F482038

General Info

Members Datasets Scaffolds Average Seq Length
815 594 516 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016522445|8016529994
Length 233
Sequence LINLIIQATGESLYMVGLAALIGTVIGLPLGVFLATSRKGELFAAPVVNRVLGIVVNATRSTPFIILVVAIIPFTRLVAGTSIGSTAAIVPLTIASAPFIARLVEAAIREVDGGLIETASSFGASPIQIVLKVLIPEALPGLLLALTLAVVSLLGYSAMVGAVGGGGLGDLGIRYGYQRFMPEMMLAVVVVLIALVQLVQSAGDYLARRGQPPAAASLTSVGGGPHIGYLMWF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
11 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
28 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
29 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
30 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
31 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
32 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
33 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
34 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
35 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
36 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
37 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
38 2643221568 Rhizobium sp. Root564 Isolate Unclassified
39 2643221582 Rhizobium sp. Root651 Isolate Unclassified
40 2643221591 Devosia sp. Root685 Isolate Unclassified
41 2643221688 Rhizobium sp. Root482 Isolate Unclassified
42 2643221693 Rhizobium sp. Root491 Isolate Unclassified
43 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
44 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
45 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
46 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
47 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
48 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
49 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
50 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
51 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
52 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
53 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
54 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
55 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
56 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
57 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
58 2818991467 Bosea vestrisii 3192 Isolate Unclassified
59 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
60 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
61 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
62 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
63 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
64 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
65 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
66 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
67 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
68 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
69 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
70 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
71 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
72 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
73 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
74 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
75 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
76 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
77 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
78 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
79 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
80 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
81 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
82 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
83 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
84 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
85 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
86 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
87 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
88 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
89 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
90 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
91 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
92 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
93 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
94 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
95 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
96 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
97 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
98 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
99 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
100 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
101 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
102 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
103 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
104 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
105 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
106 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
107 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
108 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
109 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
110 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
111 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
112 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
113 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
114 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
115 2854911287 Brucella lupini LUP21 Isolate Unclassified
116 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
117 2855730933 Achromobacter sp. HZ28 Isolate Nodule
118 2855767633 Achromobacter sp. HZ34 Isolate Nodule
119 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
120 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
121 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
122 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
123 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
124 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
125 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
126 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
127 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
128 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
129 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
130 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
131 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
132 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
133 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
134 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
135 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
136 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
137 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
138 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
139 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
140 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
141 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
142 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
143 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
144 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
145 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
146 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
147 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
148 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
149 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
150 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
151 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
152 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
153 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
154 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
155 2904699407
156 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
157 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
158 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
159 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
160 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
161 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
162 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
163 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
164 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
165 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
166 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
167 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
168 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
169 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
170 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
171 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
172 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
173 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
174 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
175 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
176 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
177 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
178 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
179 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
180 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
181 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
182 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
183 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
184 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
185 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
186 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
187 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
188 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
189 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
190 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
191 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
192 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
193 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
194 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
195 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
196 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
197 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
198 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
199 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
200 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
201 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
202 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
203 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
204 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
205 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
206 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
207 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
208 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
209 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
210 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
211 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
212 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
213 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
214 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
215 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
216 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
217 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
218 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
219 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
220 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
221 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
222 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
223 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
224 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
225 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
226 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
227 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
228 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
229 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
230 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
231 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
232 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
233 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
234 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
235 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
236 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
237 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
238 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
239 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
