F482038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 594 | 516 | 211 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016522445|8016529994 |
| Length | 233 |
| Sequence | LINLIIQATGESLYMVGLAALIGTVIGLPLGVFLATSRKGELFAAPVVNRVLGIVVNATRSTPFIILVVAIIPFTRLVAGTSIGSTAAIVPLTIASAPFIARLVEAAIREVDGGLIETASSFGASPIQIVLKVLIPEALPGLLLALTLAVVSLLGYSAMVGAVGGGGLGDLGIRYGYQRFMPEMMLAVVVVLIALVQLVQSAGDYLARRGQPPAAASLTSVGGGPHIGYLMWF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 5 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 8 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 11 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 20 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 21 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 22 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 23 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 24 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 25 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 26 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 27 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 28 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 29 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 30 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 31 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 32 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 33 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 34 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 35 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 36 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 37 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 38 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 39 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 40 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 41 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 42 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 43 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 44 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 45 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 46 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 47 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 48 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 49 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 50 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 51 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 52 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 53 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 54 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 55 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 56 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 57 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 58 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 59 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 60 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 61 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 62 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 63 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 64 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 65 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 66 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 67 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 68 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 69 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 70 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 71 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 72 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 73 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 74 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 75 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 76 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 77 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 78 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 79 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 80 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 81 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 82 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 83 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 84 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 85 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 86 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 87 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 88 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 89 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 90 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 91 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 92 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 93 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 94 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 95 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 96 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 97 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 98 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 99 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 100 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 101 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 102 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 103 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 104 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 105 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 106 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 107 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 108 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 109 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 110 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 111 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 112 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 113 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 114 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 115 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 116 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 117 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 118 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 119 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 120 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 121 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 122 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 123 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 124 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 125 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 126 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 127 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 128 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 129 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 130 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 131 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 132 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 133 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 134 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 135 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 136 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 137 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 138 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 139 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 140 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 141 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 142 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 143 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 144 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 145 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 146 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 147 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 148 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 149 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 150 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 151 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 152 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 153 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 154 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 155 | 2904699407 | |||
| 156 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 157 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 158 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 159 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 160 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 161 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 162 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 163 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 164 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 165 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 166 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 167 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 168 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 169 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 170 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 171 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 172 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 173 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 174 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 175 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 176 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 177 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 178 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 179 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 180 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 181 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 182 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 183 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 184 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 185 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 186 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 187 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 188 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 189 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 190 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 191 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 192 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 193 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 194 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 195 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 196 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 197 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 198 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 199 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 200 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 201 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 202 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 203 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 204 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 205 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 206 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 207 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 208 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 209 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 210 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 211 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 212 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 213 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 214 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 215 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 216 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 217 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 218 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 219 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 220 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 221 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 222 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 223 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 224 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 225 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 226 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 227 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 228 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 229 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 230 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 231 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 232 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 233 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 234 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 235 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 236 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 237 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 238 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 239 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 240 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 241 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 242 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 243 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 244 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 245 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 246 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 247 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 248 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 249 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 250 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 251 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 252 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 253 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 254 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 255 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 256 