0495631_0023447 Ga0495631_0023447_1038_1532 164
738 3300046519 Ga0495632_0197982 Ga0495632_0197982_150_644 164
739 3300046522 Ga0495643_0002506 Ga0495643_0002506_3808_4302 164
740 3300046523 Ga0495644_0281808 Ga0495644_0281808_142_636 164
741 3300046524 Ga0495648_0004238 Ga0495648_0004238_11778_12272 164
742 3300046525 Ga0495663_0005449 Ga0495663_0005449_2666_3160 164
743 3300046526 Ga0495666_0009385 Ga0495666_0009385_3265_3759 164
744 3300046528 Ga0495642_0000186 Ga0495642_0000186_907_1401 164
745 3300046528 Ga0495642_0030208 Ga0495642_0030208_393_887 164
746 3300046531 Ga0495665_0017816 Ga0495665_0017816_720_1214 164
747 3300046542 Ga0495597_0007929 Ga0495597_0007929_170_664 164
748 3300046543 Ga0495645_0046255 Ga0495645_0046255_2252_2746 164
749 3300046557 Ga0495622_0006838 Ga0495622_0006838_1969_2463 164
750 3300046558 Ga0495633_0020014 Ga0495633_0020014_1154_1648 164
751 3300046615 Ga0495656_0027203 Ga0495656_0027203_1417_1911 164
752 3300046616 Ga0495668_0056537 Ga0495668_0056537_1375_1869 164
753 3300046648 Ga0495611_0027847 Ga0495611_0027847_1058_1552 164
754 3300046660 Ga0495625_0581121 Ga0495625_0581121_82_576 164
755 3300046665 Ga0495661_0002894 Ga0495661_0002894_3218_3712 164
756 3300046665 Ga0495661_0045301 Ga0495661_0045301_140_634 164
757 3300046665 Ga0495661_0110995 Ga0495661_0110995_312_806 164
758 3300046674 Ga0495588_0000201 Ga0495588_0000201_54443_54937 164
759 3300046684 Ga0495669_0204924 Ga0495669_0204924_261_755 164
760 3300046690 Ga0495624_0013524 Ga0495624_0013524_1650_2144 164
761 3300046691 Ga0495670_0005624 Ga0495670_0005624_4035_4529 164
762 3300046694 Ga0495649_0111853 Ga0495649_0111853_217_711 164
763 3300046794 Ga0495589_0001008 Ga0495589_0001008_5994_6488 164
764 3300046794 Ga0495589_0060253 Ga0495589_0060253_1081_1575 164
765 3300046810 Ga0495660_0000079 Ga0495660_0000079_64691_65185 164
766 3300047315 Ga0495581_0022284 Ga0495581_0022284_2283_2777 164
767 3300047320 Ga0495672_0075317 Ga0495672_0075317_1038_1532 164
768 3300047443 Ga0495687_000036 Ga0495687_000036_51273_51767 164
769 3300047443 Ga0495687_000534 Ga0495687_000534_10128_10622 164
770 3300047445 Ga0495677_0018478 Ga0495677_0018478_579_1073 164
771 3300047445 Ga0495677_0028588 Ga0495677_0028588_901_1395 164
772 3300047470 Ga0495681_0040214 Ga0495681_0040214_558_1052 164
773 3300048091 Ga0495626_0003125 Ga0495626_0003125_336_830 164
774 3300048903 Ga0496100_0513319 Ga0496100_0513319_381_875 164
775 3300048904 Ga0496101_0128836 Ga0496101_0128836_1385_1879 164
776 3300048905 Ga0496102_0057265 Ga0496102_0057265_2423_2917 164
777 3300048906 Ga0496103_0433451 Ga0496103_0433451_160_654 164
778 3300048909 Ga0496106_0000824 Ga0496106_0000824_1658_2152 164
779 3300048910 Ga0496107_0102944 Ga0496107_0102944_1040_1534 164
780 3300048912 Ga0496109_0432242 Ga0496109_0432242_268_762 164
781 3300048913 Ga0496110_0715489 Ga0496110_0715489_187_681 164
782 3300048914 Ga0496111_0644112 Ga0496111_0644112_61_555 164
783 3300048917 Ga0496114_0375265 Ga0496114_0375265_110_604 164
784 3300048924 Ga0496121_0166486 Ga0496121_0166486_405_899 164
785 3300048927 Ga0496124_0035967 Ga0496124_0035967_1201_1695 164
786 3300048929 Ga0496126_0714366 Ga0496126_0714366_92_586 164
787 3300049128 Ga0501308_000154 Ga0501308_000154_2102_2596 164