240 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
241 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
242 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
243 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
244 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
245 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
246 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
247 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
248 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
249 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
250 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
251 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
252 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
253 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
254 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
255 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
256 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
257 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
258 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
259 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
260 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
261 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
262 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
263 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
264 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
265 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
266 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
267 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
268 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
269 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
270 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
271 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
272 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
273 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
274 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
275 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
276 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
277 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
278 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
279 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
280 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
281 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
282 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
283 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
284 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
285 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
286 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
287 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
288 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
289 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
290 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
291 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
292 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
293 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
294 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
295 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
296 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
297 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
298 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
299 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
300 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
301 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
302 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
303 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
304 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
305 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
306 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
307 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
308 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
309 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
310 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
311 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
312 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
313 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
314 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
315 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
316 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
317 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
318 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
319 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
320 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
321 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
322 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
323 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
324 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
325 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
326 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
327 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
328 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
329 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
330 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
331 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
332 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
333 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
334 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
335 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
336 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
337 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
340 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
342 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
344 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
345 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
346 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
349 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
387 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
389 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
390 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
391 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
393 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
394 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
395 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
396 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
397 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
398 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
399 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
400 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
401 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
402 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
403 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
404 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
405 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
406 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
407 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
408 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
409 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
410 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
411 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
412 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
413 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
414 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
415 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
416 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
417 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
418 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
419 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
420 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
421 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
422 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
423 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
424 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
425 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
426 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
427 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
428 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
429 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
430 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
431 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
432 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
433 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
434 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
435 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
436 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
437 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
438 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
439 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
440 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
441 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
442 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
443 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
444 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
445 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
446 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
447 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
448 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
449 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
450 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
451 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
452 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
458 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
459 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
460 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
461 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
462 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
463 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
464 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
467 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
468 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
469 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
470 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
471 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
472 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
473 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
474 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
475 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
476 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
477 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
478 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
479 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
480 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
481 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
482 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
483 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
484 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
485 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
486 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
487 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
488 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
489 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
490 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
491 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
492 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
493 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
494 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
495 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
496 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
497 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
506 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
507 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
508 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
509 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
510 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
511 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
512 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
513 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
514 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
515 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
516 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
519 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