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 257 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 258 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 259 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 260 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 261 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 262 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 263 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 264 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 265 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 266 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 267 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 268 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 269 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 270 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 274 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 276 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 281 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 282 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 284 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 288 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 289 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 291 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 293 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 294 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 295 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 296 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 297 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 298 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 299 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 300 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 301 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 302 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 303 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 304 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 305 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 306 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 307 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 308 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 309 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 310 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 311 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 328 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 329 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 331 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 332 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 333 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 334 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 335 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 336 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 337 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 345 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 348 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 387 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 389 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 390 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 391 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 393 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 394 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 395 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 396 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 397 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 398 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 399 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 400 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 401 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 402 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 403 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 404 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 405 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 406 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 407 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 408 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 409 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 410 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 411 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 412 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 413 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 414 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 415 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 416 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 417 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 418 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 419 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 420 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 421 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 422 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 423 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 424 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 425 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 426 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 427 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 428 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 429 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 430 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 431 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 432 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 433 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 477 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 478 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 479 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 480 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 481 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 482 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 483 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 484 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 485 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 486 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 487 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 488 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 489 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 490 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 491 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 492 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 493 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 494 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 495 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 496 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 497 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 498 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 499 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 507 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 508 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 509 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 510 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 511 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 512 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 513 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 519 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 520 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 522 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 523 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 524 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 525 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 526 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 528 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 529 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 530 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 531 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 532 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 533 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 535 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 536 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 537 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 539 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 540 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 541 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 542 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 543 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 544 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 545 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 546 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 547 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 548 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 549 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 550 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 551 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 552 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 553 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 554 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 555 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 556 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 557 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 558 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 559 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 560 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 561 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 562 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 563 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 564 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 565 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 566 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 567 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 568 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 569 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 570 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 571 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 572 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 573 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 574 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 575 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 576 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 577 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 578 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 579 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 580 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 581 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 582 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 583 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 584 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 585 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 586 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 587 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 588 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 589 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 590 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 591 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 592 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 593 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 594 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.39 |
| Metatranscriptomes | 0 |
| Isolates | 36.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.61 |
| Bulb | 0 |
| Endosphere | 18.53 |
| Nodule | 21.96 |
| Rhizoplane | 4.17 |
| Rhizosphere | 30.43 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 24.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10110358 | 3300001989 | Bacteria | 826 |
| 2 | JGI24735J21928_10007393 | 3300002067 | Bacteria | 3585 |
| 3 | JGI25159J45721_1022004 | 3300002987 | Bacteria | 1188 |
| 4 | JGI25151J46595_10000251 | 3300003187 | Bacteria | 62870 |
| 5 | JGI25153J46596_10000430 | 3300003215 | Bacteria | 27183 |
| 6 | JGI25153J46596_10000458 | 3300003215 | Bacteria | 26109 |
| 7 | JGI25153J46596_10001248 | 3300003215 | Bacteria | 15329 |
| 8 | rootH2_10007114 | 3300003320 | Bacteria | 1970 |
| 9 | JGI25160J50197_1002571 | 3300003354 | Bacteria | 8390 |
| 10 | JGI25160J50197_1005261 | 3300003354 | Bacteria | 5416 |
| 11 | Ga0055539_1023632 | 3300003752 | Bacteria | 722 |
| 12 | Ga0058692_1001437 | 3300003856 | Bacteria | 8765 |
| 13 | Ga0055543_1013739 | 3300004625 | Bacteria | 1594 |
| 14 | Ga0065165_1002812 | 3300005262 | Bacteria | 13640 |
| 15 | Ga0065165_1003726 | 3300005262 | Bacteria | 10283 |
| 16 | Ga0065165_1030670 | 3300005262 | Bacteria | 1708 |
| 17 | Ga0065704_10002985 | 3300005289 | Bacteria | 4467 |
| 18 | Ga0070658_10318671 | 3300005327 | Bacteria | 1327 |
| 19 | Ga0070676_10312963 | 3300005328 | Bacteria | 1068 |
| 20 | Ga0070670_100656901 | 3300005331 | Bacteria | 941 |
| 21 | Ga0068869_100738779 | 3300005334 | Bacteria | 842 |
| 22 | Ga0070666_10080081 | 3300005335 | Bacteria | 2232 |
| 23 | Ga0070682_100057836 | 3300005337 | Bacteria | 2444 |
| 24 | Ga0070668_100014846 | 3300005347 | Bacteria | 5822 |
| 25 | Ga0070668_100109611 | 3300005347 | Bacteria | 2196 |
| 26 | Ga0070671_100742566 | 3300005355 | Bacteria | 853 |
| 27 | Ga0070674_100006548 | 3300005356 | Bacteria | 6805 |
| 28 | Ga0070667_100256167 | 3300005367 | Bacteria | 1565 |
| 29 | Ga0070713_100135697 | 3300005436 | Bacteria | 2174 |
| 30 | Ga0070710_10025600 | 3300005437 | Bacteria | 3126 |
| 31 | Ga0070711_100052664 | 3300005439 | Bacteria | 2801 |
| 32 | Ga0070700_100884539 | 3300005441 | Bacteria | 726 |
| 33 | Ga0070663_100145395 | 3300005455 | Bacteria | 1814 |
| 34 | Ga0070663_100281377 | 3300005455 | Bacteria | 1326 |
| 35 | Ga0070663_100451192 | 3300005455 | Bacteria | 1060 |
| 36 | Ga0070678_100161945 | 3300005456 | Bacteria | 1814 |
| 37 | Ga0070662_100238073 | 3300005457 | Bacteria | 1459 |
| 38 | Ga0070662_100265189 | 3300005457 | Bacteria | 1385 |
| 39 | Ga0068867_100214158 | 3300005459 | Bacteria | 1549 |
