F481962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 310 | 1626 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300061719|Ga0466962_0100638|Ga0466962_0100638_52_633 |
| Length | 193 |
| Sequence | MIHAGDTIHNPVTGERIVFRQTSRETNGEAVVIETFVQPNGFVAAAHVHPGQEERFEILRGSVGFKVGGEKLVAGPGQRLTVPAGTPHRFWNAGEEEEAHFVCEVRPALQFETLLETMFALAADGKTNRKGMPNPLRLAVIANAHFDTVRLPFPPALVQRIGLALGAPLGRLFGYEPIYVPAEPAAIAAAASI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 173 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.89 |
| Metatranscriptomes | 1.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 11.56 |
| Rhizosphere | 87.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466962_0100638 | 3300061719 | Bacteria | 1388 |
| 2 | Ga0070658_10048475 | 3300005327 | Bacteria | 3440 |
| 3 | Ga0070658_10163814 | 3300005327 | Bacteria | 1866 |
| 4 | Ga0070676_10293742 | 3300005328 | Unclassified | 1099 |
| 5 | Ga0070683_100009898 | 3300005329 | Bacteria | 8171 |
| 6 | Ga0070683_100017148 | 3300005329 | Bacteria | 6395 |
| 7 | Ga0070683_100591634 | 3300005329 | Unclassified | 1062 |
| 8 | Ga0070680_100013850 | 3300005336 | Bacteria | 6291 |
| 9 | Ga0070680_100015369 | 3300005336 | Bacteria | 5999 |
| 10 | Ga0070680_100512736 | 3300005336 | Bacteria | 1027 |
| 11 | Ga0070682_100181559 | 3300005337 | Bacteria | 1470 |
| 12 | Ga0068868_100453446 | 3300005338 | Unclassified | 1116 |
| 13 | Ga0070660_100003547 | 3300005339 | Bacteria | 10768 |
| 14 | Ga0070660_100057819 | 3300005339 | Bacteria | 3005 |
| 15 | Ga0070660_100308239 | 3300005339 | Bacteria | 1299 |
| 16 | Ga0070691_10353023 | 3300005341 | Unclassified | 817 |
| 17 | Ga0070661_100018395 | 3300005344 | Bacteria | 4967 |
| 18 | Ga0070692_10143624 | 3300005345 | Bacteria | 1353 |
| 19 | Ga0070669_100577997 | 3300005353 | Unclassified | 939 |
| 20 | Ga0070675_100349037 | 3300005354 | Bacteria | 1312 |
| 21 | Ga0070671_100083566 | 3300005355 | Bacteria | 2670 |
| 22 | Ga0070674_100268799 | 3300005356 | Bacteria | 1346 |
| 23 | Ga0070674_100436076 | 3300005356 | Unclassified | 1078 |
| 24 | Ga0070674_100500709 | 3300005356 | Bacteria | 1012 |
| 25 | Ga0070674_100918299 | 3300005356 | Bacteria | 763 |
| 26 | Ga0070673_100327387 | 3300005364 | Bacteria | 1355 |
| 27 | Ga0070688_100440589 | 3300005365 | Unclassified | 972 |
| 28 | Ga0070659_101196149 | 3300005366 | Unclassified | 672 |
| 29 | Ga0070709_10034207 | 3300005434 | Bacteria | 3079 |
| 30 | Ga0070714_100022116 | 3300005435 | Bacteria | 5211 |
| 31 | Ga0070714_100133574 | 3300005435 | Bacteria | 2219 |
| 32 | Ga0070714_100821152 | 3300005435 | Unclassified | 901 |
| 33 | Ga0070714_101037263 | 3300005435 | Bacteria | 798 |
| 34 | Ga0070713_100017782 | 3300005436 | Bacteria | 5390 |
| 35 | Ga0070713_100075810 | 3300005436 | Bacteria | 2854 |
| 36 | Ga0070713_100209377 | 3300005436 | Bacteria | 1764 |
| 37 | Ga0070713_101020081 | 3300005436 | Bacteria | 798 |
| 38 | Ga0070710_10036401 | 3300005437 | Bacteria | 2691 |
| 39 | Ga0070710_10045878 | 3300005437 | Bacteria | 2431 |
| 40 | Ga0070710_10148554 | 3300005437 | Unclassified | 1443 |
| 41 | Ga0070711_100076689 | 3300005439 | Bacteria | 2370 |
| 42 | Ga0070711_100232682 | 3300005439 | Bacteria | 1437 |
| 43 | Ga0070705_100274395 | 3300005440 | Unclassified | 1196 |
| 44 | Ga0070700_100039513 | 3300005441 | Bacteria | 2883 |
| 45 | Ga0070700_100379139 | 3300005441 | Unclassified | 1057 |
| 46 | Ga0070694_100231589 | 3300005444 | Bacteria | 1390 |
| 47 | Ga0070678_100262606 | 3300005456 | Unclassified | 1453 |
| 48 | Ga0070678_100669297 | 3300005456 | Bacteria | 933 |
| 49 | Ga0070681_10024831 | 3300005458 | Bacteria | 6029 |
| 50 | Ga0070681_10068898 | 3300005458 | Bacteria | 3504 |
| 51 | Ga0070681_10208689 | 3300005458 | Bacteria | 1870 |
| 52 | Ga0070681_10217146 | 3300005458 | Bacteria | 1828 |
| 53 | Ga0070681_10278532 | 3300005458 | Bacteria | 1583 |
| 54 | Ga0068867_100502034 | 3300005459 | Unclassified | 1043 |
| 55 | Ga0068867_100637546 | 3300005459 | Unclassified | 933 |
| 56 | Ga0070698_100006851 | 3300005471 | Bacteria | 12344 |
| 57 | Ga0070699_100552965 | 3300005518 | Unclassified | 1048 |
| 58 | Ga0070679_100047736 | 3300005530 | Bacteria | 4267 |
| 59 | Ga0070679_100062622 | 3300005530 | Bacteria | 3709 |
| 60 | Ga0070679_100065001 | 3300005530 | Bacteria | 3636 |
| 61 | Ga0070679_100067929 | 3300005530 | Bacteria | 3555 |
| 62 | Ga0070679_100226034 | 3300005530 | Bacteria | 1832 |
| 63 | Ga0070679_100250880 | 3300005530 | Bacteria | 1726 |
| 64 | Ga0070679_100515486 | 3300005530 | Bacteria | 1139 |
| 65 | Ga0070679_100564451 | 3300005530 | Bacteria | 1082 |
| 66 | Ga0070684_100057735 | 3300005535 | Bacteria | 3389 |
| 67 | Ga0070684_100105667 | 3300005535 | Bacteria | 2519 |
| 68 | Ga0070684_100340102 | 3300005535 | Bacteria | 1380 |
| 69 | Ga0068853_100178017 | 3300005539 | Bacteria | 1928 |
| 70 | Ga0070686_100212391 | 3300005544 | Bacteria | 1394 |
| 71 | Ga0070695_100000363 | 3300005545 | Bacteria | 23281 |
| 72 | Ga0070695_100196744 | 3300005545 | Bacteria | 1438 |
| 73 | Ga0070693_100021474 | 3300005547 | Bacteria | 3420 |
| 74 | Ga0070693_100023834 | 3300005547 | Bacteria | 3276 |
| 75 | Ga0070665_100016660 | 3300005548 | Bacteria | 7364 |
| 76 | Ga0070704_100168968 | 3300005549 | Bacteria | 1737 |
| 77 | Ga0068855_100047632 | 3300005563 | Bacteria | 5063 |
| 78 | Ga0068855_100195121 | 3300005563 | Bacteria | 2281 |
| 79 | Ga0068855_100532543 | 3300005563 | Bacteria | 1273 |
| 80 | Ga0068855_100679051 | 3300005563 | Unclassified | 1104 |
| 81 | Ga0070664_100780376 | 3300005564 | Bacteria | 893 |
| 82 | Ga0068854_100090519 | 3300005578 | Bacteria | 2275 |
| 83 | Ga0068856_100022903 | 3300005614 | Bacteria | 6075 |
| 84 | Ga0068856_100316926 | 3300005614 | Bacteria | 1577 |
| 85 | Ga0068852_100003792 | 3300005616 | Bacteria | 10602 |
| 86 | Ga0068852_100181461 | 3300005616 | Bacteria | 1979 |
| 87 | Ga0068852_101090172 | 3300005616 | Unclassified | 819 |
| 88 | Ga0068852_101437806 | 3300005616 | Bacteria | 712 |
| 89 | Ga0068866_10410789 | 3300005718 | Unclassified | 876 |
| 90 | Ga0068861_100071059 | 3300005719 | Bacteria | 2697 |
| 91 | Ga0068851_10140072 | 3300005834 | Bacteria | 1315 |
| 92 | Ga0068863_101183346 | 3300005841 | Unclassified | 770 |
| 93 | Ga0068862_100351162 | 3300005844 | Unclassified | 1368 |
| 94 | Ga0081455_10053251 | 3300005937 | Bacteria | 3458 |
| 95 | Ga0081455_10089780 | 3300005937 | Bacteria | 2493 |
| 96 | Ga0081455_10099186 | 3300005937 | Bacteria | 2343 |
| 97 | Ga0081538_10002117 | 3300005981 | Bacteria | 19784 |
| 98 | Ga0081539_10000781 | 3300005985 | Bacteria | 62064 |
| 99 | Ga0070717_10009169 | 3300006028 | Bacteria | 7435 |
| 100 | Ga0075364_10131550 | 3300006051 | Bacteria | 1679 |
| 101 | Ga0070715_10010483 | 3300006163 | Bacteria | 3304 |
| 102 | Ga0070715_10039362 | 3300006163 | Bacteria | 1969 |
| 103 | Ga0070716_100016356 | 3300006173 | Bacteria | 3826 |
| 104 | Ga0070716_100034338 | 3300006173 | Bacteria | 2780 |
| 105 | Ga0070712_100018844 | 3300006175 | Bacteria | 4491 |
| 106 | Ga0070712_100076773 | 3300006175 | Bacteria | 2406 |
| 107 | Ga0070712_100106221 | 3300006175 | Bacteria | 2087 |
| 108 | Ga0070712_100127803 | 3300006175 | Bacteria | 1922 |
| 109 | Ga0070712_100182671 | 3300006175 | Bacteria | 1635 |
| 110 | Ga0070712_100560644 | 3300006175 | Unclassified | 963 |
| 111 | Ga0075362_10024646 | 3300006177 | Bacteria | 2554 |
| 112 | Ga0075366_10075782 | 3300006195 | Bacteria | 2007 |
| 113 | Ga0097621_100444910 | 3300006237 | Bacteria | 1167 |
| 114 | Ga0097621_100602040 | 3300006237 | Unclassified | 1005 |
| 115 | Ga0075428_100099811 | 3300006844 | Unclassified | 3165 |
| 116 | Ga0075430_100050445 | 3300006846 | Bacteria | 3509 |
| 117 | Ga0075431_100165737 | 3300006847 | Bacteria | 2271 |
| 118 | Ga0075431_100221813 | 3300006847 | Unclassified | 1928 |
| 119 | Ga0075433_10208699 | 3300006852 | Bacteria | 1736 |
| 120 | Ga0075433_10390743 | 3300006852 | Bacteria | 1228 |
| 121 | Ga0075433_10458814 | 3300006852 | Bacteria | 1123 |
| 122 | Ga0075434_100016720 | 3300006871 | Bacteria | 7057 |
| 123 | Ga0075434_100104006 | 3300006871 | Bacteria | 2849 |
| 124 | Ga0075434_101024992 | 3300006871 | Bacteria | 839 |
| 125 | Ga0075429_100306874 | 3300006880 | Bacteria | 1389 |
| 126 | Ga0068865_100087649 | 3300006881 | Bacteria | 2250 |
| 127 | Ga0068865_100365557 | 3300006881 | Bacteria | 1173 |
| 128 | Ga0068865_100574582 | 3300006881 | Bacteria | 950 |
| 129 | Ga0075436_100206274 | 3300006914 | Bacteria | 1393 |
| 130 | Ga0075435_100058951 | 3300007076 | Bacteria | 3111 |
| 131 | Ga0099795_10102231 | 3300007788 | Bacteria | 1126 |
| 132 | Ga0105251_10293718 | 3300009011 | Unclassified | 736 |
| 133 | Ga0105240_10162039 | 3300009093 | Bacteria | 2656 |
| 134 | Ga0111539_10078401 | 3300009094 | Bacteria | 3887 |
| 135 | Ga0111539_10096130 | 3300009094 | Bacteria | 3479 |
| 136 | Ga0111539_11516519 | 3300009094 | Bacteria | 777 |
| 137 | Ga0105245_10057981 | 3300009098 | Bacteria | 3485 |
| 138 | Ga0105245_10151345 | 3300009098 | Bacteria | 2194 |
| 139 | Ga0105245_10281352 | 3300009098 | Bacteria | 1626 |
| 140 | Ga0105245_10338716 | 3300009098 | Unclassified | 1487 |
| 141 | Ga0105245_10983485 | 3300009098 | Unclassified | 888 |
| 142 | Ga0114129_10904995 | 3300009147 | Unclassified | 1118 |
| 143 | Ga0105243_10101793 | 3300009148 | Bacteria | 2386 |
| 144 | Ga0105241_10411291 | 3300009174 | Bacteria | 1189 |
| 145 | Ga0105242_10057932 | 3300009176 | Bacteria | 3174 |
| 146 | Ga0105242_10380666 | 3300009176 | Bacteria | 1312 |
| 147 | Ga0105242_10652556 | 3300009176 | Bacteria | 1023 |
| 148 | Ga0105242_10731576 | 3300009176 | Unclassified | 972 |
| 149 | Ga0105248_10537006 | 3300009177 | Bacteria | 1319 |
| 150 | Ga0105237_10009640 | 3300009545 | Bacteria | 10335 |