520 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
521 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
522 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
523 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
524 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
525 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
526 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
527 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
528 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
529 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
530 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
531 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
532 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
533 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
534 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
535 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
536 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
537 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
541 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
542 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
543 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
544 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
545 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
546 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
547 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
548 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
549 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
550 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
551 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
552 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
553 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
554 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
555 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
556 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
557 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
558 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
559 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
560 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
561 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
562 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
563 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
564 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
565 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
566 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
567 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
568 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
569 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
570 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
571 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
572 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
573 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
574 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
575 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
576 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
577 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
578 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
579 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
580 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
581 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
582 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
583 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
584 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
585 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
586 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
587 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
588 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
589 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
590 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
591 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
592 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
593 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
594 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.39
Metatranscriptomes 0
Isolates 36.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 18.53
Nodule 21.96
Rhizoplane 4.17
Rhizosphere 30.43
Stem 0
Stem Tuber 0.12
Unclassified 24.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10110358 3300001989 Bacteria 826
2 JGI24735J21928_10007393 3300002067 Bacteria 3585
3 JGI25159J45721_1022004 3300002987 Bacteria 1188
4 JGI25151J46595_10000251 3300003187 Bacteria 62870
5 JGI25153J46596_10000430 3300003215 Bacteria 27183
6 JGI25153J46596_10000458 3300003215 Bacteria 26109
7 JGI25153J46596_10001248 3300003215 Bacteria 15329
8 rootH2_10007114 3300003320 Bacteria 1970
9 JGI25160J50197_1002571 3300003354 Bacteria 8390
10 JGI25160J50197_1005261 3300003354 Bacteria 5416
11 Ga0055539_1023632 3300003752 Bacteria 722
12 Ga0058692_1001437 3300003856 Bacteria 8765
13 Ga0055543_1013739 3300004625 Bacteria 1594
14 Ga0065165_1002812 3300005262 Bacteria 13640
15 Ga0065165_1003726 3300005262 Bacteria 10283
16 Ga0065165_1030670 3300005262 Bacteria 1708
17 Ga0065704_10002985 3300005289 Bacteria 4467
18 Ga0070658_10318671 3300005327 Bacteria 1327
19 Ga0070676_10312963 3300005328 Bacteria 1068
20 Ga0070670_100656901 3300005331 Bacteria 941
21 Ga0068869_100738779 3300005334 Bacteria 842
22 Ga0070666_10080081 3300005335 Bacteria 2232
23 Ga0070682_100057836 3300005337 Bacteria 2444
24 Ga0070668_100014846 3300005347 Bacteria 5822
25 Ga0070668_100109611 3300005347 Bacteria 2196
26 Ga0070671_100742566 3300005355 Bacteria 853
27 Ga0070674_100006548 3300005356 Bacteria 6805
28 Ga0070667_100256167 3300005367 Bacteria 1565
29 Ga0070713_100135697 3300005436 Bacteria 2174
30 Ga0070710_10025600 3300005437 Bacteria 3126
31 Ga0070711_100052664 3300005439 Bacteria 2801
32 Ga0070700_100884539 3300005441 Bacteria 726
33 Ga0070663_100145395 3300005455 Bacteria 1814
34 Ga0070663_100281377 3300005455 Bacteria 1326
35 Ga0070663_100451192 3300005455 Bacteria 1060
36 Ga0070678_100161945 3300005456 Bacteria 1814
37 Ga0070662_100238073 3300005457 Bacteria 1459
38 Ga0070662_100265189 3300005457 Bacteria 1385
39 Ga0068867_100214158 3300005459 Bacteria 1549
40 Ga0068853_100044460 3300005539 Bacteria 3802
41 Ga0070672_100306129 3300005543 Bacteria 1348
42 Ga0070686_100406554 3300005544 Bacteria 1037
43 Ga0070665_100019592 3300005548 Bacteria 6792
44 Ga0070665_100211010 3300005548 Bacteria 1942
45 Ga0070665_100236991 3300005548 Bacteria 1825
46 Ga0070665_100503361 3300005548 Bacteria 1222
47 Ga0068857_100523593 3300005577 Bacteria 1114
48 Ga0068854_100672897 3300005578 Bacteria 891
49 Ga0068856_100146435 3300005614 Bacteria 2369
50 Ga0068852_100003079 3300005616 Bacteria 11608
51 Ga0068852_100054851 3300005616 Bacteria 3437
52 Ga0068866_10029830 3300005718 Bacteria 2612
53 Ga0068866_10275015 3300005718 Bacteria 1041
54 Ga0068861_100471423 3300005719 Bacteria 1129
55 Ga0081540_1030153 3300005983 Bacteria 3009
56 Ga0081540_1053749 3300005983 Bacteria 1972
57 Ga0075365_10054337 3300006038 Bacteria 2655
58 Ga0075365_10178292 3300006038 Bacteria 1485
59 Ga0075365_10254087 3300006038 Bacteria 1235
60 Ga0075368_10013851 3300006042 Bacteria 2967
61 Ga0075363_100016148 3300006048 Bacteria 3683
62 Ga0075363_100135627 3300006048 Bacteria 1383
63 Ga0075364_10071264 3300006051 Bacteria 2289
64 Ga0075364_10078515 3300006051 Bacteria 2180
65 Ga0075364_10137803 3300006051 Bacteria 1640
66 Ga0070716_100056422 3300006173 Bacteria 2252
67 Ga0075362_10068801 3300006177 Bacteria 1613
68 Ga0075367_10070888 3300006178 Bacteria 2096
69 Ga0075367_10129362 3300006178 Bacteria 1560
70 Ga0075369_10016015 3300006186 Bacteria 3018
71 Ga0075369_10056855 3300006186 Bacteria 1701
72 Ga0075366_10064496 3300006195 Bacteria 2178
73 Ga0075366_10081027 3300006195 Bacteria 1938
74 Ga0075370_10041412 3300006353 Bacteria 2600
75 Ga0075370_10069609 3300006353 Bacteria 2011
76 Ga0075370_10318076 3300006353 Bacteria 927
77 Ga0099824_1018757 3300006942 Bacteria 5585
78 Ga0099826_10003152 3300006948 Bacteria 11065
79 Ga0099826_10196678 3300006948 Bacteria 1107
80 Ga0105240_10007593 3300009093 Bacteria 15706
81 Ga0105245_10304197 3300009098 Bacteria 1565
82 Ga0105247_10310510 3300009101 Bacteria 1097
83 Ga0105243_10782078 3300009148 Bacteria 939
84 Ga0105241_10175003 3300009174 Bacteria 1775
85 Ga0105241_10402188 3300009174 Bacteria 1201
86 Ga0105242_10243892 3300009176 Bacteria 1616
87 Ga0105242_10683080 3300009176 Bacteria 1002
88 Ga0105248_10291812 3300009177 Bacteria 1836
89 Ga0105237_10001252 3300009545 Bacteria 33910
90 Ga0105237_10482024 3300009545 Bacteria 1247
91 Ga0105237_10771984 3300009545 Bacteria 968
92 Ga0105238_10152325 3300009551 Bacteria 2287
93 Ga0105239_10580168 3300010375 Bacteria 1278
94 Ga0105246_10128951 3300011119 Bacteria 1886
95 Ga0157370_10240313 3300013104 Bacteria 1676
96 Ga0157369_10081684 3300013105 Bacteria 3459
97 Ga0157375_10227560 3300013308 Bacteria 2024
98 Ga0163163_10220165 3300014325 Bacteria 1947
99 Ga0157380_10461719 3300014326 Bacteria 1222
100 Ga0182007_10140073 3300015262 Bacteria 818
101 Ga0183361_10039 3300016635 Bacteria 25237
102 Ga0163161_10012756 3300017792 Bacteria 5837
103 Ga0214544_1000002 3300021320 Bacteria 753857
104 Ga0214542_1000153 3300021321 Bacteria 101854
105 Ga0214545_1000018 3300021324 Bacteria 172019
106 Ga0214543_1000001 3300021327 Bacteria 776921
107 Ga0213876_10214675 3300021384 Bacteria 1023
108 Ga0213875_10174109 3300021388 Bacteria 1011
109 Ga0207425_1028214 3300025245 Bacteria 1140
110 Ga0209677_101840 3300025253 Bacteria 8640
111 Ga0209148_1000274 3300025254 Bacteria 81201
112 Ga0209233_1006973 3300025261 Bacteria 3608
113 Ga0209455_1002505 3300025272 Bacteria 7054
114 Ga0209130_1003833 3300025284 Bacteria 6080
115 Ga0209676_1000214 3300025292 Bacteria 127818
116 Ga0209025_1000478 3300025294 Bacteria 77516
117 Ga0209025_1000622 3300025294 Bacteria 62938
118 Ga0209564_1001354 3300025295 Bacteria 25872
119 Ga0209564_1004180 3300025295 Bacteria 9012
120 Ga0209564_1033313 3300025295 Bacteria 1534
121 Ga0209758_1000021 3300025297 Bacteria 697691
122 Ga0209758_1000211 3300025297 Bacteria 127721
123 Ga0209758_1002374 3300025297 Bacteria 19373
124 Ga0209758_1004266 3300025297 Bacteria 12075
125 Ga0209758_1007536 3300025297 Bacteria 7365
126 Ga0209758_1015829 3300025297 Bacteria 3875
127 Ga0209758_1023139 3300025297 Bacteria 2820
128 Ga0209050_1022914 3300025298 Bacteria 2219
129 Ga0209256_1004128 3300025299 Bacteria 9395
130 Ga0209256_1047672 3300025299 Bacteria 1053
131 Ga0207426_1000085 3300025302 Bacteria 293171
132 Ga0207426_1000143 3300025302 Bacteria 192948
133 Ga0207426_1000687 3300025302 Bacteria 40682
134 Ga0207426_1018646 3300025302 Bacteria 2441
135 Ga0209257_1000883 3300025304 Bacteria 42345
136 Ga0209257_1028788 3300025304 Bacteria 1823
137 Ga0209257_1032587 3300025304 Bacteria 1650
138 Ga0207692_10120042 3300025898 Bacteria 1471
139 Ga0207642_10033767 3300025899 Bacteria 2168
140 Ga0207688_10072635 3300025901 Bacteria 1955
141 Ga0207680_10402174 3300025903 Bacteria 968
142 Ga0207647_10048671 3300025904 Bacteria 2632
143 Ga0207647_10093465 3300025904 Bacteria 1792
144 Ga0207647_10306704 3300025904 Bacteria 903
145 Ga0207685_10082736 3300025905 Bacteria 1332
146 Ga0207699_10043945 3300025906 Bacteria 2599
147 Ga0207705_10228043 3300025909 Bacteria 1416
148 Ga0207695_10000015 3300025913 Bacteria 803205
149 Ga0207671_10007054 3300025914 Bacteria 9837
150 Ga0207671_10169184 3300025914 Bacteria 1696
151 Ga0207671_10294054 3300025914 Bacteria 1283
152 Ga0207693_10008703 3300025915 Bacteria 8298
153 Ga0207663_10182945 3300025916 Bacteria 1498
154 Ga0207657_10131973 3300025919 Bacteria 2047
155 Ga0207687_10063458 3300025927 Bacteria 2615
156 Ga0207687_10213064 3300025927 Bacteria 1517
157 Ga0207644_10486928 3300025931 Bacteria 1016
158 Ga0207706_10127998 3300025933 Bacteria 2233
159 Ga0207706_10261167 3300025933 Bacteria 1512
160 Ga0207706_10952648 3300025933 Bacteria 723
161 Ga0207709_10091806 3300025935 Bacteria 1986
162 Ga0207670_10738755 3300025936 Bacteria 817
163 Ga0207669_10001575 3300025937 Bacteria 9733
164 Ga0207665_10094343 3300025939 Bacteria 2078
165 Ga0207691_10476595 3300025940 Bacteria 1061
166 Ga0207711_10648309 3300025941 Bacteria 985
167 Ga0207689_10316093 3300025942 Bacteria 1295
168 Ga0207679_10572101 3300025945 Bacteria 1016
169 Ga0207667_10511390 3300025949 Bacteria 1217
170 Ga0207668_10078977 3300025972 Bacteria 2378
171 Ga0207668_10667098 3300025972 Bacteria 911
172 Ga0207668_11148299 3300025972 Bacteria 697
173 Ga0207658_10099606 3300025986 Bacteria 2274
174 Ga0207678_10079536 3300026067 Bacteria 2807