| 40 | Ga0068853_100044460 | 3300005539 | Bacteria | 3802 |
| 41 | Ga0070672_100306129 | 3300005543 | Bacteria | 1348 |
| 42 | Ga0070686_100406554 | 3300005544 | Bacteria | 1037 |
| 43 | Ga0070665_100019592 | 3300005548 | Bacteria | 6792 |
| 44 | Ga0070665_100211010 | 3300005548 | Bacteria | 1942 |
| 45 | Ga0070665_100236991 | 3300005548 | Bacteria | 1825 |
| 46 | Ga0070665_100503361 | 3300005548 | Bacteria | 1222 |
| 47 | Ga0068857_100523593 | 3300005577 | Bacteria | 1114 |
| 48 | Ga0068854_100672897 | 3300005578 | Bacteria | 891 |
| 49 | Ga0068856_100146435 | 3300005614 | Bacteria | 2369 |
| 50 | Ga0068852_100003079 | 3300005616 | Bacteria | 11608 |
| 51 | Ga0068852_100054851 | 3300005616 | Bacteria | 3437 |
| 52 | Ga0068866_10029830 | 3300005718 | Bacteria | 2612 |
| 53 | Ga0068866_10275015 | 3300005718 | Bacteria | 1041 |
| 54 | Ga0068861_100471423 | 3300005719 | Bacteria | 1129 |
| 55 | Ga0081540_1030153 | 3300005983 | Bacteria | 3009 |
| 56 | Ga0081540_1053749 | 3300005983 | Bacteria | 1972 |
| 57 | Ga0075365_10054337 | 3300006038 | Bacteria | 2655 |
| 58 | Ga0075365_10178292 | 3300006038 | Bacteria | 1485 |
| 59 | Ga0075365_10254087 | 3300006038 | Bacteria | 1235 |
| 60 | Ga0075368_10013851 | 3300006042 | Bacteria | 2967 |
| 61 | Ga0075363_100016148 | 3300006048 | Bacteria | 3683 |
| 62 | Ga0075363_100135627 | 3300006048 | Bacteria | 1383 |
| 63 | Ga0075364_10071264 | 3300006051 | Bacteria | 2289 |
| 64 | Ga0075364_10078515 | 3300006051 | Bacteria | 2180 |
| 65 | Ga0075364_10137803 | 3300006051 | Bacteria | 1640 |
| 66 | Ga0070716_100056422 | 3300006173 | Bacteria | 2252 |
| 67 | Ga0075362_10068801 | 3300006177 | Bacteria | 1613 |
| 68 | Ga0075367_10070888 | 3300006178 | Bacteria | 2096 |
| 69 | Ga0075367_10129362 | 3300006178 | Bacteria | 1560 |
| 70 | Ga0075369_10016015 | 3300006186 | Bacteria | 3018 |
| 71 | Ga0075369_10056855 | 3300006186 | Bacteria | 1701 |
| 72 | Ga0075366_10064496 | 3300006195 | Bacteria | 2178 |
| 73 | Ga0075366_10081027 | 3300006195 | Bacteria | 1938 |
| 74 | Ga0075370_10041412 | 3300006353 | Bacteria | 2600 |
| 75 | Ga0075370_10069609 | 3300006353 | Bacteria | 2011 |
| 76 | Ga0075370_10318076 | 3300006353 | Bacteria | 927 |
| 77 | Ga0099824_1018757 | 3300006942 | Bacteria | 5585 |
| 78 | Ga0099826_10003152 | 3300006948 | Bacteria | 11065 |
| 79 | Ga0099826_10196678 | 3300006948 | Bacteria | 1107 |
| 80 | Ga0105240_10007593 | 3300009093 | Bacteria | 15706 |
| 81 | Ga0105245_10304197 | 3300009098 | Bacteria | 1565 |
| 82 | Ga0105247_10310510 | 3300009101 | Bacteria | 1097 |
| 83 | Ga0105243_10782078 | 3300009148 | Bacteria | 939 |
| 84 | Ga0105241_10175003 | 3300009174 | Bacteria | 1775 |
| 85 | Ga0105241_10402188 | 3300009174 | Bacteria | 1201 |
| 86 | Ga0105242_10243892 | 3300009176 | Bacteria | 1616 |
| 87 | Ga0105242_10683080 | 3300009176 | Bacteria | 1002 |
| 88 | Ga0105248_10291812 | 3300009177 | Bacteria | 1836 |
| 89 | Ga0105237_10001252 | 3300009545 | Bacteria | 33910 |
| 90 | Ga0105237_10482024 | 3300009545 | Bacteria | 1247 |
| 91 | Ga0105237_10771984 | 3300009545 | Bacteria | 968 |
| 92 | Ga0105238_10152325 | 3300009551 | Bacteria | 2287 |
| 93 | Ga0105239_10580168 | 3300010375 | Bacteria | 1278 |
| 94 | Ga0105246_10128951 | 3300011119 | Bacteria | 1886 |
| 95 | Ga0157370_10240313 | 3300013104 | Bacteria | 1676 |
| 96 | Ga0157369_10081684 | 3300013105 | Bacteria | 3459 |
| 97 | Ga0157375_10227560 | 3300013308 | Bacteria | 2024 |
| 98 | Ga0163163_10220165 | 3300014325 | Bacteria | 1947 |
| 99 | Ga0157380_10461719 | 3300014326 | Bacteria | 1222 |
| 100 | Ga0182007_10140073 | 3300015262 | Bacteria | 818 |
| 101 | Ga0183361_10039 | 3300016635 | Bacteria | 25237 |
| 102 | Ga0163161_10012756 | 3300017792 | Bacteria | 5837 |
| 103 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 104 | Ga0214542_1000153 | 3300021321 | Bacteria | 101854 |
| 105 | Ga0214545_1000018 | 3300021324 | Bacteria | 172019 |
| 106 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 107 | Ga0213876_10214675 | 3300021384 | Bacteria | 1023 |
| 108 | Ga0213875_10174109 | 3300021388 | Bacteria | 1011 |
| 109 | Ga0207425_1028214 | 3300025245 | Bacteria | 1140 |
| 110 | Ga0209677_101840 | 3300025253 | Bacteria | 8640 |
| 111 | Ga0209148_1000274 | 3300025254 | Bacteria | 81201 |
| 112 | Ga0209233_1006973 | 3300025261 | Bacteria | 3608 |
| 113 | Ga0209455_1002505 | 3300025272 | Bacteria | 7054 |
| 114 | Ga0209130_1003833 | 3300025284 | Bacteria | 6080 |
| 115 | Ga0209676_1000214 | 3300025292 | Bacteria | 127818 |
| 116 | Ga0209025_1000478 | 3300025294 | Bacteria | 77516 |
| 117 | Ga0209025_1000622 | 3300025294 | Bacteria | 62938 |
| 118 | Ga0209564_1001354 | 3300025295 | Bacteria | 25872 |
| 119 | Ga0209564_1004180 | 3300025295 | Bacteria | 9012 |
| 120 | Ga0209564_1033313 | 3300025295 | Bacteria | 1534 |
| 121 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 122 | Ga0209758_1000211 | 3300025297 | Bacteria | 127721 |
| 123 | Ga0209758_1002374 | 3300025297 | Bacteria | 19373 |
| 124 | Ga0209758_1004266 | 3300025297 | Bacteria | 12075 |
| 125 | Ga0209758_1007536 | 3300025297 | Bacteria | 7365 |
| 126 | Ga0209758_1015829 | 3300025297 | Bacteria | 3875 |
| 127 | Ga0209758_1023139 | 3300025297 | Bacteria | 2820 |
| 128 | Ga0209050_1022914 | 3300025298 | Bacteria | 2219 |
| 129 | Ga0209256_1004128 | 3300025299 | Bacteria | 9395 |
| 130 | Ga0209256_1047672 | 3300025299 | Bacteria | 1053 |
| 131 | Ga0207426_1000085 | 3300025302 | Bacteria | 293171 |
| 132 | Ga0207426_1000143 | 3300025302 | Bacteria | 192948 |
| 133 | Ga0207426_1000687 | 3300025302 | Bacteria | 40682 |
| 134 | Ga0207426_1018646 | 3300025302 | Bacteria | 2441 |
| 135 | Ga0209257_1000883 | 3300025304 | Bacteria | 42345 |
| 136 | Ga0209257_1028788 | 3300025304 | Bacteria | 1823 |
| 137 | Ga0209257_1032587 | 3300025304 | Bacteria | 1650 |
| 138 | Ga0207692_10120042 | 3300025898 | Bacteria | 1471 |
| 139 | Ga0207642_10033767 | 3300025899 | Bacteria | 2168 |
| 140 | Ga0207688_10072635 | 3300025901 | Bacteria | 1955 |
| 141 | Ga0207680_10402174 | 3300025903 | Bacteria | 968 |
| 142 | Ga0207647_10048671 | 3300025904 | Bacteria | 2632 |
| 143 | Ga0207647_10093465 | 3300025904 | Bacteria | 1792 |
| 144 | Ga0207647_10306704 | 3300025904 | Bacteria | 903 |
| 145 | Ga0207685_10082736 | 3300025905 | Bacteria | 1332 |
| 146 | Ga0207699_10043945 | 3300025906 | Bacteria | 2599 |
| 147 | Ga0207705_10228043 | 3300025909 | Bacteria | 1416 |
| 148 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 149 | Ga0207671_10007054 | 3300025914 | Bacteria | 9837 |
| 150 | Ga0207671_10169184 | 3300025914 | Bacteria | 1696 |
| 151 | Ga0207671_10294054 | 3300025914 | Bacteria | 1283 |
| 152 | Ga0207693_10008703 | 3300025915 | Bacteria | 8298 |
| 153 | Ga0207663_10182945 | 3300025916 | Bacteria | 1498 |
| 154 | Ga0207657_10131973 | 3300025919 | Bacteria | 2047 |
| 155 | Ga0207687_10063458 | 3300025927 | Bacteria | 2615 |
| 156 | Ga0207687_10213064 | 3300025927 | Bacteria | 1517 |
| 157 | Ga0207644_10486928 | 3300025931 | Bacteria | 1016 |
| 158 | Ga0207706_10127998 | 3300025933 | Bacteria | 2233 |
| 159 | Ga0207706_10261167 | 3300025933 | Bacteria | 1512 |
| 160 | Ga0207706_10952648 | 3300025933 | Bacteria | 723 |
| 161 | Ga0207709_10091806 | 3300025935 | Bacteria | 1986 |
| 162 | Ga0207670_10738755 | 3300025936 | Bacteria | 817 |
| 163 | Ga0207669_10001575 | 3300025937 | Bacteria | 9733 |
| 164 | Ga0207665_10094343 | 3300025939 | Bacteria | 2078 |
| 165 | Ga0207691_10476595 | 3300025940 | Bacteria | 1061 |
| 166 | Ga0207711_10648309 | 3300025941 | Bacteria | 985 |
| 167 | Ga0207689_10316093 | 3300025942 | Bacteria | 1295 |
| 168 | Ga0207679_10572101 | 3300025945 | Bacteria | 1016 |
| 169 | Ga0207667_10511390 | 3300025949 | Bacteria | 1217 |
| 170 | Ga0207668_10078977 | 3300025972 | Bacteria | 2378 |
| 171 | Ga0207668_10667098 | 3300025972 | Bacteria | 911 |
| 172 | Ga0207668_11148299 | 3300025972 | Bacteria | 697 |
| 173 | Ga0207658_10099606 | 3300025986 | Bacteria | 2274 |
| 174 | Ga0207678_10079536 | 3300026067 | Bacteria | 2807 |
| 175 | Ga0207678_10134291 | 3300026067 | Bacteria | 2111 |
| 176 | Ga0207678_10149331 | 3300026067 | Bacteria | 1995 |
| 177 | Ga0207678_10199958 | 3300026067 | Bacteria | 1708 |
| 178 | Ga0207678_10289050 | 3300026067 | Bacteria | 1408 |
| 179 | Ga0207708_10497319 | 3300026075 | Bacteria | 1021 |
| 180 | Ga0207641_10481560 | 3300026088 | Bacteria | 1203 |
| 181 | Ga0207648_10048037 | 3300026089 | Bacteria | 3738 |
| 182 | Ga0207676_10817235 | 3300026095 | Bacteria | 910 |
| 183 | Ga0207674_10235516 | 3300026116 | Bacteria | 1778 |
| 184 | Ga0207675_100516050 | 3300026118 | Bacteria | 1191 |
| 185 | Ga0207683_10855030 | 3300026121 | Bacteria | 844 |
| 186 | Ga0207698_10073854 | 3300026142 | Bacteria | 2717 |
| 187 | Ga0209389_1010332 | 3300027296 | Bacteria | 8410 |
| 188 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 189 | Ga0209589_1000180 | 3300027357 | Bacteria | 72900 |
| 190 | Ga0209489_100031 | 3300027361 | Bacteria | 184074 |
| 191 | Ga0209282_1000245 | 3300027666 | Bacteria | 27454 |
| 192 | Ga0268266_10024153 | 3300028379 | Bacteria | 5172 |
| 193 | Ga0268266_10266392 | 3300028379 | Bacteria | 1589 |
| 194 | Ga0268266_10461763 | 3300028379 | Bacteria | 1208 |
| 195 | Ga0307515_10022313 | 3300028794 | Bacteria | 11163 |
| 196 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 197 | Ga0307511_10000406 | 3300030521 | Bacteria | 45893 |
| 198 | Ga0265325_10050588 | 3300031241 | Bacteria | 2139 |
| 199 | Ga0265340_10000891 | 3300031247 | Bacteria | 16923 |
| 200 | Ga0307408_100055761 | 3300031548 | Bacteria | 2863 |
| 201 | Ga0265314_10106061 | 3300031711 | Bacteria | 1796 |
| 202 | Ga0265342_10075824 | 3300031712 | Bacteria | 1950 |
| 203 | Ga0307410_10102148 | 3300031852 | Bacteria | 2057 |
| 204 | Ga0307407_10193501 | 3300031903 | Bacteria | 1358 |
| 205 | Ga0307412_10787951 | 3300031911 | Bacteria | 824 |
| 206 | Ga0307409_100421292 | 3300031995 | Bacteria | 1281 |
| 207 | Ga0307414_10375336 | 3300032004 | Bacteria | 1228 |
| 208 | Ga0395900_0215646 | 3300037418 | Bacteria | 1937 |
| 209 | Ga0395900_0953459 | 3300037418 | Bacteria | 779 |
| 210 | Ga0395898_0488174 | 3300037466 | Bacteria | 1172 |
| 211 | Ga0395905_0000185 | 3300037471 | Bacteria | 99394 |
| 212 | Ga0395905_0033610 | 3300037471 | Bacteria | 4816 |
| 213 | Ga0395905_0122291 | 3300037471 | Bacteria | 2447 |
| 214 | Ga0436364_0062391 | 3300037853 | Bacteria | 2467 |
| 215 | Ga0436364_0854504 | 3300037853 | Bacteria | 1161 |
| 216 | Ga0436365_0406973 | 3300039437 | Bacteria | 950 |
| 217 | Ga0436365_0435073 | 3300039437 | Bacteria | 2775 |
| 218 | Ga0436365_0435855 | 3300039437 | Bacteria | 2457 |
| 219 | Ga0436365_1315065 | 3300039437 | Bacteria | 1017 |
| 220 | Ga0436365_1860794 | 3300039437 | Bacteria | 1646 |
| 221 | Ga0436360_1118848 | 3300039438 | Bacteria | 1240 |
| 222 | Ga0436361_0487656 | 3300039447 | Bacteria | 4039 |
| 223 | Ga0436363_0824796 | 3300039450 | Bacteria | 742 |
| 224 | Ga0439465_0097569 | 3300041413 | Bacteria | 1012 |
| 225 | Ga0451793_1147702 | 3300041452 | Bacteria | 1428 |
| 226 | Ga0451798_0714672 | 3300041458 | Bacteria | 906 |
| 227 | Ga0451833_0015134 | 3300041491 | Bacteria | 869 |
| 228 | Ga0451845_0496252 | 3300041501 | Bacteria | 786 |
| 229 | Ga0439445_0032561 | 3300042004 | Bacteria | 1359 |
| 230 | Ga0450902_017989 | 3300042137 | Bacteria | 1157 |
| 231 | Ga0466969_0027418 | 3300044656 | Bacteria | 2917 |
| 232 | Ga0466972_0000188 | 3300044658 | Bacteria | 47766 |
| 233 | Ga0466972_0010330 | 3300044658 | Bacteria | 4687 |
| 234 | Ga0466965_0020027 | 3300044683 | Bacteria | 3214 |
| 235 | Ga0466966_0001263 | 3300044684 | Bacteria | 16199 |
| 236 | Ga0466961_0000587 | 3300044693 | Bacteria | 23048 |
| 237 | Ga0466963_0132104 | 3300044694 | Bacteria | 1725 |
| 238 | Ga0466968_0068856 | 3300044735 | Bacteria | 1537 |
| 239 | Ga0466968_0177787 | 3300044735 | Bacteria | 988 |
| 240 | Ga0466970_0112654 | 3300044765 | Bacteria | 1486 |
| 241 | Ga0466970_0143761 | 3300044765 | Bacteria | 1315 |
| 242 | Ga0466957_0084350 | 3300044842 | Bacteria | 1983 |
| 243 | Ga0466960_0017610 | 3300044901 | Bacteria | 3118 |
| 244 | Ga0466960_0047816 | 3300044901 | Bacteria | 2053 |
| 245 | Ga0466960_0253196 | 3300044901 | Bacteria | 979 |
| 246 | Ga0466959_0290768 | 3300045049 | Bacteria | 1120 |
| 247 | Ga0466958_0359690 | 3300045836 | Bacteria | 938 |
| 248 | Ga0466967_0007932 | 3300045976 | Bacteria | 7723 |
| 249 | Ga0466967_0927676 | 3300045976 | Bacteria | 866 |
| 250 | Ga0495592_0174189 | 3300046454 | Bacteria | 1471 |
| 251 | Ga0495603_0183723 | 3300046455 | Bacteria | 1210 |
| 252 | Ga0495629_0007729 | 3300046459 | Bacteria | 7912 |
| 253 | Ga0495638_0005484 | 3300046460 | Bacteria | 9432 |
| 254 | Ga0495651_0010856 | 3300046462 | Bacteria | 7004 |
| 255 | Ga0495651_0377866 | 3300046462 | Bacteria | 930 |
| 256 | Ga0495653_0245357 | 3300046463 | Bacteria | 1191 |
| 257 | Ga0495664_0026263 | 3300046477 | Bacteria | 3392 |
| 258 | Ga0495607_0127641 | 3300046501 | Bacteria | 1328 |
| 259 | Ga0495606_0246069 | 3300046507 | Bacteria | 994 |
| 260 | Ga0495606_0313402 | 3300046507 | Bacteria | 846 |
| 261 | Ga0495608_0040710 | 3300046511 | Bacteria | 3112 |
| 262 | Ga0495610_0171979 | 3300046512 | Bacteria | 908 |
| 263 | Ga0495616_0034642 | 3300046513 | Bacteria | 2620 |
| 264 | Ga0495628_0030307 | 3300046516 | Bacteria | 4381 |
| 265 | Ga0495631_0094186 | 3300046518 | Bacteria | 1289 |
| 266 | Ga0495632_0097477 | 3300046519 | Bacteria | 1388 |
| 267 | Ga0495643_0048350 | 3300046522 | Bacteria | 2299 |
| 268 | Ga0495643_0115321 | 3300046522 | Bacteria | 1362 |
| 269 | Ga0495648_0000426 | 3300046524 | Bacteria | 46243 |
| 270 | Ga0495648_0002857 | 3300046524 | Bacteria | 15549 |
| 271 | Ga0495648_0119955 | 3300046524 | Bacteria | 1416 |
| 272 | Ga0495652_0053710 | 3300046529 | Bacteria | 3433 |
| 273 | Ga0495640_0017481 | 3300046533 | Bacteria | 5345 |
| 274 | Ga0495609_0070451 | 3300046538 | Bacteria | 1537 |
| 275 | Ga0495597_0129804 | 3300046542 | Bacteria | 1046 |
| 276 | Ga0495645_0130515 | 3300046543 | Bacteria | 1761 |
| 277 | Ga0495667_0146737 | 3300046559 | Bacteria | 1519 |
| 278 | Ga0495668_0127682 | 3300046616 | Bacteria | 1392 |
| 279 | Ga0495668_0130090 | 3300046616 | Bacteria | 1378 |