| 151 | Ga0105237_10026472 | 3300009545 | Bacteria | 5928 |
| 152 | Ga0105238_10063652 | 3300009551 | Bacteria | 3689 |
| 153 | Ga0105238_10319259 | 3300009551 | Bacteria | 1539 |
| 154 | Ga0105249_10002935 | 3300009553 | Bacteria | 14709 |
| 155 | Ga0105239_10114018 | 3300010375 | Bacteria | 2998 |
| 156 | Ga0105239_10128853 | 3300010375 | Bacteria | 2813 |
| 157 | Ga0105239_10194731 | 3300010375 | Bacteria | 2270 |
| 158 | Ga0105239_10269718 | 3300010375 | Bacteria | 1914 |
| 159 | Ga0105239_10286929 | 3300010375 | Bacteria | 1853 |
| 160 | Ga0105239_10598748 | 3300010375 | Bacteria | 1257 |
| 161 | Ga0105246_10503044 | 3300011119 | Unclassified | 1029 |
| 162 | Ga0157329_1006789 | 3300012491 | Unclassified | 815 |
| 163 | Ga0157373_10417961 | 3300013100 | Bacteria | 962 |
| 164 | Ga0157370_10001705 | 3300013104 | Bacteria | 27045 |
| 165 | Ga0157370_10008120 | 3300013104 | Bacteria | 11360 |
| 166 | Ga0157370_10015648 | 3300013104 | Bacteria | 7705 |
| 167 | Ga0157370_10186282 | 3300013104 | Bacteria | 1927 |
| 168 | Ga0157369_10009399 | 3300013105 | Bacteria | 11178 |
| 169 | Ga0157369_10026009 | 3300013105 | Bacteria | 6494 |
| 170 | Ga0157374_10389473 | 3300013296 | Bacteria | 1389 |
| 171 | Ga0157374_10471152 | 3300013296 | Bacteria | 1258 |
| 172 | Ga0163162_10075411 | 3300013306 | Bacteria | 3433 |
| 173 | Ga0157372_10011307 | 3300013307 | Bacteria | 9495 |
| 174 | Ga0157372_10023472 | 3300013307 | Bacteria | 6686 |
| 175 | Ga0157372_10133199 | 3300013307 | Bacteria | 2861 |
| 176 | Ga0157372_10617307 | 3300013307 | Bacteria | 1264 |
| 177 | Ga0157375_10067823 | 3300013308 | Bacteria | 3566 |
| 178 | Ga0157375_10293934 | 3300013308 | Bacteria | 1788 |
| 179 | Ga0157375_10807372 | 3300013308 | Unclassified | 1086 |
| 180 | Ga0163163_10569083 | 3300014325 | Bacteria | 1196 |
| 181 | Ga0157377_10210664 | 3300014745 | Bacteria | 1239 |
| 182 | Ga0157376_10086587 | 3300014969 | Bacteria | 2702 |
| 183 | Ga0157376_10163407 | 3300014969 | Bacteria | 2020 |
| 184 | Ga0206356_10034121 | 3300020070 | Bacteria | 3563 |
| 185 | Ga0206356_10058303 | 3300020070 | Bacteria | 1232 |
| 186 | Ga0206350_10083145 | 3300020080 | Bacteria | 2040 |
| 187 | Ga0206353_10956052 | 3300020082 | Bacteria | 1586 |
| 188 | Ga0206353_11078391 | 3300020082 | Bacteria | 1218 |
| 189 | Ga0224712_10012062 | 3300022467 | Bacteria | 2704 |
| 190 | Ga0207692_10041656 | 3300025898 | Unclassified | 2275 |
| 191 | Ga0207692_10054357 | 3300025898 | Bacteria | 2044 |
| 192 | Ga0207688_10169873 | 3300025901 | Bacteria | 1296 |
| 193 | Ga0207647_10134586 | 3300025904 | Unclassified | 1451 |
| 194 | Ga0207685_10059778 | 3300025905 | Unclassified | 1505 |
| 195 | Ga0207685_10068682 | 3300025905 | Bacteria | 1429 |
| 196 | Ga0207699_10255944 | 3300025906 | Unclassified | 1208 |
| 197 | Ga0207699_10437739 | 3300025906 | Bacteria | 936 |
| 198 | Ga0207643_10237186 | 3300025908 | Unclassified | 1120 |
| 199 | Ga0207643_10268999 | 3300025908 | Bacteria | 1054 |
| 200 | Ga0207705_10137448 | 3300025909 | Bacteria | 1823 |
| 201 | Ga0207705_10148324 | 3300025909 | Bacteria | 1756 |
| 202 | Ga0207705_10366061 | 3300025909 | Bacteria | 1112 |
| 203 | Ga0207654_10072191 | 3300025911 | Bacteria | 2054 |
| 204 | Ga0207707_10021670 | 3300025912 | Bacteria | 5616 |
| 205 | Ga0207707_10062364 | 3300025912 | Bacteria | 3244 |
| 206 | Ga0207707_10099891 | 3300025912 | Bacteria | 2536 |
| 207 | Ga0207707_10121815 | 3300025912 | Bacteria | 2281 |
| 208 | Ga0207707_10150991 | 3300025912 | Bacteria | 2031 |
| 209 | Ga0207707_10283943 | 3300025912 | Bacteria | 1433 |
| 210 | Ga0207695_10040677 | 3300025913 | Bacteria | 4981 |
| 211 | Ga0207695_10210848 | 3300025913 | Bacteria | 1853 |
| 212 | Ga0207671_10032718 | 3300025914 | Bacteria | 3868 |
| 213 | Ga0207693_10003543 | 3300025915 | Bacteria | 13334 |
| 214 | Ga0207693_10011364 | 3300025915 | Bacteria | 7209 |
| 215 | Ga0207693_10031619 | 3300025915 | Bacteria | 4182 |
| 216 | Ga0207693_10036998 | 3300025915 | Bacteria | 3847 |
| 217 | Ga0207693_10039554 | 3300025915 | Bacteria | 3714 |
| 218 | Ga0207663_10033908 | 3300025916 | Bacteria | 3046 |
| 219 | Ga0207663_10047509 | 3300025916 | Bacteria | 2650 |
| 220 | Ga0207663_10275827 | 3300025916 | Bacteria | 1247 |
| 221 | Ga0207660_10032860 | 3300025917 | Bacteria | 3584 |
| 222 | Ga0207660_10095422 | 3300025917 | Bacteria | 2213 |
| 223 | Ga0207657_10001511 | 3300025919 | Bacteria | 24895 |
| 224 | Ga0207657_10020508 | 3300025919 | Bacteria | 6243 |
| 225 | Ga0207657_10272334 | 3300025919 | Bacteria | 1346 |
| 226 | Ga0207649_10062282 | 3300025920 | Bacteria | 2351 |
| 227 | Ga0207649_10195641 | 3300025920 | Bacteria | 1425 |
| 228 | Ga0207652_10034097 | 3300025921 | Bacteria | 4289 |
| 229 | Ga0207652_10038093 | 3300025921 | Bacteria | 4073 |
| 230 | Ga0207652_10102921 | 3300025921 | Bacteria | 2524 |
| 231 | Ga0207652_10140599 | 3300025921 | Bacteria | 2158 |
| 232 | Ga0207652_10273481 | 3300025921 | Bacteria | 1524 |
| 233 | Ga0207652_10452364 | 3300025921 | Bacteria | 1157 |
| 234 | Ga0207652_10485003 | 3300025921 | Bacteria | 1113 |
| 235 | Ga0207646_10332074 | 3300025922 | Unclassified | 1374 |
| 236 | Ga0207646_10378622 | 3300025922 | Bacteria | 1278 |
| 237 | Ga0207694_10187658 | 3300025924 | Bacteria | 1678 |
| 238 | Ga0207694_10378657 | 3300025924 | Bacteria | 1174 |
| 239 | Ga0207687_10046423 | 3300025927 | Bacteria | 3007 |
| 240 | Ga0207687_10148534 | 3300025927 | Bacteria | 1786 |
| 241 | Ga0207687_10342806 | 3300025927 | Unclassified | 1215 |
| 242 | Ga0207700_10024422 | 3300025928 | Bacteria | 4183 |
| 243 | Ga0207700_10040403 | 3300025928 | Bacteria | 3405 |
| 244 | Ga0207700_10061048 | 3300025928 | Bacteria | 2858 |
| 245 | Ga0207664_10005471 | 3300025929 | Bacteria | 8686 |
| 246 | Ga0207664_10032566 | 3300025929 | Bacteria | 3997 |
| 247 | Ga0207664_10087989 | 3300025929 | Bacteria | 2541 |
| 248 | Ga0207664_10195969 | 3300025929 | Unclassified | 1741 |
| 249 | Ga0207664_10209670 | 3300025929 | Bacteria | 1685 |
| 250 | Ga0207690_10667489 | 3300025932 | Unclassified | 853 |
| 251 | Ga0207706_10463006 | 3300025933 | Bacteria | 1096 |
| 252 | Ga0207706_10512782 | 3300025933 | Bacteria | 1034 |
| 253 | Ga0207706_10592440 | 3300025933 | Unclassified | 953 |
| 254 | Ga0207686_10105367 | 3300025934 | Bacteria | 1891 |
| 255 | Ga0207686_10396706 | 3300025934 | Unclassified | 1050 |
| 256 | Ga0207709_10143623 | 3300025935 | Bacteria | 1644 |
| 257 | Ga0207669_10221676 | 3300025937 | Bacteria | 1388 |
| 258 | Ga0207669_10250769 | 3300025937 | Bacteria | 1318 |
| 259 | Ga0207704_10103487 | 3300025938 | Bacteria | 1905 |
| 260 | Ga0207665_10000359 | 3300025939 | Bacteria | 31672 |
| 261 | Ga0207665_10001883 | 3300025939 | Bacteria | 14141 |
| 262 | Ga0207665_10310193 | 3300025939 | Bacteria | 1182 |
| 263 | Ga0207691_10401178 | 3300025940 | Unclassified | 1170 |
| 264 | Ga0207661_10073918 | 3300025944 | Bacteria | 2793 |
| 265 | Ga0207661_10796829 | 3300025944 | Bacteria | 870 |
| 266 | Ga0207679_10102966 | 3300025945 | Bacteria | 2237 |
| 267 | Ga0207667_10062838 | 3300025949 | Bacteria | 3881 |
| 268 | Ga0207651_10290833 | 3300025960 | Bacteria | 1355 |
| 269 | Ga0207712_10017910 | 3300025961 | Bacteria | 4609 |
| 270 | Ga0207712_10100461 | 3300025961 | Bacteria | 2149 |
| 271 | Ga0207668_10868174 | 3300025972 | Bacteria | 802 |
| 272 | Ga0207640_10817762 | 3300025981 | Bacteria | 808 |
| 273 | Ga0207677_10547335 | 3300026023 | Bacteria | 1008 |
| 274 | Ga0207639_10529262 | 3300026041 | Bacteria | 1080 |
| 275 | Ga0207678_10106537 | 3300026067 | Bacteria | 2391 |
| 276 | Ga0207678_10426770 | 3300026067 | Bacteria | 1150 |
| 277 | Ga0207708_10126477 | 3300026075 | Bacteria | 1995 |
| 278 | Ga0207708_10317600 | 3300026075 | Bacteria | 1270 |
| 279 | Ga0207702_10003896 | 3300026078 | Bacteria | 13443 |
| 280 | Ga0207702_10075803 | 3300026078 | Bacteria | 2906 |
| 281 | Ga0207702_10122702 | 3300026078 | Bacteria | 2327 |
| 282 | Ga0207702_10284510 | 3300026078 | Bacteria | 1564 |
| 283 | Ga0207702_10625339 | 3300026078 | Unclassified | 1058 |
| 284 | Ga0207702_10794676 | 3300026078 | Bacteria | 935 |
| 285 | Ga0207641_11167613 | 3300026088 | Unclassified | 769 |
| 286 | Ga0207648_10145206 | 3300026089 | Bacteria | 2093 |
| 287 | Ga0207648_10588185 | 3300026089 | Unclassified | 1025 |
| 288 | Ga0207648_10719010 | 3300026089 | Unclassified | 926 |
| 289 | Ga0207674_10170355 | 3300026116 | Bacteria | 2131 |
| 290 | Ga0207674_10566676 | 3300026116 | Bacteria | 1097 |
| 291 | Ga0207675_100118906 | 3300026118 | Bacteria | 2499 |
| 292 | Ga0207683_10007746 | 3300026121 | Bacteria | 9194 |
| 293 | Ga0207683_10166140 | 3300026121 | Bacteria | 1997 |
| 294 | Ga0207683_10462649 | 3300026121 | Bacteria | 1170 |
| 295 | Ga0207698_10147023 | 3300026142 | Bacteria | 2040 |
| 296 | Ga0207698_10194711 | 3300026142 | Bacteria | 1809 |
| 297 | Ga0207428_10011860 | 3300027907 | Bacteria | 7680 |
| 298 | Ga0268265_10198622 | 3300028380 | Unclassified | 1738 |
| 299 | Ga0268265_11018512 | 3300028380 | Unclassified | 819 |
| 300 | Ga0268264_11781041 | 3300028381 | Bacteria | 626 |
| 301 | Ga0373938_0033234 | 3300034957 | Bacteria | 1115 |
| 302 | Ga0373944_0076833 | 3300035089 | Bacteria | 1097 |
| 303 | Ga0373951_0033451 | 3300035091 | Bacteria | 1219 |
| 304 | Ga0373952_0037827 | 3300035092 | Bacteria | 1103 |
| 305 | Ga0373932_0021335 | 3300035112 | Bacteria | 1709 |
| 306 | Ga0373939_0155496 | 3300035114 | Unclassified | 836 |
| 307 | Ga0373941_0007480 | 3300035115 | Bacteria | 2674 |
| 308 | Ga0373960_0067874 | 3300035121 | Unclassified | 1096 |
| 309 | Ga0373960_0110143 | 3300035121 | Bacteria | 902 |
| 310 | Ga0373943_0003569 | 3300035170 | Bacteria | 7078 |
| 311 | Ga0373943_0221950 | 3300035170 | Unclassified | 1053 |