175 Ga0207678_10134291 3300026067 Bacteria 2111
176 Ga0207678_10149331 3300026067 Bacteria 1995
177 Ga0207678_10199958 3300026067 Bacteria 1708
178 Ga0207678_10289050 3300026067 Bacteria 1408
179 Ga0207708_10497319 3300026075 Bacteria 1021
180 Ga0207641_10481560 3300026088 Bacteria 1203
181 Ga0207648_10048037 3300026089 Bacteria 3738
182 Ga0207676_10817235 3300026095 Bacteria 910
183 Ga0207674_10235516 3300026116 Bacteria 1778
184 Ga0207675_100516050 3300026118 Bacteria 1191
185 Ga0207683_10855030 3300026121 Bacteria 844
186 Ga0207698_10073854 3300026142 Bacteria 2717
187 Ga0209389_1010332 3300027296 Bacteria 8410
188 Ga0209371_1000003 3300027312 Bacteria 1122971
189 Ga0209589_1000180 3300027357 Bacteria 72900
190 Ga0209489_100031 3300027361 Bacteria 184074
191 Ga0209282_1000245 3300027666 Bacteria 27454
192 Ga0268266_10024153 3300028379 Bacteria 5172
193 Ga0268266_10266392 3300028379 Bacteria 1589
194 Ga0268266_10461763 3300028379 Bacteria 1208
195 Ga0307515_10022313 3300028794 Bacteria 11163
196 Ga0268256_1000004 3300030500 Bacteria 1122967
197 Ga0307511_10000406 3300030521 Bacteria 45893
198 Ga0265325_10050588 3300031241 Bacteria 2139
199 Ga0265340_10000891 3300031247 Bacteria 16923
200 Ga0307408_100055761 3300031548 Bacteria 2863
201 Ga0265314_10106061 3300031711 Bacteria 1796
202 Ga0265342_10075824 3300031712 Bacteria 1950
203 Ga0307410_10102148 3300031852 Bacteria 2057
204 Ga0307407_10193501 3300031903 Bacteria 1358
205 Ga0307412_10787951 3300031911 Bacteria 824
206 Ga0307409_100421292 3300031995 Bacteria 1281
207 Ga0307414_10375336 3300032004 Bacteria 1228
208 Ga0395900_0215646 3300037418 Bacteria 1937
209 Ga0395900_0953459 3300037418 Bacteria 779
210 Ga0395898_0488174 3300037466 Bacteria 1172
211 Ga0395905_0000185 3300037471 Bacteria 99394
212 Ga0395905_0033610 3300037471 Bacteria 4816
213 Ga0395905_0122291 3300037471 Bacteria 2447
214 Ga0436364_0062391 3300037853 Bacteria 2467
215 Ga0436364_0854504 3300037853 Bacteria 1161
216 Ga0436365_0406973 3300039437 Bacteria 950
217 Ga0436365_0435073 3300039437 Bacteria 2775
218 Ga0436365_0435855 3300039437 Bacteria 2457
219 Ga0436365_1315065 3300039437 Bacteria 1017
220 Ga0436365_1860794 3300039437 Bacteria 1646
221 Ga0436360_1118848 3300039438 Bacteria 1240
222 Ga0436361_0487656 3300039447 Bacteria 4039
223 Ga0436363_0824796 3300039450 Bacteria 742
224 Ga0439465_0097569 3300041413 Bacteria 1012
225 Ga0451793_1147702 3300041452 Bacteria 1428
226 Ga0451798_0714672 3300041458 Bacteria 906
227 Ga0451833_0015134 3300041491 Bacteria 869
228 Ga0451845_0496252 3300041501 Bacteria 786
229 Ga0439445_0032561 3300042004 Bacteria 1359
230 Ga0450902_017989 3300042137 Bacteria 1157
231 Ga0466969_0027418 3300044656 Bacteria 2917
232 Ga0466972_0000188 3300044658 Bacteria 47766
233 Ga0466972_0010330 3300044658 Bacteria 4687
234 Ga0466965_0020027 3300044683 Bacteria 3214
235 Ga0466966_0001263 3300044684 Bacteria 16199
236 Ga0466961_0000587 3300044693 Bacteria 23048
237 Ga0466963_0132104 3300044694 Bacteria 1725
238 Ga0466968_0068856 3300044735 Bacteria 1537
239 Ga0466968_0177787 3300044735 Bacteria 988
240 Ga0466970_0112654 3300044765 Bacteria 1486
241 Ga0466970_0143761 3300044765 Bacteria 1315
242 Ga0466957_0084350 3300044842 Bacteria 1983
243 Ga0466960_0017610 3300044901 Bacteria 3118
244 Ga0466960_0047816 3300044901 Bacteria 2053
245 Ga0466960_0253196 3300044901 Bacteria 979
246 Ga0466959_0290768 3300045049 Bacteria 1120
247 Ga0466958_0359690 3300045836 Bacteria 938
248 Ga0466967_0007932 3300045976 Bacteria 7723
249 Ga0466967_0927676 3300045976 Bacteria 866
250 Ga0495592_0174189 3300046454 Bacteria 1471
251 Ga0495603_0183723 3300046455 Bacteria 1210
252 Ga0495629_0007729 3300046459 Bacteria 7912
253 Ga0495638_0005484 3300046460 Bacteria 9432
254 Ga0495651_0010856 3300046462 Bacteria 7004
255 Ga0495651_0377866 3300046462 Bacteria 930
256 Ga0495653_0245357 3300046463 Bacteria 1191
257 Ga0495664_0026263 3300046477 Bacteria 3392
258 Ga0495607_0127641 3300046501 Bacteria 1328
259 Ga0495606_0246069 3300046507 Bacteria 994
260 Ga0495606_0313402 3300046507 Bacteria 846
261 Ga0495608_0040710 3300046511 Bacteria 3112
262 Ga0495610_0171979 3300046512 Bacteria 908
263 Ga0495616_0034642 3300046513 Bacteria 2620
264 Ga0495628_0030307 3300046516 Bacteria 4381
265 Ga0495631_0094186 3300046518 Bacteria 1289
266 Ga0495632_0097477 3300046519 Bacteria 1388
267 Ga0495643_0048350 3300046522 Bacteria 2299
268 Ga0495643_0115321 3300046522 Bacteria 1362
269 Ga0495648_0000426 3300046524 Bacteria 46243
270 Ga0495648_0002857 3300046524 Bacteria 15549
271 Ga0495648_0119955 3300046524 Bacteria 1416
272 Ga0495652_0053710 3300046529 Bacteria 3433
273 Ga0495640_0017481 3300046533 Bacteria 5345
274 Ga0495609_0070451 3300046538 Bacteria 1537
275 Ga0495597_0129804 3300046542 Bacteria 1046
276 Ga0495645_0130515 3300046543 Bacteria 1761
277 Ga0495667_0146737 3300046559 Bacteria 1519
278 Ga0495668_0127682 3300046616 Bacteria 1392
279 Ga0495668_0130090 3300046616 Bacteria 1378
280 Ga0495668_0462079 3300046616 Bacteria 699
281 Ga0495611_0031892 3300046648 Bacteria 2322
282 Ga0495625_0081399 3300046660 Bacteria 2254
283 Ga0495625_0317479 3300046660 Bacteria 993
284 Ga0495635_0012073 3300046663 Bacteria 6055
285 Ga0495661_0134631 3300046665 Bacteria 1350
286 Ga0495646_0016495 3300046680 Bacteria 4689
287 Ga0495670_0036549 3300046691 Bacteria 2447
288 Ga0495600_0004694 3300046809 Bacteria 8196
289 Ga0495604_0006635 3300047317 Bacteria 9172
290 Ga0495604_0012394 3300047317 Bacteria 6778
291 Ga0495672_0038074 3300047320 Bacteria 2936
292 Ga0495680_0002702 3300047322 Bacteria 17907
293 Ga0495687_097552 3300047443 Bacteria 1110
294 Ga0495675_0031749 3300047444 Bacteria 3372
295 Ga0495673_0032706 3300047469 Bacteria 2421
296 Ga0495681_0140369 3300047470 Bacteria 1021
297 Ga0495684_0219050 3300047471 Bacteria 1396
298 Ga0495686_0216095 3300047472 Bacteria 1093
299 Ga0495602_0022693 3300048088 Bacteria 6138
300 Ga0495602_0369040 3300048088 Bacteria 1031
301 Ga0495626_0027116 3300048091 Bacteria 2787
302 Ga0496101_0196723 3300048904 Bacteria 1557
303 Ga0496101_0419742 3300048904 Bacteria 1054
304 Ga0496102_0381950 3300048905 Bacteria 1325
305 Ga0496103_0037348 3300048906 Bacteria 2976
306 Ga0496104_0007578 3300048907 Bacteria 9606
307 Ga0496104_0082005 3300048907 Bacteria 3076
308 Ga0496105_0017907 3300048908 Bacteria 5685
309 Ga0496106_0028578 3300048909 Bacteria 4154
310 Ga0496106_0118187 3300048909 Bacteria 2070
311 Ga0496106_0391116 3300048909 Bacteria 1117
312 Ga0496107_0085273 3300048910 Bacteria 2305
313 Ga0496107_0099829 3300048910 Bacteria 2128
314 Ga0496108_0231713 3300048911 Bacteria 1606
315 Ga0496108_0325947 3300048911 Bacteria 1339
316 Ga0496110_0341343 3300048913 Bacteria 1364
317 Ga0496110_0603622 3300048913 Bacteria 995
318 Ga0496111_0117275 3300048914 Bacteria 1964
319 Ga0496112_0061528 3300048915 Bacteria 3701
320 Ga0496112_0186673 3300048915 Bacteria 2036
321 Ga0496112_0276330 3300048915 Bacteria 1627
322 Ga0496113_0187902 3300048916 Bacteria 1639
323 Ga0496113_0292578 3300048916 Bacteria 1303
324 Ga0496113_0391955 3300048916 Bacteria 1115
325 Ga0496115_0066694 3300048918 Bacteria 2909
326 Ga0496115_0434619 3300048918 Bacteria 1062
327 Ga0496116_0000097 3300048919 Bacteria 200658
328 Ga0496116_0005629 3300048919 Bacteria 11540
329 Ga0496116_0045623 3300048919 Bacteria 2965
330 Ga0496116_0220168 3300048919 Bacteria 973
331 Ga0496116_0271295 3300048919 Bacteria 829
332 Ga0496116_0313881 3300048919 Bacteria 738
333 Ga0496117_0018170 3300048920 Bacteria 5838
334 Ga0496117_0155412 3300048920 Bacteria 1347
335 Ga0496117_0190192 3300048920 Bacteria 1170
336 Ga0496117_0212504 3300048920 Bacteria 1083
337 Ga0496117_0226343 3300048920 Bacteria 1037
338 Ga0496118_0016217 3300048921 Bacteria 6845
339 Ga0496118_0022563 3300048921 Bacteria 5496
340 Ga0496118_0073322 3300048921 Bacteria 2453
341 Ga0496118_0073506 3300048921 Bacteria 2449
342 Ga0496118_0091282 3300048921 Bacteria 2095
343 Ga0496118_0124596 3300048921 Bacteria 1671
344 Ga0496118_0195194 3300048921 Bacteria 1206
345 Ga0496118_0199682 3300048921 Bacteria 1186
346 Ga0496118_0227083 3300048921 Bacteria 1081
347 Ga0496119_0002464 3300048922 Bacteria 20306
348 Ga0496119_0009213 3300048922 Bacteria 8518
349 Ga0496119_0018995 3300048922 Bacteria 5086
350 Ga0496119_0043733 3300048922 Bacteria 2827
351 Ga0496119_0144272 3300048922 Bacteria 1282
352 Ga0496119_0164862 3300048922 Bacteria 1174
353 Ga0496119_0164915 3300048922 Bacteria 1174
354 Ga0496119_0217495 3300048922 Bacteria 979
355 Ga0496120_0017055 3300048923 Bacteria 4722
356 Ga0496120_0055427 3300048923 Bacteria 2241
357 Ga0496120_0058683 3300048923 Bacteria 2160
358 Ga0496121_0000003 3300048924 Bacteria 1191431
359 Ga0496121_0010528 3300048924 Bacteria 10409
360 Ga0496121_0036835 3300048924 Bacteria 4353
361 Ga0496121_0040610 3300048924 Bacteria 4079
362 Ga0496121_0058509 3300048924 Bacteria 3186
363 Ga0496121_0151805 3300048924 Bacteria 1703
364 Ga0496121_0226503 3300048924 Bacteria 1312
365 Ga0496122_0010642 3300048925 Bacteria 9447
366 Ga0496122_0016451 3300048925 Bacteria 6996
367 Ga0496122_0033813 3300048925 Bacteria 4198
368 Ga0496122_0036331 3300048925 Bacteria 3986
369 Ga0496122_0075684 3300048925 Bacteria 2373
370 Ga0496122_0129446 3300048925 Bacteria 1607
371 Ga0496122_0141763 3300048925 Bacteria 1502
372 Ga0496122_0195777 3300048925 Bacteria 1187
373 Ga0496122_0197800 3300048925 Bacteria 1178
374 Ga0496122_0202949 3300048925 Bacteria 1157
375 Ga0496123_0013068 3300048926 Bacteria 7008
376 Ga0496123_0037687 3300048926 Bacteria 3411
377 Ga0496123_0072116 3300048926 Bacteria 2150
378 Ga0496123_0178332 3300048926 Bacteria 1112
379 Ga0496123_0278080 3300048926 Bacteria 810
380 Ga0496124_0009576 3300048927 Bacteria 9948
381 Ga0496124_0119468 3300048927 Bacteria 2108
382 Ga0496124_0134007 3300048927 Bacteria 1964
383 Ga0496124_0420519 3300048927 Bacteria 921
384 Ga0496125_0000170 3300048928 Bacteria 145369
385 Ga0496125_0000477 3300048928 Bacteria 70913
386 Ga0496125_0000481 3300048928 Bacteria 70594
387 Ga0496125_0003063 3300048928 Bacteria 20872
388 Ga0496125_0003174 3300048928 Bacteria 20373
389 Ga0496125_0011833 3300048928 Bacteria 8694
390 Ga0496125_0036213 3300048928 Bacteria 4313
391 Ga0496125_0071108 3300048928 Bacteria 2720
392 Ga0496125_0092683 3300048928 Bacteria 2258
393 Ga0496125_0115031 3300048928 Bacteria 1936
394 Ga0496125_0228910 3300048928 Bacteria 1190
395 Ga0496125_0245842 3300048928 Bacteria 1132
396 Ga0496125_0410408 3300048928 Bacteria 788
397 Ga0496126_0000119 3300048929 Bacteria 184211
398 Ga0496126_0002021 3300048929 Bacteria 28687
399 Ga0496126_0004626 3300048929 Bacteria 16302
400 Ga0496126_0015812 3300048929 Bacteria 7579
401 Ga0496126_0036837 3300048929 Bacteria 4571
402 Ga0496126_0045598 3300048929 Bacteria 4027
403 Ga0496126_0081599 3300048929 Bacteria 2858
404 Ga0496126_0083028 3300048929 Bacteria 2828
405 Ga0496126_0087837 3300048929 Bacteria 2740
406 Ga0496126_0233852 3300048929 Bacteria 1538
407 Ga0496126_0236965 3300048929 Bacteria 1526
408 Ga0496126_0289240 3300048929 Bacteria 1356
409 Ga0496126_0391947 3300048929 Bacteria 1128
410 Ga0496126_0420269 3300048929 Bacteria 1081
411 Ga0496126_0494113 3300048929 Bacteria 979
412 Ga0496126_0579648 3300048929 Bacteria 886
413 Ga0501031_0070813 3300049568 Bacteria 2271
414 Ga0501033_0146541 3300049570 Bacteria 1704
415 Ga0501033_0314505 3300049570 Bacteria 1101
416 Ga0501034_0026055 3300049571 Bacteria 5956
417 Ga0501034_0042325 3300049571 Bacteria 4611
418 Ga0501034_0046481 3300049571 Bacteria 4385
419 Ga0501036_0062351 3300049572 Bacteria 3158
420 Ga0501037_0003530 3300049573 Bacteria 11355
421 Ga0501043_0060363 3300049579 Bacteria 2976
422 Ga0501035_0098262 3300049822 Bacteria 2570
423 nmdc:mga03683_31568_c1 3300050489 Bacteria 2126
424 nmdc:mga03n38_13013_c1 3300050490 Bacteria 3148
425 nmdc:mga03n38_81392_c1 3300050490 Bacteria 1522
426 nmdc:mga00v17_134463_c1 3300050491 Bacteria 1582
427 nmdc:mga00v17_173833_c1 3300050491 Bacteria 1389
428 nmdc:mga00v17_54869_c1 3300050491 Bacteria 2432
429 nmdc:mga0yw44_162114_c1 3300050492 Bacteria 1464
430 nmdc:mga0yw44_185037_c1 3300050492 Bacteria 1372
431 nmdc:mga0yw44_261821_c1 3300050492 Bacteria 1153
432 nmdc:mga0yw44_342808_c1 3300050492 Bacteria 1005
433 nmdc:mga0yw44_6695_c1 3300050492 Bacteria 5595
434 nmdc:mga0yw44_72573_c1 3300050492 Bacteria 2140
435 nmdc:mga0k408_111800_c1 3300050493 Bacteria 1615
436 nmdc:mga0k408_15443_c1 3300050493 Bacteria 4224
437 nmdc:mga06z11_14149_c1 3300050494 Bacteria 3527
438 nmdc:mga06z11_295204_c1 3300050494 Bacteria 963
439 nmdc:mga06z11_32926_c1 3300050494 Bacteria 2531
440 nmdc:mga06z11_36650_c1 3300050494 Bacteria 2422
441 nmdc:mga06z11_58114_c1 3300050494 Bacteria 2006