| 280 | Ga0495668_0462079 | 3300046616 | Bacteria | 699 |
| 281 | Ga0495611_0031892 | 3300046648 | Bacteria | 2322 |
| 282 | Ga0495625_0081399 | 3300046660 | Bacteria | 2254 |
| 283 | Ga0495625_0317479 | 3300046660 | Bacteria | 993 |
| 284 | Ga0495635_0012073 | 3300046663 | Bacteria | 6055 |
| 285 | Ga0495661_0134631 | 3300046665 | Bacteria | 1350 |
| 286 | Ga0495646_0016495 | 3300046680 | Bacteria | 4689 |
| 287 | Ga0495670_0036549 | 3300046691 | Bacteria | 2447 |
| 288 | Ga0495600_0004694 | 3300046809 | Bacteria | 8196 |
| 289 | Ga0495604_0006635 | 3300047317 | Bacteria | 9172 |
| 290 | Ga0495604_0012394 | 3300047317 | Bacteria | 6778 |
| 291 | Ga0495672_0038074 | 3300047320 | Bacteria | 2936 |
| 292 | Ga0495680_0002702 | 3300047322 | Bacteria | 17907 |
| 293 | Ga0495687_097552 | 3300047443 | Bacteria | 1110 |
| 294 | Ga0495675_0031749 | 3300047444 | Bacteria | 3372 |
| 295 | Ga0495673_0032706 | 3300047469 | Bacteria | 2421 |
| 296 | Ga0495681_0140369 | 3300047470 | Bacteria | 1021 |
| 297 | Ga0495684_0219050 | 3300047471 | Bacteria | 1396 |
| 298 | Ga0495686_0216095 | 3300047472 | Bacteria | 1093 |
| 299 | Ga0495602_0022693 | 3300048088 | Bacteria | 6138 |
| 300 | Ga0495602_0369040 | 3300048088 | Bacteria | 1031 |
| 301 | Ga0495626_0027116 | 3300048091 | Bacteria | 2787 |
| 302 | Ga0496101_0196723 | 3300048904 | Bacteria | 1557 |
| 303 | Ga0496101_0419742 | 3300048904 | Bacteria | 1054 |
| 304 | Ga0496102_0381950 | 3300048905 | Bacteria | 1325 |
| 305 | Ga0496103_0037348 | 3300048906 | Bacteria | 2976 |
| 306 | Ga0496104_0007578 | 3300048907 | Bacteria | 9606 |
| 307 | Ga0496104_0082005 | 3300048907 | Bacteria | 3076 |
| 308 | Ga0496105_0017907 | 3300048908 | Bacteria | 5685 |
| 309 | Ga0496106_0028578 | 3300048909 | Bacteria | 4154 |
| 310 | Ga0496106_0118187 | 3300048909 | Bacteria | 2070 |
| 311 | Ga0496106_0391116 | 3300048909 | Bacteria | 1117 |
| 312 | Ga0496107_0085273 | 3300048910 | Bacteria | 2305 |
| 313 | Ga0496107_0099829 | 3300048910 | Bacteria | 2128 |
| 314 | Ga0496108_0231713 | 3300048911 | Bacteria | 1606 |
| 315 | Ga0496108_0325947 | 3300048911 | Bacteria | 1339 |
| 316 | Ga0496110_0341343 | 3300048913 | Bacteria | 1364 |
| 317 | Ga0496110_0603622 | 3300048913 | Bacteria | 995 |
| 318 | Ga0496111_0117275 | 3300048914 | Bacteria | 1964 |
| 319 | Ga0496112_0061528 | 3300048915 | Bacteria | 3701 |
| 320 | Ga0496112_0186673 | 3300048915 | Bacteria | 2036 |
| 321 | Ga0496112_0276330 | 3300048915 | Bacteria | 1627 |
| 322 | Ga0496113_0187902 | 3300048916 | Bacteria | 1639 |
| 323 | Ga0496113_0292578 | 3300048916 | Bacteria | 1303 |
| 324 | Ga0496113_0391955 | 3300048916 | Bacteria | 1115 |
| 325 | Ga0496115_0066694 | 3300048918 | Bacteria | 2909 |
| 326 | Ga0496115_0434619 | 3300048918 | Bacteria | 1062 |
| 327 | Ga0496116_0000097 | 3300048919 | Bacteria | 200658 |
| 328 | Ga0496116_0005629 | 3300048919 | Bacteria | 11540 |
| 329 | Ga0496116_0045623 | 3300048919 | Bacteria | 2965 |
| 330 | Ga0496116_0220168 | 3300048919 | Bacteria | 973 |
| 331 | Ga0496116_0271295 | 3300048919 | Bacteria | 829 |
| 332 | Ga0496116_0313881 | 3300048919 | Bacteria | 738 |
| 333 | Ga0496117_0018170 | 3300048920 | Bacteria | 5838 |
| 334 | Ga0496117_0155412 | 3300048920 | Bacteria | 1347 |
| 335 | Ga0496117_0190192 | 3300048920 | Bacteria | 1170 |
| 336 | Ga0496117_0212504 | 3300048920 | Bacteria | 1083 |
| 337 | Ga0496117_0226343 | 3300048920 | Bacteria | 1037 |
| 338 | Ga0496118_0016217 | 3300048921 | Bacteria | 6845 |
| 339 | Ga0496118_0022563 | 3300048921 | Bacteria | 5496 |
| 340 | Ga0496118_0073322 | 3300048921 | Bacteria | 2453 |
| 341 | Ga0496118_0073506 | 3300048921 | Bacteria | 2449 |
| 342 | Ga0496118_0091282 | 3300048921 | Bacteria | 2095 |
| 343 | Ga0496118_0124596 | 3300048921 | Bacteria | 1671 |
| 344 | Ga0496118_0195194 | 3300048921 | Bacteria | 1206 |
| 345 | Ga0496118_0199682 | 3300048921 | Bacteria | 1186 |
| 346 | Ga0496118_0227083 | 3300048921 | Bacteria | 1081 |
| 347 | Ga0496119_0002464 | 3300048922 | Bacteria | 20306 |
| 348 | Ga0496119_0009213 | 3300048922 | Bacteria | 8518 |
| 349 | Ga0496119_0018995 | 3300048922 | Bacteria | 5086 |
| 350 | Ga0496119_0043733 | 3300048922 | Bacteria | 2827 |
| 351 | Ga0496119_0144272 | 3300048922 | Bacteria | 1282 |
| 352 | Ga0496119_0164862 | 3300048922 | Bacteria | 1174 |
| 353 | Ga0496119_0164915 | 3300048922 | Bacteria | 1174 |
| 354 | Ga0496119_0217495 | 3300048922 | Bacteria | 979 |
| 355 | Ga0496120_0017055 | 3300048923 | Bacteria | 4722 |
| 356 | Ga0496120_0055427 | 3300048923 | Bacteria | 2241 |
| 357 | Ga0496120_0058683 | 3300048923 | Bacteria | 2160 |
| 358 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 359 | Ga0496121_0010528 | 3300048924 | Bacteria | 10409 |
| 360 | Ga0496121_0036835 | 3300048924 | Bacteria | 4353 |
| 361 | Ga0496121_0040610 | 3300048924 | Bacteria | 4079 |
| 362 | Ga0496121_0058509 | 3300048924 | Bacteria | 3186 |
| 363 | Ga0496121_0151805 | 3300048924 | Bacteria | 1703 |
| 364 | Ga0496121_0226503 | 3300048924 | Bacteria | 1312 |
| 365 | Ga0496122_0010642 | 3300048925 | Bacteria | 9447 |
| 366 | Ga0496122_0016451 | 3300048925 | Bacteria | 6996 |
| 367 | Ga0496122_0033813 | 3300048925 | Bacteria | 4198 |
| 368 | Ga0496122_0036331 | 3300048925 | Bacteria | 3986 |
| 369 | Ga0496122_0075684 | 3300048925 | Bacteria | 2373 |
| 370 | Ga0496122_0129446 | 3300048925 | Bacteria | 1607 |
| 371 | Ga0496122_0141763 | 3300048925 | Bacteria | 1502 |
| 372 | Ga0496122_0195777 | 3300048925 | Bacteria | 1187 |
| 373 | Ga0496122_0197800 | 3300048925 | Bacteria | 1178 |
| 374 | Ga0496122_0202949 | 3300048925 | Bacteria | 1157 |
| 375 | Ga0496123_0013068 | 3300048926 | Bacteria | 7008 |
| 376 | Ga0496123_0037687 | 3300048926 | Bacteria | 3411 |
| 377 | Ga0496123_0072116 | 3300048926 | Bacteria | 2150 |
| 378 | Ga0496123_0178332 | 3300048926 | Bacteria | 1112 |
| 379 | Ga0496123_0278080 | 3300048926 | Bacteria | 810 |
| 380 | Ga0496124_0009576 | 3300048927 | Bacteria | 9948 |
| 381 | Ga0496124_0119468 | 3300048927 | Bacteria | 2108 |
| 382 | Ga0496124_0134007 | 3300048927 | Bacteria | 1964 |
| 383 | Ga0496124_0420519 | 3300048927 | Bacteria | 921 |
| 384 | Ga0496125_0000170 | 3300048928 | Bacteria | 145369 |
| 385 | Ga0496125_0000477 | 3300048928 | Bacteria | 70913 |
| 386 | Ga0496125_0000481 | 3300048928 | Bacteria | 70594 |
| 387 | Ga0496125_0003063 | 3300048928 | Bacteria | 20872 |
| 388 | Ga0496125_0003174 | 3300048928 | Bacteria | 20373 |
| 389 | Ga0496125_0011833 | 3300048928 | Bacteria | 8694 |
| 390 | Ga0496125_0036213 | 3300048928 | Bacteria | 4313 |
| 391 | Ga0496125_0071108 | 3300048928 | Bacteria | 2720 |
| 392 | Ga0496125_0092683 | 3300048928 | Bacteria | 2258 |
| 393 | Ga0496125_0115031 | 3300048928 | Bacteria | 1936 |
| 394 | Ga0496125_0228910 | 3300048928 | Bacteria | 1190 |
| 395 | Ga0496125_0245842 | 3300048928 | Bacteria | 1132 |
| 396 | Ga0496125_0410408 | 3300048928 | Bacteria | 788 |
| 397 | Ga0496126_0000119 | 3300048929 | Bacteria | 184211 |
| 398 | Ga0496126_0002021 | 3300048929 | Bacteria | 28687 |
| 399 | Ga0496126_0004626 | 3300048929 | Bacteria | 16302 |
| 400 | Ga0496126_0015812 | 3300048929 | Bacteria | 7579 |
| 401 | Ga0496126_0036837 | 3300048929 | Bacteria | 4571 |
| 402 | Ga0496126_0045598 | 3300048929 | Bacteria | 4027 |
| 403 | Ga0496126_0081599 | 3300048929 | Bacteria | 2858 |
| 404 | Ga0496126_0083028 | 3300048929 | Bacteria | 2828 |
| 405 | Ga0496126_0087837 | 3300048929 | Bacteria | 2740 |
| 406 | Ga0496126_0233852 | 3300048929 | Bacteria | 1538 |
| 407 | Ga0496126_0236965 | 3300048929 | Bacteria | 1526 |
| 408 | Ga0496126_0289240 | 3300048929 | Bacteria | 1356 |
| 409 | Ga0496126_0391947 | 3300048929 | Bacteria | 1128 |
| 410 | Ga0496126_0420269 | 3300048929 | Bacteria | 1081 |
| 411 | Ga0496126_0494113 | 3300048929 | Bacteria | 979 |
| 412 | Ga0496126_0579648 | 3300048929 | Bacteria | 886 |
| 413 | Ga0501031_0070813 | 3300049568 | Bacteria | 2271 |
| 414 | Ga0501033_0146541 | 3300049570 | Bacteria | 1704 |
| 415 | Ga0501033_0314505 | 3300049570 | Bacteria | 1101 |
| 416 | Ga0501034_0026055 | 3300049571 | Bacteria | 5956 |
| 417 | Ga0501034_0042325 | 3300049571 | Bacteria | 4611 |
| 418 | Ga0501034_0046481 | 3300049571 | Bacteria | 4385 |
| 419 | Ga0501036_0062351 | 3300049572 | Bacteria | 3158 |
| 420 | Ga0501037_0003530 | 3300049573 | Bacteria | 11355 |
| 421 | Ga0501043_0060363 | 3300049579 | Bacteria | 2976 |
| 422 | Ga0501035_0098262 | 3300049822 | Bacteria | 2570 |
| 423 | nmdc:mga03683_31568_c1 | 3300050489 | Bacteria | 2126 |
| 424 | nmdc:mga03n38_13013_c1 | 3300050490 | Bacteria | 3148 |
| 425 | nmdc:mga03n38_81392_c1 | 3300050490 | Bacteria | 1522 |
| 426 | nmdc:mga00v17_134463_c1 | 3300050491 | Bacteria | 1582 |
| 427 | nmdc:mga00v17_173833_c1 | 3300050491 | Bacteria | 1389 |
| 428 | nmdc:mga00v17_54869_c1 | 3300050491 | Bacteria | 2432 |
| 429 | nmdc:mga0yw44_162114_c1 | 3300050492 | Bacteria | 1464 |
| 430 | nmdc:mga0yw44_185037_c1 | 3300050492 | Bacteria | 1372 |
| 431 | nmdc:mga0yw44_261821_c1 | 3300050492 | Bacteria | 1153 |
| 432 | nmdc:mga0yw44_342808_c1 | 3300050492 | Bacteria | 1005 |
| 433 | nmdc:mga0yw44_6695_c1 | 3300050492 | Bacteria | 5595 |
| 434 | nmdc:mga0yw44_72573_c1 | 3300050492 | Bacteria | 2140 |
| 435 | nmdc:mga0k408_111800_c1 | 3300050493 | Bacteria | 1615 |
| 436 | nmdc:mga0k408_15443_c1 | 3300050493 | Bacteria | 4224 |
| 437 | nmdc:mga06z11_14149_c1 | 3300050494 | Bacteria | 3527 |
| 438 | nmdc:mga06z11_295204_c1 | 3300050494 | Bacteria | 963 |
| 439 | nmdc:mga06z11_32926_c1 | 3300050494 | Bacteria | 2531 |
| 440 | nmdc:mga06z11_36650_c1 | 3300050494 | Bacteria | 2422 |
| 441 | nmdc:mga06z11_58114_c1 | 3300050494 | Bacteria | 2006 |
| 442 | nmdc:mga06z11_78824_c1 | 3300050494 | Bacteria | 1762 |
| 443 | nmdc:mga04h51_12233_c1 | 3300050495 | Bacteria | 2404 |
| 444 | nmdc:mga07m45_220301_c1 | 3300050496 | Bacteria | 1104 |
| 445 | nmdc:mga07m45_39342_c1 | 3300050496 | Bacteria | 2642 |
| 446 | nmdc:mga07m45_65906_c1 | 3300050496 | Bacteria | 2057 |
| 447 | nmdc:mga0sz30_120099_c1 | 3300050516 | Bacteria | 1155 |
| 448 | nmdc:mga0sz30_132996_c1 | 3300050516 | Bacteria | 1096 |
| 449 | nmdc:mga0sz30_48316_c1 | 3300050516 | Bacteria | 1800 |
| 450 | nmdc:mga0sz30_67011_c1 | 3300050516 | Bacteria | 1541 |
| 451 | nmdc:mga0sz30_8932_c1 | 3300050516 | Bacteria | 3799 |
| 452 | Ga0500610_0165641 | 3300053079 | Bacteria | 1096 |
| 453 | Ga0495655_0081804 | 3300053083 | Bacteria | 925 |
| 454 | Ga0495595_0087431 | 3300053084 | Bacteria | 1492 |
| 455 | Ga0500578_0066446 | 3300053086 | Bacteria | 2300 |
| 456 | Ga0500643_000085 | 3300053087 | Bacteria | 98026 |
| 457 | Ga0500581_074781 | 3300053089 | Bacteria | 1701 |
| 458 | Ga0500646_0018471 | 3300053090 | Bacteria | 1837 |
| 459 | Ga0500646_0029505 | 3300053090 | Bacteria | 1502 |
| 460 | Ga0500651_0100180 | 3300053093 | Bacteria | 1776 |
| 461 | Ga0500651_0137222 | 3300053093 | Bacteria | 1476 |
| 462 | Ga0500641_0064307 | 3300053096 | Bacteria | 1532 |
| 463 | Ga0500650_0040958 | 3300053098 | Bacteria | 2137 |
| 464 | Ga0500555_001875 | 3300053103 | Bacteria | 6250 |
| 465 | Ga0500555_034629 | 3300053103 | Bacteria | 1422 |
| 466 | Ga0500555_049643 | 3300053103 | Bacteria | 1150 |
| 467 | Ga0500556_0000066 | 3300053104 | Bacteria | 105850 |
| 468 | Ga0500556_0000070 | 3300053104 | Bacteria | 101159 |
| 469 | Ga0500556_0043429 | 3300053104 | Bacteria | 1596 |
| 470 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 471 | Ga0500562_030571 | 3300053108 | Bacteria | 1419 |
| 472 | Ga0500562_093374 | 3300053108 | Bacteria | 817 |
| 473 | Ga0500569_011975 | 3300053109 | Bacteria | 2086 |
| 474 | Ga0500569_022888 | 3300053109 | Bacteria | 1671 |
| 475 | Ga0500595_010924 | 3300053119 | Bacteria | 3579 |
| 476 | Ga0500607_041458 | 3300053121 | Bacteria | 2488 |
| 477 | Ga0500607_165094 | 3300053121 | Bacteria | 1006 |
| 478 | Ga0500608_050882 | 3300053122 | Bacteria | 1990 |
| 479 | Ga0500618_000855 | 3300053125 | Bacteria | 16375 |
| 480 | Ga0500618_001004 | 3300053125 | Bacteria | 14234 |
| 481 | Ga0500618_015946 | 3300053125 | Bacteria | 1888 |
| 482 | Ga0500618_019260 | 3300053125 | Bacteria | 1681 |
| 483 | Ga0500642_0000072 | 3300053130 | Bacteria | 55645 |
| 484 | Ga0500642_0000442 | 3300053130 | Bacteria | 13325 |
| 485 | Ga0500642_0074914 | 3300053130 | Bacteria | 1545 |
| 486 | Ga0500642_0178266 | 3300053130 | Bacteria | 993 |
| 487 | Ga0500652_041482 | 3300053131 | Bacteria | 1853 |
| 488 | Ga0500652_224857 | 3300053131 | Bacteria | 753 |
| 489 | Ga0500655_001905 | 3300053133 | Bacteria | 3877 |
| 490 | Ga0500658_0231334 | 3300053134 | Bacteria | 848 |
| 491 | Ga0500559_0001217 | 3300053136 | Bacteria | 15252 |
| 492 | Ga0500559_0015675 | 3300053136 | Bacteria | 3200 |
| 493 | Ga0500559_0052465 | 3300053136 | Bacteria | 1802 |
| 494 | Ga0500568_0003002 | 3300053139 | Bacteria | 9651 |
| 495 | Ga0500568_0006816 | 3300053139 | Bacteria | 5689 |
| 496 | Ga0500568_0232269 | 3300053139 | Bacteria | 673 |
| 497 | Ga0500577_0000803 | 3300053142 | Bacteria | 8089 |
| 498 | Ga0500577_0030785 | 3300053142 | Bacteria | 1871 |
| 499 | Ga0500588_0161712 | 3300053146 | Bacteria | 815 |
| 500 | Ga0500590_024498 | 3300053148 | Bacteria | 3133 |
| 501 | Ga0500603_088427 | 3300053150 | Bacteria | 907 |
| 502 | Ga0500603_126493 | 3300053150 | Bacteria | 778 |
| 503 | Ga0500604_0001808 | 3300053151 | Bacteria | 5968 |
| 504 | Ga0500616_0000177 | 3300053153 | Bacteria | 106498 |
| 505 | Ga0500616_0067362 | 3300053153 | Bacteria | 1836 |
| 506 | Ga0500620_005118 | 3300053155 | Bacteria | 3004 |
| 507 | Ga0500622_0004935 | 3300053156 | Bacteria | 8132 |
| 508 | Ga0500634_0157095 | 3300053161 | Bacteria | 1055 |
| 509 | Ga0500638_115709 | 3300053162 | Bacteria | 1233 |
| 510 | Ga0500636_0000103 | 3300053177 | Bacteria | 43319 |
| 511 | Ga0500636_0011422 | 3300053177 | Bacteria | 5200 |
| 512 | Ga0500625_115717 | 3300053729 | Bacteria | 1089 |
| 513 | Ga0500645_007235 | 3300053730 | Bacteria | 3885 |
| 514 | Ga0500645_011879 | 3300053730 | Bacteria | 2829 |
| 515 | Ga0500601_000169 | 3300053737 | Bacteria | 13565 |
| 516 | Ga0530510_0000859 | 3300061734 | Bacteria | 20014 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0155412 | Ga0496117_0155412_120_830 | 177 |
