F482055

General Info

Members Datasets Scaffolds Average Seq Length
816 243 1632 103

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10217242|Ga0207650_102172422
Length 120
Sequence MVRDPARQGPNVRNRGIGRARMFFGGLILFAAVIAWATALMMSPHSESTVAHGTEHVRNVVVIFIRNSAIGTLLLSALSGWLLFPARRPKTPWRDRAIIGVLAVLVLTSLYQLFWLRTVV

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
224 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
225 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
226 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
227 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
228 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
233 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
237 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
238 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
239 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
240 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
241 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
242 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.21
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10217242 3300025925 Bacteria 1537
2 JGI24736J21556_1065705 3300001904 Bacteria 563
3 JGI24741J21665_1014380 3300001915 Bacteria 1324
4 JGI24747J21853_1011318 3300001978 Bacteria 901
5 JGI24737J22298_10031601 3300001990 Bacteria 1652
6 JGI24735J21928_10044835 3300002067 Bacteria 1285
7 JGI24738J21930_10016097 3300002075 Bacteria 1584
8 JGI24738J21930_10060732 3300002075 Bacteria 776
9 JGI24738J21930_10097063 3300002075 Bacteria 627
10 JGI24744J21845_10004818 3300002077 Bacteria 2790
11 JGI24744J21845_10033291 3300002077 Unclassified 981
12 JGI24742J22300_10008505 3300002244 Bacteria 1693
13 JGI24742J22300_10097258 3300002244 Unclassified 567
14 Ga0070658_10025009 3300005327 Bacteria 4788
15 Ga0070658_10029765 3300005327 Bacteria 4388
16 Ga0070658_10036184 3300005327 Bacteria 3978
17 Ga0070658_10050771 3300005327 Bacteria 3362
18 Ga0070658_10382628 3300005327 Bacteria 1207
19 Ga0070658_10414877 3300005327 Bacteria 1157
20 Ga0070658_10638632 3300005327 Bacteria 923
21 Ga0070658_10808647 3300005327 Bacteria 814
22 Ga0070658_11183671 3300005327 Bacteria 664
23 Ga0070658_11382860 3300005327 Bacteria 611
24 Ga0070676_10055897 3300005328 Bacteria 2330
25 Ga0070676_10128528 3300005328 Bacteria 1599
26 Ga0070676_10344409 3300005328 Bacteria 1023
27 Ga0070676_10413026 3300005328 Bacteria 941
28 Ga0070676_10759855 3300005328 Bacteria 712
29 Ga0070676_11173832 3300005328 Bacteria 582
30 Ga0070683_100183134 3300005329 Bacteria 1988
31 Ga0070683_100364717 3300005329 Unclassified 1376
32 Ga0070683_101195388 3300005329 Bacteria 731
33 Ga0070690_100016532 3300005330 Bacteria 4422
34 Ga0070690_100979038 3300005330 Bacteria 665
35 Ga0070670_100000504 3300005331 Bacteria 31371
36 Ga0070670_100021209 3300005331 Bacteria 5589
37 Ga0070670_100112185 3300005331 Bacteria 2350
38 Ga0070670_100167907 3300005331 Bacteria 1903
39 Ga0070670_100303259 3300005331 Bacteria 1397
40 Ga0070670_100527544 3300005331 Bacteria 1052
41 Ga0068869_100186324 3300005334 Bacteria 1629
42 Ga0068869_100909001 3300005334 Bacteria 762
43 Ga0070666_10000838 3300005335 Bacteria 18641
44 Ga0070666_10014525 3300005335 Bacteria 5015
45 Ga0070666_10396252 3300005335 Bacteria 992
46 Ga0070666_10517917 3300005335 Unclassified 866
47 Ga0070666_10664755 3300005335 Bacteria 763
48 Ga0070666_10848767 3300005335 Bacteria 674
49 Ga0070680_100336337 3300005336 Bacteria 1283
50 Ga0070680_100741620 3300005336 Bacteria 845
51 Ga0070680_100789751 3300005336 Bacteria 818
52 Ga0070680_101429902 3300005336 Bacteria 599
53 Ga0070682_100899671 3300005337 Bacteria 727
54 Ga0070682_101655376 3300005337 Bacteria 555
55 Ga0068868_100074442 3300005338 Bacteria 2712
56 Ga0068868_100246187 3300005338 Bacteria 1503
57 Ga0068868_101098483 3300005338 Unclassified 732
58 Ga0070660_100007560 3300005339 Bacteria 7573
59 Ga0070660_100011772 3300005339 Bacteria 6229
60 Ga0070660_100066379 3300005339 Bacteria 2808
61 Ga0070660_100141657 3300005339 Bacteria 1929
62 Ga0070660_100501812 3300005339 Bacteria 1009
63 Ga0070660_100591305 3300005339 Bacteria 927
64 Ga0070660_100977925 3300005339 Bacteria 715
65 Ga0070689_100795818 3300005340 Bacteria 831
66 Ga0070661_100021547 3300005344 Bacteria 4606
67 Ga0070661_100029491 3300005344 Bacteria 3961
68 Ga0070661_100158841 3300005344 Bacteria 1711
69 Ga0070661_100198167 3300005344 Bacteria 1533
70 Ga0070661_100263046 3300005344 Bacteria 1334
71 Ga0070661_100330890 3300005344 Bacteria 1191
72 Ga0070661_100438674 3300005344 Bacteria 1037
73 Ga0070661_100471946 3300005344 Bacteria 1001
74 Ga0070661_100547450 3300005344 Bacteria 931
75 Ga0070661_100938733 3300005344 Unclassified 715
76 Ga0070668_100103106 3300005347 Bacteria 2263
77 Ga0070668_100640637 3300005347 Bacteria 933
78 Ga0070669_100376417 3300005353 Bacteria 1157
79 Ga0070669_100509272 3300005353 Bacteria 999
80 Ga0070675_100020784 3300005354 Bacteria 5239
81 Ga0070675_100065133 3300005354 Bacteria 3012
82 Ga0070675_100274638 3300005354 Bacteria 1480
83 Ga0070671_100001635 3300005355 Bacteria 16920
84 Ga0070671_100002820 3300005355 Bacteria 13508
85 Ga0070671_100010780 3300005355 Bacteria 7333
86 Ga0070671_100016870 3300005355 Bacteria 5907
87 Ga0070671_100016898 3300005355 Bacteria 5902
88 Ga0070671_100040219 3300005355 Bacteria 3883
89 Ga0070671_100068897 3300005355 Bacteria 2950
90 Ga0070671_100149564 3300005355 Bacteria 1971
91 Ga0070671_100304660 3300005355 Bacteria 1357
92 Ga0070671_100373827 3300005355 Bacteria 1217
93 Ga0070671_100706747 3300005355 Bacteria 875
94 Ga0070671_101120446 3300005355 Bacteria 691
95 Ga0070671_101199669 3300005355 Bacteria 668
96 Ga0070674_100014906 3300005356 Bacteria 4840
97 Ga0070674_100052018 3300005356 Bacteria 2824
98 Ga0070674_100128032 3300005356 Bacteria 1889
99 Ga0070673_100057008 3300005364 Bacteria 3085
100 Ga0070673_100060524 3300005364 Bacteria 3001
101 Ga0070673_100093360 3300005364 Bacteria 2464
102 Ga0070673_100193232 3300005364 Bacteria 1749
103 Ga0070673_100305912 3300005364 Bacteria 1401
104 Ga0070659_100043872 3300005366 Bacteria 3498
105 Ga0070659_100061288 3300005366 Bacteria 2973
106 Ga0070659_100096607 3300005366 Bacteria 2374
107 Ga0070659_100119945 3300005366 Bacteria 2129
108 Ga0070659_100410206 3300005366 Bacteria 1145
109 Ga0070659_100482387 3300005366 Bacteria 1055
110 Ga0070659_100641004 3300005366 Bacteria 915
111 Ga0070659_100662502 3300005366 Bacteria 900
112 Ga0070659_100856459 3300005366 Unclassified 792
113 Ga0070667_100034319 3300005367 Bacteria 4244
114 Ga0070667_100052298 3300005367 Bacteria 3446
115 Ga0070667_100352945 3300005367 Bacteria 1332
116 Ga0070667_100616286 3300005367 Bacteria 1000
117 Ga0070667_101830117 3300005367 Unclassified 571
118 Ga0070714_100072873 3300005435 Bacteria 2974
119 Ga0070713_100125627 3300005436 Bacteria 2256
120 Ga0070663_100019623 3300005455 Bacteria 4461
121 Ga0070663_100043282 3300005455 Bacteria 3168
122 Ga0070663_100215203 3300005455 Bacteria 1506
123 Ga0070663_100227439 3300005455 Bacteria 1467
124 Ga0070663_100245390 3300005455 Bacteria 1415
125 Ga0070663_100558390 3300005455 Bacteria 958
126 Ga0070663_100592270 3300005455 Unclassified 932
127 Ga0070663_100858410 3300005455 Bacteria 782
128 Ga0070663_100873513 3300005455 Bacteria 775
129 Ga0070678_100005521 3300005456 Bacteria 7324
130 Ga0070678_100008885 3300005456 Bacteria 6048
131 Ga0070678_100050429 3300005456 Bacteria 3011