| 312 | Ga0373962_0040834 | 3300035242 | Unclassified | 1306 |
| 313 | Ga0373931_0006757 | 3300035691 | Bacteria | 5382 |
| 314 | Ga0373935_0113294 | 3300035692 | Bacteria | 1803 |
| 315 | Ga0373927_0115826 | 3300035695 | Bacteria | 1747 |
| 316 | Ga0373947_0012653 | 3300035725 | Bacteria | 4838 |
| 317 | Ga0395899_0001311 | 3300037312 | Bacteria | 21430 |
| 318 | Ga0395899_0056346 | 3300037312 | Bacteria | 2905 |
| 319 | Ga0395899_0066297 | 3300037312 | Bacteria | 2651 |
| 320 | Ga0395899_0102813 | 3300037312 | Unclassified | 2061 |
| 321 | Ga0395899_0547909 | 3300037312 | Bacteria | 744 |
| 322 | Ga0395900_0006188 | 3300037418 | Bacteria | 12504 |
| 323 | Ga0395900_0037226 | 3300037418 | Bacteria | 5018 |
| 324 | Ga0395900_0067370 | 3300037418 | Bacteria | 3678 |
| 325 | Ga0395900_0246413 | 3300037418 | Bacteria | 1790 |
| 326 | Ga0395900_0426791 | 3300037418 | Bacteria | 1285 |
| 327 | Ga0395900_0808528 | 3300037418 | Bacteria | 865 |
| 328 | Ga0395898_0001816 | 3300037466 | Bacteria | 27562 |
| 329 | Ga0395898_0097135 | 3300037466 | Bacteria | 2829 |
| 330 | Ga0395898_0099134 | 3300037466 | Bacteria | 2798 |
| 331 | Ga0395898_0204657 | 3300037466 | Bacteria | 1883 |
| 332 | Ga0395898_0238746 | 3300037466 | Bacteria | 1733 |
| 333 | Ga0395905_0006417 | 3300037471 | Bacteria | 11842 |
| 334 | Ga0395905_0012858 | 3300037471 | Bacteria | 8046 |
| 335 | Ga0395905_0042952 | 3300037471 | Bacteria | 4241 |
| 336 | Ga0395905_0077452 | 3300037471 | Bacteria | 3115 |
| 337 | Ga0395905_0122502 | 3300037471 | Bacteria | 2445 |
| 338 | Ga0395905_0301281 | 3300037471 | Bacteria | 1490 |
| 339 | Ga0395901_0005317 | 3300038443 | Bacteria | 13010 |
| 340 | Ga0395901_0032040 | 3300038443 | Bacteria | 5423 |
| 341 | Ga0395901_0093910 | 3300038443 | Bacteria | 3141 |
| 342 | Ga0395901_0115032 | 3300038443 | Bacteria | 2825 |
| 343 | Ga0395901_0170985 | 3300038443 | Bacteria | 2280 |
| 344 | Ga0395901_0219500 | 3300038443 | Bacteria | 1987 |
| 345 | Ga0451853_1793536 | 3300041512 | Unclassified | 2524 |
| 346 | Ga0439448_0085139 | 3300042005 | Bacteria | 1065 |
| 347 | Ga0450920_051450 | 3300042122 | Bacteria | 826 |
| 348 | Ga0466969_0003305 | 3300044656 | Bacteria | 8575 |
| 349 | Ga0466965_0047774 | 3300044683 | Bacteria | 2119 |
| 350 | Ga0466965_0098566 | 3300044683 | Bacteria | 1493 |
| 351 | Ga0466965_0113758 | 3300044683 | Unclassified | 1393 |
| 352 | Ga0466965_0262129 | 3300044683 | Bacteria | 929 |
| 353 | Ga0466966_0022666 | 3300044684 | Bacteria | 4119 |
| 354 | Ga0466966_0025100 | 3300044684 | Bacteria | 3895 |
| 355 | Ga0466966_0027186 | 3300044684 | Bacteria | 3731 |
| 356 | Ga0466966_0046263 | 3300044684 | Bacteria | 2779 |
| 357 | Ga0466961_0026155 | 3300044693 | Bacteria | 3753 |
| 358 | Ga0466961_0033488 | 3300044693 | Bacteria | 3300 |
| 359 | Ga0466961_0154780 | 3300044693 | Bacteria | 1430 |
| 360 | Ga0466961_0222572 | 3300044693 | Bacteria | 1163 |
| 361 | Ga0466963_0000048 | 3300044694 | Bacteria | 39958 |
| 362 | Ga0466963_0003893 | 3300044694 | Bacteria | 8622 |
| 363 | Ga0466963_0004401 | 3300044694 | Bacteria | 8182 |
| 364 | Ga0466963_0007353 | 3300044694 | Bacteria | 6560 |
| 365 | Ga0466963_0007773 | 3300044694 | Bacteria | 6410 |
| 366 | Ga0466963_0010199 | 3300044694 | Bacteria | 5681 |
| 367 | Ga0466963_0011451 | 3300044694 | Bacteria | 5402 |
| 368 | Ga0466963_0013074 | 3300044694 | Bacteria | 5090 |
| 369 | Ga0466963_0034913 | 3300044694 | Bacteria | 3274 |
| 370 | Ga0466963_0038042 | 3300044694 | Bacteria | 3145 |
| 371 | Ga0466963_0118128 | 3300044694 | Unclassified | 1823 |
| 372 | Ga0466963_0122278 | 3300044694 | Unclassified | 1792 |
| 373 | Ga0466963_0809891 | 3300044694 | Bacteria | 660 |
| 374 | Ga0466964_0002291 | 3300044706 | Bacteria | 6786 |
| 375 | Ga0466964_0002374 | 3300044706 | Bacteria | 6690 |
| 376 | Ga0466964_0004438 | 3300044706 | Bacteria | 5183 |
| 377 | Ga0466964_0011534 | 3300044706 | Bacteria | 3340 |
| 378 | Ga0466964_0043150 | 3300044706 | Bacteria | 1829 |
| 379 | Ga0466964_0057857 | 3300044706 | Bacteria | 1606 |
| 380 | Ga0466964_0144996 | 3300044706 | Bacteria | 1095 |
| 381 | Ga0466964_0180760 | 3300044706 | Bacteria | 1000 |
| 382 | Ga0466964_0534671 | 3300044706 | Unclassified | 634 |
| 383 | Ga0466971_0000420 | 3300044719 | Bacteria | 16565 |
| 384 | Ga0466971_0000987 | 3300044719 | Bacteria | 11732 |
| 385 | Ga0466971_0004618 | 3300044719 | Bacteria | 5948 |
| 386 | Ga0466971_0023590 | 3300044719 | Bacteria | 2743 |
| 387 | Ga0466971_0026285 | 3300044719 | Bacteria | 2600 |
| 388 | Ga0466971_0147570 | 3300044719 | Bacteria | 1097 |
| 389 | Ga0466968_0044321 | 3300044735 | Bacteria | 1885 |
| 390 | Ga0466968_0051349 | 3300044735 | Bacteria | 1761 |
| 391 | Ga0466968_0075118 | 3300044735 | Bacteria | 1477 |
| 392 | Ga0466968_0132393 | 3300044735 | Bacteria | 1136 |
| 393 | Ga0466970_0001835 | 3300044765 | Bacteria | 10267 |
| 394 | Ga0466970_0069412 | 3300044765 | Bacteria | 1894 |
| 395 | Ga0466957_0002892 | 3300044842 | Bacteria | 9306 |
| 396 | Ga0466957_0009643 | 3300044842 | Bacteria | 5513 |
| 397 | Ga0466957_0090484 | 3300044842 | Bacteria | 1916 |
| 398 | Ga0466957_0140302 | 3300044842 | Bacteria | 1556 |
| 399 | Ga0466957_0298169 | 3300044842 | Bacteria | 1082 |
| 400 | Ga0466960_0003851 | 3300044901 | Bacteria | 5819 |
| 401 | Ga0466960_0022955 | 3300044901 | Bacteria | 2795 |
| 402 | Ga0466960_0095301 | 3300044901 | Bacteria | 1524 |
| 403 | Ga0466960_0238636 | 3300044901 | Unclassified | 1006 |
| 404 | Ga0466959_0002014 | 3300045049 | Bacteria | 12826 |
| 405 | Ga0466959_0002279 | 3300045049 | Bacteria | 12241 |
| 406 | Ga0466959_0015181 | 3300045049 | Bacteria | 5610 |
| 407 | Ga0466959_0015407 | 3300045049 | Bacteria | 5568 |
| 408 | Ga0466959_0023127 | 3300045049 | Bacteria | 4598 |
| 409 | Ga0466959_0024046 | 3300045049 | Bacteria | 4511 |
| 410 | Ga0466959_0050640 | 3300045049 | Bacteria | 3049 |
| 411 | Ga0466959_0118991 | 3300045049 | Unclassified | 1879 |
| 412 | Ga0466959_0245309 | 3300045049 | Unclassified | 1236 |
| 413 | Ga0466958_0009833 | 3300045836 | Bacteria | 5337 |
| 414 | Ga0466958_0016767 | 3300045836 | Bacteria | 4223 |
| 415 | Ga0466958_0028044 | 3300045836 | Bacteria | 3335 |
| 416 | Ga0466958_0085685 | 3300045836 | Bacteria | 1943 |
| 417 | Ga0466958_0087071 | 3300045836 | Bacteria | 1928 |
| 418 | Ga0466958_0099443 | 3300045836 | Bacteria | 1807 |
| 419 | Ga0466958_0109034 | 3300045836 | Bacteria | 1727 |
| 420 | Ga0466958_0477580 | 3300045836 | Unclassified | 808 |
| 421 | Ga0466967_0018656 | 3300045976 | Bacteria | 5552 |
| 422 | Ga0466967_0019838 | 3300045976 | Bacteria | 5416 |
| 423 | Ga0466967_0022926 | 3300045976 | Bacteria | 5105 |
| 424 | Ga0466967_0032684 | 3300045976 | Bacteria | 4396 |
| 425 | Ga0466967_0034545 | 3300045976 | Bacteria | 4293 |
| 426 | Ga0466967_0055845 | 3300045976 | Bacteria | 3479 |
| 427 | Ga0466967_0061085 | 3300045976 | Bacteria | 3342 |
| 428 | Ga0466967_0075743 | 3300045976 | Bacteria | 3025 |
| 429 | Ga0466967_0075869 | 3300045976 | Bacteria | 3022 |
| 430 | Ga0466967_0083634 | 3300045976 | Bacteria | 2886 |
| 431 | Ga0466967_0118681 | 3300045976 | Bacteria | 2440 |
| 432 | Ga0466967_0141109 | 3300045976 | Bacteria | 2244 |
| 433 | Ga0466967_0181155 | 3300045976 | Bacteria | 1987 |
| 434 | Ga0466967_0211837 | 3300045976 | Unclassified | 1838 |
| 435 | Ga0466967_0252400 | 3300045976 | Bacteria | 1685 |
| 436 | Ga0466967_0272368 | 3300045976 | Bacteria | 1622 |
| 437 | Ga0466967_0324045 | 3300045976 | Bacteria | 1486 |
| 438 | Ga0466967_0371290 | 3300045976 | Bacteria | 1388 |
| 439 | Ga0466967_0430359 | 3300045976 | Bacteria | 1287 |
| 440 | Ga0495592_0180357 | 3300046454 | Bacteria | 1439 |
| 441 | Ga0495603_0015652 | 3300046455 | Bacteria | 4589 |
| 442 | Ga0495641_0066150 | 3300046461 | Unclassified | 1627 |
| 443 | Ga0495641_0104546 | 3300046461 | Unclassified | 1263 |
| 444 | Ga0495651_0099831 | 3300046462 | Bacteria | 2164 |
| 445 | Ga0495653_0326809 | 3300046463 | Bacteria | 992 |
| 446 | Ga0495580_0129610 | 3300046472 | Bacteria | 1750 |
| 447 | Ga0495582_0011730 | 3300046473 | Bacteria | 4829 |
| 448 | Ga0495582_0094475 | 3300046473 | Unclassified | 1669 |
| 449 | Ga0495605_0040354 | 3300046474 | Bacteria | 2331 |
| 450 | Ga0495605_0140730 | 3300046474 | Bacteria | 1083 |
| 451 | Ga0495605_0180376 | 3300046474 | Bacteria | 929 |
| 452 | Ga0495639_0002174 | 3300046475 | Bacteria | 8641 |
| 453 | Ga0495662_0000943 | 3300046476 | Bacteria | 14253 |
| 454 | Ga0495664_0003309 | 3300046477 | Bacteria | 8764 |
| 455 | Ga0495664_0425431 | 3300046477 | Bacteria | 796 |
| 456 | Ga0495584_0224055 | 3300046491 | Archaea | 956 |
| 457 | Ga0495594_0294935 | 3300046499 | Bacteria | 924 |
| 458 | Ga0495607_0036609 | 3300046501 | Bacteria | 2955 |
| 459 | Ga0495607_0162876 | 3300046501 | Archaea | 1132 |
| 460 | Ga0495607_0262866 | 3300046501 | Unclassified | 826 |
| 461 | Ga0495608_0075512 | 3300046511 | Bacteria | 2196 |
| 462 | Ga0495618_0008098 | 3300046514 | Bacteria | 6364 |
| 463 | Ga0495618_0210333 | 3300046514 | Bacteria | 1229 |
| 464 | Ga0495628_0517935 | 3300046516 | Bacteria | 859 |
| 465 | Ga0495630_0010114 | 3300046517 | Bacteria | 6798 |
| 466 | Ga0495630_0019970 | 3300046517 | Bacteria | 4932 |
| 467 | Ga0495630_0152532 | 3300046517 | Bacteria | 1758 |
| 468 | Ga0495630_0381600 | 3300046517 | Bacteria | 1079 |
| 469 | Ga0495631_0231514 | 3300046518 | Unclassified | 788 |
| 470 | Ga0495644_0065218 | 3300046523 | Unclassified | 1368 |
| 471 | Ga0495644_0167230 | 3300046523 | Bacteria | 844 |
| 472 | Ga0495644_0224358 | 3300046523 | Bacteria | 727 |
| 473 | Ga0495663_0050927 | 3300046525 | Bacteria | 1281 |
| 474 | Ga0495666_0000241 | 3300046526 | Bacteria | 23544 |
| 475 | Ga0495642_0042319 | 3300046528 | Bacteria | 1855 |