788 3300049160 Ga0501304_000831 Ga0501304_000831_589_1083 164
789 3300049161 Ga0501305_013850 Ga0501305_013850_423_917 164
790 3300049571 Ga0501034_0519076 Ga0501034_0519076_313_807 164
791 3300049822 Ga0501035_0001236 Ga0501035_0001236_11326_11820 164
792 3300059490 Ga0587066_005571 Ga0587066_005571_668_1162 164
793 3300059491 Ga0587070_023414 Ga0587070_023414_70_564 164
794 3300059491 Ga0587070_127413 Ga0587070_127413_70_564 164
795 3300059493 Ga0587077_017668 Ga0587077_017668_480_974 164
796 3300059503 Ga0587080_015078 Ga0587080_015078_518_1012 164
797 3300059504 Ga0587082_000446 Ga0587082_000446_755_1249 164
798 3300059505 Ga0587083_0006070 Ga0587083_0006070_573_1067 164
799 3300059505 Ga0587083_0015020 Ga0587083_0015020_476_970 164
800 3300059505 Ga0587083_0163977 Ga0587083_0163977_36_530 164
801 3300059508 Ga0587088_002890 Ga0587088_002890_1067_1561 164
802 3300059511 Ga0587091_044547 Ga0587091_044547_287_781 164
803 3300059604 Ga0587098_000942 Ga0587098_000942_749_1243 164
804 3300059605 Ga0587106_006814 Ga0587106_006814_794_1288 164
805 3300059640 Ga0587067_005377 Ga0587067_005377_518_1012 164
806 3300059640 Ga0587067_038066 Ga0587067_038066_131_625 164
807 3300059641 Ga0587068_000329 Ga0587068_000329_2723_3217 164
808 3300059642 Ga0587069_021994 Ga0587069_021994_192_686 164
809 3300059643 Ga0587072_007236 Ga0587072_007236_117_611 164
810 3300059643 Ga0587072_020943 Ga0587072_020943_60_554 164
811 3300059645 Ga0587076_014247 Ga0587076_014247_157_651 164
812 3300059645 Ga0587076_023388 Ga0587076_023388_83_577 164
813 3300059647 Ga0587079_001348 Ga0587079_001348_121_615 164
814 3300059649 Ga0587102_009733 Ga0587102_009733_153_647 164
815 3300059652 Ga0587107_009266 Ga0587107_009266_339_833 164
816 3300061719 Ga0466962_0089294 Ga0466962_0089294_461_955 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

36

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tv4-assembly1.cif.gz_B-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9725 2 163
4tv4-assembly1.cif.gz_A-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9685 2 163
4tv4-assembly1.cif.gz_B-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9659 2 163
4tv4-assembly1.cif.gz_A-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.962 2 163
4tv4-assembly1.cif.gz_C-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9607 2 163
ID Description Score Start End Superfamily
4w64B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9233 4 163 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8895 4 161 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8885 2 163 2.30.110.20
af_Q54I75_61_201_2.30.110.20 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8866 23 163 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8855 2 163 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A646IIC5-F1-model_v4 Type VI secretion system tube protein Hcp 0.9679 59 163
AF-A0A1G1Y6S0-F1-model_v4 Type VI secretion system tube protein Hcp 0.9581 2 164 GO:0016020
AF-N9SKZ4-F1-model_v4 Type VI secretion system tube protein Hcp 0.9578 59 163
AF-A0A6A5L546-F1-model_v4 deleted 0.9544 1 164
AF-A0A7X7DL28-F1-model_v4 Type VI secretion system tube protein Hcp 0.953 1 163

Feature Viewer

pLDDT pTM Quality
89.51 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map