132 Ga0070678_100053202 3300005456 Bacteria 2943
133 Ga0070678_100239684 3300005456 Bacteria 1516
134 Ga0070662_100009090 3300005457 Bacteria 6485
135 Ga0070662_100019027 3300005457 Bacteria 4656
136 Ga0070662_100033869 3300005457 Bacteria 3599
137 Ga0070662_100060804 3300005457 Bacteria 2756
138 Ga0070662_100068120 3300005457 Bacteria 2616
139 Ga0070662_100105806 3300005457 Bacteria 2136
140 Ga0070662_100214185 3300005457 Bacteria 1534
141 Ga0070662_100272784 3300005457 Bacteria 1366
142 Ga0070662_100444685 3300005457 Unclassified 1075
143 Ga0070662_101166831 3300005457 Bacteria 662
144 Ga0068867_100012236 3300005459 Bacteria 6064
145 Ga0068867_100120101 3300005459 Bacteria 2030
146 Ga0068867_100123096 3300005459 Bacteria 2007
147 Ga0068867_100128501 3300005459 Bacteria 1966
148 Ga0068867_100322567 3300005459 Bacteria 1280
149 Ga0070685_10062254 3300005466 Bacteria 2188
150 Ga0070685_10071060 3300005466 Unclassified 2062
151 Ga0070679_100058412 3300005530 Bacteria 3843
152 Ga0070679_100664752 3300005530 Bacteria 984
153 Ga0070679_102019758 3300005530 Bacteria 526
154 Ga0068853_100144869 3300005539 Bacteria 2134
155 Ga0068853_100210058 3300005539 Bacteria 1774
156 Ga0068853_100289261 3300005539 Bacteria 1512
157 Ga0068853_100394264 3300005539 Bacteria 1295
158 Ga0068853_100835887 3300005539 Bacteria 883
159 Ga0068853_100918562 3300005539 Bacteria 841
160 Ga0068853_101110588 3300005539 Bacteria 762
161 Ga0068853_101370073 3300005539 Bacteria 684
162 Ga0068853_101873100 3300005539 Bacteria 581
163 Ga0068853_102292164 3300005539 Unclassified 523
164 Ga0070672_100002604 3300005543 Bacteria 11523
165 Ga0070672_100083336 3300005543 Bacteria 2566
166 Ga0070672_100219474 3300005543 Bacteria 1594
167 Ga0070672_100273986 3300005543 Bacteria 1425
168 Ga0070686_100024957 3300005544 Bacteria 3589
169 Ga0070696_100690363 3300005546 Bacteria 831
170 Ga0070693_100548570 3300005547 Bacteria 827
171 Ga0070665_100026883 3300005548 Bacteria 5795
172 Ga0070665_100517356 3300005548 Bacteria 1205
173 Ga0070665_101506425 3300005548 Bacteria 681
174 Ga0068855_100127522 3300005563 Bacteria 2908
175 Ga0068855_100617210 3300005563 Bacteria 1168
176 Ga0068855_101660120 3300005563 Bacteria 652
177 Ga0070664_100008401 3300005564 Bacteria 8349
178 Ga0070664_100010325 3300005564 Bacteria 7578
179 Ga0070664_100012976 3300005564 Bacteria 6779
180 Ga0070664_100242875 3300005564 Bacteria 1617
181 Ga0070664_100468073 3300005564 Bacteria 1159
182 Ga0070664_100566363 3300005564 Bacteria 1051
183 Ga0070664_100768803 3300005564 Bacteria 900
184 Ga0070664_101293847 3300005564 Bacteria 688
185 Ga0068857_100420195 3300005577 Bacteria 1246
186 Ga0068857_102229640 3300005577 Bacteria 538
187 Ga0068854_100057257 3300005578 Bacteria 2811
188 Ga0068854_100190145 3300005578 Bacteria 1608
189 Ga0068854_100290794 3300005578 Bacteria 1318
190 Ga0068854_100340646 3300005578 Bacteria 1224
191 Ga0068854_100729792 3300005578 Bacteria 858
192 Ga0068854_100890277 3300005578 Unclassified 782
193 Ga0068854_101056655 3300005578 Bacteria 722
194 Ga0068854_101518792 3300005578 Bacteria 608
195 Ga0068856_100147306 3300005614 Bacteria 2362
196 Ga0068856_100153220 3300005614 Bacteria 2314
197 Ga0068856_100972740 3300005614 Bacteria 867
198 Ga0068852_100054276 3300005616 Bacteria 3454
199 Ga0068852_100191442 3300005616 Bacteria 1930
200 Ga0068852_100654136 3300005616 Bacteria 1059
201 Ga0068852_100800687 3300005616 Bacteria 956
202 Ga0068852_100932715 3300005616 Bacteria 886
203 Ga0068852_102180536 3300005616 Unclassified 576
204 Ga0068852_102310842 3300005616 Bacteria 559
205 Ga0068859_100007546 3300005617 Bacteria 11045
206 Ga0068859_100072492 3300005617 Bacteria 3481
207 Ga0068859_100250176 3300005617 Bacteria 1863
208 Ga0068864_100000762 3300005618 Bacteria 27087
209 Ga0068864_100012169 3300005618 Bacteria 7112
210 Ga0068864_100015925 3300005618 Bacteria 6258
211 Ga0068864_100071387 3300005618 Bacteria 3023
212 Ga0068864_100073228 3300005618 Bacteria 2986
213 Ga0068864_100223243 3300005618 Bacteria 1739
214 Ga0068866_10081729 3300005718 Bacteria 1736
215 Ga0068866_10450834 3300005718 Bacteria 841
216 Ga0068851_10034100 3300005834 Bacteria 2539
217 Ga0068851_10041102 3300005834 Bacteria 2325
218 Ga0068851_10153118 3300005834 Bacteria 1262
219 Ga0068851_10382654 3300005834 Bacteria 825
220 Ga0068851_10924002 3300005834 Bacteria 547
221 Ga0068870_10078675 3300005840 Bacteria 1817
222 Ga0068863_100003982 3300005841 Bacteria 14586
223 Ga0068863_100014914 3300005841 Bacteria 7464
224 Ga0068863_100016970 3300005841 Bacteria 6982
225 Ga0068863_100125548 3300005841 Bacteria 2448
226 Ga0068858_100006075 3300005842 Bacteria 11778
227 Ga0068858_100122467 3300005842 Bacteria 2433
228 Ga0068858_100159955 3300005842 Bacteria 2120
229 Ga0068858_101054480 3300005842 Unclassified 797
230 Ga0068860_100032301 3300005843 Bacteria 5029
231 Ga0068860_100364486 3300005843 Bacteria 1424
232 Ga0068860_100468633 3300005843 Bacteria 1254
233 Ga0068860_101478039 3300005843 Bacteria 701
234 Ga0081539_10023064 3300005985 Bacteria 4089
235 Ga0070717_10011680 3300006028 Bacteria 6677
236 Ga0097621_100006176 3300006237 Bacteria 8489
237 Ga0097621_100034337 3300006237 Bacteria 4046
238 Ga0097621_100920613 3300006237 Bacteria 815
239 Ga0097621_101047730 3300006237 Bacteria 764
240 Ga0097621_101056162 3300006237 Unclassified 761
241 Ga0068871_100011670 3300006358 Bacteria 6451
242 Ga0068871_100085222 3300006358 Bacteria 2623
243 Ga0068871_100310744 3300006358 Bacteria 1386
244 Ga0068871_101128386 3300006358 Bacteria 734
245 Ga0068871_102239225 3300006358 Bacteria 521
246 Ga0068865_100009654 3300006881 Bacteria 5985
247 Ga0068865_100097584 3300006881 Bacteria 2145
248 Ga0068865_100904662 3300006881 Bacteria 768
249 Ga0097620_100007546 3300006931 Bacteria 11045
250 Ga0097620_100072492 3300006931 Bacteria 3481
251 Ga0097620_100250174 3300006931 Bacteria 1863
252 Ga0105240_10413628 3300009093 Bacteria 1516
253 Ga0105240_10522919 3300009093 Bacteria 1316
254 Ga0105245_10067017 3300009098 Bacteria 3251
255 Ga0105245_10237470 3300009098 Bacteria 1765
256 Ga0105247_10221791 3300009101 Bacteria 1280
257 Ga0105243_10756671 3300009148 Bacteria 953
258 Ga0105243_10769343 3300009148 Bacteria 946
259 Ga0105241_10106961 3300009174 Bacteria 2233
260 Ga0105241_10545874 3300009174 Bacteria 1040
261 Ga0105242_10033397 3300009176 Bacteria 4119
262 Ga0105242_12284208 3300009176 Unclassified 587
263 Ga0105248_10001027 3300009177 Bacteria 30888
264 Ga0105248_10009567 3300009177 Bacteria 10669
265 Ga0105248_10017489 3300009177 Bacteria 7906
266 Ga0105248_10037130 3300009177 Bacteria 5449
267 Ga0105248_10085199 3300009177 Bacteria 3556
268 Ga0105248_10114737 3300009177 Bacteria 3038
269 Ga0105248_10154585 3300009177 Bacteria 2589
270 Ga0105248_10155133 3300009177 Bacteria 2584
271 Ga0105248_10792241 3300009177 Bacteria 1070
272 Ga0105248_11352753 3300009177 Unclassified 806
273 Ga0105248_11727401 3300009177 Bacteria 709
274 Ga0105248_12422077 3300009177 Bacteria 598
275 Ga0105248_13257025 3300009177 Bacteria 516
276 Ga0105238_10045147 3300009551 Bacteria 4451
277 Ga0105238_10260651 3300009551 Bacteria 1713
278 Ga0105238_11673472 3300009551 Bacteria 667
279 Ga0105239_10174679 3300010375 Bacteria 2403
280 Ga0105239_11176724 3300010375 Bacteria 883
281 Ga0105239_12820013 3300010375 Bacteria 567
282 Ga0105246_10338850 3300011119 Bacteria 1228
283 Ga0105246_10514141 3300011119 Bacteria 1019
284 Ga0157316_1024886 3300012510 Bacteria 684
285 Ga0157373_10009302 3300013100 Bacteria 7264