| 476 | Ga0495652_0232525 | 3300046529 | Unclassified | 1377 |
| 477 | Ga0495665_0010937 | 3300046531 | Bacteria | 4909 |
| 478 | Ga0495640_0025763 | 3300046533 | Bacteria | 4260 |
| 479 | Ga0495640_0306419 | 3300046533 | Bacteria | 986 |
| 480 | Ga0495586_0043684 | 3300046535 | Unclassified | 2413 |
| 481 | Ga0495586_0147565 | 3300046535 | Bacteria | 1322 |
| 482 | Ga0495587_0105949 | 3300046536 | Bacteria | 1617 |
| 483 | Ga0495609_0103056 | 3300046538 | Bacteria | 1235 |
| 484 | Ga0495609_0266545 | 3300046538 | Bacteria | 703 |
| 485 | Ga0495667_0147133 | 3300046559 | Bacteria | 1517 |
| 486 | Ga0495656_0044640 | 3300046615 | Bacteria | 1867 |
| 487 | Ga0495634_0018826 | 3300046642 | Bacteria | 4909 |
| 488 | Ga0495634_0043400 | 3300046642 | Bacteria | 3047 |
| 489 | Ga0495635_0079908 | 3300046663 | Bacteria | 2238 |
| 490 | Ga0495635_0104638 | 3300046663 | Bacteria | 1934 |
| 491 | Ga0495659_0010384 | 3300046664 | Bacteria | 2986 |
| 492 | Ga0495659_0167563 | 3300046664 | Bacteria | 890 |
| 493 | Ga0495588_0165576 | 3300046674 | Unclassified | 1169 |
| 494 | Ga0495646_0234457 | 3300046680 | Bacteria | 988 |
| 495 | Ga0495646_0235377 | 3300046680 | Unclassified | 986 |
| 496 | Ga0495647_0006034 | 3300046681 | Bacteria | 3995 |
| 497 | Ga0495658_0004561 | 3300046683 | Bacteria | 6811 |
| 498 | Ga0495658_0022429 | 3300046683 | Bacteria | 3338 |
| 499 | Ga0495613_0013632 | 3300046689 | Bacteria | 6033 |
| 500 | Ga0495613_0099346 | 3300046689 | Bacteria | 2102 |
| 501 | Ga0495624_0036174 | 3300046690 | Bacteria | 3185 |
| 502 | Ga0495624_0069073 | 3300046690 | Bacteria | 2201 |
| 503 | Ga0495670_0306154 | 3300046691 | Bacteria | 852 |
| 504 | Ga0495600_0317979 | 3300046809 | Bacteria | 979 |
| 505 | Ga0495660_0215717 | 3300046810 | Bacteria | 908 |
| 506 | Ga0495581_0001944 | 3300047315 | Bacteria | 11591 |
| 507 | Ga0495581_0030959 | 3300047315 | Bacteria | 3100 |
| 508 | Ga0495581_0048263 | 3300047315 | Bacteria | 2459 |
| 509 | Ga0495604_0041991 | 3300047317 | Bacteria | 3586 |
| 510 | Ga0495674_0164091 | 3300047319 | Bacteria | 1857 |
| 511 | Ga0495674_0506988 | 3300047319 | Bacteria | 964 |
| 512 | Ga0495676_0098914 | 3300047321 | Bacteria | 2163 |
| 513 | Ga0495680_0043183 | 3300047322 | Bacteria | 3571 |
| 514 | Ga0495679_019402 | 3300047446 | Bacteria | 2390 |
| 515 | Ga0495684_0020942 | 3300047471 | Bacteria | 5037 |
| 516 | Ga0495684_0186510 | 3300047471 | Unclassified | 1535 |
| 517 | Ga0495593_0027502 | 3300047673 | Bacteria | 3130 |
| 518 | Ga0495593_0129059 | 3300047673 | Unclassified | 1284 |
| 519 | Ga0495614_0000470 | 3300048089 | Bacteria | 16618 |
| 520 | Ga0496100_0003156 | 3300048903 | Bacteria | 8544 |
| 521 | Ga0496100_0058255 | 3300048903 | Bacteria | 2534 |
| 522 | Ga0496100_0065838 | 3300048903 | Bacteria | 2402 |
| 523 | Ga0496100_0189554 | 3300048903 | Bacteria | 1492 |
| 524 | Ga0496100_0546848 | 3300048903 | Unclassified | 895 |
| 525 | Ga0496101_0000373 | 3300048904 | Bacteria | 29768 |
| 526 | Ga0496101_0057970 | 3300048904 | Bacteria | 2803 |
| 527 | Ga0496101_0069284 | 3300048904 | Bacteria | 2580 |
| 528 | Ga0496101_0108364 | 3300048904 | Bacteria | 2088 |
| 529 | Ga0496101_0142186 | 3300048904 | Bacteria | 1830 |
| 530 | Ga0496101_0185702 | 3300048904 | Bacteria | 1603 |
| 531 | Ga0496101_0241279 | 3300048904 | Bacteria | 1406 |
| 532 | Ga0496102_0008612 | 3300048905 | Bacteria | 8753 |
| 533 | Ga0496102_0008634 | 3300048905 | Bacteria | 8743 |
| 534 | Ga0496102_0018765 | 3300048905 | Bacteria | 6083 |
| 535 | Ga0496102_0030836 | 3300048905 | Bacteria | 4802 |
| 536 | Ga0496102_0048853 | 3300048905 | Bacteria | 3848 |
| 537 | Ga0496102_0069435 | 3300048905 | Bacteria | 3234 |
| 538 | Ga0496102_0208540 | 3300048905 | Bacteria | 1842 |
| 539 | Ga0496102_0295723 | 3300048905 | Bacteria | 1526 |
| 540 | Ga0496102_0302374 | 3300048905 | Unclassified | 1508 |
| 541 | Ga0496102_0442618 | 3300048905 | Bacteria | 1219 |
| 542 | Ga0496103_0044971 | 3300048906 | Bacteria | 2723 |
| 543 | Ga0496103_0083644 | 3300048906 | Bacteria | 2009 |
| 544 | Ga0496103_0117066 | 3300048906 | Bacteria | 1696 |
| 545 | Ga0496103_0117856 | 3300048906 | Bacteria | 1690 |
| 546 | Ga0496103_0119076 | 3300048906 | Bacteria | 1681 |
| 547 | Ga0496103_0628725 | 3300048906 | Bacteria | 683 |
| 548 | Ga0496104_0000614 | 3300048907 | Bacteria | 30540 |
| 549 | Ga0496104_0007912 | 3300048907 | Bacteria | 9426 |
| 550 | Ga0496104_0127770 | 3300048907 | Bacteria | 2441 |
| 551 | Ga0496104_0567819 | 3300048907 | Bacteria | 1045 |
| 552 | Ga0496104_0919719 | 3300048907 | Unclassified | 779 |
| 553 | Ga0496105_0000176 | 3300048908 | Bacteria | 42647 |
| 554 | Ga0496105_0001904 | 3300048908 | Bacteria | 14980 |
| 555 | Ga0496105_0025432 | 3300048908 | Bacteria | 4818 |
| 556 | Ga0496105_0233590 | 3300048908 | Bacteria | 1494 |
| 557 | Ga0496105_0323214 | 3300048908 | Bacteria | 1236 |
| 558 | Ga0496106_0008508 | 3300048909 | Bacteria | 7588 |
| 559 | Ga0496106_0047816 | 3300048909 | Bacteria | 3220 |
| 560 | Ga0496106_0061432 | 3300048909 | Bacteria | 2850 |
| 561 | Ga0496106_0082021 | 3300048909 | Bacteria | 2478 |
| 562 | Ga0496106_0180168 | 3300048909 | Bacteria | 1677 |
| 563 | Ga0496106_0480689 | 3300048909 | Bacteria | 998 |
| 564 | Ga0496107_0002190 | 3300048910 | Bacteria | 12556 |
| 565 | Ga0496107_0002871 | 3300048910 | Bacteria | 11384 |
| 566 | Ga0496107_0055262 | 3300048910 | Bacteria | 2867 |
| 567 | Ga0496107_0057219 | 3300048910 | Bacteria | 2819 |
| 568 | Ga0496107_0120076 | 3300048910 | Bacteria | 1936 |
| 569 | Ga0496107_0253813 | 3300048910 | Unclassified | 1308 |
| 570 | Ga0496107_0273088 | 3300048910 | Unclassified | 1258 |
| 571 | Ga0496107_0276990 | 3300048910 | Bacteria | 1249 |
| 572 | Ga0496107_0598941 | 3300048910 | Bacteria | 815 |
| 573 | Ga0496108_0028724 | 3300048911 | Bacteria | 4602 |
| 574 | Ga0496108_0033158 | 3300048911 | Bacteria | 4290 |
| 575 | Ga0496108_0136807 | 3300048911 | Bacteria | 2108 |
| 576 | Ga0496108_0160206 | 3300048911 | Bacteria | 1944 |
| 577 | Ga0496108_0221305 | 3300048911 | Bacteria | 1645 |
| 578 | Ga0496108_0365775 | 3300048911 | Bacteria | 1259 |
| 579 | Ga0496108_1105944 | 3300048911 | Unclassified | 673 |
| 580 | Ga0496109_0000514 | 3300048912 | Bacteria | 32883 |
| 581 | Ga0496109_0010239 | 3300048912 | Bacteria | 8009 |
| 582 | Ga0496109_0028777 | 3300048912 | Bacteria | 4973 |
| 583 | Ga0496109_0400848 | 3300048912 | Unclassified | 1296 |
| 584 | Ga0496109_0530763 | 3300048912 | Bacteria | 1110 |
| 585 | Ga0496110_0000265 | 3300048913 | Bacteria | 33861 |
| 586 | Ga0496110_0015917 | 3300048913 | Bacteria | 6272 |
| 587 | Ga0496110_0180800 | 3300048913 | Bacteria | 1915 |
| 588 | Ga0496111_0000146 | 3300048914 | Bacteria | 31767 |
| 589 | Ga0496111_0003236 | 3300048914 | Bacteria | 10048 |
| 590 | Ga0496111_0005208 | 3300048914 | Bacteria | 8293 |
| 591 | Ga0496111_0080326 | 3300048914 | Bacteria | 2379 |
| 592 | Ga0496111_0134644 | 3300048914 | Bacteria | 1830 |
| 593 | Ga0496111_0317828 | 3300048914 | Bacteria | 1153 |
| 594 | Ga0496112_0001508 | 3300048915 | Bacteria | 17922 |
| 595 | Ga0496112_0007627 | 3300048915 | Bacteria | 9620 |
| 596 | Ga0496112_0136671 | 3300048915 | Bacteria | 2421 |
| 597 | Ga0496112_0483549 | 3300048915 | Bacteria | 1174 |
| 598 | Ga0496113_0011770 | 3300048916 | Bacteria | 5858 |
| 599 | Ga0496113_0021064 | 3300048916 | Bacteria | 4595 |
| 600 | Ga0496113_0029188 | 3300048916 | Bacteria | 3979 |
| 601 | Ga0496114_0016718 | 3300048917 | Bacteria | 5916 |
| 602 | Ga0496114_0029557 | 3300048917 | Bacteria | 4506 |
| 603 | Ga0496114_0034098 | 3300048917 | Bacteria | 4197 |
| 604 | Ga0496114_0046420 | 3300048917 | Bacteria | 3609 |
| 605 | Ga0496114_0047029 | 3300048917 | Bacteria | 3587 |
| 606 | Ga0496114_0059638 | 3300048917 | Bacteria | 3188 |
| 607 | Ga0496114_0153084 | 3300048917 | Unclassified | 2001 |
| 608 | Ga0496114_0257688 | 3300048917 | Bacteria | 1535 |
| 609 | Ga0496115_0001644 | 3300048918 | Bacteria | 16074 |
| 610 | Ga0496115_0036825 | 3300048918 | Bacteria | 3875 |
| 611 | Ga0496115_0042180 | 3300048918 | Bacteria | 3634 |
| 612 | Ga0496115_0067053 | 3300048918 | Bacteria | 2901 |
| 613 | Ga0496115_0095615 | 3300048918 | Bacteria | 2432 |
| 614 | Ga0501309_022029 | 3300049129 | Bacteria | 899 |
| 615 | Ga0501311_031044 | 3300049527 | Unclassified | 774 |
| 616 | Ga0501031_0000164 | 3300049568 | Bacteria | 37777 |
| 617 | Ga0501031_0007171 | 3300049568 | Bacteria | 7272 |
| 618 | Ga0501031_0008759 | 3300049568 | Bacteria | 6581 |
| 619 | Ga0501031_0024664 | 3300049568 | Bacteria | 3921 |
| 620 | Ga0501031_0034811 | 3300049568 | Bacteria | 3286 |
| 621 | Ga0501032_0019486 | 3300049569 | Bacteria | 4745 |
| 622 | Ga0501032_0037263 | 3300049569 | Bacteria | 3316 |
| 623 | Ga0501032_0043851 | 3300049569 | Bacteria | 3028 |
| 624 | Ga0501032_0081222 | 3300049569 | Bacteria | 2157 |
| 625 | Ga0501033_0000208 | 3300049570 | Bacteria | 56046 |
| 626 | Ga0501033_0002483 | 3300049570 | Bacteria | 15636 |
| 627 | Ga0501034_0019034 | 3300049571 | Bacteria | 7033 |
| 628 | Ga0501036_0000085 | 3300049572 | Bacteria | 58421 |
| 629 | Ga0501036_0048005 | 3300049572 | Bacteria | 3615 |
| 630 | Ga0501036_0067248 | 3300049572 | Bacteria | 3031 |
| 631 | Ga0501036_0086086 | 3300049572 | Bacteria | 2657 |
| 632 | Ga0501036_0131466 | 3300049572 | Unclassified | 2113 |
| 633 | Ga0501036_0290584 | 3300049572 | Bacteria | 1368 |
| 634 | Ga0501037_0002242 | 3300049573 | Bacteria | 13976 |
| 635 | Ga0501037_0007515 | 3300049573 | Bacteria | 7979 |
| 636 | Ga0501038_0003370 | 3300049574 | Bacteria | 14906 |
| 637 | Ga0501038_0008091 | 3300049574 | Bacteria | 9676 |
| 638 | Ga0501038_0178259 | 3300049574 | Unclassified | 1716 |
| 639 | Ga0501038_0413698 | 3300049574 | Unclassified | 1041 |