| 2 | 3300048925 | Ga0496122_0129446 | Ga0496122_0129446_780_1490 | 177 |
| 3 | 3300048926 | Ga0496123_0278080 | Ga0496123_0278080_80_790 | 177 |
| 4 | 3300048927 | Ga0496124_0009576 | Ga0496124_0009576_5319_6029 | 177 |
| 5 | 3300048929 | Ga0496126_0233852 | Ga0496126_0233852_91_801 | 177 |
| 6 | iso_pu_bacteria | 2904699407 | 2904706944 | 178 |
| 7 | 3300053125 | Ga0500618_000855 | Ga0500618_000855_6847_7515 | 186 |
| 8 | 3300039437 | Ga0436365_0435073 | Ga0436365_0435073_23_634 | 187 |
| 9 | 3300025295 | Ga0209564_1033313 | Ga0209564_10333132 | 188 |
| 10 | 3300039450 | Ga0436363_0824796 | Ga0436363_0824796_30_641 | 188 |
| 11 | 3300041452 | Ga0451793_1147702 | Ga0451793_1147702_803_1414 | 188 |
| 12 | 3300048919 | Ga0496116_0313881 | Ga0496116_0313881_25_636 | 188 |
| 13 | 3300053136 | Ga0500559_0052465 | Ga0500559_0052465_1164_1775 | 188 |
| 14 | 3300053139 | Ga0500568_0232269 | Ga0500568_0232269_17_628 | 188 |
| 15 | 3300048927 | Ga0496124_0420519 | Ga0496124_0420519_27_704 | 189 |
| 16 | 3300009148 | Ga0105243_10782078 | Ga0105243_107820782 | 191 |
| 17 | 3300025942 | Ga0207689_10316093 | Ga0207689_103160932 | 191 |
| 18 | 3300046455 | Ga0495603_0183723 | Ga0495603_0183723_258_923 | 191 |
| 19 | 3300046616 | Ga0495668_0462079 | Ga0495668_0462079_19_663 | 191 |
| 20 | 3300048904 | Ga0496101_0196723 | Ga0496101_0196723_135_800 | 191 |
| 21 | 3300048916 | Ga0496113_0391955 | Ga0496113_0391955_327_992 | 191 |
| 22 | 3300048918 | Ga0496115_0066694 | Ga0496115_0066694_1926_2591 | 191 |
| 23 | 3300048925 | Ga0496122_0033813 | Ga0496122_0033813_2633_3298 | 191 |
| 24 | 3300050492 | nmdc:mga0yw44_6695_c1 | nmdc:mga0yw44_6695_c1_180_845 | 191 |
| 25 | 3300039437 | Ga0436365_0406973 | Ga0436365_0406973_66_731 | 193 |
| 26 | 3300044842 | Ga0466957_0084350 | Ga0466957_0084350_738_1403 | 193 |
| 27 | 3300048921 | Ga0496118_0073506 | Ga0496118_0073506_1641_2297 | 193 |
| 28 | 3300050494 | nmdc:mga06z11_32926_c1 | nmdc:mga06z11_32926_c1_1506_2171 | 193 |
| 29 | 3300005347 | Ga0070668_100109611 | Ga0070668_1001096112 | 194 |
| 30 | 3300005455 | Ga0070663_100281377 | Ga0070663_1002813772 | 194 |
| 31 | 3300005548 | Ga0070665_100211010 | Ga0070665_1002110102 | 194 |
| 32 | 3300006353 | Ga0075370_10318076 | Ga0075370_103180761 | 194 |
| 33 | 3300009176 | Ga0105242_10683080 | Ga0105242_106830802 | 194 |
| 34 | 3300014326 | Ga0157380_10461719 | Ga0157380_104617192 | 194 |
| 35 | 3300025297 | Ga0209758_1023139 | Ga0209758_10231392 | 194 |
| 36 | 3300025972 | Ga0207668_10667098 | Ga0207668_106670982 | 194 |
| 37 | 3300026067 | Ga0207678_10079536 | Ga0207678_100795364 | 194 |
| 38 | 3300026088 | Ga0207641_10481560 | Ga0207641_104815602 | 194 |
| 39 | 3300046459 | Ga0495629_0007729 | Ga0495629_0007729_1883_2548 | 194 |
| 40 | 3300046462 | Ga0495651_0377866 | Ga0495651_0377866_40_705 | 194 |
| 41 | 3300046501 | Ga0495607_0127641 | Ga0495607_0127641_297_962 | 194 |
| 42 | 3300046507 | Ga0495606_0313402 | Ga0495606_0313402_156_821 | 194 |
| 43 | 3300046524 | Ga0495648_0000426 | Ga0495648_0000426_42386_43051 | 194 |
| 44 | 3300046660 | Ga0495625_0317479 | Ga0495625_0317479_160_825 | 194 |
| 45 | 3300046663 | Ga0495635_0012073 | Ga0495635_0012073_379_1044 | 194 |
| 46 | 3300047317 | Ga0495604_0012394 | Ga0495604_0012394_157_822 | 194 |
| 47 | 3300048088 | Ga0495602_0369040 | Ga0495602_0369040_165_830 | 194 |
| 48 | 3300048907 | Ga0496104_0007578 | Ga0496104_0007578_97_762 | 194 |
| 49 | 3300048908 | Ga0496105_0017907 | Ga0496105_0017907_674_1339 | 194 |
| 50 | 3300048915 | Ga0496112_0061528 | Ga0496112_0061528_2631_3296 | 194 |
| 51 | 3300048915 | Ga0496112_0276330 | Ga0496112_0276330_533_1198 | 194 |
| 52 | 3300048920 | Ga0496117_0226343 | Ga0496117_0226343_106_771 | 194 |
| 53 | 3300048921 | Ga0496118_0091282 | Ga0496118_0091282_1026_1691 | 194 |
| 54 | 3300048921 | Ga0496118_0227083 | Ga0496118_0227083_188_853 | 194 |
| 55 | 3300048922 | Ga0496119_0018995 | Ga0496119_0018995_97_762 | 194 |
| 56 | 3300048924 | Ga0496121_0036835 | Ga0496121_0036835_1527_2192 | 194 |
| 57 | 3300048928 | Ga0496125_0115031 | Ga0496125_0115031_437_1102 | 194 |
| 58 | 3300048929 | Ga0496126_0083028 | Ga0496126_0083028_233_898 | 194 |
| 59 | 3300048929 | Ga0496126_0579648 | Ga0496126_0579648_130_795 | 194 |
| 60 | 3300050516 | nmdc:mga0sz30_67011_c1 | nmdc:mga0sz30_67011_c1_278_943 | 194 |
| 61 | 3300053096 | Ga0500641_0064307 | Ga0500641_0064307_429_1094 | 194 |
| 62 | 3300053162 | Ga0500638_115709 | Ga0500638_115709_404_1069 | 194 |
| 63 | 3300053730 | Ga0500645_007235 | Ga0500645_007235_2031_2696 | 194 |
| 64 | 3300061734 | Ga0530510_0000859 | Ga0530510_0000859_12366_13043 | 194 |
| 65 | 3300048924 | Ga0496121_0226503 | Ga0496121_0226503_300_965 | 195 |
| 66 | 3300048922 | Ga0496119_0144272 | Ga0496119_0144272_491_1183 | 196 |
| 67 | 3300048928 | Ga0496125_0228910 | Ga0496125_0228910_375_1067 | 196 |
| 68 | 3300044735 | Ga0466968_0068856 | Ga0466968_0068856_588_1253 | 197 |
| 69 | 3300003320 | rootH2_10007114 | rootH2_100071142 | 198 |
| 70 | 3300005539 | Ga0068853_100044460 | Ga0068853_1000444601 | 198 |
| 71 | 3300053119 | Ga0500595_010924 | Ga0500595_010924_2271_2936 | 198 |
| 72 | iso_pu_bacteria | 2513237166 | 2514054862 | 198 |
| 73 | iso_pu_bacteria | 2855730933 | 2855735630 | 198 |
| 74 | iso_pu_bacteria | 2855767633 | 2855772568 | 198 |
| 75 | iso_pu_bacteria | 2857542790 | 2857544524 | 198 |
| 76 | iso_pu_bacteria | 2881412998 | 2881416150 | 198 |
| 77 | iso_pu_bacteria | 642555112 | 642592528 | 198 |
| 78 | 3300031241 | Ga0265325_10050588 | Ga0265325_100505882 | 199 |
| 79 | 3300032004 | Ga0307414_10375336 | Ga0307414_103753362 | 199 |
| 80 | iso_pu_bacteria | 2913308742 | 2913309169 | 199 |
| 81 | 3300006038 | Ga0075365_10254087 | Ga0075365_102540872 | 200 |
| 82 | 3300006042 | Ga0075368_10013851 | Ga0075368_100138513 | 200 |
| 83 | 3300006051 | Ga0075364_10137803 | Ga0075364_101378032 | 200 |
| 84 | 3300006177 | Ga0075362_10068801 | Ga0075362_100688012 | 200 |
| 85 | 3300006195 | Ga0075366_10064496 | Ga0075366_100644962 | 200 |
| 86 | 3300050489 | nmdc:mga03683_31568_c1 | nmdc:mga03683_31568_c1_1328_1981 | 200 |
| 87 | 3300050491 | nmdc:mga00v17_54869_c1 | nmdc:mga00v17_54869_c1_440_1093 | 200 |
| 88 | 3300050492 | nmdc:mga0yw44_261821_c1 | nmdc:mga0yw44_261821_c1_468_1121 | 200 |
| 89 | 3300050493 | nmdc:mga0k408_15443_c1 | nmdc:mga0k408_15443_c1_2692_3345 | 200 |
| 90 | 3300050494 | nmdc:mga06z11_295204_c1 | nmdc:mga06z11_295204_c1_196_849 | 200 |
| 91 | 3300050496 | nmdc:mga07m45_220301_c1 | nmdc:mga07m45_220301_c1_210_863 | 200 |
| 92 | 3300053730 | Ga0500645_011879 | Ga0500645_011879_1296_1961 | 200 |
| 93 | iso_pu_bacteria | 2883577096 | 2883578054 | 201 |
| 94 | 3300002067 | JGI24735J21928_10007393 | JGI24735J21928_100073932 | 202 |
| 95 | 3300016635 | Ga0183361_10039 | Ga0183361_100399 | 202 |
| 96 | 3300030521 | Ga0307511_10000406 | Ga0307511_1000040637 | 202 |
| 97 | 3300037471 | Ga0395905_0000185 | Ga0395905_0000185_27798_28451 | 202 |
| 98 | 3300048919 | Ga0496116_0000097 | Ga0496116_0000097_161936_162592 | 202 |
| 99 | 3300048925 | Ga0496122_0141763 | Ga0496122_0141763_656_1312 | 202 |
| 100 | 3300048926 | Ga0496123_0037687 | Ga0496123_0037687_1764_2420 | 202 |
| 101 | 3300048929 | Ga0496126_0000119 | Ga0496126_0000119_19276_19932 | 202 |
| 102 | 3300050492 | nmdc:mga0yw44_342808_c1 | nmdc:mga0yw44_342808_c1_199_852 | 202 |
| 103 | 3300050516 | nmdc:mga0sz30_132996_c1 | nmdc:mga0sz30_132996_c1_261_914 | 202 |
| 104 | 3300053090 | Ga0500646_0029505 | Ga0500646_0029505_305_958 | 202 |
| 105 | 3300053103 | Ga0500555_049643 | Ga0500555_049643_406_1059 | 202 |
| 106 | 3300053133 | Ga0500655_001905 | Ga0500655_001905_417_1070 | 202 |
| 107 | 3300053151 | Ga0500604_0001808 | Ga0500604_0001808_4713_5366 | 202 |
| 108 | iso_pu_bacteria | 2507262055 | 2507508987 | 202 |
| 109 | iso_pu_bacteria | 2508501042 | 2508691219 | 202 |
| 110 | iso_pu_bacteria | 2508501128 | 2509147799 | 202 |
| 111 | iso_pu_bacteria | 2511231027 | 2511389902 | 202 |
| 112 | iso_pu_bacteria | 2511231028 | 2511394460 | 202 |
| 113 | iso_pu_bacteria | 2513237092 | 2513624353 | 202 |
| 114 | iso_pu_bacteria | 2513237094 | 2513641997 | 202 |
| 115 | iso_pu_bacteria | 2513237095 | 2513650218 | 202 |
| 116 | iso_pu_bacteria | 2513237098 | 2513671445 | 202 |
| 117 | iso_pu_bacteria | 2513237102 | 2513703687 | 202 |
| 118 | iso_pu_bacteria | 2513237104 | 2513717942 | 202 |
| 119 | iso_pu_bacteria | 2513237137 | 2513856539 | 202 |
| 120 | iso_pu_bacteria | 2513237139 | 2513872468 | 202 |
| 121 | iso_pu_bacteria | 2513237145 | 2513917135 | 202 |
| 122 | iso_pu_bacteria | 2513237161 | 2514015970 | 202 |
| 123 | iso_pu_bacteria | 2515154112 | 2515626407 | 202 |
| 124 | iso_pu_bacteria | 2517093001 | 2517101570 | 202 |
| 125 | iso_pu_bacteria | 2517572143 | 2517895584 | 202 |
| 126 | iso_pu_bacteria | 2524023205 | 2524442756 | 202 |
| 127 | iso_pu_bacteria | 2524023210 | 2524470105 | 202 |
| 128 | iso_pu_bacteria | 2524023228 | 2524539504 | 202 |
| 129 | iso_pu_bacteria | 2528768022 | 2528849736 | 202 |
| 130 | iso_pu_bacteria | 2602042107 | 2603856944 | 202 |
| 131 | iso_pu_bacteria | 2617270735 | 2617348699 | 202 |
| 132 | iso_pu_bacteria | 2617270741 | 2617376107 | 202 |
| 133 | iso_pu_bacteria | 2671180139 | 2671695521 | 202 |
| 134 | iso_pu_bacteria | 2744054633 | 2745080108 | 202 |
| 135 | iso_pu_bacteria | 2765235802 | 2765468662 | 202 |
| 136 | iso_pu_bacteria | 2767802442 | 2770195497 | 202 |
| 137 | iso_pu_bacteria | 2775506902 | 2776270568 | 202 |
| 138 | iso_pu_bacteria | 2775506904 | 2776281511 | 202 |
| 139 | iso_pu_bacteria | 2791355196 | 2793065894 | 202 |
| 140 | iso_pu_bacteria | 2791355197 | 2793072232 | 202 |
| 141 | iso_pu_bacteria | 2802429603 | 2805917945 | 202 |
| 142 | iso_pu_bacteria | 2816332527 | 2818241258 | 202 |
| 143 | iso_pu_bacteria | 2818991467 | 2819720672 | 202 |
| 144 | iso_pu_bacteria | 2821443989 | 2821448070 | 202 |
| 145 | iso_pu_bacteria | 2824617872 | 2824623365 | 202 |
| 146 | iso_pu_bacteria | 2824626560 | 2824632293 | 202 |
| 147 | iso_pu_bacteria | 2824635225 | 2824639011 | 202 |
| 148 | iso_pu_bacteria | 2824644064 | 2824648233 | 202 |
| 149 | iso_pu_bacteria | 2824661429 | 2824665634 | 202 |
| 150 | iso_pu_bacteria | 2824671348 | 2824676324 | 202 |
| 151 | iso_pu_bacteria | 2824679649 | 2824685103 | 202 |
| 152 | iso_pu_bacteria | 2824687955 | 2824692759 | 202 |
| 153 | iso_pu_bacteria | 2824696289 | 2824698870 | 202 |
| 154 | iso_pu_bacteria | 2824704595 | 2824707250 | 202 |
| 155 | iso_pu_bacteria | 2824714736 | 2824722067 | 202 |
| 156 | iso_pu_bacteria | 2824723954 | 2824725797 | 202 |
| 157 | iso_pu_bacteria | 2824732956 | 2824736364 | 202 |
| 158 | iso_pu_bacteria | 2824746037 | 2824749451 | 202 |
| 159 | iso_pu_bacteria | 2824753945 | 2824762499 | 202 |
| 160 | iso_pu_bacteria | 2824763712 | 2824766747 | 202 |
| 161 | iso_pu_bacteria | 2824773399 | 2824776480 | 202 |
| 162 | iso_pu_bacteria | 2834578030 | 2834578653 | 202 |
| 163 | iso_pu_bacteria | 2838122688 | 2838124082 | 202 |
| 164 | iso_pu_bacteria | 2839993093 | 2839997088 | 202 |
| 165 | iso_pu_bacteria | 2840764183 | 2840767350 | 202 |
| 166 | iso_pu_bacteria | 2841941048 | 2841943791 | 202 |
| 167 | iso_pu_bacteria | 2841949485 | 2841950182 | 202 |
| 168 | iso_pu_bacteria | 2841957949 | 2841958357 | 202 |
| 169 | iso_pu_bacteria | 2841966195 | 2841966576 | 202 |
| 170 | iso_pu_bacteria | 2841974524 | 2841975315 | 202 |
| 171 | iso_pu_bacteria | 2841983080 | 2841983120 | 202 |
| 172 | iso_pu_bacteria | 2842038055 | 2842039379 | 202 |
| 173 | iso_pu_bacteria | 2842045827 | 2842047675 | 202 |
| 174 | iso_pu_bacteria | 2842775625 | 2842778127 | 202 |
| 175 | iso_pu_bacteria | 2842871566 | 2842872005 | 202 |
| 176 | iso_pu_bacteria | 2844533157 | 2844539675 | 202 |
| 177 | iso_pu_bacteria | 2847930680 | 2847935847 | 202 |
| 178 | iso_pu_bacteria | 2847939898 | 2847946236 | 202 |
| 179 | iso_pu_bacteria | 2855020534 | 2855023165 | 202 |
| 180 | iso_pu_bacteria | 2857509624 | 2857513978 | 202 |
| 181 | iso_pu_bacteria | 2857524615 | 2857528621 | 202 |
| 182 | iso_pu_bacteria | 2874590934 | 2874592683 | 202 |
| 183 | iso_pu_bacteria | 2874612657 | 2874616127 | 202 |
| 184 | iso_pu_bacteria | 2874620515 | 2874627430 | 202 |
| 185 | iso_pu_bacteria | 2874628541 | 2874629820 | 202 |
| 186 | iso_pu_bacteria | 2874645413 | 2874648280 | 202 |
| 187 | iso_pu_bacteria | 2876761206 | 2876767283 | 202 |
| 188 | iso_pu_bacteria | 2876771140 | 2876772896 | 202 |
| 189 | iso_pu_bacteria | 2876818435 | 2876820224 | 202 |
| 190 | iso_pu_bacteria | 2879074833 | 2879076727 | 202 |
| 191 | iso_pu_bacteria | 2879083081 | 2879085234 | 202 |
| 192 | iso_pu_bacteria | 2879099564 | 2879103855 | 202 |
| 193 | iso_pu_bacteria | 2879127579 | 2879131662 | 202 |
| 194 | iso_pu_bacteria | 2879142872 | 2879148045 | 202 |
| 195 | iso_pu_bacteria | 2881364244 | 2881371725 | 202 |
| 196 | iso_pu_bacteria | 2881665667 | 2881666429 | 202 |
| 197 | iso_pu_bacteria | 2885366525 | 2885372190 | 202 |
| 198 | iso_pu_bacteria | 2885383462 | 2885386841 | 202 |
| 199 | iso_pu_bacteria | 2888378607 | 2888383745 | 202 |
| 200 | iso_pu_bacteria | 2888388044 | 2888394123 | 202 |
| 201 | iso_pu_bacteria | 2893066018 | 2893066220 | 202 |
| 202 | iso_pu_bacteria | 2894652903 | 2894655939 | 202 |
| 203 | iso_pu_bacteria | 2897803580 | 2897809610 | 202 |
| 204 | iso_pu_bacteria | 2903748898 | 2903759129 | 202 |
| 205 | iso_pu_bacteria | 2903768456 | 2903769632 | 202 |
| 206 | iso_pu_bacteria | 2904578770 | 2904580523 | 202 |
| 207 | iso_pu_bacteria | 2904666416 | 2904671052 | 202 |
| 208 | iso_pu_bacteria | 2904690495 | 2904694056 | 202 |
| 209 | iso_pu_bacteria | 2904711408 | 2904720866 | 202 |
| 210 | iso_pu_bacteria | 2906626472 | 2906630019 | 202 |
| 211 | iso_pu_bacteria | 2906635258 | 2906638541 | 202 |
| 212 | iso_pu_bacteria | 2906643746 | 2906648737 | 202 |
| 213 | iso_pu_bacteria | 2906660503 | 2906662776 | 202 |
| 214 | iso_pu_bacteria | 2908756301 | 2908764585 | 202 |
| 215 | iso_pu_bacteria | 2908775508 | 2908779815 | 202 |
| 216 | iso_pu_bacteria | 2919073203 | 2919076067 | 202 |
| 217 | iso_pu_bacteria | 2919119836 | 2919121732 | 202 |
| 218 | iso_pu_bacteria | 2922393267 | 2922396705 | 202 |
| 219 | iso_pu_bacteria | 2928521798 | 2928523929 | 202 |