286 Ga0157373_10068081 3300013100 Bacteria 2517
287 Ga0157373_10086316 3300013100 Bacteria 2212
288 Ga0157373_10275767 3300013100 Bacteria 1191
289 Ga0157373_10381439 3300013100 Bacteria 1008
290 Ga0157373_10565683 3300013100 Bacteria 825
291 Ga0157373_10746543 3300013100 Bacteria 719
292 Ga0157373_11488745 3300013100 Unclassified 516
293 Ga0157371_10115904 3300013102 Bacteria 1903
294 Ga0157371_10134183 3300013102 Bacteria 1762
295 Ga0157371_10221867 3300013102 Bacteria 1358
296 Ga0157371_10226984 3300013102 Bacteria 1341
297 Ga0157371_10669415 3300013102 Bacteria 775
298 Ga0157371_11554183 3300013102 Unclassified 517
299 Ga0157370_10419208 3300013104 Bacteria 1231
300 Ga0157370_10465799 3300013104 Bacteria 1161
301 Ga0157369_10053369 3300013105 Bacteria 4370
302 Ga0157369_10174116 3300013105 Bacteria 2266
303 Ga0157369_10185961 3300013105 Bacteria 2185
304 Ga0157369_10466948 3300013105 Bacteria 1307
305 Ga0157374_10001518 3300013296 Bacteria 19561
306 Ga0157374_10058066 3300013296 Bacteria 3616
307 Ga0157374_10081735 3300013296 Bacteria 3066
308 Ga0157374_10223959 3300013296 Bacteria 1846
309 Ga0157374_11413524 3300013296 Bacteria 719
310 Ga0157374_12062999 3300013296 Unclassified 597
311 Ga0157378_10030119 3300013297 Bacteria 4794
312 Ga0157378_10130048 3300013297 Bacteria 2330
313 Ga0157378_10191299 3300013297 Bacteria 1930
314 Ga0157378_11345752 3300013297 Bacteria 756
315 Ga0157378_12233279 3300013297 Unclassified 598
316 Ga0163162_10001258 3300013306 Bacteria 23693
317 Ga0163162_10081870 3300013306 Bacteria 3299
318 Ga0163162_10202040 3300013306 Bacteria 2116
319 Ga0163162_11168116 3300013306 Bacteria 873
320 Ga0157372_10456135 3300013307 Bacteria 1490
321 Ga0157372_10775150 3300013307 Bacteria 1115
322 Ga0157375_10003827 3300013308 Bacteria 13049
323 Ga0157375_10742558 3300013308 Bacteria 1133
324 Ga0163163_10006707 3300014325 Bacteria 10089
325 Ga0163163_10306128 3300014325 Bacteria 1642
326 Ga0163163_10492644 3300014325 Bacteria 1287
327 Ga0157380_10483604 3300014326 Bacteria 1198
328 Ga0182008_10242926 3300014497 Bacteria 927
329 Ga0157377_10142079 3300014745 Bacteria 1476
330 Ga0157377_11203997 3300014745 Bacteria 587
331 Ga0157379_10107013 3300014968 Bacteria 2510
332 Ga0157379_10359795 3300014968 Bacteria 1334
333 Ga0157379_10981041 3300014968 Bacteria 805
334 Ga0157376_10062632 3300014969 Bacteria 3130
335 Ga0207697_10031490 3300025315 Bacteria 2169
336 Ga0207697_10153218 3300025315 Bacteria 1003
337 Ga0207656_10006838 3300025321 Bacteria 4127
338 Ga0207656_10071057 3300025321 Bacteria 1547
339 Ga0207656_10084242 3300025321 Bacteria 1434
340 Ga0207656_10172665 3300025321 Bacteria 1034
341 Ga0207656_10603121 3300025321 Bacteria 561
342 Ga0207682_10172897 3300025893 Bacteria 983
343 Ga0207642_10017153 3300025899 Bacteria 2747
344 Ga0207642_10053112 3300025899 Bacteria 1842
345 Ga0207688_10026033 3300025901 Bacteria 3214
346 Ga0207688_10035245 3300025901 Bacteria 2772
347 Ga0207688_10115831 3300025901 Bacteria 1560
348 Ga0207688_10382560 3300025901 Bacteria 871
349 Ga0207680_10032699 3300025903 Bacteria 2960
350 Ga0207680_10033837 3300025903 Bacteria 2919
351 Ga0207680_10112449 3300025903 Bacteria 1768
352 Ga0207680_10324086 3300025903 Bacteria 1078
353 Ga0207680_10359736 3300025903 Bacteria 1023
354 Ga0207680_10639005 3300025903 Bacteria 762
355 Ga0207647_10019517 3300025904 Bacteria 4557
356 Ga0207647_10051970 3300025904 Bacteria 2530
357 Ga0207647_10231827 3300025904 Bacteria 1062
358 Ga0207645_10030197 3300025907 Bacteria 3492
359 Ga0207645_10064735 3300025907 Bacteria 2336
360 Ga0207645_10510742 3300025907 Bacteria 814
361 Ga0207705_10002166 3300025909 Bacteria 15203
362 Ga0207705_10006319 3300025909 Bacteria 8795
363 Ga0207705_10019265 3300025909 Bacteria 4880
364 Ga0207705_10051535 3300025909 Bacteria 2962
365 Ga0207705_10084802 3300025909 Bacteria 2313
366 Ga0207705_10266332 3300025909 Bacteria 1309
367 Ga0207705_10542189 3300025909 Bacteria 904
368 Ga0207705_10657111 3300025909 Bacteria 815
369 Ga0207705_11154540 3300025909 Bacteria 595
370 Ga0207705_11203690 3300025909 Bacteria 581
371 Ga0207707_10438324 3300025912 Bacteria 1119
372 Ga0207707_10565325 3300025912 Bacteria 965
373 Ga0207695_10984817 3300025913 Bacteria 723
374 Ga0207660_10736381 3300025917 Bacteria 804
375 Ga0207660_10814238 3300025917 Bacteria 762
376 Ga0207662_10013143 3300025918 Bacteria 4625
377 Ga0207657_10001850 3300025919 Bacteria 22857
378 Ga0207657_10005123 3300025919 Bacteria 13731
379 Ga0207657_10020568 3300025919 Bacteria 6233
380 Ga0207657_10022060 3300025919 Bacteria 5976
381 Ga0207657_10037836 3300025919 Bacteria 4304
382 Ga0207657_10205201 3300025919 Bacteria 1584
383 Ga0207657_10219084 3300025919 Bacteria 1525
384 Ga0207657_10456326 3300025919 Bacteria 1003
385 Ga0207657_10701516 3300025919 Bacteria 786
386 Ga0207649_10028261 3300025920 Bacteria 3301
387 Ga0207649_10042359 3300025920 Bacteria 2777
388 Ga0207649_10100008 3300025920 Bacteria 1917
389 Ga0207649_10150319 3300025920 Bacteria 1603
390 Ga0207649_10183084 3300025920 Bacteria 1467
391 Ga0207649_10298995 3300025920 Bacteria 1176
392 Ga0207649_10347287 3300025920 Bacteria 1097
393 Ga0207649_10439613 3300025920 Bacteria 982
394 Ga0207649_10830241 3300025920 Bacteria 722
395 Ga0207649_10959124 3300025920 Unclassified 672
396 Ga0207652_10099039 3300025921 Bacteria 2572
397 Ga0207652_10167013 3300025921 Bacteria 1973
398 Ga0207652_11194631 3300025921 Bacteria 662
399 Ga0207652_11809834 3300025921 Bacteria 516
400 Ga0207694_10181558 3300025924 Bacteria 1706
401 Ga0207694_10232064 3300025924 Bacteria 1507
402 Ga0207650_10005712 3300025925 Bacteria 8490
403 Ga0207650_10024647 3300025925 Bacteria 4279
404 Ga0207650_10256122 3300025925 Bacteria 1418
405 Ga0207650_10281002 3300025925 Bacteria 1355
406 Ga0207659_10013467 3300025926 Bacteria 5239
407 Ga0207659_10494667 3300025926 Bacteria 1034
408 Ga0207659_11145035 3300025926 Bacteria 669
409 Ga0207687_10079172 3300025927 Bacteria 2369
410 Ga0207687_10117697 3300025927 Bacteria 1982
411 Ga0207700_10243673 3300025928 Bacteria 1533
412 Ga0207664_10151615 3300025929 Bacteria 1970
413 Ga0207644_10000848 3300025931 Bacteria 19364
414 Ga0207644_10000938 3300025931 Bacteria 18557
415 Ga0207644_10009900 3300025931 Bacteria 6271
416 Ga0207644_10057221 3300025931 Bacteria 2815
417 Ga0207644_10092064 3300025931 Bacteria 2261
418 Ga0207644_10180406 3300025931 Bacteria 1654
419 Ga0207644_10219793 3300025931 Bacteria 1505
420 Ga0207644_10305238 3300025931 Bacteria 1284
421 Ga0207644_10361448 3300025931 Bacteria 1181
422 Ga0207644_10685196 3300025931 Bacteria 854
423 Ga0207690_10052405 3300025932 Bacteria 2733
424 Ga0207690_10138150 3300025932 Bacteria 1792
425 Ga0207690_10161622 3300025932 Bacteria 1670
426 Ga0207690_10267272 3300025932 Bacteria 1327
427 Ga0207690_10408248 3300025932 Bacteria 1084
428 Ga0207690_10590529 3300025932 Bacteria 906
429 Ga0207690_11842302 3300025932 Bacteria 505
430 Ga0207706_10003663 3300025933 Bacteria 14675
431 Ga0207706_10004030 3300025933 Bacteria 13895
432 Ga0207706_10012803 3300025933 Bacteria 7633
433 Ga0207706_10060848 3300025933 Bacteria 3326
434 Ga0207706_10070303 3300025933 Bacteria 3079
435 Ga0207706_10183469 3300025933 Bacteria 1838
436 Ga0207706_10212131 3300025933 Bacteria 1697
437 Ga0207706_10282255 3300025933 Bacteria 1448
438 Ga0207706_10337796 3300025933 Bacteria 1310
439 Ga0207706_10387009 3300025933 Bacteria 1213
440 Ga0207706_10435653 3300025933 Bacteria 1135