| 640 | Ga0501039_0000171 | 3300049575 | Bacteria | 45473 |
| 641 | Ga0501039_0002083 | 3300049575 | Bacteria | 14830 |
| 642 | Ga0501039_0026300 | 3300049575 | Bacteria | 4472 |
| 643 | Ga0501039_0081355 | 3300049575 | Bacteria | 2521 |
| 644 | Ga0501039_0130423 | 3300049575 | Bacteria | 1973 |
| 645 | Ga0501039_0432604 | 3300049575 | Unclassified | 1033 |
| 646 | Ga0501040_0000094 | 3300049576 | Bacteria | 44554 |
| 647 | Ga0501040_0010978 | 3300049576 | Bacteria | 5922 |
| 648 | Ga0501040_0044593 | 3300049576 | Bacteria | 3023 |
| 649 | Ga0501041_0000247 | 3300049577 | Bacteria | 25322 |
| 650 | Ga0501041_0012725 | 3300049577 | Bacteria | 4985 |
| 651 | Ga0501041_0024201 | 3300049577 | Bacteria | 3644 |
| 652 | Ga0501041_0028393 | 3300049577 | Bacteria | 3375 |
| 653 | Ga0501041_0046818 | 3300049577 | Bacteria | 2631 |
| 654 | Ga0501041_0588838 | 3300049577 | Bacteria | 710 |
| 655 | Ga0501042_0001242 | 3300049578 | Bacteria | 14860 |
| 656 | Ga0501042_0002764 | 3300049578 | Bacteria | 10835 |
| 657 | Ga0501042_0006168 | 3300049578 | Bacteria | 7773 |
| 658 | Ga0501042_0019505 | 3300049578 | Bacteria | 4710 |
| 659 | Ga0501042_0032936 | 3300049578 | Bacteria | 3672 |
| 660 | Ga0501042_0169782 | 3300049578 | Bacteria | 1574 |
| 661 | Ga0501043_0000295 | 3300049579 | Bacteria | 45082 |
| 662 | Ga0501043_0000789 | 3300049579 | Bacteria | 28178 |
| 663 | Ga0501043_0121173 | 3300049579 | Bacteria | 2051 |
| 664 | Ga0501046_0000999 | 3300049580 | Bacteria | 27627 |
| 665 | Ga0501046_0001480 | 3300049580 | Bacteria | 22508 |
| 666 | Ga0501046_0012237 | 3300049580 | Bacteria | 7312 |
| 667 | Ga0501046_0048039 | 3300049580 | Bacteria | 3381 |
| 668 | Ga0501046_0065872 | 3300049580 | Bacteria | 2825 |
| 669 | Ga0501047_0001721 | 3300049581 | Bacteria | 21277 |
| 670 | Ga0501048_0000790 | 3300049582 | Bacteria | 23204 |
| 671 | Ga0501048_0001465 | 3300049582 | Bacteria | 17896 |
| 672 | Ga0501048_0002757 | 3300049582 | Bacteria | 13403 |
| 673 | Ga0501048_0017835 | 3300049582 | Bacteria | 5223 |
| 674 | Ga0501048_0052982 | 3300049582 | Bacteria | 2887 |
| 675 | Ga0501048_0055638 | 3300049582 | Bacteria | 2808 |
| 676 | Ga0501067_0009617 | 3300049583 | Bacteria | 5354 |
| 677 | Ga0501067_0144709 | 3300049583 | Bacteria | 1324 |
| 678 | Ga0501068_0000052 | 3300049584 | Bacteria | 45484 |
| 679 | Ga0501068_0005073 | 3300049584 | Bacteria | 7178 |
| 680 | Ga0501068_0183046 | 3300049584 | Bacteria | 1325 |
| 681 | Ga0501069_0000210 | 3300049585 | Bacteria | 25997 |
| 682 | Ga0501069_0006810 | 3300049585 | Bacteria | 5977 |
| 683 | Ga0501069_0006904 | 3300049585 | Bacteria | 5933 |
| 684 | Ga0501069_0280861 | 3300049585 | Bacteria | 974 |
| 685 | Ga0501070_0006667 | 3300049586 | Bacteria | 9832 |
| 686 | Ga0501070_0011352 | 3300049586 | Bacteria | 7527 |
| 687 | Ga0501070_0155016 | 3300049586 | Bacteria | 1889 |
| 688 | Ga0501071_0001124 | 3300049587 | Bacteria | 14927 |
| 689 | Ga0501071_0014500 | 3300049587 | Bacteria | 5391 |
| 690 | Ga0501071_0134121 | 3300049587 | Unclassified | 1841 |
| 691 | Ga0501071_0257523 | 3300049587 | Unclassified | 1317 |
| 692 | Ga0501071_0267115 | 3300049587 | Bacteria | 1293 |
| 693 | Ga0501071_0779242 | 3300049587 | Unclassified | 737 |
| 694 | Ga0501071_0854826 | 3300049587 | Bacteria | 702 |
| 695 | Ga0501072_0011287 | 3300049588 | Bacteria | 6822 |
| 696 | Ga0501072_0017332 | 3300049588 | Bacteria | 5534 |
| 697 | Ga0501072_0022606 | 3300049588 | Bacteria | 4877 |
| 698 | Ga0501072_0036935 | 3300049588 | Bacteria | 3831 |
| 699 | Ga0501072_0096870 | 3300049588 | Bacteria | 2344 |
| 700 | Ga0501072_0148242 | 3300049588 | Bacteria | 1871 |
| 701 | Ga0501072_0191970 | 3300049588 | Bacteria | 1629 |
| 702 | Ga0501073_0002697 | 3300049589 | Bacteria | 13294 |
| 703 | Ga0501073_0344691 | 3300049589 | Bacteria | 1028 |
| 704 | Ga0501074_0003275 | 3300049590 | Bacteria | 11449 |
| 705 | Ga0501074_0007040 | 3300049590 | Bacteria | 8123 |
| 706 | Ga0501074_0009193 | 3300049590 | Bacteria | 7179 |
| 707 | Ga0501074_0063202 | 3300049590 | Bacteria | 2667 |
| 708 | Ga0501075_0000109 | 3300049591 | Bacteria | 38985 |
| 709 | Ga0501075_0011827 | 3300049591 | Bacteria | 6190 |
| 710 | Ga0501075_0014313 | 3300049591 | Bacteria | 5684 |
| 711 | Ga0501075_0172174 | 3300049591 | Unclassified | 1652 |
| 712 | Ga0501075_0182995 | 3300049591 | Unclassified | 1599 |
| 713 | Ga0501075_0328983 | 3300049591 | Bacteria | 1164 |
| 714 | Ga0501075_0662744 | 3300049591 | Bacteria | 795 |
| 715 | Ga0501076_0000554 | 3300049592 | Bacteria | 23855 |
| 716 | Ga0501076_0004193 | 3300049592 | Bacteria | 10205 |
| 717 | Ga0501076_0007063 | 3300049592 | Bacteria | 8160 |
| 718 | Ga0501076_0035608 | 3300049592 | Bacteria | 3895 |
| 719 | Ga0501076_0057153 | 3300049592 | Bacteria | 3097 |
| 720 | Ga0501076_0133077 | 3300049592 | Bacteria | 2017 |
| 721 | Ga0501076_0391266 | 3300049592 | Unclassified | 1143 |
| 722 | Ga0501077_0000809 | 3300049593 | Bacteria | 18979 |
| 723 | Ga0501077_0023355 | 3300049593 | Bacteria | 3921 |
| 724 | Ga0501077_0080248 | 3300049593 | Bacteria | 2067 |
| 725 | Ga0501077_0184854 | 3300049593 | Bacteria | 1324 |
| 726 | Ga0501079_0000099 | 3300049741 | Bacteria | 43513 |
| 727 | Ga0501079_0020669 | 3300049741 | Bacteria | 5032 |
| 728 | Ga0501079_0063618 | 3300049741 | Bacteria | 2846 |
| 729 | Ga0501079_0128000 | 3300049741 | Bacteria | 1975 |
| 730 | Ga0501079_0169270 | 3300049741 | Bacteria | 1704 |
| 731 | Ga0501079_0209805 | 3300049741 | Unclassified | 1521 |
| 732 | Ga0501079_0661342 | 3300049741 | Bacteria | 822 |
| 733 | Ga0501080_0000768 | 3300049742 | Bacteria | 26067 |
| 734 | Ga0501080_0009951 | 3300049742 | Bacteria | 8689 |
| 735 | Ga0501080_0520441 | 3300049742 | Unclassified | 1061 |
| 736 | Ga0501081_0010244 | 3300049743 | Bacteria | 6120 |
| 737 | Ga0501081_0013305 | 3300049743 | Bacteria | 5412 |
| 738 | Ga0501081_0020877 | 3300049743 | Bacteria | 4370 |
| 739 | Ga0501081_0033563 | 3300049743 | Bacteria | 3488 |
| 740 | Ga0501081_0052676 | 3300049743 | Bacteria | 2809 |
| 741 | Ga0501081_0176517 | 3300049743 | Bacteria | 1544 |
| 742 | Ga0501081_0891244 | 3300049743 | Unclassified | 671 |
| 743 | Ga0501083_0000227 | 3300049744 | Bacteria | 36195 |
| 744 | Ga0501083_0000261 | 3300049744 | Bacteria | 33465 |
| 745 | Ga0501035_0002978 | 3300049822 | Bacteria | 16287 |
| 746 | Ga0501035_0005322 | 3300049822 | Bacteria | 12174 |
| 747 | Ga0501035_0076680 | 3300049822 | Bacteria | 2956 |
| 748 | Ga0501035_0130317 | 3300049822 | Bacteria | 2193 |
| 749 | Ga0501044_0017382 | 3300049823 | Bacteria | 7715 |
| 750 | Ga0501044_0199942 | 3300049823 | Bacteria | 1957 |
| 751 | Ga0501044_0594352 | 3300049823 | Unclassified | 1000 |
| 752 | Ga0501045_0008557 | 3300049824 | Bacteria | 7130 |
| 753 | Ga0501045_0032119 | 3300049824 | Bacteria | 3803 |
| 754 | Ga0501045_0077342 | 3300049824 | Bacteria | 2452 |
| 755 | Ga0501045_0104007 | 3300049824 | Bacteria | 2103 |
| 756 | Ga0501045_0108085 | 3300049824 | Bacteria | 2061 |
| 757 | Ga0501045_0303380 | 3300049824 | Bacteria | 1188 |
| 758 | Ga0501045_0309528 | 3300049824 | Bacteria | 1176 |
| 759 | Ga0501045_0794731 | 3300049824 | Unclassified | 697 |
| 760 | nmdc:mga00v17_59827_c1 | 3300050491 | Bacteria | 2339 |
| 761 | nmdc:mga0yw44_119978_c1 | 3300050492 | Bacteria | 1693 |
| 762 | nmdc:mga0k408_91658_c1 | 3300050493 | Bacteria | 1785 |
| 763 | nmdc:mga05p37_27625_c1 | 3300050507 | Bacteria | 6911 |
| 764 | nmdc:mga05p37_672774_c1 | 3300050507 | Bacteria | 1155 |
| 765 | nmdc:mga05p37_826568_c1 | 3300050507 | Bacteria | 1010 |
| 766 | nmdc:mga09592_1045066_c1 | 3300050508 | Bacteria | 681 |
| 767 | nmdc:mga09592_160851_c1 | 3300050508 | Bacteria | 1940 |
| 768 | nmdc:mga0qj67_48226_c1 | 3300050509 | Bacteria | 3365 |
| 769 | nmdc:mga08y16_187773_c1 | 3300050511 | Bacteria | 2144 |
| 770 | nmdc:mga08y16_72441_c1 | 3300050511 | Bacteria | 3591 |
| 771 | nmdc:mga0n895_243336_c1 | 3300050512 | Bacteria | 1826 |
| 772 | nmdc:mga0n895_328592_c1 | 3300050512 | Archaea | 1549 |
| 773 | nmdc:mga0n895_399836_c1 | 3300050512 | Bacteria | 1389 |
| 774 | nmdc:mga0n895_840435_c1 | 3300050512 | Unclassified | 906 |
| 775 | nmdc:mga0n895_88124_c1 | 3300050512 | Bacteria | 3103 |
| 776 | nmdc:mga0n895_941228_c1 | 3300050512 | Bacteria | 848 |
| 777 | nmdc:mga0rr50_327024_c1 | 3300050513 | Bacteria | 1286 |
| 778 | nmdc:mga0rr50_752409_c1 | 3300050513 | Bacteria | 832 |
| 779 | nmdc:mga08x19_659280_c1 | 3300050514 | Unclassified | 742 |
| 780 | nmdc:mga0a205_299899_c1 | 3300050515 | Bacteria | 1480 |
| 781 | Ga0495601_0015474 | 3300053077 | Bacteria | 4609 |
| 782 | Ga0495601_0109234 | 3300053077 | Bacteria | 1790 |
| 783 | Ga0495601_0573022 | 3300053077 | Bacteria | 725 |
| 784 | Ga0495612_0011200 | 3300053078 | Bacteria | 3620 |
| 785 | Ga0495655_0051595 | 3300053083 | Bacteria | 1091 |
| 786 | Ga0495595_0004031 | 3300053084 | Bacteria | 5877 |
| 787 | Ga0500566_0027221 | 3300053094 | Bacteria | 3346 |
| 788 | Ga0501084_0001093 | 3300054114 | Bacteria | 21105 |
| 789 | Ga0501084_0011779 | 3300054114 | Bacteria | 7240 |
| 790 | Ga0501084_0012517 | 3300054114 | Bacteria | 7026 |
| 791 | Ga0501084_0045249 | 3300054114 | Bacteria | 3685 |
| 792 | Ga0501084_0060876 | 3300054114 | Bacteria | 3161 |
| 793 | Ga0501084_0070049 | 3300054114 | Bacteria | 2936 |
| 794 | Ga0501084_0277174 | 3300054114 | Bacteria | 1416 |
| 795 | Ga0590077_075824 | 3300059426 | Archaea | 771 |
| 796 | Ga0587073_0027293 | 3300059492 | Bacteria | 1151 |
| 797 | Ga0501082_0000563 | 3300060353 | Bacteria | 32925 |
| 798 | Ga0501082_0026919 | 3300060353 | Bacteria | 4955 |
| 799 | Ga0501082_0036310 | 3300060353 | Bacteria | 4245 |
| 800 | Ga0501082_0040068 | 3300060353 | Bacteria | 4041 |