442 nmdc:mga06z11_78824_c1 3300050494 Bacteria 1762
443 nmdc:mga04h51_12233_c1 3300050495 Bacteria 2404
444 nmdc:mga07m45_220301_c1 3300050496 Bacteria 1104
445 nmdc:mga07m45_39342_c1 3300050496 Bacteria 2642
446 nmdc:mga07m45_65906_c1 3300050496 Bacteria 2057
447 nmdc:mga0sz30_120099_c1 3300050516 Bacteria 1155
448 nmdc:mga0sz30_132996_c1 3300050516 Bacteria 1096
449 nmdc:mga0sz30_48316_c1 3300050516 Bacteria 1800
450 nmdc:mga0sz30_67011_c1 3300050516 Bacteria 1541
451 nmdc:mga0sz30_8932_c1 3300050516 Bacteria 3799
452 Ga0500610_0165641 3300053079 Bacteria 1096
453 Ga0495655_0081804 3300053083 Bacteria 925
454 Ga0495595_0087431 3300053084 Bacteria 1492
455 Ga0500578_0066446 3300053086 Bacteria 2300
456 Ga0500643_000085 3300053087 Bacteria 98026
457 Ga0500581_074781 3300053089 Bacteria 1701
458 Ga0500646_0018471 3300053090 Bacteria 1837
459 Ga0500646_0029505 3300053090 Bacteria 1502
460 Ga0500651_0100180 3300053093 Bacteria 1776
461 Ga0500651_0137222 3300053093 Bacteria 1476
462 Ga0500641_0064307 3300053096 Bacteria 1532
463 Ga0500650_0040958 3300053098 Bacteria 2137
464 Ga0500555_001875 3300053103 Bacteria 6250
465 Ga0500555_034629 3300053103 Bacteria 1422
466 Ga0500555_049643 3300053103 Bacteria 1150
467 Ga0500556_0000066 3300053104 Bacteria 105850
468 Ga0500556_0000070 3300053104 Bacteria 101159
469 Ga0500556_0043429 3300053104 Bacteria 1596
470 Ga0500557_000002 3300053105 Bacteria 234207
471 Ga0500562_030571 3300053108 Bacteria 1419
472 Ga0500562_093374 3300053108 Bacteria 817
473 Ga0500569_011975 3300053109 Bacteria 2086
474 Ga0500569_022888 3300053109 Bacteria 1671
475 Ga0500595_010924 3300053119 Bacteria 3579
476 Ga0500607_041458 3300053121 Bacteria 2488
477 Ga0500607_165094 3300053121 Bacteria 1006
478 Ga0500608_050882 3300053122 Bacteria 1990
479 Ga0500618_000855 3300053125 Bacteria 16375
480 Ga0500618_001004 3300053125 Bacteria 14234
481 Ga0500618_015946 3300053125 Bacteria 1888
482 Ga0500618_019260 3300053125 Bacteria 1681
483 Ga0500642_0000072 3300053130 Bacteria 55645
484 Ga0500642_0000442 3300053130 Bacteria 13325
485 Ga0500642_0074914 3300053130 Bacteria 1545
486 Ga0500642_0178266 3300053130 Bacteria 993
487 Ga0500652_041482 3300053131 Bacteria 1853
488 Ga0500652_224857 3300053131 Bacteria 753
489 Ga0500655_001905 3300053133 Bacteria 3877
490 Ga0500658_0231334 3300053134 Bacteria 848
491 Ga0500559_0001217 3300053136 Bacteria 15252
492 Ga0500559_0015675 3300053136 Bacteria 3200
493 Ga0500559_0052465 3300053136 Bacteria 1802
494 Ga0500568_0003002 3300053139 Bacteria 9651
495 Ga0500568_0006816 3300053139 Bacteria 5689
496 Ga0500568_0232269 3300053139 Bacteria 673
497 Ga0500577_0000803 3300053142 Bacteria 8089
498 Ga0500577_0030785 3300053142 Bacteria 1871
499 Ga0500588_0161712 3300053146 Bacteria 815
500 Ga0500590_024498 3300053148 Bacteria 3133
501 Ga0500603_088427 3300053150 Bacteria 907
502 Ga0500603_126493 3300053150 Bacteria 778
503 Ga0500604_0001808 3300053151 Bacteria 5968
504 Ga0500616_0000177 3300053153 Bacteria 106498
505 Ga0500616_0067362 3300053153 Bacteria 1836
506 Ga0500620_005118 3300053155 Bacteria 3004
507 Ga0500622_0004935 3300053156 Bacteria 8132
508 Ga0500634_0157095 3300053161 Bacteria 1055
509 Ga0500638_115709 3300053162 Bacteria 1233
510 Ga0500636_0000103 3300053177 Bacteria 43319
511 Ga0500636_0011422 3300053177 Bacteria 5200
512 Ga0500625_115717 3300053729 Bacteria 1089
513 Ga0500645_007235 3300053730 Bacteria 3885
514 Ga0500645_011879 3300053730 Bacteria 2829
515 Ga0500601_000169 3300053737 Bacteria 13565
516 Ga0530510_0000859 3300061734 Bacteria 20014

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0155412 Ga0496117_0155412_120_830 177
2 3300048925 Ga0496122_0129446 Ga0496122_0129446_780_1490 177
3 3300048926 Ga0496123_0278080 Ga0496123_0278080_80_790 177
4 3300048927 Ga0496124_0009576 Ga0496124_0009576_5319_6029 177
5 3300048929 Ga0496126_0233852 Ga0496126_0233852_91_801 177
6 iso_pu_bacteria 2904699407 2904706944 178
7 3300053125 Ga0500618_000855 Ga0500618_000855_6847_7515 186
8 3300039437 Ga0436365_0435073 Ga0436365_0435073_23_634 187
9 3300025295 Ga0209564_1033313 Ga0209564_10333132 188
10 3300039450 Ga0436363_0824796 Ga0436363_0824796_30_641 188
11 3300041452 Ga0451793_1147702 Ga0451793_1147702_803_1414 188
12 3300048919 Ga0496116_0313881 Ga0496116_0313881_25_636 188
13 3300053136 Ga0500559_0052465 Ga0500559_0052465_1164_1775 188
14 3300053139 Ga0500568_0232269 Ga0500568_0232269_17_628 188
15 3300048927 Ga0496124_0420519 Ga0496124_0420519_27_704 189
16 3300009148 Ga0105243_10782078 Ga0105243_107820782 191
17 3300025942 Ga0207689_10316093 Ga0207689_103160932 191
18 3300046455 Ga0495603_0183723 Ga0495603_0183723_258_923 191
19 3300046616 Ga0495668_0462079 Ga0495668_0462079_19_663 191
20 3300048904 Ga0496101_0196723 Ga0496101_0196723_135_800 191
21 3300048916 Ga0496113_0391955 Ga0496113_0391955_327_992 191
22 3300048918 Ga0496115_0066694 Ga0496115_0066694_1926_2591 191
23 3300048925 Ga0496122_0033813 Ga0496122_0033813_2633_3298 191
24 3300050492 nmdc:mga0yw44_6695_c1 nmdc:mga0yw44_6695_c1_180_845 191
25 3300039437 Ga0436365_0406973 Ga0436365_0406973_66_731 193
26 3300044842 Ga0466957_0084350 Ga0466957_0084350_738_1403 193
27 3300048921 Ga0496118_0073506 Ga0496118_0073506_1641_2297 193
28 3300050494 nmdc:mga06z11_32926_c1 nmdc:mga06z11_32926_c1_1506_2171 193
29 3300005347 Ga0070668_100109611 Ga0070668_1001096112 194
30 3300005455 Ga0070663_100281377 Ga0070663_1002813772 194
31 3300005548 Ga0070665_100211010 Ga0070665_1002110102 194
32 3300006353 Ga0075370_10318076 Ga0075370_103180761 194
33 3300009176 Ga0105242_10683080 Ga0105242_106830802 194
34 3300014326 Ga0157380_10461719 Ga0157380_104617192 194
35 3300025297 Ga0209758_1023139 Ga0209758_10231392 194
36 3300025972 Ga0207668_10667098 Ga0207668_106670982 194
37 3300026067 Ga0207678_10079536 Ga0207678_100795364 194
38 3300026088 Ga0207641_10481560 Ga0207641_104815602 194
39 3300046459 Ga0495629_0007729 Ga0495629_0007729_1883_2548 194
40 3300046462 Ga0495651_0377866 Ga0495651_0377866_40_705 194
41 3300046501 Ga0495607_0127641 Ga0495607_0127641_297_962 194
42 3300046507 Ga0495606_0313402 Ga0495606_0313402_156_821 194
43 3300046524 Ga0495648_0000426 Ga0495648_0000426_42386_43051 194
44 3300046660 Ga0495625_0317479 Ga0495625_0317479_160_825 194
45 3300046663 Ga0495635_0012073 Ga0495635_0012073_379_1044 194
46 3300047317 Ga0495604_0012394 Ga0495604_0012394_157_822 194
47 3300048088 Ga0495602_0369040 Ga0495602_0369040_165_830 194
48 3300048907 Ga0496104_0007578 Ga0496104_0007578_97_762 194
49 3300048908 Ga0496105_0017907 Ga0496105_0017907_674_1339 194
50 3300048915 Ga0496112_0061528 Ga0496112_0061528_2631_3296 194
51 3300048915 Ga0496112_0276330 Ga0496112_0276330_533_1198 194
52 3300048920 Ga0496117_0226343 Ga0496117_0226343_106_771 194
53 3300048921 Ga0496118_0091282 Ga0496118_0091282_1026_1691 194
54 3300048921 Ga0496118_0227083 Ga0496118_0227083_188_853 194
55 3300048922 Ga0496119_0018995 Ga0496119_0018995_97_762 194
56 3300048924 Ga0496121_0036835 Ga0496121_0036835_1527_2192 194
57 3300048928 Ga0496125_0115031 Ga0496125_0115031_437_1102 194
58 3300048929 Ga0496126_0083028 Ga0496126_0083028_233_898 194
59 3300048929 Ga0496126_0579648 Ga0496126_0579648_130_795 194
60 3300050516 nmdc:mga0sz30_67011_c1 nmdc:mga0sz30_67011_c1_278_943 194
61 3300053096 Ga0500641_0064307 Ga0500641_0064307_429_1094 194
62 3300053162 Ga0500638_115709 Ga0500638_115709_404_1069 194
63 3300053730 Ga0500645_007235 Ga0500645_007235_2031_2696 194
64 3300061734 Ga0530510_0000859 Ga0530510_0000859_12366_13043 194
65 3300048924 Ga0496121_0226503 Ga0496121_0226503_300_965 195
66 3300048922 Ga0496119_0144272 Ga0496119_0144272_491_1183 196
67 3300048928 Ga0496125_0228910 Ga0496125_0228910_375_1067 196
68 3300044735 Ga0466968_0068856 Ga0466968_0068856_588_1253 197
69 3300003320 rootH2_10007114 rootH2_100071142 198
70 3300005539 Ga0068853_100044460 Ga0068853_1000444601 198
71 3300053119 Ga0500595_010924 Ga0500595_010924_2271_2936 198
72 iso_pu_bacteria 2513237166 2514054862 198
73 iso_pu_bacteria 2855730933 2855735630 198
74 iso_pu_bacteria 2855767633 2855772568 198
75 iso_pu_bacteria 2857542790 2857544524 198
76 iso_pu_bacteria 2881412998 2881416150 198
77 iso_pu_bacteria 642555112 642592528 198
78 3300031241 Ga0265325_10050588 Ga0265325_100505882 199
79 3300032004 Ga0307414_10375336 Ga0307414_103753362 199
80 iso_pu_bacteria 2913308742 2913309169 199
81 3300006038 Ga0075365_10254087 Ga0075365_102540872 200
82 3300006042 Ga0075368_10013851 Ga0075368_100138513 200
83 3300006051 Ga0075364_10137803 Ga0075364_101378032 200
84 3300006177 Ga0075362_10068801 Ga0075362_100688012 200
85 3300006195 Ga0075366_10064496 Ga0075366_100644962 200
86 3300050489 nmdc:mga03683_31568_c1 nmdc:mga03683_31568_c1_1328_1981 200
87 3300050491 nmdc:mga00v17_54869_c1 nmdc:mga00v17_54869_c1_440_1093 200
88 3300050492 nmdc:mga0yw44_261821_c1 nmdc:mga0yw44_261821_c1_468_1121 200
89 3300050493 nmdc:mga0k408_15443_c1 nmdc:mga0k408_15443_c1_2692_3345 200
90 3300050494 nmdc:mga06z11_295204_c1 nmdc:mga06z11_295204_c1_196_849 200
91 3300050496 nmdc:mga07m45_220301_c1 nmdc:mga07m45_220301_c1_210_863 200
92 3300053730 Ga0500645_011879 Ga0500645_011879_1296_1961 200
93 iso_pu_bacteria 2883577096 2883578054 201
94 3300002067 JGI24735J21928_10007393 JGI24735J21928_100073932 202
95 3300016635 Ga0183361_10039 Ga0183361_100399 202
96 3300030521 Ga0307511_10000406 Ga0307511_1000040637 202
97 3300037471 Ga0395905_0000185 Ga0395905_0000185_27798_28451 202
98 3300048919 Ga0496116_0000097 Ga0496116_0000097_161936_162592 202
99 3300048925 Ga0496122_0141763 Ga0496122_0141763_656_1312 202
100 3300048926 Ga0496123_0037687 Ga0496123_0037687_1764_2420 202
101 3300048929 Ga0496126_0000119 Ga0496126_0000119_19276_19932 202
102 3300050492 nmdc:mga0yw44_342808_c1 nmdc:mga0yw44_342808_c1_199_852 202
103 3300050516 nmdc:mga0sz30_132996_c1 nmdc:mga0sz30_132996_c1_261_914 202
104 3300053090 Ga0500646_0029505 Ga0500646_0029505_305_958 202
105 3300053103 Ga0500555_049643 Ga0500555_049643_406_1059 202
106 3300053133 Ga0500655_001905 Ga0500655_001905_417_1070 202
107 3300053151 Ga0500604_0001808 Ga0500604_0001808_4713_5366 202
108 iso_pu_bacteria 2507262055 2507508987 202
109 iso_pu_bacteria 2508501042 2508691219 202
110 iso_pu_bacteria 2508501128 2509147799 202
111 iso_pu_bacteria 2511231027 2511389902 202
112 iso_pu_bacteria 2511231028 2511394460 202
113 iso_pu_bacteria 2513237092 2513624353 202
114 iso_pu_bacteria 2513237094 2513641997 202
115 iso_pu_bacteria 2513237095 2513650218 202
116 iso_pu_bacteria 2513237098 2513671445 202
117 iso_pu_bacteria 2513237102 2513703687 202
118 iso_pu_bacteria 2513237104 2513717942 202
119 iso_pu_bacteria 2513237137 2513856539 202
120 iso_pu_bacteria 2513237139 2513872468 202
121 iso_pu_bacteria 2513237145 2513917135 202
122 iso_pu_bacteria 2513237161 2514015970 202
123 iso_pu_bacteria 2515154112 2515626407 202
124 iso_pu_bacteria 2517093001 2517101570 202
125 iso_pu_bacteria 2517572143 2517895584 202
126 iso_pu_bacteria 2524023205 2524442756 202
127 iso_pu_bacteria 2524023210 2524470105 202
128 iso_pu_bacteria 2524023228 2524539504 202
129 iso_pu_bacteria 2528768022 2528849736 202
130 iso_pu_bacteria 2602042107 2603856944 202
131 iso_pu_bacteria 2617270735 2617348699 202
132 iso_pu_bacteria 2617270741 2617376107 202
133 iso_pu_bacteria 2671180139 2671695521 202
134 iso_pu_bacteria 2744054633 2745080108 202
135 iso_pu_bacteria 2765235802 2765468662 202
136 iso_pu_bacteria 2767802442 2770195497 202
137 iso_pu_bacteria 2775506902 2776270568 202
138 iso_pu_bacteria 2775506904 2776281511 202
139 iso_pu_bacteria 2791355196 2793065894 202
140 iso_pu_bacteria 2791355197 2793072232 202
141 iso_pu_bacteria 2802429603 2805917945 202
142 iso_pu_bacteria 2816332527 2818241258 202
143 iso_pu_bacteria 2818991467 2819720672 202
144 iso_pu_bacteria 2821443989 2821448070 202
145 iso_pu_bacteria 2824617872 2824623365 202
146 iso_pu_bacteria 2824626560 2824632293 202
147 iso_pu_bacteria 2824635225 2824639011 202
148 iso_pu_bacteria 2824644064 2824648233 202
149 iso_pu_bacteria 2824661429 2824665634 202
150 iso_pu_bacteria 2824671348 2824676324 202
151 iso_pu_bacteria 2824679649 2824685103 202
152 iso_pu_bacteria 2824687955 2824692759 202
153 iso_pu_bacteria 2824696289 2824698870 202
154 iso_pu_bacteria 2824704595 2824707250 202
155 iso_pu_bacteria 2824714736 2824722067 202
156 iso_pu_bacteria 2824723954 2824725797 202
157 iso_pu_bacteria 2824732956 2824736364 202
158 iso_pu_bacteria 2824746037 2824749451 202
159 iso_pu_bacteria 2824753945 2824762499 202
160 iso_pu_bacteria 2824763712 2824766747 202
161 iso_pu_bacteria 2824773399 2824776480 202
162 iso_pu_bacteria 2834578030 2834578653 202
163 iso_pu_bacteria 2838122688 2838124082 202