441 Ga0207706_10748187 3300025933 Bacteria 833
442 Ga0207706_10960769 3300025933 Bacteria 719
443 Ga0207706_11369251 3300025933 Bacteria 582
444 Ga0207686_10196876 3300025934 Bacteria 1440
445 Ga0207686_10681407 3300025934 Bacteria 816
446 Ga0207709_10253927 3300025935 Bacteria 1286
447 Ga0207709_10612554 3300025935 Bacteria 863
448 Ga0207669_10083348 3300025937 Bacteria 2056
449 Ga0207669_10141327 3300025937 Bacteria 1671
450 Ga0207669_10302360 3300025937 Bacteria 1216
451 Ga0207704_10110471 3300025938 Bacteria 1857
452 Ga0207704_10332431 3300025938 Bacteria 1176
453 Ga0207704_11498842 3300025938 Unclassified 579
454 Ga0207665_10029535 3300025939 Bacteria 3623
455 Ga0207691_10004144 3300025940 Bacteria 14086
456 Ga0207691_10017581 3300025940 Bacteria 6777
457 Ga0207691_10072679 3300025940 Bacteria 3102
458 Ga0207691_10140435 3300025940 Bacteria 2129
459 Ga0207711_10003705 3300025941 Bacteria 13172
460 Ga0207711_10004689 3300025941 Bacteria 11614
461 Ga0207711_10005802 3300025941 Bacteria 10432
462 Ga0207711_10012920 3300025941 Bacteria 6936
463 Ga0207711_10023896 3300025941 Bacteria 5115
464 Ga0207711_10026517 3300025941 Bacteria 4863
465 Ga0207711_10063537 3300025941 Bacteria 3187
466 Ga0207711_10094042 3300025941 Bacteria 2641
467 Ga0207711_10115522 3300025941 Bacteria 2392
468 Ga0207711_10187594 3300025941 Bacteria 1883
469 Ga0207711_10722162 3300025941 Unclassified 929
470 Ga0207711_11747315 3300025941 Bacteria 565
471 Ga0207689_10017816 3300025942 Bacteria 6002
472 Ga0207689_10186790 3300025942 Bacteria 1709
473 Ga0207689_10666655 3300025942 Bacteria 877
474 Ga0207661_10247610 3300025944 Bacteria 1583
475 Ga0207661_10979865 3300025944 Bacteria 779
476 Ga0207679_10003202 3300025945 Bacteria 10093
477 Ga0207679_10065725 3300025945 Bacteria 2715
478 Ga0207679_10075110 3300025945 Bacteria 2563
479 Ga0207679_10102560 3300025945 Bacteria 2240
480 Ga0207679_10111685 3300025945 Bacteria 2158
481 Ga0207679_10132006 3300025945 Bacteria 2005
482 Ga0207679_10237980 3300025945 Bacteria 1541
483 Ga0207679_10323897 3300025945 Bacteria 1335
484 Ga0207679_10345607 3300025945 Bacteria 1295
485 Ga0207679_10525577 3300025945 Bacteria 1059
486 Ga0207667_10567816 3300025949 Bacteria 1146
487 Ga0207651_10007789 3300025960 Bacteria 5728
488 Ga0207651_10086123 3300025960 Bacteria 2282
489 Ga0207651_10087537 3300025960 Bacteria 2267
490 Ga0207651_10184694 3300025960 Bacteria 1657
491 Ga0207651_11627163 3300025960 Bacteria 582
492 Ga0207668_11656123 3300025972 Bacteria 578
493 Ga0207640_10005925 3300025981 Bacteria 6673
494 Ga0207640_10314579 3300025981 Bacteria 1244
495 Ga0207640_10405084 3300025981 Bacteria 1112
496 Ga0207640_10966141 3300025981 Bacteria 748
497 Ga0207640_12141493 3300025981 Unclassified 507
498 Ga0207658_10005418 3300025986 Bacteria 8750
499 Ga0207658_10046791 3300025986 Bacteria 3161
500 Ga0207658_10259823 3300025986 Bacteria 1479
501 Ga0207658_10450233 3300025986 Bacteria 1140
502 Ga0207658_10962953 3300025986 Bacteria 778
503 Ga0207658_12079431 3300025986 Bacteria 516
504 Ga0207677_10022022 3300026023 Bacteria 3908
505 Ga0207677_10153142 3300026023 Bacteria 1782
506 Ga0207677_10206695 3300026023 Unclassified 1564
507 Ga0207677_10659780 3300026023 Bacteria 924
508 Ga0207677_10762026 3300026023 Bacteria 863
509 Ga0207677_11206574 3300026023 Bacteria 693
510 Ga0207703_10019185 3300026035 Bacteria 5341
511 Ga0207703_10019739 3300026035 Bacteria 5269
512 Ga0207703_10466543 3300026035 Bacteria 1181
513 Ga0207703_10696792 3300026035 Bacteria 966
514 Ga0207703_10919795 3300026035 Unclassified 838
515 Ga0207639_10195850 3300026041 Bacteria 1729
516 Ga0207639_10493038 3300026041 Bacteria 1118
517 Ga0207639_10847536 3300026041 Bacteria 853
518 Ga0207639_11223025 3300026041 Bacteria 705
519 Ga0207678_10033638 3300026067 Bacteria 4465
520 Ga0207678_10034643 3300026067 Bacteria 4397
521 Ga0207678_10063379 3300026067 Bacteria 3176
522 Ga0207678_10106927 3300026067 Bacteria 2387
523 Ga0207678_10110989 3300026067 Bacteria 2339
524 Ga0207678_10143345 3300026067 Bacteria 2039
525 Ga0207678_10677391 3300026067 Unclassified 907
526 Ga0207678_10689511 3300026067 Unclassified 899
527 Ga0207708_10394560 3300026075 Bacteria 1143
528 Ga0207702_10268631 3300026078 Bacteria 1608
529 Ga0207702_10271262 3300026078 Bacteria 1600
530 Ga0207702_10980692 3300026078 Bacteria 838
531 Ga0207641_10002878 3300026088 Bacteria 15597
532 Ga0207641_10004593 3300026088 Bacteria 11926
533 Ga0207641_10028895 3300026088 Bacteria 4583
534 Ga0207641_10956469 3300026088 Bacteria 852
535 Ga0207641_11139222 3300026088 Bacteria 779
536 Ga0207648_10013810 3300026089 Bacteria 7492
537 Ga0207648_10032611 3300026089 Bacteria 4597
538 Ga0207648_10070124 3300026089 Bacteria 3055
539 Ga0207648_10379766 3300026089 Bacteria 1277
540 Ga0207676_10001750 3300026095 Bacteria 15934
541 Ga0207676_10006168 3300026095 Bacteria 8464
542 Ga0207676_10035627 3300026095 Bacteria 3779
543 Ga0207676_10037116 3300026095 Bacteria 3711
544 Ga0207676_10378523 3300026095 Bacteria 1317
545 Ga0207674_10006081 3300026116 Bacteria 14265
546 Ga0207674_10874747 3300026116 Unclassified 866
547 Ga0207683_10000430 3300026121 Bacteria 38851
548 Ga0207683_10010964 3300026121 Bacteria 7729
549 Ga0207683_10057144 3300026121 Bacteria 3425
550 Ga0207683_10120262 3300026121 Bacteria 2357
551 Ga0207698_10167553 3300026142 Unclassified 1930
552 Ga0207698_10192069 3300026142 Bacteria 1820
553 Ga0207698_10272877 3300026142 Bacteria 1560
554 Ga0207698_10275932 3300026142 Bacteria 1552
555 Ga0207698_10304985 3300026142 Bacteria 1484
556 Ga0207698_10457913 3300026142 Bacteria 1233
557 Ga0207698_11128598 3300026142 Bacteria 797
558 Ga0268266_10238941 3300028379 Bacteria 1676
559 Ga0268266_10272579 3300028379 Bacteria 1571
560 Ga0268265_12713334 3300028380 Bacteria 501
561 Ga0268264_10158928 3300028381 Bacteria 2034
562 Ga0268264_10191891 3300028381 Bacteria 1863
563 Ga0307408_100099816 3300031548 Bacteria 2209
564 Ga0307408_100256637 3300031548 Bacteria 1444
565 Ga0307405_10863850 3300031731 Bacteria 762
566 Ga0307413_10021430 3300031824 Bacteria 3460
567 Ga0307406_10002502 3300031901 Bacteria 10015
568 Ga0307407_10527398 3300031903 Bacteria 869
569 Ga0307412_10702681 3300031911 Bacteria 868
570 Ga0307412_10941667 3300031911 Bacteria 759
571 Ga0307409_100009254 3300031995 Bacteria 6041
572 Ga0307409_100614194 3300031995 Bacteria 1076
573 Ga0307416_100069213 3300032002 Bacteria 2919
574 Ga0307416_100670211 3300032002 Bacteria 1124
575 Ga0307414_10026075 3300032004 Bacteria 3756
576 Ga0307411_11136772 3300032005 Bacteria 705
577 Ga0307411_12035806 3300032005 Bacteria 536
578 Ga0307415_100058123 3300032126 Bacteria 2661
579 Ga0307415_100093999 3300032126 Bacteria 2178
580 Ga0373950_0099236 3300034818 Unclassified 626
581 Ga0373959_0068164 3300034820 Bacteria 800
582 Ga0373959_0145266 3300034820 Bacteria 596
583 Ga0373929_0133679 3300035085 Bacteria 652
584 Ga0373944_0159831 3300035089 Unclassified 799
585 Ga0373936_0164730 3300035113 Bacteria 967
586 Ga0373941_0011968 3300035115 Bacteria 2256
587 Ga0373941_0057495 3300035115 Bacteria 1256
588 Ga0373960_0032219 3300035121 Bacteria 1471
589 Ga0373943_0001126 3300035170 Bacteria 11940
590 Ga0373946_0032471 3300035171 Bacteria 2097
591 Ga0373955_0400508 3300035172 Bacteria 834
592 Ga0373942_0117453 3300035207 Bacteria 828
593 Ga0373961_0137823 3300035241 Bacteria 822
594 Ga0373962_0152355 3300035242 Bacteria 758
595 Ga0373931_0033707 3300035691 Bacteria 2655