| 801 | Ga0501082_0068895 | 3300060353 | Bacteria | 3046 |
| 802 | Ga0501082_0076693 | 3300060353 | Bacteria | 2881 |
| 803 | Ga0501082_0276131 | 3300060353 | Bacteria | 1463 |
| 804 | Ga0466962_0003286 | 3300061719 | Bacteria | 7680 |
| 805 | Ga0466962_0004357 | 3300061719 | Bacteria | 6787 |
| 806 | Ga0466962_0008091 | 3300061719 | Bacteria | 5041 |
| 807 | Ga0466962_0107600 | 3300061719 | Bacteria | 1341 |
| 808 | Ga0466962_0178715 | 3300061719 | Bacteria | 1034 |
| 809 | Ga0530510_0001992 | 3300061734 | Bacteria | 14003 |
| 810 | Ga0530510_0004150 | 3300061734 | Bacteria | 10001 |
| 811 | Ga0530510_0392125 | 3300061734 | Bacteria | 1046 |
| 812 | Ga0530510_0402812 | 3300061734 | Bacteria | 1031 |
| 813 | Ga0530510_0700080 | 3300061734 | Unclassified | 772 |
| 814 | Ga0466962_0100638 | |||
| 815 | Ga0070658_10048475 | |||
| 816 | Ga0070658_10163814 | |||
| 817 | Ga0070676_10293742 | |||
| 818 | Ga0070683_100009898 | |||
| 819 | Ga0070683_100017148 | |||
| 820 | Ga0070683_100591634 | |||
| 821 | Ga0070680_100013850 | |||
| 822 | Ga0070680_100015369 | |||
| 823 | Ga0070680_100512736 | |||
| 824 | Ga0070682_100181559 | |||
| 825 | Ga0068868_100453446 | |||
| 826 | Ga0070660_100003547 | |||
| 827 | Ga0070660_100057819 | |||
| 828 | Ga0070660_100308239 | |||
| 829 | Ga0070691_10353023 | |||
| 830 | Ga0070661_100018395 | |||
| 831 | Ga0070692_10143624 | |||
| 832 | Ga0070669_100577997 | |||
| 833 | Ga0070675_100349037 | |||
| 834 | Ga0070671_100083566 | |||
| 835 | Ga0070674_100268799 | |||
| 836 | Ga0070674_100436076 | |||
| 837 | Ga0070674_100500709 | |||
| 838 | Ga0070674_100918299 | |||
| 839 | Ga0070673_100327387 | |||
| 840 | Ga0070688_100440589 | |||
| 841 | Ga0070659_101196149 | |||
| 842 | Ga0070709_10034207 | |||
| 843 | Ga0070714_100022116 | |||
| 844 | Ga0070714_100133574 | |||
| 845 | Ga0070714_100821152 | |||
| 846 | Ga0070714_101037263 | |||
| 847 | Ga0070713_100017782 | |||
| 848 | Ga0070713_100075810 | |||
| 849 | Ga0070713_100209377 | |||
| 850 | Ga0070713_101020081 | |||
| 851 | Ga0070710_10036401 | |||
| 852 | Ga0070710_10045878 | |||
| 853 | Ga0070710_10148554 | |||
| 854 | Ga0070711_100076689 | |||
| 855 | Ga0070711_100232682 | |||
| 856 | Ga0070705_100274395 | |||
| 857 | Ga0070700_100039513 | |||
| 858 | Ga0070700_100379139 | |||
| 859 | Ga0070694_100231589 | |||
| 860 | Ga0070678_100262606 | |||
| 861 | Ga0070678_100669297 | |||
| 862 | Ga0070681_10024831 | |||
| 863 | Ga0070681_10068898 | |||
| 864 | Ga0070681_10208689 | |||
| 865 | Ga0070681_10217146 | |||
| 866 | Ga0070681_10278532 | |||
| 867 | Ga0068867_100502034 | |||
| 868 | Ga0068867_100637546 | |||
| 869 | Ga0070698_100006851 | |||
| 870 | Ga0070699_100552965 | |||
| 871 | Ga0070679_100047736 | |||
| 872 | Ga0070679_100062622 | |||
| 873 | Ga0070679_100065001 | |||
| 874 | Ga0070679_100067929 | |||
| 875 | Ga0070679_100226034 | |||
| 876 | Ga0070679_100250880 | |||
| 877 | Ga0070679_100515486 | |||
| 878 | Ga0070679_100564451 | |||
| 879 | Ga0070684_100057735 | |||
| 880 | Ga0070684_100105667 | |||
| 881 | Ga0070684_100340102 | |||
| 882 | Ga0068853_100178017 | |||
| 883 | Ga0070686_100212391 | |||
| 884 | Ga0070695_100000363 | |||
| 885 | Ga0070695_100196744 | |||
| 886 | Ga0070693_100021474 | |||
| 887 | Ga0070693_100023834 | |||
| 888 | Ga0070665_100016660 | |||
| 889 | Ga0070704_100168968 | |||
| 890 | Ga0068855_100047632 | |||
| 891 | Ga0068855_100195121 | |||
| 892 | Ga0068855_100532543 | |||
| 893 | Ga0068855_100679051 | |||
| 894 | Ga0070664_100780376 | |||
| 895 | Ga0068854_100090519 | |||
| 896 | Ga0068856_100022903 | |||
| 897 | Ga0068856_100316926 | |||
| 898 | Ga0068852_100003792 | |||
| 899 | Ga0068852_100181461 | |||
| 900 | Ga0068852_101090172 | |||
| 901 | Ga0068852_101437806 | |||
| 902 | Ga0068866_10410789 | |||
| 903 | Ga0068861_100071059 | |||
| 904 | Ga0068851_10140072 | |||
| 905 | Ga0068863_101183346 | |||
| 906 | Ga0068862_100351162 | |||
| 907 | Ga0081455_10053251 | |||
| 908 | Ga0081455_10089780 | |||
| 909 | Ga0081455_10099186 | |||
| 910 | Ga0081538_10002117 | |||
| 911 | Ga0081539_10000781 | |||
| 912 | Ga0070717_10009169 | |||
| 913 | Ga0075364_10131550 | |||
| 914 | Ga0070715_10010483 | |||
| 915 | Ga0070715_10039362 | |||
| 916 | Ga0070716_100016356 | |||
| 917 | Ga0070716_100034338 | |||
| 918 | Ga0070712_100018844 | |||
| 919 | Ga0070712_100076773 | |||
| 920 | Ga0070712_100106221 | |||
| 921 | Ga0070712_100127803 | |||
| 922 | Ga0070712_100182671 | |||
| 923 | Ga0070712_100560644 | |||
| 924 | Ga0075362_10024646 | |||
| 925 | Ga0075366_10075782 | |||
| 926 | Ga0097621_100444910 | |||
| 927 | Ga0097621_100602040 | |||
| 928 | Ga0075428_100099811 | |||
| 929 | Ga0075430_100050445 | |||
| 930 | Ga0075431_100165737 | |||
| 931 | Ga0075431_100221813 | |||
| 932 | Ga0075433_10208699 | |||
| 933 | Ga0075433_10390743 | |||
| 934 | Ga0075433_10458814 | |||
| 935 | Ga0075434_100016720 | |||
| 936 | Ga0075434_100104006 | |||
| 937 | Ga0075434_101024992 | |||
| 938 | Ga0075429_100306874 | |||
| 939 | Ga0068865_100087649 | |||
| 940 | Ga0068865_100365557 | |||
| 941 | Ga0068865_100574582 | |||
| 942 | Ga0075436_100206274 | |||
| 943 | Ga0075435_100058951 | |||
| 944 | Ga0099795_10102231 | |||
| 945 | Ga0105251_10293718 | |||
| 946 | Ga0105240_10162039 | |||
| 947 | Ga0111539_10078401 | |||
| 948 | Ga0111539_10096130 | |||
| 949 | Ga0111539_11516519 | |||
| 950 | Ga0105245_10057981 | |||
| 951 | Ga0105245_10151345 | |||
| 952 | Ga0105245_10281352 | |||
| 953 | Ga0105245_10338716 | |||
| 954 | Ga0105245_10983485 | |||
| 955 | Ga0114129_10904995 | |||
| 956 | Ga0105243_10101793 | |||
| 957 | Ga0105241_10411291 | |||
| 958 | Ga0105242_10057932 | |||
| 959 | Ga0105242_10380666 | |||
| 960 | Ga0105242_10652556 | |||
| 961 | Ga0105242_10731576 | |||
| 962 | Ga0105248_10537006 | |||
| 963 | Ga0105237_10009640 | |||
| 964 | Ga0105237_10026472 | |||
| 965 | Ga0105238_10063652 | |||
| 966 | Ga0105238_10319259 | |||
| 967 | Ga0105249_10002935 | |||
| 968 | Ga0105239_10114018 | |||
| 969 | Ga0105239_10128853 | |||
| 970 | Ga0105239_10194731 | |||
| 971 | Ga0105239_10269718 | |||
| 972 | Ga0105239_10286929 | |||
| 973 | Ga0105239_10598748 | |||
| 974 | Ga0105246_10503044 | |||
| 975 | Ga0157329_1006789 | |||
| 976 | Ga0157373_10417961 | |||
| 977 | Ga0157370_10001705 | |||
| 978 | Ga0157370_10008120 | |||
| 979 | Ga0157370_10015648 | |||
| 980 | Ga0157370_10186282 | |||
| 981 | Ga0157369_10009399 | |||
| 982 | Ga0157369_10026009 | |||
| 983 | Ga0157374_10389473 | |||
| 984 | Ga0157374_10471152 | |||
| 985 | Ga0163162_10075411 | |||
| 986 | Ga0157372_10011307 | |||
| 987 | Ga0157372_10023472 | |||
| 988 | Ga0157372_10133199 | |||
| 989 | Ga0157372_10617307 | |||
| 990 | Ga0157375_10067823 | |||
| 991 | Ga0157375_10293934 | |||
| 992 | Ga0157375_10807372 | |||
| 993 | Ga0163163_10569083 | |||
| 994 | Ga0157377_10210664 | |||
| 995 | Ga0157376_10086587 | |||
| 996 | Ga0157376_10163407 | |||
| 997 | Ga0206356_10034121 | |||
| 998 | Ga0206356_10058303 | |||
| 999 | Ga0206350_10083145 | |||
| 1000 | Ga0206353_10956052 | |||
| 1001 | Ga0206353_11078391 | |||
| 1002 | Ga0224712_10012062 | |||
| 1003 | Ga0207692_10041656 | |||
| 1004 | Ga0207692_10054357 | |||
| 1005 | Ga0207688_10169873 | |||
| 1006 | Ga0207647_10134586 | |||
| 1007 | Ga0207685_10059778 | |||
| 1008 | Ga0207685_10068682 | |||
| 1009 | Ga0207699_10255944 | |||
| 1010 | Ga0207699_10437739 | |||
| 1011 | Ga0207643_10237186 | |||
| 1012 | Ga0207643_10268999 | |||
| 1013 | Ga0207705_10137448 | |||
| 1014 | Ga0207705_10148324 | |||
| 1015 | Ga0207705_10366061 | |||
| 1016 | Ga0207654_10072191 | |||
| 1017 | Ga0207707_10021670 | |||
| 1018 | Ga0207707_10062364 | |||
| 1019 | Ga0207707_10099891 | |||
| 1020 | Ga0207707_10121815 | |||
| 1021 | Ga0207707_10150991 | |||
| 1022 | Ga0207707_10283943 | |||
| 1023 | Ga0207695_10040677 | |||
| 1024 | Ga0207695_10210848 | |||
| 1025 | Ga0207671_10032718 | |||
| 1026 | Ga0207693_10003543 | |||
| 1027 | Ga0207693_10011364 | |||
| 1028 | Ga0207693_10031619 | |||
| 1029 | Ga0207693_10036998 | |||
| 1030 | Ga0207693_10039554 | |||
| 1031 | Ga0207663_10033908 | |||
| 1032 | Ga0207663_10047509 | |||
| 1033 | Ga0207663_10275827 | |||
| 1034 | Ga0207660_10032860 | |||
| 1035 | Ga0207660_10095422 | |||
| 1036 | Ga0207657_10001511 | |||
| 1037 | Ga0207657_10020508 | |||
| 1038 | Ga0207657_10272334 | |||
| 1039 | Ga0207649_10062282 | |||
| 1040 | Ga0207649_10195641 | |||
| 1041 | Ga0207652_10034097 | |||
| 1042 | Ga0207652_10038093 | |||
| 1043 | Ga0207652_10102921 | |||
| 1044 | Ga0207652_10140599 | |||
| 1045 | Ga0207652_10273481 | |||
| 1046 | Ga0207652_10452364 | |||
| 1047 | Ga0207652_10485003 | |||
| 1048 | Ga0207646_10332074 | |||
| 1049 | Ga0207646_10378622 | |||
| 1050 | Ga0207694_10187658 | |||
| 1051 | Ga0207694_10378657 | |||
| 1052 | Ga0207687_10046423 | |||
| 1053 | Ga0207687_10148534 | |||
| 1054 | Ga0207687_10342806 | |||
| 1055 | Ga0207700_10024422 | |||
| 1056 | Ga0207700_10040403 | |||
| 1057 | Ga0207700_10061048 | |||
| 1058 | Ga0207664_10005471 | |||
| 1059 | Ga0207664_10032566 | |||
| 1060 | Ga0207664_10087989 | |||
| 1061 | Ga0207664_10195969 | |||
| 1062 | Ga0207664_10209670 | |||
| 1063 | Ga0207690_10667489 | |||
| 1064 | Ga0207706_10463006 | |||
| 1065 | Ga0207706_10512782 | |||
| 1066 | Ga0207706_10592440 | |||
| 1067 | Ga0207686_10105367 | |||
| 1068 | Ga0207686_10396706 | |||
| 1069 | Ga0207709_10143623 | |||
| 1070 | Ga0207669_10221676 | |||
| 1071 | Ga0207669_10250769 | |||
| 1072 | Ga0207704_10103487 | |||
| 1073 | Ga0207665_10000359 | |||
| 1074 | Ga0207665_10001883 | |||
| 1075 | Ga0207665_10310193 | |||
| 1076 | Ga0207691_10401178 | |||
| 1077 | Ga0207661_10073918 | |||
| 1078 | Ga0207661_10796829 | |||
| 1079 | Ga0207679_10102966 | |||
| 1080 | Ga0207667_10062838 | |||