| 220 | iso_pu_bacteria | 2929199973 | 2929205752 | 202 |
| 221 | iso_pu_bacteria | 2929615660 | 2929617698 | 202 |
| 222 | iso_pu_bacteria | 2929624759 | 2929627403 | 202 |
| 223 | iso_pu_bacteria | 2932784394 | 2932788505 | 202 |
| 224 | iso_pu_bacteria | 2932794094 | 2932798574 | 202 |
| 225 | iso_pu_bacteria | 2932801729 | 2932803117 | 202 |
| 226 | iso_pu_bacteria | 2932809354 | 2932816333 | 202 |
| 227 | iso_pu_bacteria | 2932818245 | 2932821503 | 202 |
| 228 | iso_pu_bacteria | 2932828146 | 2932831588 | 202 |
| 229 | iso_pu_bacteria | 2933577622 | 2933579654 | 202 |
| 230 | iso_pu_bacteria | 2935608549 | 2935612164 | 202 |
| 231 | iso_pu_bacteria | 2935616580 | 2935622366 | 202 |
| 232 | iso_pu_bacteria | 2935638405 | 2935645205 | 202 |
| 233 | iso_pu_bacteria | 2935648319 | 2935649741 | 202 |
| 234 | iso_pu_bacteria | 2935656913 | 2935658744 | 202 |
| 235 | iso_pu_bacteria | 2935665750 | 2935671766 | 202 |
| 236 | iso_pu_bacteria | 2935675223 | 2935678831 | 202 |
| 237 | iso_pu_bacteria | 2935684952 | 2935688848 | 202 |
| 238 | iso_pu_bacteria | 2935694250 | 2935696222 | 202 |
| 239 | iso_pu_bacteria | 2935703347 | 2935706967 | 202 |
| 240 | iso_pu_bacteria | 2935713505 | 2935715867 | 202 |
| 241 | iso_pu_bacteria | 2935722832 | 2935725569 | 202 |
| 242 | iso_pu_bacteria | 2935732158 | 2935738152 | 202 |
| 243 | iso_pu_bacteria | 2935741537 | 2935747527 | 202 |
| 244 | iso_pu_bacteria | 2935750917 | 2935753898 | 202 |
| 245 | iso_pu_bacteria | 2935760218 | 2935762904 | 202 |
| 246 | iso_pu_bacteria | 2935769743 | 2935774999 | 202 |
| 247 | iso_pu_bacteria | 2935777560 | 2935782658 | 202 |
| 248 | iso_pu_bacteria | 2935785616 | 2935791756 | 202 |
| 249 | iso_pu_bacteria | 2935793552 | 2935800012 | 202 |
| 250 | iso_pu_bacteria | 2935801545 | 2935807685 | 202 |
| 251 | iso_pu_bacteria | 2935810662 | 2935817047 | 202 |
| 252 | iso_pu_bacteria | 2935819856 | 2935821634 | 202 |
| 253 | iso_pu_bacteria | 2935827899 | 2935834672 | 202 |
| 254 | iso_pu_bacteria | 2935837841 | 2935840355 | 202 |
| 255 | iso_pu_bacteria | 2935847175 | 2935847235 | 202 |
| 256 | iso_pu_bacteria | 2935855204 | 2935860566 | 202 |
| 257 | iso_pu_bacteria | 2935864058 | 2935865396 | 202 |
| 258 | iso_pu_bacteria | 2935873716 | 2935877992 | 202 |
| 259 | iso_pu_bacteria | 2935883170 | 2935885456 | 202 |
| 260 | iso_pu_bacteria | 2935908558 | 2935914661 | 202 |
| 261 | iso_pu_bacteria | 2935916978 | 2935924872 | 202 |
| 262 | iso_pu_bacteria | 2935926038 | 2935932261 | 202 |
| 263 | iso_pu_bacteria | 2935934488 | 2935940859 | 202 |
| 264 | iso_pu_bacteria | 2935942939 | 2935948932 | 202 |
| 265 | iso_pu_bacteria | 2935951376 | 2935957490 | 202 |
| 266 | iso_pu_bacteria | 2935959822 | 2935959986 | 202 |
| 267 | iso_pu_bacteria | 2935967501 | 2935973937 | 202 |
| 268 | iso_pu_bacteria | 2935975950 | 2935977315 | 202 |
| 269 | iso_pu_bacteria | 2935984226 | 2935988506 | 202 |
| 270 | iso_pu_bacteria | 2935992306 | 2935996059 | 202 |
| 271 | iso_pu_bacteria | 2936002035 | 2936006193 | 202 |
| 272 | iso_pu_bacteria | 2936011229 | 2936012777 | 202 |
| 273 | iso_pu_bacteria | 2936019824 | 2936021341 | 202 |
| 274 | iso_pu_bacteria | 2936028420 | 2936030070 | 202 |
| 275 | iso_pu_bacteria | 2936037263 | 2936043426 | 202 |
| 276 | iso_pu_bacteria | 2936046547 | 2936047535 | 202 |
| 277 | iso_pu_bacteria | 2936055302 | 2936057307 | 202 |
| 278 | iso_pu_bacteria | 2940556831 | 2940560726 | 202 |
| 279 | iso_pu_bacteria | 2941538514 | 2941541514 | 202 |
| 280 | iso_pu_bacteria | 2954011201 | 2954012873 | 202 |
| 281 | iso_pu_bacteria | 2964636051 | 2964641743 | 202 |
| 282 | iso_pu_bacteria | 3000017691 | 3000019292 | 202 |
| 283 | iso_pu_bacteria | 3002141150 | 3002144810 | 202 |
| 284 | iso_pu_bacteria | 3003930520 | 3003930558 | 202 |
| 285 | iso_pu_bacteria | 3005474847 | 3005481605 | 202 |
| 286 | iso_pu_bacteria | 3005506211 | 3005510091 | 202 |
| 287 | iso_pu_bacteria | 3005587118 | 3005592482 | 202 |
| 288 | iso_pu_bacteria | 3005594810 | 3005598940 | 202 |
| 289 | iso_pu_bacteria | 3005710791 | 3005714517 | 202 |
| 290 | iso_pu_bacteria | 8006933436 | 8006934728 | 202 |
| 291 | iso_pu_bacteria | 8006973647 | 8006974695 | 202 |
| 292 | iso_pu_bacteria | 8016511872 | 8016513666 | 202 |
| 293 | iso_pu_bacteria | 8016522445 | 8016529994 | 202 |
| 294 | iso_pu_bacteria | 8016530956 | 8016535229 | 202 |
| 295 | iso_pu_bacteria | 8016539877 | 8016548439 | 202 |
| 296 | iso_pu_bacteria | 8016557553 | 8016562070 | 202 |
| 297 | iso_pu_bacteria | 8016566248 | 8016573571 | 202 |
| 298 | iso_pu_bacteria | 8016575299 | 8016577697 | 202 |
| 299 | iso_pu_bacteria | 8016583857 | 8016592252 | 202 |
| 300 | iso_pu_bacteria | 8016595262 | 8016599892 | 202 |
| 301 | iso_pu_bacteria | 8016603502 | 8016610919 | 202 |
| 302 | iso_pu_bacteria | 8016613128 | 8016614046 | 202 |
| 303 | iso_pu_bacteria | 8016630954 | 8016640707 | 202 |
| 304 | iso_pu_bacteria | 8017057580 | 8017062780 | 202 |
| 305 | iso_pu_bacteria | 8019530166 | 8019534980 | 202 |
| 306 | iso_pu_bacteria | 8019538911 | 8019544486 | 202 |
| 307 | iso_pu_bacteria | 8019547302 | 8019554101 | 202 |
| 308 | iso_pu_bacteria | 8019586578 | 8019589908 | 202 |
| 309 | iso_pu_bacteria | 8019597564 | 8019601361 | 202 |
| 310 | iso_pu_bacteria | 8019608314 | 8019617191 | 202 |
| 311 | iso_pu_bacteria | 8019619141 | 8019627713 | 202 |
| 312 | iso_pu_bacteria | 8019629233 | 8019634793 | 202 |
| 313 | iso_pu_bacteria | 8019638758 | 8019644910 | 202 |
| 314 | iso_pu_bacteria | 8019648815 | 8019658048 | 202 |
| 315 | iso_pu_bacteria | 8019668869 | 8019672302 | 202 |
| 316 | iso_pu_bacteria | 8019678201 | 8019683905 | 202 |
| 317 | iso_pu_bacteria | 8019687851 | 8019689647 | 202 |
| 318 | iso_pu_bacteria | 8055742211 | 8055746687 | 202 |
| 319 | iso_pu_bacteria | 8055909800 | 8055914688 | 202 |
| 320 | iso_pu_bacteria | 8056681323 | 8056682542 | 202 |
| 321 | iso_pu_bacteria | 8056689827 | 8056692383 | 202 |
| 322 | iso_pu_bacteria | 8057132660 | 8057133369 | 202 |
| 323 | 3300005328 | Ga0070676_10312963 | Ga0070676_103129632 | 203 |
| 324 | 3300005347 | Ga0070668_100014846 | Ga0070668_1000148462 | 203 |
| 325 | 3300005356 | Ga0070674_100006548 | Ga0070674_1000065482 | 203 |
| 326 | 3300005441 | Ga0070700_100884539 | Ga0070700_1008845391 | 203 |
| 327 | 3300005455 | Ga0070663_100451192 | Ga0070663_1004511922 | 203 |
| 328 | 3300005457 | Ga0070662_100265189 | Ga0070662_1002651891 | 203 |
| 329 | 3300005459 | Ga0068867_100214158 | Ga0068867_1002141582 | 203 |
| 330 | 3300005543 | Ga0070672_100306129 | Ga0070672_1003061292 | 203 |
| 331 | 3300005544 | Ga0070686_100406554 | Ga0070686_1004065542 | 203 |
| 332 | 3300005718 | Ga0068866_10029830 | Ga0068866_100298302 | 203 |
| 333 | 3300005719 | Ga0068861_100471423 | Ga0068861_1004714232 | 203 |
| 334 | 3300013308 | Ga0157375_10227560 | Ga0157375_102275602 | 203 |
| 335 | 3300017792 | Ga0163161_10012756 | Ga0163161_100127562 | 203 |
| 336 | 3300021388 | Ga0213875_10174109 | Ga0213875_101741092 | 203 |
| 337 | 3300025899 | Ga0207642_10033767 | Ga0207642_100337672 | 203 |
| 338 | 3300025901 | Ga0207688_10072635 | Ga0207688_100726352 | 203 |
| 339 | 3300025927 | Ga0207687_10063458 | Ga0207687_100634582 | 203 |
| 340 | 3300025933 | Ga0207706_10261167 | Ga0207706_102611671 | 203 |
| 341 | 3300025935 | Ga0207709_10091806 | Ga0207709_100918062 | 203 |
| 342 | 3300025937 | Ga0207669_10001575 | Ga0207669_100015752 | 203 |
| 343 | 3300025972 | Ga0207668_10078977 | Ga0207668_100789772 | 203 |
| 344 | 3300026067 | Ga0207678_10289050 | Ga0207678_102890502 | 203 |
| 345 | 3300026075 | Ga0207708_10497319 | Ga0207708_104973191 | 203 |
| 346 | 3300026089 | Ga0207648_10048037 | Ga0207648_100480374 | 203 |
| 347 | 3300026118 | Ga0207675_100516050 | Ga0207675_1005160502 | 203 |
| 348 | 3300039437 | Ga0436365_0435855 | Ga0436365_0435855_289_954 | 203 |
| 349 | 3300048918 | Ga0496115_0434619 | Ga0496115_0434619_337_1002 | 203 |
| 350 | 3300048921 | Ga0496118_0124596 | Ga0496118_0124596_583_1239 | 203 |
| 351 | 3300048922 | Ga0496119_0009213 | Ga0496119_0009213_3810_4466 | 203 |
| 352 | 3300048923 | Ga0496120_0017055 | Ga0496120_0017055_3702_4358 | 203 |
| 353 | 3300048928 | Ga0496125_0036213 | Ga0496125_0036213_375_1031 | 203 |
| 354 | 3300048929 | Ga0496126_0289240 | Ga0496126_0289240_65_721 | 203 |
| 355 | 3300050491 | nmdc:mga00v17_173833_c1 | nmdc:mga00v17_173833_c1_339_995 | 203 |
| 356 | 3300050494 | nmdc:mga06z11_36650_c1 | nmdc:mga06z11_36650_c1_239_895 | 203 |
| 357 | 3300050516 | nmdc:mga0sz30_48316_c1 | nmdc:mga0sz30_48316_c1_771_1427 | 203 |
| 358 | iso_pu_bacteria | 2511231221 | 2512038188 | 203 |
| 359 | iso_pu_bacteria | 2554235003 | 2554244532 | 203 |
| 360 | iso_pu_bacteria | 2558860242 | 2559297626 | 203 |
| 361 | iso_pu_bacteria | 2585427633 | 2585997210 | 203 |
| 362 | iso_pu_bacteria | 2585427634 | 2586001812 | 203 |
| 363 | iso_pu_bacteria | 2599185210 | 2599606211 | 203 |
| 364 | iso_pu_bacteria | 2600254933 | 2600373599 | 203 |
| 365 | iso_pu_bacteria | 2600255279 | 2601612421 | 203 |
| 366 | iso_pu_bacteria | 2600255308 | 2601748962 | 203 |
| 367 | iso_pu_bacteria | 2643221568 | 2643858060 | 203 |
| 368 | iso_pu_bacteria | 2643221582 | 2643922211 | 203 |
| 369 | iso_pu_bacteria | 2643221688 | 2644494111 | 203 |
| 370 | iso_pu_bacteria | 2643221693 | 2644522720 | 203 |
| 371 | iso_pu_bacteria | 2738541317 | 2738944549 | 203 |
| 372 | iso_pu_bacteria | 2775507049 | 2776914611 | 203 |
| 373 | iso_pu_bacteria | 2808606387 | 2808989135 | 203 |
| 374 | iso_pu_bacteria | 2818991461 | 2819686481 | 203 |
| 375 | iso_pu_bacteria | 2821123053 | 2821126206 | 203 |
| 376 | iso_pu_bacteria | 2838675328 | 2838679942 | 203 |
| 377 | iso_pu_bacteria | 2838714209 | 2838717739 | 203 |
| 378 | iso_pu_bacteria | 2838719591 | 2838724513 | 203 |
| 379 | iso_pu_bacteria | 2838724970 | 2838729545 | 203 |
| 380 | iso_pu_bacteria | 2838736955 | 2838737319 | 203 |
| 381 | iso_pu_bacteria | 2841840854 | 2841842312 | 203 |
| 382 | iso_pu_bacteria | 2841846520 | 2841849983 | 203 |
| 383 | iso_pu_bacteria | 2841859092 | 2841861229 | 203 |
| 384 | iso_pu_bacteria | 2842124991 | 2842128455 | 203 |
| 385 | iso_pu_bacteria | 2842130223 | 2842134624 | 203 |
| 386 | iso_pu_bacteria | 2842140634 | 2842142091 | 203 |
| 387 | iso_pu_bacteria | 2842152218 | 2842156544 | 203 |
| 388 | iso_pu_bacteria | 2842170452 | 2842173984 | 203 |
| 389 | iso_pu_bacteria | 2842175837 | 2842180165 | 203 |
| 390 | iso_pu_bacteria | 2842187318 | 2842192164 | 203 |
| 391 | iso_pu_bacteria | 2842211629 | 2842216556 | 203 |
| 392 | iso_pu_bacteria | 2842224351 | 2842229200 | 203 |
| 393 | iso_pu_bacteria | 2842515876 | 2842518504 | 203 |
| 394 | iso_pu_bacteria | 2846952575 | 2846956811 | 203 |
| 395 | iso_pu_bacteria | 2848858292 | 2848864600 | 203 |
| 396 | iso_pu_bacteria | 2857531043 | 2857532767 | 203 |
| 397 | iso_pu_bacteria | 2891048133 | 2891052235 | 203 |
| 398 | iso_pu_bacteria | 2899792073 | 2899793135 | 203 |
| 399 | iso_pu_bacteria | 2899845264 | 2899849661 | 203 |
| 400 | iso_pu_bacteria | 2919114240 | 2919118020 | 203 |
| 401 | iso_pu_bacteria | 2919166419 | 2919169969 | 203 |
| 402 | iso_pu_bacteria | 2926754445 | 2926757787 | 203 |
| 403 | iso_pu_bacteria | 2926760298 | 2926764587 | 203 |
| 404 | iso_pu_bacteria | 2929138655 | 2929141415 | 203 |
| 405 | iso_pu_bacteria | 2933006813 | 2933010402 | 203 |
| 406 | iso_pu_bacteria | 2933011516 | 2933014130 | 203 |
| 407 | iso_pu_bacteria | 2933594066 | 2933597270 | 203 |
| 408 | iso_pu_bacteria | 2978969890 | 2978972416 | 203 |
| 409 | iso_pu_bacteria | 2979089926 | 2979090303 | 203 |
| 410 | iso_pu_bacteria | 2979095461 | 2979095832 | 203 |
| 411 | iso_pu_bacteria | 2979100975 | 2979102714 | 203 |
| 412 | iso_pu_bacteria | 2984509177 | 2984509398 | 203 |
| 413 | iso_pu_bacteria | 2984518228 | 2984519903 | 203 |
| 414 | iso_pu_bacteria | 2984537506 | 2984537730 | 203 |
| 415 | iso_pu_bacteria | 2984587000 | 2984590667 | 203 |
| 416 | iso_pu_bacteria | 2984601300 | 2984604475 | 203 |
| 417 | iso_pu_bacteria | 2989349275 | 2989352116 | 203 |
| 418 | iso_pu_bacteria | 2995392953 | 2995395926 | 203 |
| 419 | iso_pu_bacteria | 650716007 | 650844068 | 203 |
| 420 | iso_pu_bacteria | 8003570095 | 8003574423 | 203 |
| 421 | iso_pu_bacteria | 8054002106 | 8054002727 | 203 |
| 422 | iso_pu_bacteria | 8054460903 | 8054463514 | 203 |
| 423 | iso_pu_bacteria | 8056875544 | 8056876215 | 203 |
| 424 | 3300003752 | Ga0055539_1023632 | Ga0055539_10236321 | 204 |
| 425 | 3300005548 | Ga0070665_100236991 | Ga0070665_1002369912 | 204 |
| 426 | 3300025253 | Ga0209677_101840 | Ga0209677_1018408 | 204 |
| 427 | 3300028379 | Ga0268266_10266392 | Ga0268266_102663922 | 204 |
| 428 | 3300041413 | Ga0439465_0097569 | Ga0439465_0097569_270_935 | 204 |
| 429 | 3300044765 | Ga0466970_0143761 | Ga0466970_0143761_240_908 | 204 |
| 430 | 3300047472 | Ga0495686_0216095 | Ga0495686_0216095_326_991 | 204 |
| 431 | 3300048920 | Ga0496117_0190192 | Ga0496117_0190192_341_1006 | 204 |
| 432 | 3300048921 | Ga0496118_0073322 | Ga0496118_0073322_938_1603 | 204 |
| 433 | 3300048924 | Ga0496121_0058509 | Ga0496121_0058509_63_728 | 204 |
| 434 | 3300048925 | Ga0496122_0010642 | Ga0496122_0010642_5654_6319 | 204 |
| 435 | 3300048926 | Ga0496123_0013068 | Ga0496123_0013068_5833_6498 | 204 |
| 436 | 3300048927 | Ga0496124_0119468 | Ga0496124_0119468_441_1133 | 204 |
| 437 | 3300048928 | Ga0496125_0410408 | Ga0496125_0410408_102_767 | 204 |
| 438 | 3300048929 | Ga0496126_0015812 | Ga0496126_0015812_5433_6098 | 204 |
| 439 | 3300049571 | Ga0501034_0026055 | Ga0501034_0026055_1326_1991 | 204 |
| 440 | 3300005436 | Ga0070713_100135697 | Ga0070713_1001356972 | 205 |
| 441 | 3300005437 | Ga0070710_10025600 | Ga0070710_100256002 | 205 |
| 442 | 3300005439 | Ga0070711_100052664 | Ga0070711_1000526642 | 205 |
| 443 | 3300006173 | Ga0070716_100056422 | Ga0070716_1000564222 | 205 |
| 444 | 3300006178 | Ga0075367_10129362 | Ga0075367_101293622 | 205 |
| 445 | 3300013105 | Ga0157369_10081684 | Ga0157369_100816842 | 205 |
| 446 | 3300021384 | Ga0213876_10214675 | Ga0213876_102146752 | 205 |
| 447 | 3300025292 | Ga0209676_1000214 | Ga0209676_100021420 | 205 |
| 448 | 3300025298 | Ga0209050_1022914 | Ga0209050_10229142 | 205 |
| 449 | 3300025898 | Ga0207692_10120042 | Ga0207692_101200422 | 205 |