596 Ga0373935_0095809 3300035692 Bacteria 1950
597 Ga0373947_0113118 3300035725 Bacteria 1717
598 Ga0395899_0018627 3300037312 Bacteria 5275
599 Ga0395899_0037269 3300037312 Bacteria 3646
600 Ga0395899_0101401 3300037312 Bacteria 2077
601 Ga0395899_0137570 3300037312 Bacteria 1740
602 Ga0395899_0140364 3300037312 Bacteria 1719
603 Ga0395899_0613565 3300037312 Bacteria 691
604 Ga0395899_0777879 3300037312 Unclassified 593
605 Ga0395899_0796434 3300037312 Bacteria 584
606 Ga0395899_0801146 3300037312 Bacteria 582
607 Ga0395899_0861445 3300037312 Bacteria 555
608 Ga0395900_0084927 3300037418 Bacteria 3253
609 Ga0395900_0092252 3300037418 Bacteria 3111
610 Ga0395900_0287985 3300037418 Bacteria 1632
611 Ga0395900_0395850 3300037418 Bacteria 1346
612 Ga0395900_0495553 3300037418 Bacteria 1172
613 Ga0395900_0694209 3300037418 Bacteria 952
614 Ga0395900_1604623 3300037418 Bacteria 562
615 Ga0395900_1862788 3300037418 Unclassified 512
616 Ga0395898_0067388 3300037466 Bacteria 3465
617 Ga0395898_0192238 3300037466 Bacteria 1950
618 Ga0395898_0229110 3300037466 Bacteria 1772
619 Ga0395898_0430900 3300037466 Bacteria 1257
620 Ga0395898_1300496 3300037466 Bacteria 656
621 Ga0395905_0017852 3300037471 Bacteria 6741
622 Ga0395905_0018669 3300037471 Bacteria 6577
623 Ga0395905_0029032 3300037471 Bacteria 5213
624 Ga0395905_0155824 3300037471 Bacteria 2148
625 Ga0395905_0208751 3300037471 Bacteria 1830
626 Ga0395905_0212635 3300037471 Bacteria 1811
627 Ga0395905_0315813 3300037471 Bacteria 1451
628 Ga0395905_0360445 3300037471 Bacteria 1346
629 Ga0395905_0524005 3300037471 Bacteria 1085
630 Ga0395905_1878652 3300037471 Unclassified 505
631 Ga0395901_0023532 3300038443 Bacteria 6316
632 Ga0395901_0030677 3300038443 Bacteria 5539
633 Ga0395901_0038512 3300038443 Bacteria 4946
634 Ga0395901_0089376 3300038443 Bacteria 3223
635 Ga0395901_0103414 3300038443 Bacteria 2988
636 Ga0395901_0117913 3300038443 Bacteria 2789
637 Ga0395901_0161558 3300038443 Bacteria 2353
638 Ga0395901_0173834 3300038443 Bacteria 2259
639 Ga0395901_0245569 3300038443 Bacteria 1866
640 Ga0395901_0339313 3300038443 Bacteria 1552
641 Ga0395901_0472182 3300038443 Bacteria 1280
642 Ga0395901_0498096 3300038443 Bacteria 1240
643 Ga0395901_0507960 3300038443 Bacteria 1226
644 Ga0395901_0697138 3300038443 Bacteria 1013
645 Ga0395901_0842171 3300038443 Bacteria 903
646 Ga0395901_1861077 3300038443 Bacteria 550
647 Ga0395901_2092634 3300038443 Unclassified 511
648 Ga0439465_0033656 3300041413 Bacteria 1639
649 Ga0439448_0026065 3300042005 Bacteria 1837
650 Ga0439432_038327 3300042006 Bacteria 1527
651 Ga0439455_0006912 3300042012 Bacteria 2378
652 Ga0450889_048522 3300042144 Unclassified 520
653 Ga0439458_0001603 3300042157 Bacteria 5653
654 Ga0439458_0003722 3300042157 Bacteria 3535
655 Ga0439458_0080085 3300042157 Bacteria 832
656 Ga0466969_0136636 3300044656 Bacteria 1135
657 Ga0466972_0057781 3300044658 Bacteria 1863
658 Ga0466972_0522888 3300044658 Unclassified 559
659 Ga0466965_0020656 3300044683 Bacteria 3168
660 Ga0466965_0179123 3300044683 Bacteria 1118
661 Ga0466966_0053512 3300044684 Bacteria 2561
662 Ga0466966_0256362 3300044684 Bacteria 1053
663 Ga0466966_0400648 3300044684 Bacteria 824
664 Ga0466966_0774522 3300044684 Bacteria 578
665 Ga0466961_0002424 3300044693 Bacteria 11575
666 Ga0466961_0054112 3300044693 Bacteria 2560
667 Ga0466961_0057741 3300044693 Bacteria 2470
668 Ga0466961_0600746 3300044693 Bacteria 662
669 Ga0466963_0008434 3300044694 Bacteria 6173
670 Ga0466963_0020936 3300044694 Bacteria 4120
671 Ga0466963_0026648 3300044694 Bacteria 3697
672 Ga0466963_0224460 3300044694 Bacteria 1316
673 Ga0466963_0784093 3300044694 Unclassified 672
674 Ga0466963_1221190 3300044694 Bacteria 528
675 Ga0466964_0022839 3300044706 Bacteria 2429
676 Ga0466964_0028142 3300044706 Bacteria 2212
677 Ga0466964_0549190 3300044706 Bacteria 627
678 Ga0466971_0020132 3300044719 Bacteria 2965
679 Ga0466971_0133991 3300044719 Bacteria 1151
680 Ga0466971_0184107 3300044719 Bacteria 982
681 Ga0466968_0007245 3300044735 Bacteria 4213
682 Ga0466968_0652840 3300044735 Bacteria 534
683 Ga0466970_0002020 3300044765 Bacteria 9817
684 Ga0466970_0075999 3300044765 Bacteria 1809
685 Ga0466970_0098286 3300044765 Bacteria 1593
686 Ga0466970_0216502 3300044765 Bacteria 1068
687 Ga0466957_0003787 3300044842 Bacteria 8359
688 Ga0466957_0058478 3300044842 Bacteria 2362
689 Ga0466957_0636889 3300044842 Bacteria 749
690 Ga0466957_1077022 3300044842 Bacteria 579
691 Ga0466960_0009969 3300044901 Bacteria 3933
692 Ga0466960_0653072 3300044901 Bacteria 628
693 Ga0466959_0007303 3300045049 Bacteria 7745
694 Ga0466959_0416340 3300045049 Bacteria 912
695 Ga0466959_0573013 3300045049 Bacteria 760
696 Ga0466958_0001810 3300045836 Bacteria 10372
697 Ga0466958_0003603 3300045836 Bacteria 8071
698 Ga0466958_0034135 3300045836 Bacteria 3033
699 Ga0466958_0102009 3300045836 Bacteria 1785
700 Ga0466958_0194013 3300045836 Bacteria 1291
701 Ga0466967_0101269 3300045976 Bacteria 2633
702 Ga0466967_0116659 3300045976 Bacteria 2460
703 Ga0466967_0138212 3300045976 Bacteria 2267
704 Ga0466967_0200139 3300045976 Bacteria 1891
705 Ga0466967_0454524 3300045976 Bacteria 1252
706 Ga0466967_0570302 3300045976 Bacteria 1115
707 Ga0466967_0648095 3300045976 Bacteria 1044
708 Ga0466967_1990572 3300045976 Bacteria 578
709 Ga0495663_0027813 3300046525 Bacteria 1661
710 Ga0495663_0146821 3300046525 Bacteria 803
711 Ga0495663_0305340 3300046525 Bacteria 573
712 Ga0495642_0112462 3300046528 Bacteria 1165
713 Ga0495665_0187806 3300046531 Bacteria 1073
714 Ga0495621_0011931 3300046539 Bacteria 2701
715 Ga0495669_0002034 3300046684 Bacteria 8290
716 Ga0495669_0121819 3300046684 Bacteria 1223
717 Ga0495669_0124790 3300046684 Bacteria 1209
718 Ga0495669_0495300 3300046684 Bacteria 594
719 Ga0495677_0001481 3300047445 Bacteria 9425
720 Ga0495677_0233600 3300047445 Bacteria 718
721 Ga0496100_0040773 3300048903 Bacteria 2956
722 Ga0496100_0166071 3300048903 Bacteria 1586
723 Ga0496100_0466474 3300048903 Bacteria 970
724 Ga0496101_0008901 3300048904 Bacteria 6576
725 Ga0496101_0052491 3300048904 Bacteria 2940
726 Ga0496101_0087243 3300048904 Bacteria 2316
727 Ga0496101_0638350 3300048904 Bacteria 841
728 Ga0496101_1200558 3300048904 Unclassified 594
729 Ga0496102_0123041 3300048905 Bacteria 2424
730 Ga0496102_0223370 3300048905 Bacteria 1776
731 Ga0496102_0223512 3300048905 Bacteria 1775
732 Ga0496102_0339941 3300048905 Bacteria 1414
733 Ga0496102_0464954 3300048905 Bacteria 1186
734 Ga0496102_0837192 3300048905 Bacteria 842
735 Ga0496103_0087862 3300048906 Bacteria 1960
736 Ga0496103_0277198 3300048906 Bacteria 1079
737 Ga0496103_0434258 3300048906 Unclassified 843
738 Ga0496103_0534661 3300048906 Bacteria 749
739 Ga0496104_0082383 3300048907 Bacteria 3068
740 Ga0496104_0323881 3300048907 Bacteria 1454
741 Ga0496105_0053259 3300048908 Bacteria 3342
742 Ga0496105_0300224 3300048908 Bacteria 1291
743 Ga0496106_0052906 3300048909 Bacteria 3065
744 Ga0496106_0109276 3300048909 Bacteria 2152
745 Ga0496107_0048439 3300048910 Bacteria 3061
746 Ga0496107_0134806 3300048910 Bacteria 1824
747 Ga0496107_0194232 3300048910 Bacteria 1508
748 Ga0496107_0366420 3300048910 Bacteria 1072
749 Ga0496107_0438222 3300048910 Bacteria 971
750 Ga0496107_0534483 3300048910 Bacteria 869
751 Ga0496107_1203806 3300048910 Bacteria 544
752 Ga0496108_0003999 3300048911 Bacteria 11826
753 Ga0496108_0004815 3300048911 Bacteria 10888
754 Ga0496108_0012774 3300048911 Bacteria 6837