| 1081 | Ga0207651_10290833 | |||
| 1082 | Ga0207712_10017910 | |||
| 1083 | Ga0207712_10100461 | |||
| 1084 | Ga0207668_10868174 | |||
| 1085 | Ga0207640_10817762 | |||
| 1086 | Ga0207677_10547335 | |||
| 1087 | Ga0207639_10529262 | |||
| 1088 | Ga0207678_10106537 | |||
| 1089 | Ga0207678_10426770 | |||
| 1090 | Ga0207708_10126477 | |||
| 1091 | Ga0207708_10317600 | |||
| 1092 | Ga0207702_10003896 | |||
| 1093 | Ga0207702_10075803 | |||
| 1094 | Ga0207702_10122702 | |||
| 1095 | Ga0207702_10284510 | |||
| 1096 | Ga0207702_10625339 | |||
| 1097 | Ga0207702_10794676 | |||
| 1098 | Ga0207641_11167613 | |||
| 1099 | Ga0207648_10145206 | |||
| 1100 | Ga0207648_10588185 | |||
| 1101 | Ga0207648_10719010 | |||
| 1102 | Ga0207674_10170355 | |||
| 1103 | Ga0207674_10566676 | |||
| 1104 | Ga0207675_100118906 | |||
| 1105 | Ga0207683_10007746 | |||
| 1106 | Ga0207683_10166140 | |||
| 1107 | Ga0207683_10462649 | |||
| 1108 | Ga0207698_10147023 | |||
| 1109 | Ga0207698_10194711 | |||
| 1110 | Ga0207428_10011860 | |||
| 1111 | Ga0268265_10198622 | |||
| 1112 | Ga0268265_11018512 | |||
| 1113 | Ga0268264_11781041 | |||
| 1114 | Ga0373938_0033234 | |||
| 1115 | Ga0373944_0076833 | |||
| 1116 | Ga0373951_0033451 | |||
| 1117 | Ga0373952_0037827 | |||
| 1118 | Ga0373932_0021335 | |||
| 1119 | Ga0373939_0155496 | |||
| 1120 | Ga0373941_0007480 | |||
| 1121 | Ga0373960_0067874 | |||
| 1122 | Ga0373960_0110143 | |||
| 1123 | Ga0373943_0003569 | |||
| 1124 | Ga0373943_0221950 | |||
| 1125 | Ga0373962_0040834 | |||
| 1126 | Ga0373931_0006757 | |||
| 1127 | Ga0373935_0113294 | |||
| 1128 | Ga0373927_0115826 | |||
| 1129 | Ga0373947_0012653 | |||
| 1130 | Ga0395899_0001311 | |||
| 1131 | Ga0395899_0056346 | |||
| 1132 | Ga0395899_0066297 | |||
| 1133 | Ga0395899_0102813 | |||
| 1134 | Ga0395899_0547909 | |||
| 1135 | Ga0395900_0006188 | |||
| 1136 | Ga0395900_0037226 | |||
| 1137 | Ga0395900_0067370 | |||
| 1138 | Ga0395900_0246413 | |||
| 1139 | Ga0395900_0426791 | |||
| 1140 | Ga0395900_0808528 | |||
| 1141 | Ga0395898_0001816 | |||
| 1142 | Ga0395898_0097135 | |||
| 1143 | Ga0395898_0099134 | |||
| 1144 | Ga0395898_0204657 | |||
| 1145 | Ga0395898_0238746 | |||
| 1146 | Ga0395905_0006417 | |||
| 1147 | Ga0395905_0012858 | |||
| 1148 | Ga0395905_0042952 | |||
| 1149 | Ga0395905_0077452 | |||
| 1150 | Ga0395905_0122502 | |||
| 1151 | Ga0395905_0301281 | |||
| 1152 | Ga0395901_0005317 | |||
| 1153 | Ga0395901_0032040 | |||
| 1154 | Ga0395901_0093910 | |||
| 1155 | Ga0395901_0115032 | |||
| 1156 | Ga0395901_0170985 | |||
| 1157 | Ga0395901_0219500 | |||
| 1158 | Ga0451853_1793536 | |||
| 1159 | Ga0439448_0085139 | |||
| 1160 | Ga0450920_051450 | |||
| 1161 | Ga0466969_0003305 | |||
| 1162 | Ga0466965_0047774 | |||
| 1163 | Ga0466965_0098566 | |||
| 1164 | Ga0466965_0113758 | |||
| 1165 | Ga0466965_0262129 | |||
| 1166 | Ga0466966_0022666 | |||
| 1167 | Ga0466966_0025100 | |||
| 1168 | Ga0466966_0027186 | |||
| 1169 | Ga0466966_0046263 | |||
| 1170 | Ga0466961_0026155 | |||
| 1171 | Ga0466961_0033488 | |||
| 1172 | Ga0466961_0154780 | |||
| 1173 | Ga0466961_0222572 | |||
| 1174 | Ga0466963_0000048 | |||
| 1175 | Ga0466963_0003893 | |||
| 1176 | Ga0466963_0004401 | |||
| 1177 | Ga0466963_0007353 | |||
| 1178 | Ga0466963_0007773 | |||
| 1179 | Ga0466963_0010199 | |||
| 1180 | Ga0466963_0011451 | |||
| 1181 | Ga0466963_0013074 | |||
| 1182 | Ga0466963_0034913 | |||
| 1183 | Ga0466963_0038042 | |||
| 1184 | Ga0466963_0118128 | |||
| 1185 | Ga0466963_0122278 | |||
| 1186 | Ga0466963_0809891 | |||
| 1187 | Ga0466964_0002291 | |||
| 1188 | Ga0466964_0002374 | |||
| 1189 | Ga0466964_0004438 | |||
| 1190 | Ga0466964_0011534 | |||
| 1191 | Ga0466964_0043150 | |||
| 1192 | Ga0466964_0057857 | |||
| 1193 | Ga0466964_0144996 | |||
| 1194 | Ga0466964_0180760 | |||
| 1195 | Ga0466964_0534671 | |||
| 1196 | Ga0466971_0000420 | |||
| 1197 | Ga0466971_0000987 | |||
| 1198 | Ga0466971_0004618 | |||
| 1199 | Ga0466971_0023590 | |||
| 1200 | Ga0466971_0026285 | |||
| 1201 | Ga0466971_0147570 | |||
| 1202 | Ga0466968_0044321 | |||
| 1203 | Ga0466968_0051349 | |||
| 1204 | Ga0466968_0075118 | |||
| 1205 | Ga0466968_0132393 | |||
| 1206 | Ga0466970_0001835 | |||
| 1207 | Ga0466970_0069412 | |||
| 1208 | Ga0466957_0002892 | |||
| 1209 | Ga0466957_0009643 | |||
| 1210 | Ga0466957_0090484 | |||
| 1211 | Ga0466957_0140302 | |||
| 1212 | Ga0466957_0298169 | |||
| 1213 | Ga0466960_0003851 | |||
| 1214 | Ga0466960_0022955 | |||
| 1215 | Ga0466960_0095301 | |||
| 1216 | Ga0466960_0238636 | |||
| 1217 | Ga0466959_0002014 | |||
| 1218 | Ga0466959_0002279 | |||
| 1219 | Ga0466959_0015181 | |||
| 1220 | Ga0466959_0015407 | |||
| 1221 | Ga0466959_0023127 | |||
| 1222 | Ga0466959_0024046 | |||
| 1223 | Ga0466959_0050640 | |||
| 1224 | Ga0466959_0118991 | |||
| 1225 | Ga0466959_0245309 | |||
| 1226 | Ga0466958_0009833 | |||
| 1227 | Ga0466958_0016767 | |||
| 1228 | Ga0466958_0028044 | |||
| 1229 | Ga0466958_0085685 | |||
| 1230 | Ga0466958_0087071 | |||
| 1231 | Ga0466958_0099443 | |||
| 1232 | Ga0466958_0109034 | |||
| 1233 | Ga0466958_0477580 | |||
| 1234 | Ga0466967_0018656 | |||
| 1235 | Ga0466967_0019838 | |||
| 1236 | Ga0466967_0022926 | |||
| 1237 | Ga0466967_0032684 | |||
| 1238 | Ga0466967_0034545 | |||
| 1239 | Ga0466967_0055845 | |||
| 1240 | Ga0466967_0061085 | |||
| 1241 | Ga0466967_0075743 | |||
| 1242 | Ga0466967_0075869 | |||
| 1243 | Ga0466967_0083634 | |||
| 1244 | Ga0466967_0118681 | |||
| 1245 | Ga0466967_0141109 | |||
| 1246 | Ga0466967_0181155 | |||
| 1247 | Ga0466967_0211837 | |||
| 1248 | Ga0466967_0252400 | |||
| 1249 | Ga0466967_0272368 | |||
| 1250 | Ga0466967_0324045 | |||
| 1251 | Ga0466967_0371290 | |||
| 1252 | Ga0466967_0430359 | |||
| 1253 | Ga0495592_0180357 | |||
| 1254 | Ga0495603_0015652 | |||
| 1255 | Ga0495641_0066150 | |||
| 1256 | Ga0495641_0104546 | |||
| 1257 | Ga0495651_0099831 | |||
| 1258 | Ga0495653_0326809 | |||
| 1259 | Ga0495580_0129610 | |||
| 1260 | Ga0495582_0011730 | |||
| 1261 | Ga0495582_0094475 | |||
| 1262 | Ga0495605_0040354 | |||
| 1263 | Ga0495605_0140730 | |||
| 1264 | Ga0495605_0180376 | |||
| 1265 | Ga0495639_0002174 | |||
| 1266 | Ga0495662_0000943 | |||
| 1267 | Ga0495664_0003309 | |||
| 1268 | Ga0495664_0425431 | |||
| 1269 | Ga0495584_0224055 | |||
| 1270 | Ga0495594_0294935 | |||
| 1271 | Ga0495607_0036609 | |||
| 1272 | Ga0495607_0162876 | |||
| 1273 | Ga0495607_0262866 | |||
| 1274 | Ga0495608_0075512 | |||
| 1275 | Ga0495618_0008098 | |||
| 1276 | Ga0495618_0210333 | |||
| 1277 | Ga0495628_0517935 | |||
| 1278 | Ga0495630_0010114 | |||
| 1279 | Ga0495630_0019970 | |||
| 1280 | Ga0495630_0152532 | |||
| 1281 | Ga0495630_0381600 | |||
| 1282 | Ga0495631_0231514 | |||
| 1283 | Ga0495644_0065218 | |||
| 1284 | Ga0495644_0167230 | |||
| 1285 | Ga0495644_0224358 | |||
| 1286 | Ga0495663_0050927 | |||
| 1287 | Ga0495666_0000241 | |||
| 1288 | Ga0495642_0042319 | |||
| 1289 | Ga0495652_0232525 | |||
| 1290 | Ga0495665_0010937 | |||
| 1291 | Ga0495640_0025763 | |||
| 1292 | Ga0495640_0306419 | |||
| 1293 | Ga0495586_0043684 | |||
| 1294 | Ga0495586_0147565 | |||
| 1295 | Ga0495587_0105949 | |||
| 1296 | Ga0495609_0103056 | |||
| 1297 | Ga0495609_0266545 | |||
| 1298 | Ga0495667_0147133 | |||
| 1299 | Ga0495656_0044640 | |||
| 1300 | Ga0495634_0018826 | |||
| 1301 | Ga0495634_0043400 | |||
| 1302 | Ga0495635_0079908 | |||
| 1303 | Ga0495635_0104638 | |||
| 1304 | Ga0495659_0010384 | |||
| 1305 | Ga0495659_0167563 | |||
| 1306 | Ga0495588_0165576 | |||
| 1307 | Ga0495646_0234457 | |||
| 1308 | Ga0495646_0235377 | |||
| 1309 | Ga0495647_0006034 | |||
| 1310 | Ga0495658_0004561 | |||
| 1311 | Ga0495658_0022429 | |||
| 1312 | Ga0495613_0013632 | |||
| 1313 | Ga0495613_0099346 | |||
| 1314 | Ga0495624_0036174 | |||
| 1315 | Ga0495624_0069073 | |||
| 1316 | Ga0495670_0306154 | |||
| 1317 | Ga0495600_0317979 | |||
| 1318 | Ga0495660_0215717 | |||
| 1319 | Ga0495581_0001944 | |||
| 1320 | Ga0495581_0030959 | |||
| 1321 | Ga0495581_0048263 | |||
| 1322 | Ga0495604_0041991 | |||
| 1323 | Ga0495674_0164091 | |||
| 1324 | Ga0495674_0506988 | |||
| 1325 | Ga0495676_0098914 | |||
| 1326 | Ga0495680_0043183 | |||
| 1327 | Ga0495679_019402 | |||
| 1328 | Ga0495684_0020942 | |||
| 1329 | Ga0495684_0186510 | |||
| 1330 | Ga0495593_0027502 | |||
| 1331 | Ga0495593_0129059 | |||
| 1332 | Ga0495614_0000470 | |||
| 1333 | Ga0496100_0003156 | |||
| 1334 | Ga0496100_0058255 | |||
| 1335 | Ga0496100_0065838 | |||
| 1336 | Ga0496100_0189554 | |||
| 1337 | Ga0496100_0546848 | |||
| 1338 | Ga0496101_0000373 | |||
| 1339 | Ga0496101_0057970 | |||
| 1340 | Ga0496101_0069284 | |||
| 1341 | Ga0496101_0108364 | |||
| 1342 | Ga0496101_0142186 | |||
| 1343 | Ga0496101_0185702 | |||
| 1344 | Ga0496101_0241279 | |||
| 1345 | Ga0496102_0008612 | |||
| 1346 | Ga0496102_0008634 | |||
| 1347 | Ga0496102_0018765 | |||
| 1348 | Ga0496102_0030836 | |||
| 1349 | Ga0496102_0048853 | |||
| 1350 | Ga0496102_0069435 | |||
| 1351 | Ga0496102_0208540 | |||
| 1352 | Ga0496102_0295723 | |||
| 1353 | Ga0496102_0302374 | |||
| 1354 | Ga0496102_0442618 | |||
| 1355 | Ga0496103_0044971 | |||
| 1356 | Ga0496103_0083644 | |||
| 1357 | Ga0496103_0117066 | |||
| 1358 | Ga0496103_0117856 | |||
| 1359 | Ga0496103_0119076 | |||
| 1360 | Ga0496103_0628725 | |||
| 1361 | Ga0496104_0000614 | |||
| 1362 | Ga0496104_0007912 | |||
| 1363 | Ga0496104_0127770 | |||
| 1364 | Ga0496104_0567819 | |||
| 1365 | Ga0496104_0919719 | |||
| 1366 | Ga0496105_0000176 | |||
| 1367 | Ga0496105_0001904 | |||
| 1368 | Ga0496105_0025432 | |||
| 1369 | Ga0496105_0233590 | |||
| 1370 | Ga0496105_0323214 | |||
| 1371 | Ga0496106_0008508 | |||
| 1372 | Ga0496106_0047816 | |||
| 1373 | Ga0496106_0061432 | |||
| 1374 | Ga0496106_0082021 | |||