164 iso_pu_bacteria 2839993093 2839997088 202
165 iso_pu_bacteria 2840764183 2840767350 202
166 iso_pu_bacteria 2841941048 2841943791 202
167 iso_pu_bacteria 2841949485 2841950182 202
168 iso_pu_bacteria 2841957949 2841958357 202
169 iso_pu_bacteria 2841966195 2841966576 202
170 iso_pu_bacteria 2841974524 2841975315 202
171 iso_pu_bacteria 2841983080 2841983120 202
172 iso_pu_bacteria 2842038055 2842039379 202
173 iso_pu_bacteria 2842045827 2842047675 202
174 iso_pu_bacteria 2842775625 2842778127 202
175 iso_pu_bacteria 2842871566 2842872005 202
176 iso_pu_bacteria 2844533157 2844539675 202
177 iso_pu_bacteria 2847930680 2847935847 202
178 iso_pu_bacteria 2847939898 2847946236 202
179 iso_pu_bacteria 2855020534 2855023165 202
180 iso_pu_bacteria 2857509624 2857513978 202
181 iso_pu_bacteria 2857524615 2857528621 202
182 iso_pu_bacteria 2874590934 2874592683 202
183 iso_pu_bacteria 2874612657 2874616127 202
184 iso_pu_bacteria 2874620515 2874627430 202
185 iso_pu_bacteria 2874628541 2874629820 202
186 iso_pu_bacteria 2874645413 2874648280 202
187 iso_pu_bacteria 2876761206 2876767283 202
188 iso_pu_bacteria 2876771140 2876772896 202
189 iso_pu_bacteria 2876818435 2876820224 202
190 iso_pu_bacteria 2879074833 2879076727 202
191 iso_pu_bacteria 2879083081 2879085234 202
192 iso_pu_bacteria 2879099564 2879103855 202
193 iso_pu_bacteria 2879127579 2879131662 202
194 iso_pu_bacteria 2879142872 2879148045 202
195 iso_pu_bacteria 2881364244 2881371725 202
196 iso_pu_bacteria 2881665667 2881666429 202
197 iso_pu_bacteria 2885366525 2885372190 202
198 iso_pu_bacteria 2885383462 2885386841 202
199 iso_pu_bacteria 2888378607 2888383745 202
200 iso_pu_bacteria 2888388044 2888394123 202
201 iso_pu_bacteria 2893066018 2893066220 202
202 iso_pu_bacteria 2894652903 2894655939 202
203 iso_pu_bacteria 2897803580 2897809610 202
204 iso_pu_bacteria 2903748898 2903759129 202
205 iso_pu_bacteria 2903768456 2903769632 202
206 iso_pu_bacteria 2904578770 2904580523 202
207 iso_pu_bacteria 2904666416 2904671052 202
208 iso_pu_bacteria 2904690495 2904694056 202
209 iso_pu_bacteria 2904711408 2904720866 202
210 iso_pu_bacteria 2906626472 2906630019 202
211 iso_pu_bacteria 2906635258 2906638541 202
212 iso_pu_bacteria 2906643746 2906648737 202
213 iso_pu_bacteria 2906660503 2906662776 202
214 iso_pu_bacteria 2908756301 2908764585 202
215 iso_pu_bacteria 2908775508 2908779815 202
216 iso_pu_bacteria 2919073203 2919076067 202
217 iso_pu_bacteria 2919119836 2919121732 202
218 iso_pu_bacteria 2922393267 2922396705 202
219 iso_pu_bacteria 2928521798 2928523929 202
220 iso_pu_bacteria 2929199973 2929205752 202
221 iso_pu_bacteria 2929615660 2929617698 202
222 iso_pu_bacteria 2929624759 2929627403 202
223 iso_pu_bacteria 2932784394 2932788505 202
224 iso_pu_bacteria 2932794094 2932798574 202
225 iso_pu_bacteria 2932801729 2932803117 202
226 iso_pu_bacteria 2932809354 2932816333 202
227 iso_pu_bacteria 2932818245 2932821503 202
228 iso_pu_bacteria 2932828146 2932831588 202
229 iso_pu_bacteria 2933577622 2933579654 202
230 iso_pu_bacteria 2935608549 2935612164 202
231 iso_pu_bacteria 2935616580 2935622366 202
232 iso_pu_bacteria 2935638405 2935645205 202
233 iso_pu_bacteria 2935648319 2935649741 202
234 iso_pu_bacteria 2935656913 2935658744 202
235 iso_pu_bacteria 2935665750 2935671766 202
236 iso_pu_bacteria 2935675223 2935678831 202
237 iso_pu_bacteria 2935684952 2935688848 202
238 iso_pu_bacteria 2935694250 2935696222 202
239 iso_pu_bacteria 2935703347 2935706967 202
240 iso_pu_bacteria 2935713505 2935715867 202
241 iso_pu_bacteria 2935722832 2935725569 202
242 iso_pu_bacteria 2935732158 2935738152 202
243 iso_pu_bacteria 2935741537 2935747527 202
244 iso_pu_bacteria 2935750917 2935753898 202
245 iso_pu_bacteria 2935760218 2935762904 202
246 iso_pu_bacteria 2935769743 2935774999 202
247 iso_pu_bacteria 2935777560 2935782658 202
248 iso_pu_bacteria 2935785616 2935791756 202
249 iso_pu_bacteria 2935793552 2935800012 202
250 iso_pu_bacteria 2935801545 2935807685 202
251 iso_pu_bacteria 2935810662 2935817047 202
252 iso_pu_bacteria 2935819856 2935821634 202
253 iso_pu_bacteria 2935827899 2935834672 202
254 iso_pu_bacteria 2935837841 2935840355 202
255 iso_pu_bacteria 2935847175 2935847235 202
256 iso_pu_bacteria 2935855204 2935860566 202
257 iso_pu_bacteria 2935864058 2935865396 202
258 iso_pu_bacteria 2935873716 2935877992 202
259 iso_pu_bacteria 2935883170 2935885456 202
260 iso_pu_bacteria 2935908558 2935914661 202
261 iso_pu_bacteria 2935916978 2935924872 202
262 iso_pu_bacteria 2935926038 2935932261 202
263 iso_pu_bacteria 2935934488 2935940859 202
264 iso_pu_bacteria 2935942939 2935948932 202
265 iso_pu_bacteria 2935951376 2935957490 202
266 iso_pu_bacteria 2935959822 2935959986 202
267 iso_pu_bacteria 2935967501 2935973937 202
268 iso_pu_bacteria 2935975950 2935977315 202
269 iso_pu_bacteria 2935984226 2935988506 202
270 iso_pu_bacteria 2935992306 2935996059 202
271 iso_pu_bacteria 2936002035 2936006193 202
272 iso_pu_bacteria 2936011229 2936012777 202
273 iso_pu_bacteria 2936019824 2936021341 202
274 iso_pu_bacteria 2936028420 2936030070 202
275 iso_pu_bacteria 2936037263 2936043426 202
276 iso_pu_bacteria 2936046547 2936047535 202
277 iso_pu_bacteria 2936055302 2936057307 202
278 iso_pu_bacteria 2940556831 2940560726 202
279 iso_pu_bacteria 2941538514 2941541514 202
280 iso_pu_bacteria 2954011201 2954012873 202
281 iso_pu_bacteria 2964636051 2964641743 202
282 iso_pu_bacteria 3000017691 3000019292 202
283 iso_pu_bacteria 3002141150 3002144810 202
284 iso_pu_bacteria 3003930520 3003930558 202
285 iso_pu_bacteria 3005474847 3005481605 202
286 iso_pu_bacteria 3005506211 3005510091 202
287 iso_pu_bacteria 3005587118 3005592482 202
288 iso_pu_bacteria 3005594810 3005598940 202
289 iso_pu_bacteria 3005710791 3005714517 202
290 iso_pu_bacteria 8006933436 8006934728 202
291 iso_pu_bacteria 8006973647 8006974695 202
292 iso_pu_bacteria 8016511872 8016513666 202
293 iso_pu_bacteria 8016522445 8016529994 202
294 iso_pu_bacteria 8016530956 8016535229 202
295 iso_pu_bacteria 8016539877 8016548439 202
296 iso_pu_bacteria 8016557553 8016562070 202
297 iso_pu_bacteria 8016566248 8016573571 202
298 iso_pu_bacteria 8016575299 8016577697 202
299 iso_pu_bacteria 8016583857 8016592252 202
300 iso_pu_bacteria 8016595262 8016599892 202
301 iso_pu_bacteria 8016603502 8016610919 202
302 iso_pu_bacteria 8016613128 8016614046 202
303 iso_pu_bacteria 8016630954 8016640707 202
304 iso_pu_bacteria 8017057580 8017062780 202
305 iso_pu_bacteria 8019530166 8019534980 202
306 iso_pu_bacteria 8019538911 8019544486 202
307 iso_pu_bacteria 8019547302 8019554101 202
308 iso_pu_bacteria 8019586578 8019589908 202
309 iso_pu_bacteria 8019597564 8019601361 202
310 iso_pu_bacteria 8019608314 8019617191 202
311 iso_pu_bacteria 8019619141 8019627713 202
312 iso_pu_bacteria 8019629233 8019634793 202
313 iso_pu_bacteria 8019638758 8019644910 202
314 iso_pu_bacteria 8019648815 8019658048 202
315 iso_pu_bacteria 8019668869 8019672302 202
316 iso_pu_bacteria 8019678201 8019683905 202
317 iso_pu_bacteria 8019687851 8019689647 202
318 iso_pu_bacteria 8055742211 8055746687 202
319 iso_pu_bacteria 8055909800 8055914688 202
320 iso_pu_bacteria 8056681323 8056682542 202
321 iso_pu_bacteria 8056689827 8056692383 202
322 iso_pu_bacteria 8057132660 8057133369 202
323 3300005328 Ga0070676_10312963 Ga0070676_103129632 203
324 3300005347 Ga0070668_100014846 Ga0070668_1000148462 203
325 3300005356 Ga0070674_100006548 Ga0070674_1000065482 203
326 3300005441 Ga0070700_100884539 Ga0070700_1008845391 203
327 3300005455 Ga0070663_100451192 Ga0070663_1004511922 203
328 3300005457 Ga0070662_100265189 Ga0070662_1002651891 203
329 3300005459 Ga0068867_100214158 Ga0068867_1002141582 203
330 3300005543 Ga0070672_100306129 Ga0070672_1003061292 203
331 3300005544 Ga0070686_100406554 Ga0070686_1004065542 203
332 3300005718 Ga0068866_10029830 Ga0068866_100298302 203
333 3300005719 Ga0068861_100471423 Ga0068861_1004714232 203
334 3300013308 Ga0157375_10227560 Ga0157375_102275602 203
335 3300017792 Ga0163161_10012756 Ga0163161_100127562 203
336 3300021388 Ga0213875_10174109 Ga0213875_101741092 203
337 3300025899 Ga0207642_10033767 Ga0207642_100337672 203
338 3300025901 Ga0207688_10072635 Ga0207688_100726352 203
339 3300025927 Ga0207687_10063458 Ga0207687_100634582 203
340 3300025933 Ga0207706_10261167 Ga0207706_102611671 203
341 3300025935 Ga0207709_10091806 Ga0207709_100918062 203
342 3300025937 Ga0207669_10001575 Ga0207669_100015752 203
343 3300025972 Ga0207668_10078977 Ga0207668_100789772 203
344 3300026067 Ga0207678_10289050 Ga0207678_102890502 203
345 3300026075 Ga0207708_10497319 Ga0207708_104973191 203
346 3300026089 Ga0207648_10048037 Ga0207648_100480374 203
347 3300026118 Ga0207675_100516050 Ga0207675_1005160502 203
348 3300039437 Ga0436365_0435855 Ga0436365_0435855_289_954 203
349 3300048918 Ga0496115_0434619 Ga0496115_0434619_337_1002 203
350 3300048921 Ga0496118_0124596 Ga0496118_0124596_583_1239 203
351 3300048922 Ga0496119_0009213 Ga0496119_0009213_3810_4466 203
352 3300048923 Ga0496120_0017055 Ga0496120_0017055_3702_4358 203
353 3300048928 Ga0496125_0036213 Ga0496125_0036213_375_1031 203
354 3300048929 Ga0496126_0289240 Ga0496126_0289240_65_721 203
355 3300050491 nmdc:mga00v17_173833_c1 nmdc:mga00v17_173833_c1_339_995 203
356 3300050494 nmdc:mga06z11_36650_c1 nmdc:mga06z11_36650_c1_239_895 203
357 3300050516 nmdc:mga0sz30_48316_c1 nmdc:mga0sz30_48316_c1_771_1427 203
358 iso_pu_bacteria 2511231221 2512038188 203
359 iso_pu_bacteria 2554235003 2554244532 203
360 iso_pu_bacteria 2558860242 2559297626 203
361 iso_pu_bacteria 2585427633 2585997210 203
362 iso_pu_bacteria 2585427634 2586001812 203
363 iso_pu_bacteria 2599185210 2599606211 203
364 iso_pu_bacteria 2600254933 2600373599 203
365 iso_pu_bacteria 2600255279 2601612421 203
366 iso_pu_bacteria 2600255308 2601748962 203
367 iso_pu_bacteria 2643221568 2643858060 203
368 iso_pu_bacteria 2643221582 2643922211 203
369 iso_pu_bacteria 2643221688 2644494111 203
370 iso_pu_bacteria 2643221693 2644522720 203
371 iso_pu_bacteria 2738541317 2738944549 203
372 iso_pu_bacteria 2775507049 2776914611 203
373 iso_pu_bacteria 2808606387 2808989135 203
374 iso_pu_bacteria 2818991461 2819686481 203
375 iso_pu_bacteria 2821123053 2821126206 203
376 iso_pu_bacteria 2838675328 2838679942 203
377 iso_pu_bacteria 2838714209 2838717739 203
378 iso_pu_bacteria 2838719591 2838724513 203
379 iso_pu_bacteria 2838724970 2838729545 203
380 iso_pu_bacteria 2838736955 2838737319 203
381 iso_pu_bacteria 2841840854 2841842312 203
382 iso_pu_bacteria 2841846520 2841849983 203
383 iso_pu_bacteria 2841859092 2841861229 203
384 iso_pu_bacteria 2842124991 2842128455 203
385 iso_pu_bacteria 2842130223 2842134624 203
386 iso_pu_bacteria 2842140634 2842142091 203
387 iso_pu_bacteria 2842152218 2842156544 203
388 iso_pu_bacteria 2842170452 2842173984 203
389 iso_pu_bacteria 2842175837 2842180165 203
390 iso_pu_bacteria 2842187318 2842192164 203
391 iso_pu_bacteria 2842211629 2842216556 203
392 iso_pu_bacteria 2842224351 2842229200 203
393 iso_pu_bacteria 2842515876 2842518504 203
394 iso_pu_bacteria 2846952575 2846956811 203
395 iso_pu_bacteria 2848858292 2848864600 203
396 iso_pu_bacteria 2857531043 2857532767 203
397 iso_pu_bacteria 2891048133 2891052235 203
398 iso_pu_bacteria 2899792073 2899793135 203
399 iso_pu_bacteria 2899845264 2899849661 203
400 iso_pu_bacteria 2919114240 2919118020 203
401 iso_pu_bacteria 2919166419 2919169969 203
402 iso_pu_bacteria 2926754445 2926757787 203
403 iso_pu_bacteria 2926760298 2926764587 203
404 iso_pu_bacteria 2929138655 2929141415 203
405 iso_pu_bacteria 2933006813 2933010402 203
406 iso_pu_bacteria 2933011516 2933014130 203
407 iso_pu_bacteria 2933594066 2933597270 203
408 iso_pu_bacteria 2978969890 2978972416 203
409 iso_pu_bacteria 2979089926 2979090303 203
410 iso_pu_bacteria 2979095461 2979095832 203
411 iso_pu_bacteria 2979100975 2979102714 203
412 iso_pu_bacteria 2984509177 2984509398 203
413 iso_pu_bacteria 2984518228 2984519903 203
414 iso_pu_bacteria 2984537506 2984537730 203
415 iso_pu_bacteria 2984587000 2984590667 203
416 iso_pu_bacteria 2984601300 2984604475 203
417 iso_pu_bacteria 2989349275 2989352116 203
418 iso_pu_bacteria 2995392953 2995395926 203
419 iso_pu_bacteria 650716007 650844068 203
420 iso_pu_bacteria 8003570095 8003574423 203
421 iso_pu_bacteria 8054002106 8054002727 203
422 iso_pu_bacteria 8054460903 8054463514 203
423 iso_pu_bacteria 8056875544 8056876215 203
424 3300003752 Ga0055539_1023632 Ga0055539_10236321 204
425 3300005548 Ga0070665_100236991 Ga0070665_1002369912 204
426 3300025253 Ga0209677_101840 Ga0209677_1018408 204