755 Ga0496108_0028436 3300048911 Bacteria 4626
756 Ga0496108_1593859 3300048911 Bacteria 540
757 Ga0496109_0002175 3300048912 Bacteria 16290
758 Ga0496109_0056382 3300048912 Bacteria 3586
759 Ga0496109_0092747 3300048912 Bacteria 2793
760 Ga0496109_0168282 3300048912 Bacteria 2055
761 Ga0496109_0199178 3300048912 Bacteria 1882
762 Ga0496109_0218023 3300048912 Bacteria 1795
763 Ga0496109_1127352 3300048912 Unclassified 721
764 Ga0496110_0001640 3300048913 Bacteria 16421
765 Ga0496110_0060457 3300048913 Bacteria 3341
766 Ga0496110_0094262 3300048913 Bacteria 2680
767 Ga0496110_0101355 3300048913 Bacteria 2581
768 Ga0496111_0000805 3300048914 Bacteria 16836
769 Ga0496111_0030717 3300048914 Bacteria 3821
770 Ga0496111_0077921 3300048914 Bacteria 2417
771 Ga0496111_0320221 3300048914 Bacteria 1148
772 Ga0496112_0004603 3300048915 Bacteria 11731
773 Ga0496112_0004651 3300048915 Bacteria 11668
774 Ga0496112_0042818 3300048915 Bacteria 4431
775 Ga0496112_0058029 3300048915 Bacteria 3811
776 Ga0496112_0094659 3300048915 Bacteria 2957
777 Ga0496112_0119506 3300048915 Bacteria 2605
778 Ga0496112_1497523 3300048915 Bacteria 589
779 Ga0496113_0002011 3300048916 Bacteria 11667
780 Ga0496113_0024774 3300048916 Bacteria 4270
781 Ga0496113_0028088 3300048916 Bacteria 4042
782 Ga0496113_0151514 3300048916 Bacteria 1829
783 Ga0496113_1351034 3300048916 Bacteria 553
784 Ga0496114_0056519 3300048917 Bacteria 3275
785 Ga0496114_0457165 3300048917 Bacteria 1130
786 Ga0496114_1053901 3300048917 Unclassified 697
787 Ga0496115_0001561 3300048918 Bacteria 16474
788 Ga0501067_0150546 3300049583 Bacteria 1296
789 Ga0501069_0203296 3300049585 Bacteria 1148
790 Ga0501069_0253373 3300049585 Bacteria 1027
791 Ga0501206_007019 3300049653 Bacteria 1472
792 Ga0501207_080043 3300049654 Bacteria 627
793 Ga0501216_025903 3300049660 Bacteria 1056
794 Ga0501217_047573 3300049661 Bacteria 1111
795 Ga0501223_020359 3300049663 Bacteria 1301
796 Ga0501227_064470 3300049665 Bacteria 944
797 Ga0501230_064761 3300049667 Bacteria 745
798 Ga0501233_028581 3300049668 Bacteria 1246
799 Ga0501239_023053 3300049672 Bacteria 776
800 Ga0501249_139910 3300049679 Bacteria 602
801 Ga0501252_040203 3300049682 Bacteria 676
802 Ga0501258_001599 3300049687 Bacteria 1886
803 Ga0501221_010418 3300049704 Bacteria 1651
804 Ga0501225_0066080 3300049705 Bacteria 1022
805 Ga0501234_013934 3300049707 Bacteria 1261
806 Ga0501245_067155 3300049708 Unclassified 668
807 Ga0501268_002058 3300049765 Bacteria 2601
808 Ga0501270_044132 3300049767 Unclassified 786
809 Ga0501272_005974 3300049769 Bacteria 1295
810 Ga0501273_001673 3300049770 Bacteria 2157
811 Ga0501212_022674 3300049851 Bacteria 981
812 Ga0466962_0006842 3300061719 Bacteria 5471
813 Ga0466962_0107472 3300061719 Bacteria 1342
814 Ga0466962_0235123 3300061719 Bacteria 899
815 Ga0466962_0477306 3300061719 Unclassified 630
816 Ga0466962_0496130 3300061719 Bacteria 617
817 Ga0207650_10217242
818 JGI24736J21556_1065705
819 JGI24741J21665_1014380
820 JGI24747J21853_1011318
821 JGI24737J22298_10031601
822 JGI24735J21928_10044835
823 JGI24738J21930_10016097
824 JGI24738J21930_10060732
825 JGI24738J21930_10097063
826 JGI24744J21845_10004818
827 JGI24744J21845_10033291
828 JGI24742J22300_10008505
829 JGI24742J22300_10097258
830 Ga0070658_10025009
831 Ga0070658_10029765
832 Ga0070658_10036184
833 Ga0070658_10050771
834 Ga0070658_10382628
835 Ga0070658_10414877
836 Ga0070658_10638632
837 Ga0070658_10808647
838 Ga0070658_11183671
839 Ga0070658_11382860
840 Ga0070676_10055897
841 Ga0070676_10128528
842 Ga0070676_10344409
843 Ga0070676_10413026
844 Ga0070676_10759855
845 Ga0070676_11173832
846 Ga0070683_100183134
847 Ga0070683_100364717
848 Ga0070683_101195388
849 Ga0070690_100016532
850 Ga0070690_100979038
851 Ga0070670_100000504
852 Ga0070670_100021209
853 Ga0070670_100112185
854 Ga0070670_100167907
855 Ga0070670_100303259
856 Ga0070670_100527544
857 Ga0068869_100186324
858 Ga0068869_100909001
859 Ga0070666_10000838
860 Ga0070666_10014525
861 Ga0070666_10396252
862 Ga0070666_10517917
863 Ga0070666_10664755
864 Ga0070666_10848767
865 Ga0070680_100336337
866 Ga0070680_100741620
867 Ga0070680_100789751
868 Ga0070680_101429902
869 Ga0070682_100899671
870 Ga0070682_101655376
871 Ga0068868_100074442
872 Ga0068868_100246187
873 Ga0068868_101098483
874 Ga0070660_100007560
875 Ga0070660_100011772
876 Ga0070660_100066379
877 Ga0070660_100141657
878 Ga0070660_100501812
879 Ga0070660_100591305
880 Ga0070660_100977925
881 Ga0070689_100795818
882 Ga0070661_100021547
883 Ga0070661_100029491
884 Ga0070661_100158841
885 Ga0070661_100198167
886 Ga0070661_100263046
887 Ga0070661_100330890
888 Ga0070661_100438674
889 Ga0070661_100471946
890 Ga0070661_100547450
891 Ga0070661_100938733
892 Ga0070668_100103106
893 Ga0070668_100640637
894 Ga0070669_100376417
895 Ga0070669_100509272
896 Ga0070675_100020784
897 Ga0070675_100065133
898 Ga0070675_100274638
899 Ga0070671_100001635
900 Ga0070671_100002820
901 Ga0070671_100010780
902 Ga0070671_100016870
903 Ga0070671_100016898
904 Ga0070671_100040219
905 Ga0070671_100068897
906 Ga0070671_100149564
907 Ga0070671_100304660
908 Ga0070671_100373827
909 Ga0070671_100706747
910 Ga0070671_101120446
911 Ga0070671_101199669
912 Ga0070674_100014906
913 Ga0070674_100052018
914 Ga0070674_100128032
915 Ga0070673_100057008
916 Ga0070673_100060524
917 Ga0070673_100093360
918 Ga0070673_100193232
919 Ga0070673_100305912
920 Ga0070659_100043872
921 Ga0070659_100061288
922 Ga0070659_100096607
923 Ga0070659_100119945
924 Ga0070659_100410206
925 Ga0070659_100482387
926 Ga0070659_100641004
927 Ga0070659_100662502
928 Ga0070659_100856459
929 Ga0070667_100034319
930 Ga0070667_100052298
931 Ga0070667_100352945
932 Ga0070667_100616286
933 Ga0070667_101830117
934 Ga0070714_100072873
935 Ga0070713_100125627
936 Ga0070663_100019623
937 Ga0070663_100043282
938 Ga0070663_100215203
939 Ga0070663_100227439
940 Ga0070663_100245390
941 Ga0070663_100558390
942 Ga0070663_100592270
943 Ga0070663_100858410
944 Ga0070663_100873513
945 Ga0070678_100005521
946 Ga0070678_100008885
947 Ga0070678_100050429
948 Ga0070678_100053202
949 Ga0070678_100239684
950 Ga0070662_100009090
951 Ga0070662_100019027
952 Ga0070662_100033869
953 Ga0070662_100060804
954 Ga0070662_100068120
955 Ga0070662_100105806
956 Ga0070662_100214185
957 Ga0070662_100272784
958 Ga0070662_100444685
959 Ga0070662_101166831
960 Ga0068867_100012236
961 Ga0068867_100120101
962 Ga0068867_100123096
963 Ga0068867_100128501
964 Ga0068867_100322567
965 Ga0070685_10062254
966 Ga0070685_10071060
967 Ga0070679_100058412
968 Ga0070679_100664752
969 Ga0070679_102019758
970 Ga0068853_100144869
971 Ga0068853_100210058
972 Ga0068853_100289261
973 Ga0068853_100394264
974 Ga0068853_100835887
975 Ga0068853_100918562
976 Ga0068853_101110588
977 Ga0068853_101370073
978 Ga0068853_101873100
979 Ga0068853_102292164
980 Ga0070672_100002604
981 Ga0070672_100083336
982 Ga0070672_100219474
983 Ga0070672_100273986
984 Ga0070686_100024957
985 Ga0070696_100690363
986 Ga0070693_100548570
987 Ga0070665_100026883
988 Ga0070665_100517356
989 Ga0070665_101506425
990 Ga0068855_100127522
991 Ga0068855_100617210
992 Ga0068855_101660120
993 Ga0070664_100008401
994 Ga0070664_100010325
995 Ga0070664_100012976
996 Ga0070664_100242875
997 Ga0070664_100468073
998 Ga0070664_100566363
999 Ga0070664_100768803
1000 Ga0070664_101293847
1001 Ga0068857_100420195
1002 Ga0068857_102229640
1003 Ga0068854_100057257
1004 Ga0068854_100190145
1005 Ga0068854_100290794