| 1375 | Ga0496106_0180168 | |||
| 1376 | Ga0496106_0480689 | |||
| 1377 | Ga0496107_0002190 | |||
| 1378 | Ga0496107_0002871 | |||
| 1379 | Ga0496107_0055262 | |||
| 1380 | Ga0496107_0057219 | |||
| 1381 | Ga0496107_0120076 | |||
| 1382 | Ga0496107_0253813 | |||
| 1383 | Ga0496107_0273088 | |||
| 1384 | Ga0496107_0276990 | |||
| 1385 | Ga0496107_0598941 | |||
| 1386 | Ga0496108_0028724 | |||
| 1387 | Ga0496108_0033158 | |||
| 1388 | Ga0496108_0136807 | |||
| 1389 | Ga0496108_0160206 | |||
| 1390 | Ga0496108_0221305 | |||
| 1391 | Ga0496108_0365775 | |||
| 1392 | Ga0496108_1105944 | |||
| 1393 | Ga0496109_0000514 | |||
| 1394 | Ga0496109_0010239 | |||
| 1395 | Ga0496109_0028777 | |||
| 1396 | Ga0496109_0400848 | |||
| 1397 | Ga0496109_0530763 | |||
| 1398 | Ga0496110_0000265 | |||
| 1399 | Ga0496110_0015917 | |||
| 1400 | Ga0496110_0180800 | |||
| 1401 | Ga0496111_0000146 | |||
| 1402 | Ga0496111_0003236 | |||
| 1403 | Ga0496111_0005208 | |||
| 1404 | Ga0496111_0080326 | |||
| 1405 | Ga0496111_0134644 | |||
| 1406 | Ga0496111_0317828 | |||
| 1407 | Ga0496112_0001508 | |||
| 1408 | Ga0496112_0007627 | |||
| 1409 | Ga0496112_0136671 | |||
| 1410 | Ga0496112_0483549 | |||
| 1411 | Ga0496113_0011770 | |||
| 1412 | Ga0496113_0021064 | |||
| 1413 | Ga0496113_0029188 | |||
| 1414 | Ga0496114_0016718 | |||
| 1415 | Ga0496114_0029557 | |||
| 1416 | Ga0496114_0034098 | |||
| 1417 | Ga0496114_0046420 | |||
| 1418 | Ga0496114_0047029 | |||
| 1419 | Ga0496114_0059638 | |||
| 1420 | Ga0496114_0153084 | |||
| 1421 | Ga0496114_0257688 | |||
| 1422 | Ga0496115_0001644 | |||
| 1423 | Ga0496115_0036825 | |||
| 1424 | Ga0496115_0042180 | |||
| 1425 | Ga0496115_0067053 | |||
| 1426 | Ga0496115_0095615 | |||
| 1427 | Ga0501309_022029 | |||
| 1428 | Ga0501311_031044 | |||
| 1429 | Ga0501031_0000164 | |||
| 1430 | Ga0501031_0007171 | |||
| 1431 | Ga0501031_0008759 | |||
| 1432 | Ga0501031_0024664 | |||
| 1433 | Ga0501031_0034811 | |||
| 1434 | Ga0501032_0019486 | |||
| 1435 | Ga0501032_0037263 | |||
| 1436 | Ga0501032_0043851 | |||
| 1437 | Ga0501032_0081222 | |||
| 1438 | Ga0501033_0000208 | |||
| 1439 | Ga0501033_0002483 | |||
| 1440 | Ga0501034_0019034 | |||
| 1441 | Ga0501036_0000085 | |||
| 1442 | Ga0501036_0048005 | |||
| 1443 | Ga0501036_0067248 | |||
| 1444 | Ga0501036_0086086 | |||
| 1445 | Ga0501036_0131466 | |||
| 1446 | Ga0501036_0290584 | |||
| 1447 | Ga0501037_0002242 | |||
| 1448 | Ga0501037_0007515 | |||
| 1449 | Ga0501038_0003370 | |||
| 1450 | Ga0501038_0008091 | |||
| 1451 | Ga0501038_0178259 | |||
| 1452 | Ga0501038_0413698 | |||
| 1453 | Ga0501039_0000171 | |||
| 1454 | Ga0501039_0002083 | |||
| 1455 | Ga0501039_0026300 | |||
| 1456 | Ga0501039_0081355 | |||
| 1457 | Ga0501039_0130423 | |||
| 1458 | Ga0501039_0432604 | |||
| 1459 | Ga0501040_0000094 | |||
| 1460 | Ga0501040_0010978 | |||
| 1461 | Ga0501040_0044593 | |||
| 1462 | Ga0501041_0000247 | |||
| 1463 | Ga0501041_0012725 | |||
| 1464 | Ga0501041_0024201 | |||
| 1465 | Ga0501041_0028393 | |||
| 1466 | Ga0501041_0046818 | |||
| 1467 | Ga0501041_0588838 | |||
| 1468 | Ga0501042_0001242 | |||
| 1469 | Ga0501042_0002764 | |||
| 1470 | Ga0501042_0006168 | |||
| 1471 | Ga0501042_0019505 | |||
| 1472 | Ga0501042_0032936 | |||
| 1473 | Ga0501042_0169782 | |||
| 1474 | Ga0501043_0000295 | |||
| 1475 | Ga0501043_0000789 | |||
| 1476 | Ga0501043_0121173 | |||
| 1477 | Ga0501046_0000999 | |||
| 1478 | Ga0501046_0001480 | |||
| 1479 | Ga0501046_0012237 | |||
| 1480 | Ga0501046_0048039 | |||
| 1481 | Ga0501046_0065872 | |||
| 1482 | Ga0501047_0001721 | |||
| 1483 | Ga0501048_0000790 | |||
| 1484 | Ga0501048_0001465 | |||
| 1485 | Ga0501048_0002757 | |||
| 1486 | Ga0501048_0017835 | |||
| 1487 | Ga0501048_0052982 | |||
| 1488 | Ga0501048_0055638 | |||
| 1489 | Ga0501067_0009617 | |||
| 1490 | Ga0501067_0144709 | |||
| 1491 | Ga0501068_0000052 | |||
| 1492 | Ga0501068_0005073 | |||
| 1493 | Ga0501068_0183046 | |||
| 1494 | Ga0501069_0000210 | |||
| 1495 | Ga0501069_0006810 | |||
| 1496 | Ga0501069_0006904 | |||
| 1497 | Ga0501069_0280861 | |||
| 1498 | Ga0501070_0006667 | |||
| 1499 | Ga0501070_0011352 | |||
| 1500 | Ga0501070_0155016 | |||
| 1501 | Ga0501071_0001124 | |||
| 1502 | Ga0501071_0014500 | |||
| 1503 | Ga0501071_0134121 | |||
| 1504 | Ga0501071_0257523 | |||
| 1505 | Ga0501071_0267115 | |||
| 1506 | Ga0501071_0779242 | |||
| 1507 | Ga0501071_0854826 | |||
| 1508 | Ga0501072_0011287 | |||
| 1509 | Ga0501072_0017332 | |||
| 1510 | Ga0501072_0022606 | |||
| 1511 | Ga0501072_0036935 | |||
| 1512 | Ga0501072_0096870 | |||
| 1513 | Ga0501072_0148242 | |||
| 1514 | Ga0501072_0191970 | |||
| 1515 | Ga0501073_0002697 | |||
| 1516 | Ga0501073_0344691 | |||
| 1517 | Ga0501074_0003275 | |||
| 1518 | Ga0501074_0007040 | |||
| 1519 | Ga0501074_0009193 | |||
| 1520 | Ga0501074_0063202 | |||
| 1521 | Ga0501075_0000109 | |||
| 1522 | Ga0501075_0011827 | |||
| 1523 | Ga0501075_0014313 | |||
| 1524 | Ga0501075_0172174 | |||
| 1525 | Ga0501075_0182995 | |||
| 1526 | Ga0501075_0328983 | |||
| 1527 | Ga0501075_0662744 | |||
| 1528 | Ga0501076_0000554 | |||
| 1529 | Ga0501076_0004193 | |||
| 1530 | Ga0501076_0007063 | |||
| 1531 | Ga0501076_0035608 | |||
| 1532 | Ga0501076_0057153 | |||
| 1533 | Ga0501076_0133077 | |||
| 1534 | Ga0501076_0391266 | |||
| 1535 | Ga0501077_0000809 | |||
| 1536 | Ga0501077_0023355 | |||
| 1537 | Ga0501077_0080248 | |||
| 1538 | Ga0501077_0184854 | |||
| 1539 | Ga0501079_0000099 | |||
| 1540 | Ga0501079_0020669 | |||
| 1541 | Ga0501079_0063618 | |||
| 1542 | Ga0501079_0128000 | |||
| 1543 | Ga0501079_0169270 | |||
| 1544 | Ga0501079_0209805 | |||
| 1545 | Ga0501079_0661342 | |||
| 1546 | Ga0501080_0000768 | |||
| 1547 | Ga0501080_0009951 | |||
| 1548 | Ga0501080_0520441 | |||
| 1549 | Ga0501081_0010244 | |||
| 1550 | Ga0501081_0013305 | |||
| 1551 | Ga0501081_0020877 | |||
| 1552 | Ga0501081_0033563 | |||
| 1553 | Ga0501081_0052676 | |||
| 1554 | Ga0501081_0176517 | |||
| 1555 | Ga0501081_0891244 | |||
| 1556 | Ga0501083_0000227 | |||
| 1557 | Ga0501083_0000261 | |||
| 1558 | Ga0501035_0002978 | |||
| 1559 | Ga0501035_0005322 | |||
| 1560 | Ga0501035_0076680 | |||
| 1561 | Ga0501035_0130317 | |||
| 1562 | Ga0501044_0017382 | |||
| 1563 | Ga0501044_0199942 | |||
| 1564 | Ga0501044_0594352 | |||
| 1565 | Ga0501045_0008557 | |||
| 1566 | Ga0501045_0032119 | |||
| 1567 | Ga0501045_0077342 | |||
| 1568 | Ga0501045_0104007 | |||
| 1569 | Ga0501045_0108085 | |||
| 1570 | Ga0501045_0303380 | |||
| 1571 | Ga0501045_0309528 | |||
| 1572 | Ga0501045_0794731 | |||
| 1573 | nmdc:mga00v17_59827_c1 | |||
| 1574 | nmdc:mga0yw44_119978_c1 | |||
| 1575 | nmdc:mga0k408_91658_c1 | |||
| 1576 | nmdc:mga05p37_27625_c1 | |||
| 1577 | nmdc:mga05p37_672774_c1 | |||
| 1578 | nmdc:mga05p37_826568_c1 | |||
| 1579 | nmdc:mga09592_1045066_c1 | |||
| 1580 | nmdc:mga09592_160851_c1 | |||
| 1581 | nmdc:mga0qj67_48226_c1 | |||
| 1582 | nmdc:mga08y16_187773_c1 | |||
| 1583 | nmdc:mga08y16_72441_c1 | |||
| 1584 | nmdc:mga0n895_243336_c1 | |||
| 1585 | nmdc:mga0n895_328592_c1 | |||
| 1586 | nmdc:mga0n895_399836_c1 | |||
| 1587 | nmdc:mga0n895_840435_c1 | |||
| 1588 | nmdc:mga0n895_88124_c1 | |||
| 1589 | nmdc:mga0n895_941228_c1 | |||
| 1590 | nmdc:mga0rr50_327024_c1 | |||
| 1591 | nmdc:mga0rr50_752409_c1 | |||
| 1592 | nmdc:mga08x19_659280_c1 | |||
| 1593 | nmdc:mga0a205_299899_c1 | |||
| 1594 | Ga0495601_0015474 | |||
| 1595 | Ga0495601_0109234 | |||
| 1596 | Ga0495601_0573022 | |||
| 1597 | Ga0495612_0011200 | |||
| 1598 | Ga0495655_0051595 | |||
| 1599 | Ga0495595_0004031 | |||
| 1600 | Ga0500566_0027221 | |||
| 1601 | Ga0501084_0001093 | |||
| 1602 | Ga0501084_0011779 | |||
| 1603 | Ga0501084_0012517 | |||
| 1604 | Ga0501084_0045249 | |||
| 1605 | Ga0501084_0060876 | |||
| 1606 | Ga0501084_0070049 | |||
| 1607 | Ga0501084_0277174 | |||
| 1608 | Ga0590077_075824 | |||
| 1609 | Ga0587073_0027293 | |||
| 1610 | Ga0501082_0000563 | |||
| 1611 | Ga0501082_0026919 | |||
| 1612 | Ga0501082_0036310 | |||
| 1613 | Ga0501082_0040068 | |||
| 1614 | Ga0501082_0068895 | |||
| 1615 | Ga0501082_0076693 | |||
| 1616 | Ga0501082_0276131 | |||
| 1617 | Ga0466962_0003286 | |||
| 1618 | Ga0466962_0004357 | |||
| 1619 | Ga0466962_0008091 | |||
| 1620 | Ga0466962_0107600 | |||
| 1621 | Ga0466962_0178715 | |||
| 1622 | Ga0530510_0001992 | |||
| 1623 | Ga0530510_0004150 | |||
| 1624 | Ga0530510_0392125 | |||
| 1625 | Ga0530510_0402812 | |||
| 1626 | Ga0530510_0700080 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.9551 | 28 | 106 |
| 2oa2-assembly1.cif.gz_A-2 | crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution | 0.9485 | 28 | 106 |
| 8hfb-assembly1.cif.gz_B | evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis | 0.9364 | 5 | 109 |
| 6o2d-assembly1.cif.gz_A | schizosaccharomyces pombe cnp3 cupin domain | 0.934 | 15 | 106 |
| 1y3t-assembly1.cif.gz_B | crystal structure of yxag, a dioxygenase from bacillus subtilis | 0.9325 | 5 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9552 | 27 | 107 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.927 | 15 | 105 | 2.60.120.10 |
| 2h0vB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9266 | 13 | 104 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.926 | 14 | 105 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9199 | 13 | 106 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YU69-F1-model_v4 | Cupin domain-containing protein | 0.9973 | 1 | 181 |
|
| AF-A0A6J4TIX3-F1-model_v4 | Cupin type-2 domain-containing protein | 0.994 | 2 | 181 |
|
| AF-A0A1H0Y6C5-F1-model_v4 | Cupin domain-containing protein | 0.9875 | 1 | 178 |
|
| AF-A0A536DMS4-F1-model_v4 | Cupin domain-containing protein | 0.9854 | 3 | 178 |
|
| AF-A0A7K0A3J6-F1-model_v4 | Cupin domain-containing protein | 0.9852 | 1 | 178 |
|