427 3300028379 Ga0268266_10266392 Ga0268266_102663922 204
428 3300041413 Ga0439465_0097569 Ga0439465_0097569_270_935 204
429 3300044765 Ga0466970_0143761 Ga0466970_0143761_240_908 204
430 3300047472 Ga0495686_0216095 Ga0495686_0216095_326_991 204
431 3300048920 Ga0496117_0190192 Ga0496117_0190192_341_1006 204
432 3300048921 Ga0496118_0073322 Ga0496118_0073322_938_1603 204
433 3300048924 Ga0496121_0058509 Ga0496121_0058509_63_728 204
434 3300048925 Ga0496122_0010642 Ga0496122_0010642_5654_6319 204
435 3300048926 Ga0496123_0013068 Ga0496123_0013068_5833_6498 204
436 3300048927 Ga0496124_0119468 Ga0496124_0119468_441_1133 204
437 3300048928 Ga0496125_0410408 Ga0496125_0410408_102_767 204
438 3300048929 Ga0496126_0015812 Ga0496126_0015812_5433_6098 204
439 3300049571 Ga0501034_0026055 Ga0501034_0026055_1326_1991 204
440 3300005436 Ga0070713_100135697 Ga0070713_1001356972 205
441 3300005437 Ga0070710_10025600 Ga0070710_100256002 205
442 3300005439 Ga0070711_100052664 Ga0070711_1000526642 205
443 3300006173 Ga0070716_100056422 Ga0070716_1000564222 205
444 3300006178 Ga0075367_10129362 Ga0075367_101293622 205
445 3300013105 Ga0157369_10081684 Ga0157369_100816842 205
446 3300021384 Ga0213876_10214675 Ga0213876_102146752 205
447 3300025292 Ga0209676_1000214 Ga0209676_100021420 205
448 3300025298 Ga0209050_1022914 Ga0209050_10229142 205
449 3300025898 Ga0207692_10120042 Ga0207692_101200422 205
450 3300025904 Ga0207647_10093465 Ga0207647_100934652 205
451 3300025906 Ga0207699_10043945 Ga0207699_100439453 205
452 3300025915 Ga0207693_10008703 Ga0207693_100087034 205
453 3300025916 Ga0207663_10182945 Ga0207663_101829452 205
454 3300025939 Ga0207665_10094343 Ga0207665_100943433 205
455 3300031903 Ga0307407_10193501 Ga0307407_101935012 205
456 3300037853 Ga0436364_0062391 Ga0436364_0062391_1097_1762 205
457 3300039437 Ga0436365_1860794 Ga0436365_1860794_453_1118 205
458 3300039438 Ga0436360_1118848 Ga0436360_1118848_214_879 205
459 3300039447 Ga0436361_0487656 Ga0436361_0487656_3236_3901 205
460 3300045976 Ga0466967_0927676 Ga0466967_0927676_93_758 205
461 3300046524 Ga0495648_0002857 Ga0495648_0002857_14383_15048 205
462 3300048921 Ga0496118_0199682 Ga0496118_0199682_336_1010 205
463 3300048927 Ga0496124_0134007 Ga0496124_0134007_770_1444 205
464 3300048928 Ga0496125_0000481 Ga0496125_0000481_24867_25541 205
465 3300048928 Ga0496125_0092683 Ga0496125_0092683_433_1107 205
466 3300048929 Ga0496126_0002021 Ga0496126_0002021_21504_22169 205
467 3300049568 Ga0501031_0070813 Ga0501031_0070813_459_1127 205
468 3300049570 Ga0501033_0146541 Ga0501033_0146541_493_1161 205
469 3300049571 Ga0501034_0046481 Ga0501034_0046481_3040_3708 205
470 3300049572 Ga0501036_0062351 Ga0501036_0062351_594_1262 205
471 3300049579 Ga0501043_0060363 Ga0501043_0060363_2056_2724 205
472 3300049822 Ga0501035_0098262 Ga0501035_0098262_1374_2042 205
473 3300050494 nmdc:mga06z11_14149_c1 nmdc:mga06z11_14149_c1_966_1634 205
474 3300050494 nmdc:mga06z11_58114_c1 nmdc:mga06z11_58114_c1_1044_1712 205
475 3300053136 Ga0500559_0015675 Ga0500559_0015675_853_1521 205
476 3300053150 Ga0500603_126493 Ga0500603_126493_23_688 205
477 iso_pu_bacteria 2513237087 2513594115 205
478 iso_pu_bacteria 2643221591 2643964163 205
479 3300001989 JGI24739J22299_10110358 JGI24739J22299_101103581 206
480 3300002987 JGI25159J45721_1022004 JGI25159J45721_10220042 206
481 3300003187 JGI25151J46595_10000251 JGI25151J46595_1000025152 206
482 3300003215 JGI25153J46596_10000430 JGI25153J46596_1000043012 206
483 3300003215 JGI25153J46596_10000458 JGI25153J46596_1000045811 206
484 3300003215 JGI25153J46596_10001248 JGI25153J46596_100012484 206
485 3300003354 JGI25160J50197_1002571 JGI25160J50197_10025712 206
486 3300003354 JGI25160J50197_1005261 JGI25160J50197_10052616 206
487 3300003856 Ga0058692_1001437 Ga0058692_10014372 206
488 3300004625 Ga0055543_1013739 Ga0055543_10137392 206
489 3300005262 Ga0065165_1002812 Ga0065165_10028127 206
490 3300005262 Ga0065165_1003726 Ga0065165_10037263 206
491 3300005262 Ga0065165_1030670 Ga0065165_10306702 206
492 3300005289 Ga0065704_10002985 Ga0065704_100029854 206
493 3300005327 Ga0070658_10318671 Ga0070658_103186711 206
494 3300005331 Ga0070670_100656901 Ga0070670_1006569011 206
495 3300005334 Ga0068869_100738779 Ga0068869_1007387791 206
496 3300005335 Ga0070666_10080081 Ga0070666_100800812 206
497 3300005337 Ga0070682_100057836 Ga0070682_1000578363 206
498 3300005355 Ga0070671_100742566 Ga0070671_1007425661 206
499 3300005367 Ga0070667_100256167 Ga0070667_1002561672 206
500 3300005455 Ga0070663_100145395 Ga0070663_1001453952 206
501 3300005456 Ga0070678_100161945 Ga0070678_1001619452 206
502 3300005457 Ga0070662_100238073 Ga0070662_1002380732 206
503 3300005548 Ga0070665_100019592 Ga0070665_1000195925 206
504 3300005548 Ga0070665_100503361 Ga0070665_1005033612 206
505 3300005577 Ga0068857_100523593 Ga0068857_1005235931 206
506 3300005578 Ga0068854_100672897 Ga0068854_1006728972 206
507 3300005614 Ga0068856_100146435 Ga0068856_1001464352 206
508 3300005616 Ga0068852_100003079 Ga0068852_1000030793 206
509 3300005616 Ga0068852_100054851 Ga0068852_1000548512 206
510 3300005718 Ga0068866_10275015 Ga0068866_102750152 206
511 3300005983 Ga0081540_1030153 Ga0081540_10301532 206
512 3300005983 Ga0081540_1053749 Ga0081540_10537492 206
513 3300006038 Ga0075365_10054337 Ga0075365_100543373 206
514 3300006038 Ga0075365_10178292 Ga0075365_101782922 206
515 3300006048 Ga0075363_100016148 Ga0075363_1000161483 206
516 3300006048 Ga0075363_100135627 Ga0075363_1001356271 206
517 3300006051 Ga0075364_10071264 Ga0075364_100712643 206
518 3300006051 Ga0075364_10078515 Ga0075364_100785152 206
519 3300006178 Ga0075367_10070888 Ga0075367_100708882 206
520 3300006186 Ga0075369_10016015 Ga0075369_100160153 206
521 3300006186 Ga0075369_10056855 Ga0075369_100568551 206
522 3300006195 Ga0075366_10081027 Ga0075366_100810272 206
523 3300006353 Ga0075370_10041412 Ga0075370_100414123 206
524 3300006353 Ga0075370_10069609 Ga0075370_100696092 206
525 3300006942 Ga0099824_1018757 Ga0099824_10187573 206
526 3300006948 Ga0099826_10003152 Ga0099826_100031529 206
527 3300006948 Ga0099826_10196678 Ga0099826_101966781 206
528 3300009093 Ga0105240_10007593 Ga0105240_100075932 206
529 3300009098 Ga0105245_10304197 Ga0105245_103041972 206
530 3300009101 Ga0105247_10310510 Ga0105247_103105102 206
531 3300009174 Ga0105241_10175003 Ga0105241_101750032 206
532 3300009174 Ga0105241_10402188 Ga0105241_104021882 206
533 3300009176 Ga0105242_10243892 Ga0105242_102438922 206
534 3300009177 Ga0105248_10291812 Ga0105248_102918122 206
535 3300009545 Ga0105237_10001252 Ga0105237_1000125224 206
536 3300009545 Ga0105237_10482024 Ga0105237_104820242 206
537 3300009545 Ga0105237_10771984 Ga0105237_107719842 206
538 3300009551 Ga0105238_10152325 Ga0105238_101523252 206
539 3300010375 Ga0105239_10580168 Ga0105239_105801682 206
540 3300011119 Ga0105246_10128951 Ga0105246_101289512 206
541 3300013104 Ga0157370_10240313 Ga0157370_102403132 206
542 3300014325 Ga0163163_10220165 Ga0163163_102201652 206
543 3300015262 Ga0182007_10140073 Ga0182007_101400732 206
544 3300021320 Ga0214544_1000002 Ga0214544_1000002755 206
545 3300021321 Ga0214542_1000153 Ga0214542_100015348 206
546 3300021324 Ga0214545_1000018 Ga0214545_100001894 206
547 3300021327 Ga0214543_1000001 Ga0214543_100000123 206
548 3300025245 Ga0207425_1028214 Ga0207425_10282142 206
549 3300025254 Ga0209148_1000274 Ga0209148_100027419 206
550 3300025261 Ga0209233_1006973 Ga0209233_10069732 206
551 3300025272 Ga0209455_1002505 Ga0209455_10025053 206
552 3300025284 Ga0209130_1003833 Ga0209130_10038334 206
553 3300025294 Ga0209025_1000478 Ga0209025_100047860 206
554 3300025294 Ga0209025_1000622 Ga0209025_100062252 206
555 3300025295 Ga0209564_1001354 Ga0209564_100135414 206
556 3300025295 Ga0209564_1004180 Ga0209564_10041808 206
557 3300025297 Ga0209758_1000021 Ga0209758_1000021380 206
558 3300025297 Ga0209758_1000211 Ga0209758_100021173 206
559 3300025297 Ga0209758_1002374 Ga0209758_100237416 206
560 3300025297 Ga0209758_1004266 Ga0209758_10042665 206
561 3300025297 Ga0209758_1007536 Ga0209758_10075367 206
562 3300025297 Ga0209758_1015829 Ga0209758_10158293 206
563 3300025299 Ga0209256_1004128 Ga0209256_10041284 206
564 3300025299 Ga0209256_1047672 Ga0209256_10476721 206
565 3300025302 Ga0207426_1000085 Ga0207426_100008591 206
566 3300025302 Ga0207426_1000143 Ga0207426_1000143134 206
567 3300025302 Ga0207426_1000687 Ga0207426_10006876 206
568 3300025302 Ga0207426_1018646 Ga0207426_10186462 206
569 3300025304 Ga0209257_1000883 Ga0209257_10008836 206
570 3300025304 Ga0209257_1028788 Ga0209257_10287882 206
571 3300025304 Ga0209257_1032587 Ga0209257_10325871 206
572 3300025903 Ga0207680_10402174 Ga0207680_104021742 206
573 3300025904 Ga0207647_10048671 Ga0207647_100486713 206
574 3300025904 Ga0207647_10306704 Ga0207647_103067042 206
575 3300025905 Ga0207685_10082736 Ga0207685_100827362 206
576 3300025909 Ga0207705_10228043 Ga0207705_102280432 206
577 3300025913 Ga0207695_10000015 Ga0207695_10000015427 206
578 3300025914 Ga0207671_10007054 Ga0207671_100070545 206
579 3300025914 Ga0207671_10169184 Ga0207671_101691842 206
580 3300025914 Ga0207671_10294054 Ga0207671_102940542 206
581 3300025919 Ga0207657_10131973 Ga0207657_101319732 206
582 3300025927 Ga0207687_10213064 Ga0207687_102130642 206
583 3300025931 Ga0207644_10486928 Ga0207644_104869282 206
584 3300025933 Ga0207706_10127998 Ga0207706_101279982 206
585 3300025933 Ga0207706_10952648 Ga0207706_109526481 206
586 3300025936 Ga0207670_10738755 Ga0207670_107387552 206
587 3300025940 Ga0207691_10476595 Ga0207691_104765951 206
588 3300025941 Ga0207711_10648309 Ga0207711_106483092 206
589 3300025945 Ga0207679_10572101 Ga0207679_105721012 206
590 3300025949 Ga0207667_10511390 Ga0207667_105113902 206
591 3300025972 Ga0207668_11148299 Ga0207668_111482991 206
592 3300025986 Ga0207658_10099606 Ga0207658_100996062 206
593 3300026067 Ga0207678_10134291 Ga0207678_101342912 206
594 3300026067 Ga0207678_10149331 Ga0207678_101493312 206
595 3300026067 Ga0207678_10199958 Ga0207678_101999582 206
596 3300026095 Ga0207676_10817235 Ga0207676_108172351 206
597 3300026116 Ga0207674_10235516 Ga0207674_102355162 206
598 3300026121 Ga0207683_10855030 Ga0207683_108550302 206
599 3300026142 Ga0207698_10073854 Ga0207698_100738542 206
600 3300027296 Ga0209389_1010332 Ga0209389_10103324 206
601 3300027312 Ga0209371_1000003 Ga0209371_1000003300 206
602 3300027357 Ga0209589_1000180 Ga0209589_10001802 206
603 3300027361 Ga0209489_100031 Ga0209489_100031113 206
604 3300027666 Ga0209282_1000245 Ga0209282_100024520 206
605 3300028379 Ga0268266_10024153 Ga0268266_100241532 206
606 3300028379 Ga0268266_10461763 Ga0268266_104617632 206
607 3300028794 Ga0307515_10022313 Ga0307515_100223132 206
608 3300030500 Ga0268256_1000004 Ga0268256_1000004751 206
609 3300031247 Ga0265340_10000891 Ga0265340_1000089114 206
610 3300031548 Ga0307408_100055761 Ga0307408_1000557613 206
611 3300031711 Ga0265314_10106061 Ga0265314_101060612 206
612 3300031712 Ga0265342_10075824 Ga0265342_100758242 206
613 3300031852 Ga0307410_10102148 Ga0307410_101021482 206
614 3300031911 Ga0307412_10787951 Ga0307412_107879511 206
615 3300031995 Ga0307409_100421292 Ga0307409_1004212921 206
616 3300037418 Ga0395900_0215646 Ga0395900_0215646_1043_1708 206
617 3300037418 Ga0395900_0953459 Ga0395900_0953459_60_725 206
618 3300037466 Ga0395898_0488174 Ga0395898_0488174_269_934 206
619 3300037471 Ga0395905_0033610 Ga0395905_0033610_1135_1800 206
620 3300037471 Ga0395905_0122291 Ga0395905_0122291_300_965 206
621 3300037853 Ga0436364_0854504 Ga0436364_0854504_301_966 206
622 3300039437 Ga0436365_1315065 Ga0436365_1315065_335_1000 206
623 3300041458 Ga0451798_0714672 Ga0451798_0714672_102_767 206
624 3300041491 Ga0451833_0015134 Ga0451833_0015134_31_696 206
625 3300041501 Ga0451845_0496252 Ga0451845_0496252_45_710 206
626 3300042004 Ga0439445_0032561 Ga0439445_0032561_248_916 206
627 3300042137 Ga0450902_017989 Ga0450902_017989_11_679 206
628 3300044656 Ga0466969_0027418 Ga0466969_0027418_1677_2342 206
629 3300044658 Ga0466972_0000188 Ga0466972_0000188_33260_33925 206
630 3300044658 Ga0466972_0010330 Ga0466972_0010330_3922_4587 206
631 3300044683 Ga0466965_0020027 Ga0466965_0020027_854_1519 206
632 3300044684 Ga0466966_0001263 Ga0466966_0001263_6541_7206 206
633 3300044693 Ga0466961_0000587 Ga0466961_0000587_13411_14076 206
634 3300044694 Ga0466963_0132104 Ga0466963_0132104_88_753 206
635 3300044735 Ga0466968_0177787 Ga0466968_0177787_15_680 206
636 3300044765 Ga0466970_0112654 Ga0466970_0112654_478_1143 206
637 3300044901 Ga0466960_0017610 Ga0466960_0017610_1195_1860 206
638 3300044901 Ga0466960_0047816 Ga0466960_0047816_86_751 206