1006 Ga0068854_100340646
1007 Ga0068854_100729792
1008 Ga0068854_100890277
1009 Ga0068854_101056655
1010 Ga0068854_101518792
1011 Ga0068856_100147306
1012 Ga0068856_100153220
1013 Ga0068856_100972740
1014 Ga0068852_100054276
1015 Ga0068852_100191442
1016 Ga0068852_100654136
1017 Ga0068852_100800687
1018 Ga0068852_100932715
1019 Ga0068852_102180536
1020 Ga0068852_102310842
1021 Ga0068859_100007546
1022 Ga0068859_100072492
1023 Ga0068859_100250176
1024 Ga0068864_100000762
1025 Ga0068864_100012169
1026 Ga0068864_100015925
1027 Ga0068864_100071387
1028 Ga0068864_100073228
1029 Ga0068864_100223243
1030 Ga0068866_10081729
1031 Ga0068866_10450834
1032 Ga0068851_10034100
1033 Ga0068851_10041102
1034 Ga0068851_10153118
1035 Ga0068851_10382654
1036 Ga0068851_10924002
1037 Ga0068870_10078675
1038 Ga0068863_100003982
1039 Ga0068863_100014914
1040 Ga0068863_100016970
1041 Ga0068863_100125548
1042 Ga0068858_100006075
1043 Ga0068858_100122467
1044 Ga0068858_100159955
1045 Ga0068858_101054480
1046 Ga0068860_100032301
1047 Ga0068860_100364486
1048 Ga0068860_100468633
1049 Ga0068860_101478039
1050 Ga0081539_10023064
1051 Ga0070717_10011680
1052 Ga0097621_100006176
1053 Ga0097621_100034337
1054 Ga0097621_100920613
1055 Ga0097621_101047730
1056 Ga0097621_101056162
1057 Ga0068871_100011670
1058 Ga0068871_100085222
1059 Ga0068871_100310744
1060 Ga0068871_101128386
1061 Ga0068871_102239225
1062 Ga0068865_100009654
1063 Ga0068865_100097584
1064 Ga0068865_100904662
1065 Ga0097620_100007546
1066 Ga0097620_100072492
1067 Ga0097620_100250174
1068 Ga0105240_10413628
1069 Ga0105240_10522919
1070 Ga0105245_10067017
1071 Ga0105245_10237470
1072 Ga0105247_10221791
1073 Ga0105243_10756671
1074 Ga0105243_10769343
1075 Ga0105241_10106961
1076 Ga0105241_10545874
1077 Ga0105242_10033397
1078 Ga0105242_12284208
1079 Ga0105248_10001027
1080 Ga0105248_10009567
1081 Ga0105248_10017489
1082 Ga0105248_10037130
1083 Ga0105248_10085199
1084 Ga0105248_10114737
1085 Ga0105248_10154585
1086 Ga0105248_10155133
1087 Ga0105248_10792241
1088 Ga0105248_11352753
1089 Ga0105248_11727401
1090 Ga0105248_12422077
1091 Ga0105248_13257025
1092 Ga0105238_10045147
1093 Ga0105238_10260651
1094 Ga0105238_11673472
1095 Ga0105239_10174679
1096 Ga0105239_11176724
1097 Ga0105239_12820013
1098 Ga0105246_10338850
1099 Ga0105246_10514141
1100 Ga0157316_1024886
1101 Ga0157373_10009302
1102 Ga0157373_10068081
1103 Ga0157373_10086316
1104 Ga0157373_10275767
1105 Ga0157373_10381439
1106 Ga0157373_10565683
1107 Ga0157373_10746543
1108 Ga0157373_11488745
1109 Ga0157371_10115904
1110 Ga0157371_10134183
1111 Ga0157371_10221867
1112 Ga0157371_10226984
1113 Ga0157371_10669415
1114 Ga0157371_11554183
1115 Ga0157370_10419208
1116 Ga0157370_10465799
1117 Ga0157369_10053369
1118 Ga0157369_10174116
1119 Ga0157369_10185961
1120 Ga0157369_10466948
1121 Ga0157374_10001518
1122 Ga0157374_10058066
1123 Ga0157374_10081735
1124 Ga0157374_10223959
1125 Ga0157374_11413524
1126 Ga0157374_12062999
1127 Ga0157378_10030119
1128 Ga0157378_10130048
1129 Ga0157378_10191299
1130 Ga0157378_11345752
1131 Ga0157378_12233279
1132 Ga0163162_10001258
1133 Ga0163162_10081870
1134 Ga0163162_10202040
1135 Ga0163162_11168116
1136 Ga0157372_10456135
1137 Ga0157372_10775150
1138 Ga0157375_10003827
1139 Ga0157375_10742558
1140 Ga0163163_10006707
1141 Ga0163163_10306128
1142 Ga0163163_10492644
1143 Ga0157380_10483604
1144 Ga0182008_10242926
1145 Ga0157377_10142079
1146 Ga0157377_11203997
1147 Ga0157379_10107013
1148 Ga0157379_10359795
1149 Ga0157379_10981041
1150 Ga0157376_10062632
1151 Ga0207697_10031490
1152 Ga0207697_10153218
1153 Ga0207656_10006838
1154 Ga0207656_10071057
1155 Ga0207656_10084242
1156 Ga0207656_10172665
1157 Ga0207656_10603121
1158 Ga0207682_10172897
1159 Ga0207642_10017153
1160 Ga0207642_10053112
1161 Ga0207688_10026033
1162 Ga0207688_10035245
1163 Ga0207688_10115831
1164 Ga0207688_10382560
1165 Ga0207680_10032699
1166 Ga0207680_10033837
1167 Ga0207680_10112449
1168 Ga0207680_10324086
1169 Ga0207680_10359736
1170 Ga0207680_10639005
1171 Ga0207647_10019517
1172 Ga0207647_10051970
1173 Ga0207647_10231827
1174 Ga0207645_10030197
1175 Ga0207645_10064735
1176 Ga0207645_10510742
1177 Ga0207705_10002166
1178 Ga0207705_10006319
1179 Ga0207705_10019265
1180 Ga0207705_10051535
1181 Ga0207705_10084802
1182 Ga0207705_10266332
1183 Ga0207705_10542189
1184 Ga0207705_10657111
1185 Ga0207705_11154540
1186 Ga0207705_11203690
1187 Ga0207707_10438324
1188 Ga0207707_10565325
1189 Ga0207695_10984817
1190 Ga0207660_10736381
1191 Ga0207660_10814238
1192 Ga0207662_10013143
1193 Ga0207657_10001850
1194 Ga0207657_10005123
1195 Ga0207657_10020568
1196 Ga0207657_10022060
1197 Ga0207657_10037836
1198 Ga0207657_10205201
1199 Ga0207657_10219084
1200 Ga0207657_10456326
1201 Ga0207657_10701516
1202 Ga0207649_10028261
1203 Ga0207649_10042359
1204 Ga0207649_10100008
1205 Ga0207649_10150319
1206 Ga0207649_10183084
1207 Ga0207649_10298995
1208 Ga0207649_10347287
1209 Ga0207649_10439613
1210 Ga0207649_10830241
1211 Ga0207649_10959124
1212 Ga0207652_10099039
1213 Ga0207652_10167013
1214 Ga0207652_11194631
1215 Ga0207652_11809834
1216 Ga0207694_10181558
1217 Ga0207694_10232064
1218 Ga0207650_10005712
1219 Ga0207650_10024647
1220 Ga0207650_10256122
1221 Ga0207650_10281002
1222 Ga0207659_10013467
1223 Ga0207659_10494667
1224 Ga0207659_11145035
1225 Ga0207687_10079172
1226 Ga0207687_10117697
1227 Ga0207700_10243673
1228 Ga0207664_10151615
1229 Ga0207644_10000848
1230 Ga0207644_10000938
1231 Ga0207644_10009900
1232 Ga0207644_10057221
1233 Ga0207644_10092064
1234 Ga0207644_10180406
1235 Ga0207644_10219793
1236 Ga0207644_10305238
1237 Ga0207644_10361448
1238 Ga0207644_10685196
1239 Ga0207690_10052405
1240 Ga0207690_10138150
1241 Ga0207690_10161622
1242 Ga0207690_10267272
1243 Ga0207690_10408248
1244 Ga0207690_10590529
1245 Ga0207690_11842302
1246 Ga0207706_10003663
1247 Ga0207706_10004030
1248 Ga0207706_10012803
1249 Ga0207706_10060848
1250 Ga0207706_10070303
1251 Ga0207706_10183469
1252 Ga0207706_10212131
1253 Ga0207706_10282255
1254 Ga0207706_10337796
1255 Ga0207706_10387009
1256 Ga0207706_10435653
1257 Ga0207706_10748187
1258 Ga0207706_10960769
1259 Ga0207706_11369251
1260 Ga0207686_10196876
1261 Ga0207686_10681407
1262 Ga0207709_10253927
1263 Ga0207709_10612554
1264 Ga0207669_10083348
1265 Ga0207669_10141327
1266 Ga0207669_10302360
1267 Ga0207704_10110471
1268 Ga0207704_10332431
1269 Ga0207704_11498842
1270 Ga0207665_10029535
1271 Ga0207691_10004144
1272 Ga0207691_10017581
1273 Ga0207691_10072679
1274 Ga0207691_10140435
1275 Ga0207711_10003705
1276 Ga0207711_10004689
1277 Ga0207711_10005802
1278 Ga0207711_10012920
1279 Ga0207711_10023896
1280 Ga0207711_10026517
1281 Ga0207711_10063537
1282 Ga0207711_10094042
1283 Ga0207711_10115522
1284 Ga0207711_10187594
1285 Ga0207711_10722162
1286 Ga0207711_11747315
1287 Ga0207689_10017816
1288 Ga0207689_10186790
1289 Ga0207689_10666655
1290 Ga0207661_10247610
1291 Ga0207661_10979865
1292 Ga0207679_10003202
1293 Ga0207679_10065725
1294 Ga0207679_10075110
1295 Ga0207679_10102560
1296 Ga0207679_10111685
1297 Ga0207679_10132006
1298 Ga0207679_10237980
1299 Ga0207679_10323897
1300 Ga0207679_10345607
1301 Ga0207679_10525577
1302 Ga0207667_10567816
1303 Ga0207651_10007789
1304 Ga0207651_10086123
1305 Ga0207651_10087537
1306 Ga0207651_10184694
1307 Ga0207651_11627163
1308 Ga0207668_11656123
1309 Ga0207640_10005925
1310 Ga0207640_10314579
1311 Ga0207640_10405084
1312 Ga0207640_10966141
1313 Ga0207640_12141493