| 450 | 3300025904 | Ga0207647_10093465 | Ga0207647_100934652 | 205 |
| 451 | 3300025906 | Ga0207699_10043945 | Ga0207699_100439453 | 205 |
| 452 | 3300025915 | Ga0207693_10008703 | Ga0207693_100087034 | 205 |
| 453 | 3300025916 | Ga0207663_10182945 | Ga0207663_101829452 | 205 |
| 454 | 3300025939 | Ga0207665_10094343 | Ga0207665_100943433 | 205 |
| 455 | 3300031903 | Ga0307407_10193501 | Ga0307407_101935012 | 205 |
| 456 | 3300037853 | Ga0436364_0062391 | Ga0436364_0062391_1097_1762 | 205 |
| 457 | 3300039437 | Ga0436365_1860794 | Ga0436365_1860794_453_1118 | 205 |
| 458 | 3300039438 | Ga0436360_1118848 | Ga0436360_1118848_214_879 | 205 |
| 459 | 3300039447 | Ga0436361_0487656 | Ga0436361_0487656_3236_3901 | 205 |
| 460 | 3300045976 | Ga0466967_0927676 | Ga0466967_0927676_93_758 | 205 |
| 461 | 3300046524 | Ga0495648_0002857 | Ga0495648_0002857_14383_15048 | 205 |
| 462 | 3300048921 | Ga0496118_0199682 | Ga0496118_0199682_336_1010 | 205 |
| 463 | 3300048927 | Ga0496124_0134007 | Ga0496124_0134007_770_1444 | 205 |
| 464 | 3300048928 | Ga0496125_0000481 | Ga0496125_0000481_24867_25541 | 205 |
| 465 | 3300048928 | Ga0496125_0092683 | Ga0496125_0092683_433_1107 | 205 |
| 466 | 3300048929 | Ga0496126_0002021 | Ga0496126_0002021_21504_22169 | 205 |
| 467 | 3300049568 | Ga0501031_0070813 | Ga0501031_0070813_459_1127 | 205 |
| 468 | 3300049570 | Ga0501033_0146541 | Ga0501033_0146541_493_1161 | 205 |
| 469 | 3300049571 | Ga0501034_0046481 | Ga0501034_0046481_3040_3708 | 205 |
| 470 | 3300049572 | Ga0501036_0062351 | Ga0501036_0062351_594_1262 | 205 |
| 471 | 3300049579 | Ga0501043_0060363 | Ga0501043_0060363_2056_2724 | 205 |
| 472 | 3300049822 | Ga0501035_0098262 | Ga0501035_0098262_1374_2042 | 205 |
| 473 | 3300050494 | nmdc:mga06z11_14149_c1 | nmdc:mga06z11_14149_c1_966_1634 | 205 |
| 474 | 3300050494 | nmdc:mga06z11_58114_c1 | nmdc:mga06z11_58114_c1_1044_1712 | 205 |
| 475 | 3300053136 | Ga0500559_0015675 | Ga0500559_0015675_853_1521 | 205 |
| 476 | 3300053150 | Ga0500603_126493 | Ga0500603_126493_23_688 | 205 |
| 477 | iso_pu_bacteria | 2513237087 | 2513594115 | 205 |
| 478 | iso_pu_bacteria | 2643221591 | 2643964163 | 205 |
| 479 | 3300001989 | JGI24739J22299_10110358 | JGI24739J22299_101103581 | 206 |
| 480 | 3300002987 | JGI25159J45721_1022004 | JGI25159J45721_10220042 | 206 |
| 481 | 3300003187 | JGI25151J46595_10000251 | JGI25151J46595_1000025152 | 206 |
| 482 | 3300003215 | JGI25153J46596_10000430 | JGI25153J46596_1000043012 | 206 |
| 483 | 3300003215 | JGI25153J46596_10000458 | JGI25153J46596_1000045811 | 206 |
| 484 | 3300003215 | JGI25153J46596_10001248 | JGI25153J46596_100012484 | 206 |
| 485 | 3300003354 | JGI25160J50197_1002571 | JGI25160J50197_10025712 | 206 |
| 486 | 3300003354 | JGI25160J50197_1005261 | JGI25160J50197_10052616 | 206 |
| 487 | 3300003856 | Ga0058692_1001437 | Ga0058692_10014372 | 206 |
| 488 | 3300004625 | Ga0055543_1013739 | Ga0055543_10137392 | 206 |
| 489 | 3300005262 | Ga0065165_1002812 | Ga0065165_10028127 | 206 |
| 490 | 3300005262 | Ga0065165_1003726 | Ga0065165_10037263 | 206 |
| 491 | 3300005262 | Ga0065165_1030670 | Ga0065165_10306702 | 206 |
| 492 | 3300005289 | Ga0065704_10002985 | Ga0065704_100029854 | 206 |
| 493 | 3300005327 | Ga0070658_10318671 | Ga0070658_103186711 | 206 |
| 494 | 3300005331 | Ga0070670_100656901 | Ga0070670_1006569011 | 206 |
| 495 | 3300005334 | Ga0068869_100738779 | Ga0068869_1007387791 | 206 |
| 496 | 3300005335 | Ga0070666_10080081 | Ga0070666_100800812 | 206 |
| 497 | 3300005337 | Ga0070682_100057836 | Ga0070682_1000578363 | 206 |
| 498 | 3300005355 | Ga0070671_100742566 | Ga0070671_1007425661 | 206 |
| 499 | 3300005367 | Ga0070667_100256167 | Ga0070667_1002561672 | 206 |
| 500 | 3300005455 | Ga0070663_100145395 | Ga0070663_1001453952 | 206 |
| 501 | 3300005456 | Ga0070678_100161945 | Ga0070678_1001619452 | 206 |
| 502 | 3300005457 | Ga0070662_100238073 | Ga0070662_1002380732 | 206 |
| 503 | 3300005548 | Ga0070665_100019592 | Ga0070665_1000195925 | 206 |
| 504 | 3300005548 | Ga0070665_100503361 | Ga0070665_1005033612 | 206 |
| 505 | 3300005577 | Ga0068857_100523593 | Ga0068857_1005235931 | 206 |
| 506 | 3300005578 | Ga0068854_100672897 | Ga0068854_1006728972 | 206 |
| 507 | 3300005614 | Ga0068856_100146435 | Ga0068856_1001464352 | 206 |
| 508 | 3300005616 | Ga0068852_100003079 | Ga0068852_1000030793 | 206 |
| 509 | 3300005616 | Ga0068852_100054851 | Ga0068852_1000548512 | 206 |
| 510 | 3300005718 | Ga0068866_10275015 | Ga0068866_102750152 | 206 |
| 511 | 3300005983 | Ga0081540_1030153 | Ga0081540_10301532 | 206 |
| 512 | 3300005983 | Ga0081540_1053749 | Ga0081540_10537492 | 206 |
| 513 | 3300006038 | Ga0075365_10054337 | Ga0075365_100543373 | 206 |
| 514 | 3300006038 | Ga0075365_10178292 | Ga0075365_101782922 | 206 |
| 515 | 3300006048 | Ga0075363_100016148 | Ga0075363_1000161483 | 206 |
| 516 | 3300006048 | Ga0075363_100135627 | Ga0075363_1001356271 | 206 |
| 517 | 3300006051 | Ga0075364_10071264 | Ga0075364_100712643 | 206 |
| 518 | 3300006051 | Ga0075364_10078515 | Ga0075364_100785152 | 206 |
| 519 | 3300006178 | Ga0075367_10070888 | Ga0075367_100708882 | 206 |
| 520 | 3300006186 | Ga0075369_10016015 | Ga0075369_100160153 | 206 |
| 521 | 3300006186 | Ga0075369_10056855 | Ga0075369_100568551 | 206 |
| 522 | 3300006195 | Ga0075366_10081027 | Ga0075366_100810272 | 206 |
| 523 | 3300006353 | Ga0075370_10041412 | Ga0075370_100414123 | 206 |
| 524 | 3300006353 | Ga0075370_10069609 | Ga0075370_100696092 | 206 |
| 525 | 3300006942 | Ga0099824_1018757 | Ga0099824_10187573 | 206 |
| 526 | 3300006948 | Ga0099826_10003152 | Ga0099826_100031529 | 206 |
| 527 | 3300006948 | Ga0099826_10196678 | Ga0099826_101966781 | 206 |
| 528 | 3300009093 | Ga0105240_10007593 | Ga0105240_100075932 | 206 |
| 529 | 3300009098 | Ga0105245_10304197 | Ga0105245_103041972 | 206 |
| 530 | 3300009101 | Ga0105247_10310510 | Ga0105247_103105102 | 206 |
| 531 | 3300009174 | Ga0105241_10175003 | Ga0105241_101750032 | 206 |
| 532 | 3300009174 | Ga0105241_10402188 | Ga0105241_104021882 | 206 |
| 533 | 3300009176 | Ga0105242_10243892 | Ga0105242_102438922 | 206 |
| 534 | 3300009177 | Ga0105248_10291812 | Ga0105248_102918122 | 206 |
| 535 | 3300009545 | Ga0105237_10001252 | Ga0105237_1000125224 | 206 |
| 536 | 3300009545 | Ga0105237_10482024 | Ga0105237_104820242 | 206 |
| 537 | 3300009545 | Ga0105237_10771984 | Ga0105237_107719842 | 206 |
| 538 | 3300009551 | Ga0105238_10152325 | Ga0105238_101523252 | 206 |
| 539 | 3300010375 | Ga0105239_10580168 | Ga0105239_105801682 | 206 |
| 540 | 3300011119 | Ga0105246_10128951 | Ga0105246_101289512 | 206 |
| 541 | 3300013104 | Ga0157370_10240313 | Ga0157370_102403132 | 206 |
| 542 | 3300014325 | Ga0163163_10220165 | Ga0163163_102201652 | 206 |
| 543 | 3300015262 | Ga0182007_10140073 | Ga0182007_101400732 | 206 |
| 544 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002755 | 206 |
| 545 | 3300021321 | Ga0214542_1000153 | Ga0214542_100015348 | 206 |
| 546 | 3300021324 | Ga0214545_1000018 | Ga0214545_100001894 | 206 |
| 547 | 3300021327 | Ga0214543_1000001 | Ga0214543_100000123 | 206 |
| 548 | 3300025245 | Ga0207425_1028214 | Ga0207425_10282142 | 206 |
| 549 | 3300025254 | Ga0209148_1000274 | Ga0209148_100027419 | 206 |
| 550 | 3300025261 | Ga0209233_1006973 | Ga0209233_10069732 | 206 |
| 551 | 3300025272 | Ga0209455_1002505 | Ga0209455_10025053 | 206 |
| 552 | 3300025284 | Ga0209130_1003833 | Ga0209130_10038334 | 206 |
| 553 | 3300025294 | Ga0209025_1000478 | Ga0209025_100047860 | 206 |
| 554 | 3300025294 | Ga0209025_1000622 | Ga0209025_100062252 | 206 |
| 555 | 3300025295 | Ga0209564_1001354 | Ga0209564_100135414 | 206 |
| 556 | 3300025295 | Ga0209564_1004180 | Ga0209564_10041808 | 206 |
| 557 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021380 | 206 |
| 558 | 3300025297 | Ga0209758_1000211 | Ga0209758_100021173 | 206 |
| 559 | 3300025297 | Ga0209758_1002374 | Ga0209758_100237416 | 206 |
| 560 | 3300025297 | Ga0209758_1004266 | Ga0209758_10042665 | 206 |
| 561 | 3300025297 | Ga0209758_1007536 | Ga0209758_10075367 | 206 |
| 562 | 3300025297 | Ga0209758_1015829 | Ga0209758_10158293 | 206 |
| 563 | 3300025299 | Ga0209256_1004128 | Ga0209256_10041284 | 206 |
| 564 | 3300025299 | Ga0209256_1047672 | Ga0209256_10476721 | 206 |
| 565 | 3300025302 | Ga0207426_1000085 | Ga0207426_100008591 | 206 |
| 566 | 3300025302 | Ga0207426_1000143 | Ga0207426_1000143134 | 206 |
| 567 | 3300025302 | Ga0207426_1000687 | Ga0207426_10006876 | 206 |
| 568 | 3300025302 | Ga0207426_1018646 | Ga0207426_10186462 | 206 |
| 569 | 3300025304 | Ga0209257_1000883 | Ga0209257_10008836 | 206 |
| 570 | 3300025304 | Ga0209257_1028788 | Ga0209257_10287882 | 206 |
| 571 | 3300025304 | Ga0209257_1032587 | Ga0209257_10325871 | 206 |
| 572 | 3300025903 | Ga0207680_10402174 | Ga0207680_104021742 | 206 |
| 573 | 3300025904 | Ga0207647_10048671 | Ga0207647_100486713 | 206 |
| 574 | 3300025904 | Ga0207647_10306704 | Ga0207647_103067042 | 206 |
| 575 | 3300025905 | Ga0207685_10082736 | Ga0207685_100827362 | 206 |
| 576 | 3300025909 | Ga0207705_10228043 | Ga0207705_102280432 | 206 |
| 577 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015427 | 206 |
| 578 | 3300025914 | Ga0207671_10007054 | Ga0207671_100070545 | 206 |
| 579 | 3300025914 | Ga0207671_10169184 | Ga0207671_101691842 | 206 |
| 580 | 3300025914 | Ga0207671_10294054 | Ga0207671_102940542 | 206 |
| 581 | 3300025919 | Ga0207657_10131973 | Ga0207657_101319732 | 206 |
| 582 | 3300025927 | Ga0207687_10213064 | Ga0207687_102130642 | 206 |
| 583 | 3300025931 | Ga0207644_10486928 | Ga0207644_104869282 | 206 |
| 584 | 3300025933 | Ga0207706_10127998 | Ga0207706_101279982 | 206 |
| 585 | 3300025933 | Ga0207706_10952648 | Ga0207706_109526481 | 206 |
| 586 | 3300025936 | Ga0207670_10738755 | Ga0207670_107387552 | 206 |
| 587 | 3300025940 | Ga0207691_10476595 | Ga0207691_104765951 | 206 |
| 588 | 3300025941 | Ga0207711_10648309 | Ga0207711_106483092 | 206 |
| 589 | 3300025945 | Ga0207679_10572101 | Ga0207679_105721012 | 206 |
| 590 | 3300025949 | Ga0207667_10511390 | Ga0207667_105113902 | 206 |
| 591 | 3300025972 | Ga0207668_11148299 | Ga0207668_111482991 | 206 |
| 592 | 3300025986 | Ga0207658_10099606 | Ga0207658_100996062 | 206 |
| 593 | 3300026067 | Ga0207678_10134291 | Ga0207678_101342912 | 206 |
| 594 | 3300026067 | Ga0207678_10149331 | Ga0207678_101493312 | 206 |
| 595 | 3300026067 | Ga0207678_10199958 | Ga0207678_101999582 | 206 |
| 596 | 3300026095 | Ga0207676_10817235 | Ga0207676_108172351 | 206 |
| 597 | 3300026116 | Ga0207674_10235516 | Ga0207674_102355162 | 206 |
| 598 | 3300026121 | Ga0207683_10855030 | Ga0207683_108550302 | 206 |
| 599 | 3300026142 | Ga0207698_10073854 | Ga0207698_100738542 | 206 |
| 600 | 3300027296 | Ga0209389_1010332 | Ga0209389_10103324 | 206 |
| 601 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003300 | 206 |
| 602 | 3300027357 | Ga0209589_1000180 | Ga0209589_10001802 | 206 |
| 603 | 3300027361 | Ga0209489_100031 | Ga0209489_100031113 | 206 |
| 604 | 3300027666 | Ga0209282_1000245 | Ga0209282_100024520 | 206 |
| 605 | 3300028379 | Ga0268266_10024153 | Ga0268266_100241532 | 206 |
| 606 | 3300028379 | Ga0268266_10461763 | Ga0268266_104617632 | 206 |
| 607 | 3300028794 | Ga0307515_10022313 | Ga0307515_100223132 | 206 |
| 608 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004751 | 206 |
| 609 | 3300031247 | Ga0265340_10000891 | Ga0265340_1000089114 | 206 |
| 610 | 3300031548 | Ga0307408_100055761 | Ga0307408_1000557613 | 206 |
| 611 | 3300031711 | Ga0265314_10106061 | Ga0265314_101060612 | 206 |
| 612 | 3300031712 | Ga0265342_10075824 | Ga0265342_100758242 | 206 |
| 613 | 3300031852 | Ga0307410_10102148 | Ga0307410_101021482 | 206 |
| 614 | 3300031911 | Ga0307412_10787951 | Ga0307412_107879511 | 206 |
| 615 | 3300031995 | Ga0307409_100421292 | Ga0307409_1004212921 | 206 |
| 616 | 3300037418 | Ga0395900_0215646 | Ga0395900_0215646_1043_1708 | 206 |
| 617 | 3300037418 | Ga0395900_0953459 | Ga0395900_0953459_60_725 | 206 |
| 618 | 3300037466 | Ga0395898_0488174 | Ga0395898_0488174_269_934 | 206 |
| 619 | 3300037471 | Ga0395905_0033610 | Ga0395905_0033610_1135_1800 | 206 |
| 620 | 3300037471 | Ga0395905_0122291 | Ga0395905_0122291_300_965 | 206 |
| 621 | 3300037853 | Ga0436364_0854504 | Ga0436364_0854504_301_966 | 206 |
| 622 | 3300039437 | Ga0436365_1315065 | Ga0436365_1315065_335_1000 | 206 |
| 623 | 3300041458 | Ga0451798_0714672 | Ga0451798_0714672_102_767 | 206 |
| 624 | 3300041491 | Ga0451833_0015134 | Ga0451833_0015134_31_696 | 206 |
| 625 | 3300041501 | Ga0451845_0496252 | Ga0451845_0496252_45_710 | 206 |
| 626 | 3300042004 | Ga0439445_0032561 | Ga0439445_0032561_248_916 | 206 |
| 627 | 3300042137 | Ga0450902_017989 | Ga0450902_017989_11_679 | 206 |
| 628 | 3300044656 | Ga0466969_0027418 | Ga0466969_0027418_1677_2342 | 206 |
| 629 | 3300044658 | Ga0466972_0000188 | Ga0466972_0000188_33260_33925 | 206 |
| 630 | 3300044658 | Ga0466972_0010330 | Ga0466972_0010330_3922_4587 | 206 |
| 631 | 3300044683 | Ga0466965_0020027 | Ga0466965_0020027_854_1519 | 206 |
| 632 | 3300044684 | Ga0466966_0001263 | Ga0466966_0001263_6541_7206 | 206 |
| 633 | 3300044693 | Ga0466961_0000587 | Ga0466961_0000587_13411_14076 | 206 |
| 634 | 3300044694 | Ga0466963_0132104 | Ga0466963_0132104_88_753 | 206 |
| 635 | 3300044735 | Ga0466968_0177787 | Ga0466968_0177787_15_680 | 206 |
| 636 | 3300044765 | Ga0466970_0112654 | Ga0466970_0112654_478_1143 | 206 |
| 637 | 3300044901 | Ga0466960_0017610 | Ga0466960_0017610_1195_1860 | 206 |
| 638 | 3300044901 | Ga0466960_0047816 | Ga0466960_0047816_86_751 | 206 |
| 639 | 3300044901 | Ga0466960_0253196 | Ga0466960_0253196_84_749 | 206 |
| 640 | 3300045049 | Ga0466959_0290768 | Ga0466959_0290768_329_994 | 206 |
| 641 | 3300045836 | Ga0466958_0359690 | Ga0466958_0359690_82_747 | 206 |
| 642 | 3300045976 | Ga0466967_0007932 | Ga0466967_0007932_5354_6019 | 206 |
| 643 | 3300046454 | Ga0495592_0174189 | Ga0495592_0174189_341_1006 | 206 |
| 644 | 3300046460 | Ga0495638_0005484 | Ga0495638_0005484_824_1489 | 206 |
| 645 | 3300046462 | Ga0495651_0010856 | Ga0495651_0010856_3405_4070 | 206 |
| 646 | 3300046463 | Ga0495653_0245357 | Ga0495653_0245357_474_1139 | 206 |
| 647 | 3300046477 | Ga0495664_0026263 | Ga0495664_0026263_1043_1708 | 206 |