639 3300044901 Ga0466960_0253196 Ga0466960_0253196_84_749 206
640 3300045049 Ga0466959_0290768 Ga0466959_0290768_329_994 206
641 3300045836 Ga0466958_0359690 Ga0466958_0359690_82_747 206
642 3300045976 Ga0466967_0007932 Ga0466967_0007932_5354_6019 206
643 3300046454 Ga0495592_0174189 Ga0495592_0174189_341_1006 206
644 3300046460 Ga0495638_0005484 Ga0495638_0005484_824_1489 206
645 3300046462 Ga0495651_0010856 Ga0495651_0010856_3405_4070 206
646 3300046463 Ga0495653_0245357 Ga0495653_0245357_474_1139 206
647 3300046477 Ga0495664_0026263 Ga0495664_0026263_1043_1708 206
648 3300046507 Ga0495606_0246069 Ga0495606_0246069_204_869 206
649 3300046511 Ga0495608_0040710 Ga0495608_0040710_1555_2220 206
650 3300046512 Ga0495610_0171979 Ga0495610_0171979_207_872 206
651 3300046513 Ga0495616_0034642 Ga0495616_0034642_872_1537 206
652 3300046516 Ga0495628_0030307 Ga0495628_0030307_777_1442 206
653 3300046518 Ga0495631_0094186 Ga0495631_0094186_501_1166 206
654 3300046519 Ga0495632_0097477 Ga0495632_0097477_560_1249 206
655 3300046522 Ga0495643_0048350 Ga0495643_0048350_712_1377 206
656 3300046522 Ga0495643_0115321 Ga0495643_0115321_237_902 206
657 3300046524 Ga0495648_0119955 Ga0495648_0119955_437_1102 206
658 3300046529 Ga0495652_0053710 Ga0495652_0053710_1084_1749 206
659 3300046533 Ga0495640_0017481 Ga0495640_0017481_2361_3026 206
660 3300046538 Ga0495609_0070451 Ga0495609_0070451_141_806 206
661 3300046542 Ga0495597_0129804 Ga0495597_0129804_266_931 206
662 3300046543 Ga0495645_0130515 Ga0495645_0130515_10_675 206
663 3300046559 Ga0495667_0146737 Ga0495667_0146737_734_1399 206
664 3300046616 Ga0495668_0127682 Ga0495668_0127682_383_1048 206
665 3300046616 Ga0495668_0130090 Ga0495668_0130090_512_1177 206
666 3300046648 Ga0495611_0031892 Ga0495611_0031892_644_1309 206
667 3300046660 Ga0495625_0081399 Ga0495625_0081399_1220_1885 206
668 3300046665 Ga0495661_0134631 Ga0495661_0134631_425_1090 206
669 3300046680 Ga0495646_0016495 Ga0495646_0016495_1092_1757 206
670 3300046691 Ga0495670_0036549 Ga0495670_0036549_1359_2024 206
671 3300046809 Ga0495600_0004694 Ga0495600_0004694_1482_2147 206
672 3300047317 Ga0495604_0006635 Ga0495604_0006635_5413_6078 206
673 3300047320 Ga0495672_0038074 Ga0495672_0038074_1517_2182 206
674 3300047322 Ga0495680_0002702 Ga0495680_0002702_1692_2357 206
675 3300047443 Ga0495687_097552 Ga0495687_097552_312_977 206
676 3300047444 Ga0495675_0031749 Ga0495675_0031749_1062_1727 206
677 3300047469 Ga0495673_0032706 Ga0495673_0032706_930_1595 206
678 3300047470 Ga0495681_0140369 Ga0495681_0140369_198_863 206
679 3300047471 Ga0495684_0219050 Ga0495684_0219050_439_1104 206
680 3300048088 Ga0495602_0022693 Ga0495602_0022693_2880_3545 206
681 3300048091 Ga0495626_0027116 Ga0495626_0027116_1503_2168 206
682 3300048904 Ga0496101_0419742 Ga0496101_0419742_251_916 206
683 3300048905 Ga0496102_0381950 Ga0496102_0381950_202_867 206
684 3300048906 Ga0496103_0037348 Ga0496103_0037348_896_1561 206
685 3300048907 Ga0496104_0082005 Ga0496104_0082005_1671_2336 206
686 3300048909 Ga0496106_0028578 Ga0496106_0028578_2449_3114 206
687 3300048909 Ga0496106_0118187 Ga0496106_0118187_1233_1898 206
688 3300048909 Ga0496106_0391116 Ga0496106_0391116_49_714 206
689 3300048910 Ga0496107_0085273 Ga0496107_0085273_693_1358 206
690 3300048910 Ga0496107_0099829 Ga0496107_0099829_20_685 206
691 3300048911 Ga0496108_0231713 Ga0496108_0231713_80_745 206
692 3300048911 Ga0496108_0325947 Ga0496108_0325947_637_1302 206
693 3300048913 Ga0496110_0341343 Ga0496110_0341343_357_1022 206
694 3300048913 Ga0496110_0603622 Ga0496110_0603622_49_714 206
695 3300048914 Ga0496111_0117275 Ga0496111_0117275_1028_1693 206
696 3300048915 Ga0496112_0186673 Ga0496112_0186673_432_1097 206
697 3300048916 Ga0496113_0187902 Ga0496113_0187902_835_1500 206
698 3300048916 Ga0496113_0292578 Ga0496113_0292578_582_1247 206
699 3300048919 Ga0496116_0005629 Ga0496116_0005629_1748_2413 206
700 3300048919 Ga0496116_0045623 Ga0496116_0045623_832_1497 206
701 3300048919 Ga0496116_0220168 Ga0496116_0220168_136_828 206
702 3300048919 Ga0496116_0271295 Ga0496116_0271295_107_772 206
703 3300048920 Ga0496117_0018170 Ga0496117_0018170_1869_2561 206
704 3300048920 Ga0496117_0212504 Ga0496117_0212504_381_1046 206
705 3300048921 Ga0496118_0016217 Ga0496118_0016217_39_704 206
706 3300048921 Ga0496118_0022563 Ga0496118_0022563_2469_3134 206
707 3300048921 Ga0496118_0195194 Ga0496118_0195194_300_965 206
708 3300048922 Ga0496119_0002464 Ga0496119_0002464_11553_12218 206
709 3300048922 Ga0496119_0043733 Ga0496119_0043733_145_837 206
710 3300048922 Ga0496119_0164862 Ga0496119_0164862_394_1059 206
711 3300048922 Ga0496119_0164915 Ga0496119_0164915_107_772 206
712 3300048922 Ga0496119_0217495 Ga0496119_0217495_114_779 206
713 3300048923 Ga0496120_0055427 Ga0496120_0055427_1092_1784 206
714 3300048923 Ga0496120_0058683 Ga0496120_0058683_115_780 206
715 3300048924 Ga0496121_0000003 Ga0496121_0000003_875081_875773 206
716 3300048924 Ga0496121_0010528 Ga0496121_0010528_8659_9324 206
717 3300048924 Ga0496121_0040610 Ga0496121_0040610_3217_3882 206
718 3300048924 Ga0496121_0151805 Ga0496121_0151805_522_1163 206
719 3300048925 Ga0496122_0016451 Ga0496122_0016451_4946_5611 206
720 3300048925 Ga0496122_0036331 Ga0496122_0036331_2801_3466 206
721 3300048925 Ga0496122_0075684 Ga0496122_0075684_1617_2282 206
722 3300048925 Ga0496122_0195777 Ga0496122_0195777_430_1095 206
723 3300048925 Ga0496122_0197800 Ga0496122_0197800_223_915 206
724 3300048925 Ga0496122_0202949 Ga0496122_0202949_59_724 206
725 3300048926 Ga0496123_0072116 Ga0496123_0072116_70_735 206
726 3300048926 Ga0496123_0178332 Ga0496123_0178332_39_731 206
727 3300048928 Ga0496125_0000170 Ga0496125_0000170_71258_71950 206
728 3300048928 Ga0496125_0000477 Ga0496125_0000477_25206_25871 206
729 3300048928 Ga0496125_0003063 Ga0496125_0003063_15961_16626 206
730 3300048928 Ga0496125_0003174 Ga0496125_0003174_1085_1750 206
731 3300048928 Ga0496125_0011833 Ga0496125_0011833_6345_7010 206
732 3300048928 Ga0496125_0071108 Ga0496125_0071108_618_1283 206
733 3300048928 Ga0496125_0245842 Ga0496125_0245842_427_1092 206
734 3300048929 Ga0496126_0004626 Ga0496126_0004626_792_1457 206
735 3300048929 Ga0496126_0036837 Ga0496126_0036837_1575_2267 206
736 3300048929 Ga0496126_0045598 Ga0496126_0045598_2524_3189 206
737 3300048929 Ga0496126_0081599 Ga0496126_0081599_544_1209 206
738 3300048929 Ga0496126_0087837 Ga0496126_0087837_810_1478 206
739 3300048929 Ga0496126_0236965 Ga0496126_0236965_99_791 206
740 3300048929 Ga0496126_0391947 Ga0496126_0391947_449_1114 206
741 3300048929 Ga0496126_0420269 Ga0496126_0420269_107_772 206
742 3300048929 Ga0496126_0494113 Ga0496126_0494113_245_910 206
743 3300049570 Ga0501033_0314505 Ga0501033_0314505_124_789 206
744 3300049571 Ga0501034_0042325 Ga0501034_0042325_1843_2508 206
745 3300049573 Ga0501037_0003530 Ga0501037_0003530_7608_8273 206
746 3300050490 nmdc:mga03n38_13013_c1 nmdc:mga03n38_13013_c1_1616_2281 206
747 3300050490 nmdc:mga03n38_81392_c1 nmdc:mga03n38_81392_c1_536_1201 206
748 3300050491 nmdc:mga00v17_134463_c1 nmdc:mga00v17_134463_c1_351_1016 206
749 3300050492 nmdc:mga0yw44_162114_c1 nmdc:mga0yw44_162114_c1_150_815 206
750 3300050492 nmdc:mga0yw44_185037_c1 nmdc:mga0yw44_185037_c1_616_1281 206
751 3300050492 nmdc:mga0yw44_72573_c1 nmdc:mga0yw44_72573_c1_904_1569 206
752 3300050493 nmdc:mga0k408_111800_c1 nmdc:mga0k408_111800_c1_196_861 206
753 3300050494 nmdc:mga06z11_78824_c1 nmdc:mga06z11_78824_c1_544_1209 206
754 3300050495 nmdc:mga04h51_12233_c1 nmdc:mga04h51_12233_c1_1244_1909 206
755 3300050496 nmdc:mga07m45_39342_c1 nmdc:mga07m45_39342_c1_1623_2288 206
756 3300050496 nmdc:mga07m45_65906_c1 nmdc:mga07m45_65906_c1_42_707 206
757 3300050516 nmdc:mga0sz30_120099_c1 nmdc:mga0sz30_120099_c1_203_868 206
758 3300050516 nmdc:mga0sz30_8932_c1 nmdc:mga0sz30_8932_c1_2874_3539 206
759 3300053079 Ga0500610_0165641 Ga0500610_0165641_250_915 206
760 3300053083 Ga0495655_0081804 Ga0495655_0081804_61_726 206
761 3300053084 Ga0495595_0087431 Ga0495595_0087431_558_1223 206
762 3300053086 Ga0500578_0066446 Ga0500578_0066446_358_1023 206
763 3300053087 Ga0500643_000085 Ga0500643_000085_57357_58022 206
764 3300053089 Ga0500581_074781 Ga0500581_074781_713_1378 206
765 3300053090 Ga0500646_0018471 Ga0500646_0018471_992_1657 206
766 3300053093 Ga0500651_0100180 Ga0500651_0100180_29_694 206
767 3300053093 Ga0500651_0137222 Ga0500651_0137222_171_836 206
768 3300053098 Ga0500650_0040958 Ga0500650_0040958_575_1240 206
769 3300053103 Ga0500555_001875 Ga0500555_001875_977_1642 206
770 3300053103 Ga0500555_034629 Ga0500555_034629_105_770 206
771 3300053104 Ga0500556_0000066 Ga0500556_0000066_24370_25035 206
772 3300053104 Ga0500556_0000070 Ga0500556_0000070_52385_53050 206
773 3300053104 Ga0500556_0043429 Ga0500556_0043429_18_683 206
774 3300053105 Ga0500557_000002 Ga0500557_000002_64648_65313 206
775 3300053108 Ga0500562_030571 Ga0500562_030571_283_948 206
776 3300053108 Ga0500562_093374 Ga0500562_093374_103_768 206
777 3300053109 Ga0500569_011975 Ga0500569_011975_1270_1935 206
778 3300053109 Ga0500569_022888 Ga0500569_022888_37_702 206
779 3300053121 Ga0500607_041458 Ga0500607_041458_1559_2224 206
780 3300053121 Ga0500607_165094 Ga0500607_165094_253_918 206
781 3300053122 Ga0500608_050882 Ga0500608_050882_433_1098 206
782 3300053125 Ga0500618_001004 Ga0500618_001004_11064_11753 206
783 3300053125 Ga0500618_015946 Ga0500618_015946_1034_1699 206
784 3300053125 Ga0500618_019260 Ga0500618_019260_212_877 206
785 3300053130 Ga0500642_0000072 Ga0500642_0000072_1377_2042 206
786 3300053130 Ga0500642_0000442 Ga0500642_0000442_8284_8949 206
787 3300053130 Ga0500642_0074914 Ga0500642_0074914_431_1096 206
788 3300053130 Ga0500642_0178266 Ga0500642_0178266_40_705 206
789 3300053131 Ga0500652_041482 Ga0500652_041482_632_1297 206
790 3300053131 Ga0500652_224857 Ga0500652_224857_21_686 206
791 3300053134 Ga0500658_0231334 Ga0500658_0231334_140_805 206
792 3300053136 Ga0500559_0001217 Ga0500559_0001217_7512_8177 206
793 3300053139 Ga0500568_0003002 Ga0500568_0003002_7877_8542 206
794 3300053139 Ga0500568_0006816 Ga0500568_0006816_3040_3705 206
795 3300053142 Ga0500577_0000803 Ga0500577_0000803_5247_5912 206
796 3300053142 Ga0500577_0030785 Ga0500577_0030785_993_1658 206
797 3300053146 Ga0500588_0161712 Ga0500588_0161712_140_805 206
798 3300053148 Ga0500590_024498 Ga0500590_024498_346_1011 206
799 3300053150 Ga0500603_088427 Ga0500603_088427_84_749 206
800 3300053153 Ga0500616_0000177 Ga0500616_0000177_52694_53359 206
801 3300053153 Ga0500616_0067362 Ga0500616_0067362_1010_1675 206
802 3300053155 Ga0500620_005118 Ga0500620_005118_965_1630 206
803 3300053156 Ga0500622_0004935 Ga0500622_0004935_936_1601 206
804 3300053161 Ga0500634_0157095 Ga0500634_0157095_77_742 206
805 3300053177 Ga0500636_0000103 Ga0500636_0000103_27003_27668 206
806 3300053177 Ga0500636_0011422 Ga0500636_0011422_247_912 206
807 3300053729 Ga0500625_115717 Ga0500625_115717_397_1062 206
808 3300053737 Ga0500601_000169 Ga0500601_000169_856_1521 206
809 iso_pu_bacteria 2510461069 2510840244 206
810 iso_pu_bacteria 2758568016 2758639079 206
811 iso_pu_bacteria 2775507049 2776916029 206
812 iso_pu_bacteria 2854911287 2854916394 206
813 iso_pu_bacteria 2919450847 2919453338 206
814 iso_pu_bacteria 2929138655 2929141261 206
815 iso_pu_bacteria 8001845381 8001847134 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

27

210

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.9037 8 181
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.883 12 174
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.8825 12 174
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.8809 8 181
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8779 4 199
ID Description Score Start End Superfamily
af_Q2FZZ1_20_231_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9298 7 189 1.10.3720.10
3dhwF00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9037 8 181 1.10.3720.10
af_Q2G0V1_7_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8996 7 200 1.10.3720.10
af_P9WG11_24_299_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8813 12 164 1.10.3720.10
3dhwE00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8809 8 181 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A847JIQ3-F1-model_v4 ABC transporter permease 0.995 1 175 GO:0005886
GO:0048473
AF-A0A7J6YUS8-F1-model_v4 deleted 0.9894 20 168
AF-A0A847JIQ3-F1-model_v4 ABC transporter permease 0.9838 1 175 GO:0005886
GO:0048473
AF-A0A4U3BA09-F1-model_v4 deleted 0.9836 9 165
AF-A0A3S1DYD4-F1-model_v4 ABC transporter permease 0.9832 1 162 GO:0005886
GO:0048473

Feature Viewer

pLDDT pTM Quality
91.05 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map