1314 Ga0207658_10005418
1315 Ga0207658_10046791
1316 Ga0207658_10259823
1317 Ga0207658_10450233
1318 Ga0207658_10962953
1319 Ga0207658_12079431
1320 Ga0207677_10022022
1321 Ga0207677_10153142
1322 Ga0207677_10206695
1323 Ga0207677_10659780
1324 Ga0207677_10762026
1325 Ga0207677_11206574
1326 Ga0207703_10019185
1327 Ga0207703_10019739
1328 Ga0207703_10466543
1329 Ga0207703_10696792
1330 Ga0207703_10919795
1331 Ga0207639_10195850
1332 Ga0207639_10493038
1333 Ga0207639_10847536
1334 Ga0207639_11223025
1335 Ga0207678_10033638
1336 Ga0207678_10034643
1337 Ga0207678_10063379
1338 Ga0207678_10106927
1339 Ga0207678_10110989
1340 Ga0207678_10143345
1341 Ga0207678_10677391
1342 Ga0207678_10689511
1343 Ga0207708_10394560
1344 Ga0207702_10268631
1345 Ga0207702_10271262
1346 Ga0207702_10980692
1347 Ga0207641_10002878
1348 Ga0207641_10004593
1349 Ga0207641_10028895
1350 Ga0207641_10956469
1351 Ga0207641_11139222
1352 Ga0207648_10013810
1353 Ga0207648_10032611
1354 Ga0207648_10070124
1355 Ga0207648_10379766
1356 Ga0207676_10001750
1357 Ga0207676_10006168
1358 Ga0207676_10035627
1359 Ga0207676_10037116
1360 Ga0207676_10378523
1361 Ga0207674_10006081
1362 Ga0207674_10874747
1363 Ga0207683_10000430
1364 Ga0207683_10010964
1365 Ga0207683_10057144
1366 Ga0207683_10120262
1367 Ga0207698_10167553
1368 Ga0207698_10192069
1369 Ga0207698_10272877
1370 Ga0207698_10275932
1371 Ga0207698_10304985
1372 Ga0207698_10457913
1373 Ga0207698_11128598
1374 Ga0268266_10238941
1375 Ga0268266_10272579
1376 Ga0268265_12713334
1377 Ga0268264_10158928
1378 Ga0268264_10191891
1379 Ga0307408_100099816
1380 Ga0307408_100256637
1381 Ga0307405_10863850
1382 Ga0307413_10021430
1383 Ga0307406_10002502
1384 Ga0307407_10527398
1385 Ga0307412_10702681
1386 Ga0307412_10941667
1387 Ga0307409_100009254
1388 Ga0307409_100614194
1389 Ga0307416_100069213
1390 Ga0307416_100670211
1391 Ga0307414_10026075
1392 Ga0307411_11136772
1393 Ga0307411_12035806
1394 Ga0307415_100058123
1395 Ga0307415_100093999
1396 Ga0373950_0099236
1397 Ga0373959_0068164
1398 Ga0373959_0145266
1399 Ga0373929_0133679
1400 Ga0373944_0159831
1401 Ga0373936_0164730
1402 Ga0373941_0011968
1403 Ga0373941_0057495
1404 Ga0373960_0032219
1405 Ga0373943_0001126
1406 Ga0373946_0032471
1407 Ga0373955_0400508
1408 Ga0373942_0117453
1409 Ga0373961_0137823
1410 Ga0373962_0152355
1411 Ga0373931_0033707
1412 Ga0373935_0095809
1413 Ga0373947_0113118
1414 Ga0395899_0018627
1415 Ga0395899_0037269
1416 Ga0395899_0101401
1417 Ga0395899_0137570
1418 Ga0395899_0140364
1419 Ga0395899_0613565
1420 Ga0395899_0777879
1421 Ga0395899_0796434
1422 Ga0395899_0801146
1423 Ga0395899_0861445
1424 Ga0395900_0084927
1425 Ga0395900_0092252
1426 Ga0395900_0287985
1427 Ga0395900_0395850
1428 Ga0395900_0495553
1429 Ga0395900_0694209
1430 Ga0395900_1604623
1431 Ga0395900_1862788
1432 Ga0395898_0067388
1433 Ga0395898_0192238
1434 Ga0395898_0229110
1435 Ga0395898_0430900
1436 Ga0395898_1300496
1437 Ga0395905_0017852
1438 Ga0395905_0018669
1439 Ga0395905_0029032
1440 Ga0395905_0155824
1441 Ga0395905_0208751
1442 Ga0395905_0212635
1443 Ga0395905_0315813
1444 Ga0395905_0360445
1445 Ga0395905_0524005
1446 Ga0395905_1878652
1447 Ga0395901_0023532
1448 Ga0395901_0030677
1449 Ga0395901_0038512
1450 Ga0395901_0089376
1451 Ga0395901_0103414
1452 Ga0395901_0117913
1453 Ga0395901_0161558
1454 Ga0395901_0173834
1455 Ga0395901_0245569
1456 Ga0395901_0339313
1457 Ga0395901_0472182
1458 Ga0395901_0498096
1459 Ga0395901_0507960
1460 Ga0395901_0697138
1461 Ga0395901_0842171
1462 Ga0395901_1861077
1463 Ga0395901_2092634
1464 Ga0439465_0033656
1465 Ga0439448_0026065
1466 Ga0439432_038327
1467 Ga0439455_0006912
1468 Ga0450889_048522
1469 Ga0439458_0001603
1470 Ga0439458_0003722
1471 Ga0439458_0080085
1472 Ga0466969_0136636
1473 Ga0466972_0057781
1474 Ga0466972_0522888
1475 Ga0466965_0020656
1476 Ga0466965_0179123
1477 Ga0466966_0053512
1478 Ga0466966_0256362
1479 Ga0466966_0400648
1480 Ga0466966_0774522
1481 Ga0466961_0002424
1482 Ga0466961_0054112
1483 Ga0466961_0057741
1484 Ga0466961_0600746
1485 Ga0466963_0008434
1486 Ga0466963_0020936
1487 Ga0466963_0026648
1488 Ga0466963_0224460
1489 Ga0466963_0784093
1490 Ga0466963_1221190
1491 Ga0466964_0022839
1492 Ga0466964_0028142
1493 Ga0466964_0549190
1494 Ga0466971_0020132
1495 Ga0466971_0133991
1496 Ga0466971_0184107
1497 Ga0466968_0007245
1498 Ga0466968_0652840
1499 Ga0466970_0002020
1500 Ga0466970_0075999
1501 Ga0466970_0098286
1502 Ga0466970_0216502
1503 Ga0466957_0003787
1504 Ga0466957_0058478
1505 Ga0466957_0636889
1506 Ga0466957_1077022
1507 Ga0466960_0009969
1508 Ga0466960_0653072
1509 Ga0466959_0007303
1510 Ga0466959_0416340
1511 Ga0466959_0573013
1512 Ga0466958_0001810
1513 Ga0466958_0003603
1514 Ga0466958_0034135
1515 Ga0466958_0102009
1516 Ga0466958_0194013
1517 Ga0466967_0101269
1518 Ga0466967_0116659
1519 Ga0466967_0138212
1520 Ga0466967_0200139
1521 Ga0466967_0454524
1522 Ga0466967_0570302
1523 Ga0466967_0648095
1524 Ga0466967_1990572
1525 Ga0495663_0027813
1526 Ga0495663_0146821
1527 Ga0495663_0305340
1528 Ga0495642_0112462
1529 Ga0495665_0187806
1530 Ga0495621_0011931
1531 Ga0495669_0002034
1532 Ga0495669_0121819
1533 Ga0495669_0124790
1534 Ga0495669_0495300
1535 Ga0495677_0001481
1536 Ga0495677_0233600
1537 Ga0496100_0040773
1538 Ga0496100_0166071
1539 Ga0496100_0466474
1540 Ga0496101_0008901
1541 Ga0496101_0052491
1542 Ga0496101_0087243
1543 Ga0496101_0638350
1544 Ga0496101_1200558
1545 Ga0496102_0123041
1546 Ga0496102_0223370
1547 Ga0496102_0223512
1548 Ga0496102_0339941
1549 Ga0496102_0464954
1550 Ga0496102_0837192
1551 Ga0496103_0087862
1552 Ga0496103_0277198
1553 Ga0496103_0434258
1554 Ga0496103_0534661
1555 Ga0496104_0082383
1556 Ga0496104_0323881
1557 Ga0496105_0053259
1558 Ga0496105_0300224
1559 Ga0496106_0052906
1560 Ga0496106_0109276
1561 Ga0496107_0048439
1562 Ga0496107_0134806
1563 Ga0496107_0194232
1564 Ga0496107_0366420
1565 Ga0496107_0438222
1566 Ga0496107_0534483
1567 Ga0496107_1203806
1568 Ga0496108_0003999
1569 Ga0496108_0004815
1570 Ga0496108_0012774
1571 Ga0496108_0028436
1572 Ga0496108_1593859
1573 Ga0496109_0002175
1574 Ga0496109_0056382
1575 Ga0496109_0092747
1576 Ga0496109_0168282
1577 Ga0496109_0199178
1578 Ga0496109_0218023
1579 Ga0496109_1127352
1580 Ga0496110_0001640
1581 Ga0496110_0060457
1582 Ga0496110_0094262
1583 Ga0496110_0101355
1584 Ga0496111_0000805
1585 Ga0496111_0030717
1586 Ga0496111_0077921
1587 Ga0496111_0320221
1588 Ga0496112_0004603
1589 Ga0496112_0004651
1590 Ga0496112_0042818
1591 Ga0496112_0058029
1592 Ga0496112_0094659
1593 Ga0496112_0119506
1594 Ga0496112_1497523
1595 Ga0496113_0002011
1596 Ga0496113_0024774
1597 Ga0496113_0028088
1598 Ga0496113_0151514
1599 Ga0496113_1351034
1600 Ga0496114_0056519
1601 Ga0496114_0457165
1602 Ga0496114_1053901
1603 Ga0496115_0001561
1604 Ga0501067_0150546
1605 Ga0501069_0203296
1606 Ga0501069_0253373
1607 Ga0501206_007019
1608 Ga0501207_080043
1609 Ga0501216_025903
1610 Ga0501217_047573
1611 Ga0501223_020359
1612 Ga0501227_064470
1613 Ga0501230_064761
1614 Ga0501233_028581
1615 Ga0501239_023053
1616 Ga0501249_139910
1617 Ga0501252_040203
1618 Ga0501258_001599
1619 Ga0501221_010418
1620 Ga0501225_0066080
1621 Ga0501234_013934
1622 Ga0501245_067155
1623 Ga0501268_002058
1624 Ga0501270_044132
1625 Ga0501272_005974
1626 Ga0501273_001673
1627 Ga0501212_022674
1628 Ga0466962_0006842
1629 Ga0466962_0107472
1630 Ga0466962_0235123
1631 Ga0466962_0477306
1632 Ga0466962_0496130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map