| 648 | 3300046507 | Ga0495606_0246069 | Ga0495606_0246069_204_869 | 206 |
| 649 | 3300046511 | Ga0495608_0040710 | Ga0495608_0040710_1555_2220 | 206 |
| 650 | 3300046512 | Ga0495610_0171979 | Ga0495610_0171979_207_872 | 206 |
| 651 | 3300046513 | Ga0495616_0034642 | Ga0495616_0034642_872_1537 | 206 |
| 652 | 3300046516 | Ga0495628_0030307 | Ga0495628_0030307_777_1442 | 206 |
| 653 | 3300046518 | Ga0495631_0094186 | Ga0495631_0094186_501_1166 | 206 |
| 654 | 3300046519 | Ga0495632_0097477 | Ga0495632_0097477_560_1249 | 206 |
| 655 | 3300046522 | Ga0495643_0048350 | Ga0495643_0048350_712_1377 | 206 |
| 656 | 3300046522 | Ga0495643_0115321 | Ga0495643_0115321_237_902 | 206 |
| 657 | 3300046524 | Ga0495648_0119955 | Ga0495648_0119955_437_1102 | 206 |
| 658 | 3300046529 | Ga0495652_0053710 | Ga0495652_0053710_1084_1749 | 206 |
| 659 | 3300046533 | Ga0495640_0017481 | Ga0495640_0017481_2361_3026 | 206 |
| 660 | 3300046538 | Ga0495609_0070451 | Ga0495609_0070451_141_806 | 206 |
| 661 | 3300046542 | Ga0495597_0129804 | Ga0495597_0129804_266_931 | 206 |
| 662 | 3300046543 | Ga0495645_0130515 | Ga0495645_0130515_10_675 | 206 |
| 663 | 3300046559 | Ga0495667_0146737 | Ga0495667_0146737_734_1399 | 206 |
| 664 | 3300046616 | Ga0495668_0127682 | Ga0495668_0127682_383_1048 | 206 |
| 665 | 3300046616 | Ga0495668_0130090 | Ga0495668_0130090_512_1177 | 206 |
| 666 | 3300046648 | Ga0495611_0031892 | Ga0495611_0031892_644_1309 | 206 |
| 667 | 3300046660 | Ga0495625_0081399 | Ga0495625_0081399_1220_1885 | 206 |
| 668 | 3300046665 | Ga0495661_0134631 | Ga0495661_0134631_425_1090 | 206 |
| 669 | 3300046680 | Ga0495646_0016495 | Ga0495646_0016495_1092_1757 | 206 |
| 670 | 3300046691 | Ga0495670_0036549 | Ga0495670_0036549_1359_2024 | 206 |
| 671 | 3300046809 | Ga0495600_0004694 | Ga0495600_0004694_1482_2147 | 206 |
| 672 | 3300047317 | Ga0495604_0006635 | Ga0495604_0006635_5413_6078 | 206 |
| 673 | 3300047320 | Ga0495672_0038074 | Ga0495672_0038074_1517_2182 | 206 |
| 674 | 3300047322 | Ga0495680_0002702 | Ga0495680_0002702_1692_2357 | 206 |
| 675 | 3300047443 | Ga0495687_097552 | Ga0495687_097552_312_977 | 206 |
| 676 | 3300047444 | Ga0495675_0031749 | Ga0495675_0031749_1062_1727 | 206 |
| 677 | 3300047469 | Ga0495673_0032706 | Ga0495673_0032706_930_1595 | 206 |
| 678 | 3300047470 | Ga0495681_0140369 | Ga0495681_0140369_198_863 | 206 |
| 679 | 3300047471 | Ga0495684_0219050 | Ga0495684_0219050_439_1104 | 206 |
| 680 | 3300048088 | Ga0495602_0022693 | Ga0495602_0022693_2880_3545 | 206 |
| 681 | 3300048091 | Ga0495626_0027116 | Ga0495626_0027116_1503_2168 | 206 |
| 682 | 3300048904 | Ga0496101_0419742 | Ga0496101_0419742_251_916 | 206 |
| 683 | 3300048905 | Ga0496102_0381950 | Ga0496102_0381950_202_867 | 206 |
| 684 | 3300048906 | Ga0496103_0037348 | Ga0496103_0037348_896_1561 | 206 |
| 685 | 3300048907 | Ga0496104_0082005 | Ga0496104_0082005_1671_2336 | 206 |
| 686 | 3300048909 | Ga0496106_0028578 | Ga0496106_0028578_2449_3114 | 206 |
| 687 | 3300048909 | Ga0496106_0118187 | Ga0496106_0118187_1233_1898 | 206 |
| 688 | 3300048909 | Ga0496106_0391116 | Ga0496106_0391116_49_714 | 206 |
| 689 | 3300048910 | Ga0496107_0085273 | Ga0496107_0085273_693_1358 | 206 |
| 690 | 3300048910 | Ga0496107_0099829 | Ga0496107_0099829_20_685 | 206 |
| 691 | 3300048911 | Ga0496108_0231713 | Ga0496108_0231713_80_745 | 206 |
| 692 | 3300048911 | Ga0496108_0325947 | Ga0496108_0325947_637_1302 | 206 |
| 693 | 3300048913 | Ga0496110_0341343 | Ga0496110_0341343_357_1022 | 206 |
| 694 | 3300048913 | Ga0496110_0603622 | Ga0496110_0603622_49_714 | 206 |
| 695 | 3300048914 | Ga0496111_0117275 | Ga0496111_0117275_1028_1693 | 206 |
| 696 | 3300048915 | Ga0496112_0186673 | Ga0496112_0186673_432_1097 | 206 |
| 697 | 3300048916 | Ga0496113_0187902 | Ga0496113_0187902_835_1500 | 206 |
| 698 | 3300048916 | Ga0496113_0292578 | Ga0496113_0292578_582_1247 | 206 |
| 699 | 3300048919 | Ga0496116_0005629 | Ga0496116_0005629_1748_2413 | 206 |
| 700 | 3300048919 | Ga0496116_0045623 | Ga0496116_0045623_832_1497 | 206 |
| 701 | 3300048919 | Ga0496116_0220168 | Ga0496116_0220168_136_828 | 206 |
| 702 | 3300048919 | Ga0496116_0271295 | Ga0496116_0271295_107_772 | 206 |
| 703 | 3300048920 | Ga0496117_0018170 | Ga0496117_0018170_1869_2561 | 206 |
| 704 | 3300048920 | Ga0496117_0212504 | Ga0496117_0212504_381_1046 | 206 |
| 705 | 3300048921 | Ga0496118_0016217 | Ga0496118_0016217_39_704 | 206 |
| 706 | 3300048921 | Ga0496118_0022563 | Ga0496118_0022563_2469_3134 | 206 |
| 707 | 3300048921 | Ga0496118_0195194 | Ga0496118_0195194_300_965 | 206 |
| 708 | 3300048922 | Ga0496119_0002464 | Ga0496119_0002464_11553_12218 | 206 |
| 709 | 3300048922 | Ga0496119_0043733 | Ga0496119_0043733_145_837 | 206 |
| 710 | 3300048922 | Ga0496119_0164862 | Ga0496119_0164862_394_1059 | 206 |
| 711 | 3300048922 | Ga0496119_0164915 | Ga0496119_0164915_107_772 | 206 |
| 712 | 3300048922 | Ga0496119_0217495 | Ga0496119_0217495_114_779 | 206 |
| 713 | 3300048923 | Ga0496120_0055427 | Ga0496120_0055427_1092_1784 | 206 |
| 714 | 3300048923 | Ga0496120_0058683 | Ga0496120_0058683_115_780 | 206 |
| 715 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_875081_875773 | 206 |
| 716 | 3300048924 | Ga0496121_0010528 | Ga0496121_0010528_8659_9324 | 206 |
| 717 | 3300048924 | Ga0496121_0040610 | Ga0496121_0040610_3217_3882 | 206 |
| 718 | 3300048924 | Ga0496121_0151805 | Ga0496121_0151805_522_1163 | 206 |
| 719 | 3300048925 | Ga0496122_0016451 | Ga0496122_0016451_4946_5611 | 206 |
| 720 | 3300048925 | Ga0496122_0036331 | Ga0496122_0036331_2801_3466 | 206 |
| 721 | 3300048925 | Ga0496122_0075684 | Ga0496122_0075684_1617_2282 | 206 |
| 722 | 3300048925 | Ga0496122_0195777 | Ga0496122_0195777_430_1095 | 206 |
| 723 | 3300048925 | Ga0496122_0197800 | Ga0496122_0197800_223_915 | 206 |
| 724 | 3300048925 | Ga0496122_0202949 | Ga0496122_0202949_59_724 | 206 |
| 725 | 3300048926 | Ga0496123_0072116 | Ga0496123_0072116_70_735 | 206 |
| 726 | 3300048926 | Ga0496123_0178332 | Ga0496123_0178332_39_731 | 206 |
| 727 | 3300048928 | Ga0496125_0000170 | Ga0496125_0000170_71258_71950 | 206 |
| 728 | 3300048928 | Ga0496125_0000477 | Ga0496125_0000477_25206_25871 | 206 |
| 729 | 3300048928 | Ga0496125_0003063 | Ga0496125_0003063_15961_16626 | 206 |
| 730 | 3300048928 | Ga0496125_0003174 | Ga0496125_0003174_1085_1750 | 206 |
| 731 | 3300048928 | Ga0496125_0011833 | Ga0496125_0011833_6345_7010 | 206 |
| 732 | 3300048928 | Ga0496125_0071108 | Ga0496125_0071108_618_1283 | 206 |
| 733 | 3300048928 | Ga0496125_0245842 | Ga0496125_0245842_427_1092 | 206 |
| 734 | 3300048929 | Ga0496126_0004626 | Ga0496126_0004626_792_1457 | 206 |
| 735 | 3300048929 | Ga0496126_0036837 | Ga0496126_0036837_1575_2267 | 206 |
| 736 | 3300048929 | Ga0496126_0045598 | Ga0496126_0045598_2524_3189 | 206 |
| 737 | 3300048929 | Ga0496126_0081599 | Ga0496126_0081599_544_1209 | 206 |
| 738 | 3300048929 | Ga0496126_0087837 | Ga0496126_0087837_810_1478 | 206 |
| 739 | 3300048929 | Ga0496126_0236965 | Ga0496126_0236965_99_791 | 206 |
| 740 | 3300048929 | Ga0496126_0391947 | Ga0496126_0391947_449_1114 | 206 |
| 741 | 3300048929 | Ga0496126_0420269 | Ga0496126_0420269_107_772 | 206 |
| 742 | 3300048929 | Ga0496126_0494113 | Ga0496126_0494113_245_910 | 206 |
| 743 | 3300049570 | Ga0501033_0314505 | Ga0501033_0314505_124_789 | 206 |
| 744 | 3300049571 | Ga0501034_0042325 | Ga0501034_0042325_1843_2508 | 206 |
| 745 | 3300049573 | Ga0501037_0003530 | Ga0501037_0003530_7608_8273 | 206 |
| 746 | 3300050490 | nmdc:mga03n38_13013_c1 | nmdc:mga03n38_13013_c1_1616_2281 | 206 |
| 747 | 3300050490 | nmdc:mga03n38_81392_c1 | nmdc:mga03n38_81392_c1_536_1201 | 206 |
| 748 | 3300050491 | nmdc:mga00v17_134463_c1 | nmdc:mga00v17_134463_c1_351_1016 | 206 |
| 749 | 3300050492 | nmdc:mga0yw44_162114_c1 | nmdc:mga0yw44_162114_c1_150_815 | 206 |
| 750 | 3300050492 | nmdc:mga0yw44_185037_c1 | nmdc:mga0yw44_185037_c1_616_1281 | 206 |
| 751 | 3300050492 | nmdc:mga0yw44_72573_c1 | nmdc:mga0yw44_72573_c1_904_1569 | 206 |
| 752 | 3300050493 | nmdc:mga0k408_111800_c1 | nmdc:mga0k408_111800_c1_196_861 | 206 |
| 753 | 3300050494 | nmdc:mga06z11_78824_c1 | nmdc:mga06z11_78824_c1_544_1209 | 206 |
| 754 | 3300050495 | nmdc:mga04h51_12233_c1 | nmdc:mga04h51_12233_c1_1244_1909 | 206 |
| 755 | 3300050496 | nmdc:mga07m45_39342_c1 | nmdc:mga07m45_39342_c1_1623_2288 | 206 |
| 756 | 3300050496 | nmdc:mga07m45_65906_c1 | nmdc:mga07m45_65906_c1_42_707 | 206 |
| 757 | 3300050516 | nmdc:mga0sz30_120099_c1 | nmdc:mga0sz30_120099_c1_203_868 | 206 |
| 758 | 3300050516 | nmdc:mga0sz30_8932_c1 | nmdc:mga0sz30_8932_c1_2874_3539 | 206 |
| 759 | 3300053079 | Ga0500610_0165641 | Ga0500610_0165641_250_915 | 206 |
| 760 | 3300053083 | Ga0495655_0081804 | Ga0495655_0081804_61_726 | 206 |
| 761 | 3300053084 | Ga0495595_0087431 | Ga0495595_0087431_558_1223 | 206 |
| 762 | 3300053086 | Ga0500578_0066446 | Ga0500578_0066446_358_1023 | 206 |
| 763 | 3300053087 | Ga0500643_000085 | Ga0500643_000085_57357_58022 | 206 |
| 764 | 3300053089 | Ga0500581_074781 | Ga0500581_074781_713_1378 | 206 |
| 765 | 3300053090 | Ga0500646_0018471 | Ga0500646_0018471_992_1657 | 206 |
| 766 | 3300053093 | Ga0500651_0100180 | Ga0500651_0100180_29_694 | 206 |
| 767 | 3300053093 | Ga0500651_0137222 | Ga0500651_0137222_171_836 | 206 |
| 768 | 3300053098 | Ga0500650_0040958 | Ga0500650_0040958_575_1240 | 206 |
| 769 | 3300053103 | Ga0500555_001875 | Ga0500555_001875_977_1642 | 206 |
| 770 | 3300053103 | Ga0500555_034629 | Ga0500555_034629_105_770 | 206 |
| 771 | 3300053104 | Ga0500556_0000066 | Ga0500556_0000066_24370_25035 | 206 |
| 772 | 3300053104 | Ga0500556_0000070 | Ga0500556_0000070_52385_53050 | 206 |
| 773 | 3300053104 | Ga0500556_0043429 | Ga0500556_0043429_18_683 | 206 |
| 774 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_64648_65313 | 206 |
| 775 | 3300053108 | Ga0500562_030571 | Ga0500562_030571_283_948 | 206 |
| 776 | 3300053108 | Ga0500562_093374 | Ga0500562_093374_103_768 | 206 |
| 777 | 3300053109 | Ga0500569_011975 | Ga0500569_011975_1270_1935 | 206 |
| 778 | 3300053109 | Ga0500569_022888 | Ga0500569_022888_37_702 | 206 |
| 779 | 3300053121 | Ga0500607_041458 | Ga0500607_041458_1559_2224 | 206 |
| 780 | 3300053121 | Ga0500607_165094 | Ga0500607_165094_253_918 | 206 |
| 781 | 3300053122 | Ga0500608_050882 | Ga0500608_050882_433_1098 | 206 |
| 782 | 3300053125 | Ga0500618_001004 | Ga0500618_001004_11064_11753 | 206 |
| 783 | 3300053125 | Ga0500618_015946 | Ga0500618_015946_1034_1699 | 206 |
| 784 | 3300053125 | Ga0500618_019260 | Ga0500618_019260_212_877 | 206 |
| 785 | 3300053130 | Ga0500642_0000072 | Ga0500642_0000072_1377_2042 | 206 |
| 786 | 3300053130 | Ga0500642_0000442 | Ga0500642_0000442_8284_8949 | 206 |
| 787 | 3300053130 | Ga0500642_0074914 | Ga0500642_0074914_431_1096 | 206 |
| 788 | 3300053130 | Ga0500642_0178266 | Ga0500642_0178266_40_705 | 206 |
| 789 | 3300053131 | Ga0500652_041482 | Ga0500652_041482_632_1297 | 206 |
| 790 | 3300053131 | Ga0500652_224857 | Ga0500652_224857_21_686 | 206 |
| 791 | 3300053134 | Ga0500658_0231334 | Ga0500658_0231334_140_805 | 206 |
| 792 | 3300053136 | Ga0500559_0001217 | Ga0500559_0001217_7512_8177 | 206 |
| 793 | 3300053139 | Ga0500568_0003002 | Ga0500568_0003002_7877_8542 | 206 |
| 794 | 3300053139 | Ga0500568_0006816 | Ga0500568_0006816_3040_3705 | 206 |
| 795 | 3300053142 | Ga0500577_0000803 | Ga0500577_0000803_5247_5912 | 206 |
| 796 | 3300053142 | Ga0500577_0030785 | Ga0500577_0030785_993_1658 | 206 |
| 797 | 3300053146 | Ga0500588_0161712 | Ga0500588_0161712_140_805 | 206 |
| 798 | 3300053148 | Ga0500590_024498 | Ga0500590_024498_346_1011 | 206 |
| 799 | 3300053150 | Ga0500603_088427 | Ga0500603_088427_84_749 | 206 |
| 800 | 3300053153 | Ga0500616_0000177 | Ga0500616_0000177_52694_53359 | 206 |
| 801 | 3300053153 | Ga0500616_0067362 | Ga0500616_0067362_1010_1675 | 206 |
| 802 | 3300053155 | Ga0500620_005118 | Ga0500620_005118_965_1630 | 206 |
| 803 | 3300053156 | Ga0500622_0004935 | Ga0500622_0004935_936_1601 | 206 |
| 804 | 3300053161 | Ga0500634_0157095 | Ga0500634_0157095_77_742 | 206 |
| 805 | 3300053177 | Ga0500636_0000103 | Ga0500636_0000103_27003_27668 | 206 |
| 806 | 3300053177 | Ga0500636_0011422 | Ga0500636_0011422_247_912 | 206 |
| 807 | 3300053729 | Ga0500625_115717 | Ga0500625_115717_397_1062 | 206 |
| 808 | 3300053737 | Ga0500601_000169 | Ga0500601_000169_856_1521 | 206 |
| 809 | iso_pu_bacteria | 2510461069 | 2510840244 | 206 |
| 810 | iso_pu_bacteria | 2758568016 | 2758639079 | 206 |
| 811 | iso_pu_bacteria | 2775507049 | 2776916029 | 206 |
| 812 | iso_pu_bacteria | 2854911287 | 2854916394 | 206 |
| 813 | iso_pu_bacteria | 2919450847 | 2919453338 | 206 |
| 814 | iso_pu_bacteria | 2929138655 | 2929141261 | 206 |
| 815 | iso_pu_bacteria | 8001845381 | 8001847134 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
27
210
0.93
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.9037 | 8 | 181 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.883 | 12 | 174 |
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.8825 | 12 | 174 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.8809 | 8 | 181 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.8779 | 4 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZZ1_20_231_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9298 | 7 | 189 | 1.10.3720.10 |
| 3dhwF00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9037 | 8 | 181 | 1.10.3720.10 |
| af_Q2G0V1_7_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8996 | 7 | 200 | 1.10.3720.10 |
| af_P9WG11_24_299_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8813 | 12 | 164 | 1.10.3720.10 |
| 3dhwE00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8809 | 8 | 181 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847JIQ3-F1-model_v4 | ABC transporter permease | 0.995 | 1 | 175 |
GO:0005886
GO:0048473 |
| AF-A0A7J6YUS8-F1-model_v4 | deleted | 0.9894 | 20 | 168 |
|
| AF-A0A847JIQ3-F1-model_v4 | ABC transporter permease | 0.9838 | 1 | 175 |
GO:0005886
GO:0048473 |
| AF-A0A4U3BA09-F1-model_v4 | deleted | 0.9836 | 9 | 165 |
|
| AF-A0A3S1DYD4-F1-model_v4 | ABC transporter permease | 0.9832 | 1 | 162 |
GO:0005886
GO:0048473 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar