F481962

General Info

Members Datasets Scaffolds Average Seq Length
813 310 1626 190

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0100638|Ga0466962_0100638_52_633
Length 193
Sequence MIHAGDTIHNPVTGERIVFRQTSRETNGEAVVIETFVQPNGFVAAAHVHPGQEERFEILRGSVGFKVGGEKLVAGPGQRLTVPAGTPHRFWNAGEEEEAHFVCEVRPALQFETLLETMFALAADGKTNRKGMPNPLRLAVIANAHFDTVRLPFPPALVQRIGLALGAPLGRLFGYEPIYVPAEPAAIAAAASI

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 11.56
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 12.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0100638 3300061719 Bacteria 1388
2 Ga0070658_10048475 3300005327 Bacteria 3440
3 Ga0070658_10163814 3300005327 Bacteria 1866
4 Ga0070676_10293742 3300005328 Unclassified 1099
5 Ga0070683_100009898 3300005329 Bacteria 8171
6 Ga0070683_100017148 3300005329 Bacteria 6395
7 Ga0070683_100591634 3300005329 Unclassified 1062
8 Ga0070680_100013850 3300005336 Bacteria 6291
9 Ga0070680_100015369 3300005336 Bacteria 5999
10 Ga0070680_100512736 3300005336 Bacteria 1027
11 Ga0070682_100181559 3300005337 Bacteria 1470
12 Ga0068868_100453446 3300005338 Unclassified 1116
13 Ga0070660_100003547 3300005339 Bacteria 10768
14 Ga0070660_100057819 3300005339 Bacteria 3005
15 Ga0070660_100308239 3300005339 Bacteria 1299
16 Ga0070691_10353023 3300005341 Unclassified 817
17 Ga0070661_100018395 3300005344 Bacteria 4967
18 Ga0070692_10143624 3300005345 Bacteria 1353
19 Ga0070669_100577997 3300005353 Unclassified 939
20 Ga0070675_100349037 3300005354 Bacteria 1312
21 Ga0070671_100083566 3300005355 Bacteria 2670
22 Ga0070674_100268799 3300005356 Bacteria 1346
23 Ga0070674_100436076 3300005356 Unclassified 1078
24 Ga0070674_100500709 3300005356 Bacteria 1012
25 Ga0070674_100918299 3300005356 Bacteria 763
26 Ga0070673_100327387 3300005364 Bacteria 1355
27 Ga0070688_100440589 3300005365 Unclassified 972
28 Ga0070659_101196149 3300005366 Unclassified 672
29 Ga0070709_10034207 3300005434 Bacteria 3079
30 Ga0070714_100022116 3300005435 Bacteria 5211
31 Ga0070714_100133574 3300005435 Bacteria 2219
32 Ga0070714_100821152 3300005435 Unclassified 901
33 Ga0070714_101037263 3300005435 Bacteria 798
34 Ga0070713_100017782 3300005436 Bacteria 5390
35 Ga0070713_100075810 3300005436 Bacteria 2854
36 Ga0070713_100209377 3300005436 Bacteria 1764
37 Ga0070713_101020081 3300005436 Bacteria 798
38 Ga0070710_10036401 3300005437 Bacteria 2691
39 Ga0070710_10045878 3300005437 Bacteria 2431
40 Ga0070710_10148554 3300005437 Unclassified 1443
41 Ga0070711_100076689 3300005439 Bacteria 2370
42 Ga0070711_100232682 3300005439 Bacteria 1437
43 Ga0070705_100274395 3300005440 Unclassified 1196
44 Ga0070700_100039513 3300005441 Bacteria 2883
45 Ga0070700_100379139 3300005441 Unclassified 1057
46 Ga0070694_100231589 3300005444 Bacteria 1390
47 Ga0070678_100262606 3300005456 Unclassified 1453
48 Ga0070678_100669297 3300005456 Bacteria 933
49 Ga0070681_10024831 3300005458 Bacteria 6029
50 Ga0070681_10068898 3300005458 Bacteria 3504
51 Ga0070681_10208689 3300005458 Bacteria 1870
52 Ga0070681_10217146 3300005458 Bacteria 1828
53 Ga0070681_10278532 3300005458 Bacteria 1583
54 Ga0068867_100502034 3300005459 Unclassified 1043
55 Ga0068867_100637546 3300005459 Unclassified 933
56 Ga0070698_100006851 3300005471 Bacteria 12344
57 Ga0070699_100552965 3300005518 Unclassified 1048
58 Ga0070679_100047736 3300005530 Bacteria 4267
59 Ga0070679_100062622 3300005530 Bacteria 3709
60 Ga0070679_100065001 3300005530 Bacteria 3636
61 Ga0070679_100067929 3300005530 Bacteria 3555
62 Ga0070679_100226034 3300005530 Bacteria 1832
63 Ga0070679_100250880 3300005530 Bacteria 1726
64 Ga0070679_100515486 3300005530 Bacteria 1139
65 Ga0070679_100564451 3300005530 Bacteria 1082
66 Ga0070684_100057735 3300005535 Bacteria 3389
67 Ga0070684_100105667 3300005535 Bacteria 2519
68 Ga0070684_100340102 3300005535 Bacteria 1380
69 Ga0068853_100178017 3300005539 Bacteria 1928
70 Ga0070686_100212391 3300005544 Bacteria 1394
71 Ga0070695_100000363 3300005545 Bacteria 23281
72 Ga0070695_100196744 3300005545 Bacteria 1438
73 Ga0070693_100021474 3300005547 Bacteria 3420
74 Ga0070693_100023834 3300005547 Bacteria 3276
75 Ga0070665_100016660 3300005548 Bacteria 7364
76 Ga0070704_100168968 3300005549 Bacteria 1737
77 Ga0068855_100047632 3300005563 Bacteria 5063
78 Ga0068855_100195121 3300005563 Bacteria 2281
79 Ga0068855_100532543 3300005563 Bacteria 1273
80 Ga0068855_100679051 3300005563 Unclassified 1104
81 Ga0070664_100780376 3300005564 Bacteria 893
82 Ga0068854_100090519 3300005578 Bacteria 2275
83 Ga0068856_100022903 3300005614 Bacteria 6075
84 Ga0068856_100316926 3300005614 Bacteria 1577
85 Ga0068852_100003792 3300005616 Bacteria 10602
86 Ga0068852_100181461 3300005616 Bacteria 1979
87 Ga0068852_101090172 3300005616 Unclassified 819
88 Ga0068852_101437806 3300005616 Bacteria 712
89 Ga0068866_10410789 3300005718 Unclassified 876
90 Ga0068861_100071059 3300005719 Bacteria 2697
91 Ga0068851_10140072 3300005834 Bacteria 1315
92 Ga0068863_101183346 3300005841 Unclassified 770
93 Ga0068862_100351162 3300005844 Unclassified 1368
94 Ga0081455_10053251 3300005937 Bacteria 3458
95 Ga0081455_10089780 3300005937 Bacteria 2493
96 Ga0081455_10099186 3300005937 Bacteria 2343
97 Ga0081538_10002117 3300005981 Bacteria 19784
98 Ga0081539_10000781 3300005985 Bacteria 62064
99 Ga0070717_10009169 3300006028 Bacteria 7435
100 Ga0075364_10131550 3300006051 Bacteria 1679
101 Ga0070715_10010483 3300006163 Bacteria 3304
102 Ga0070715_10039362 3300006163 Bacteria 1969
103 Ga0070716_100016356 3300006173 Bacteria 3826
104 Ga0070716_100034338 3300006173 Bacteria 2780
105 Ga0070712_100018844 3300006175 Bacteria 4491
106 Ga0070712_100076773 3300006175 Bacteria 2406
107 Ga0070712_100106221 3300006175 Bacteria 2087
108 Ga0070712_100127803 3300006175 Bacteria 1922
109 Ga0070712_100182671 3300006175 Bacteria 1635
110 Ga0070712_100560644 3300006175 Unclassified 963
111 Ga0075362_10024646 3300006177 Bacteria 2554
112 Ga0075366_10075782 3300006195 Bacteria 2007
113 Ga0097621_100444910 3300006237 Bacteria 1167
114 Ga0097621_100602040 3300006237 Unclassified 1005
115 Ga0075428_100099811 3300006844 Unclassified 3165
116 Ga0075430_100050445 3300006846 Bacteria 3509
117 Ga0075431_100165737 3300006847 Bacteria 2271
118 Ga0075431_100221813 3300006847 Unclassified 1928
119 Ga0075433_10208699 3300006852 Bacteria 1736
120 Ga0075433_10390743 3300006852 Bacteria 1228
121 Ga0075433_10458814 3300006852 Bacteria 1123
122 Ga0075434_100016720 3300006871 Bacteria 7057
123 Ga0075434_100104006 3300006871 Bacteria 2849
124 Ga0075434_101024992 3300006871 Bacteria 839
125 Ga0075429_100306874 3300006880 Bacteria 1389
126 Ga0068865_100087649 3300006881 Bacteria 2250
127 Ga0068865_100365557 3300006881 Bacteria 1173
128 Ga0068865_100574582 3300006881 Bacteria 950
129 Ga0075436_100206274 3300006914 Bacteria 1393
130 Ga0075435_100058951 3300007076 Bacteria 3111
131 Ga0099795_10102231 3300007788 Bacteria 1126
132 Ga0105251_10293718 3300009011 Unclassified 736
133 Ga0105240_10162039 3300009093 Bacteria 2656
134 Ga0111539_10078401 3300009094 Bacteria 3887
135 Ga0111539_10096130 3300009094 Bacteria 3479
136 Ga0111539_11516519 3300009094 Bacteria 777
137 Ga0105245_10057981 3300009098 Bacteria 3485
138 Ga0105245_10151345 3300009098 Bacteria 2194
139 Ga0105245_10281352 3300009098 Bacteria 1626
140 Ga0105245_10338716 3300009098 Unclassified 1487
141 Ga0105245_10983485 3300009098 Unclassified 888
142 Ga0114129_10904995 3300009147 Unclassified 1118
143 Ga0105243_10101793 3300009148 Bacteria 2386
144 Ga0105241_10411291 3300009174 Bacteria 1189
145 Ga0105242_10057932 3300009176 Bacteria 3174
146 Ga0105242_10380666 3300009176 Bacteria 1312
147 Ga0105242_10652556 3300009176 Bacteria 1023
148 Ga0105242_10731576 3300009176 Unclassified 972
149 Ga0105248_10537006 3300009177 Bacteria 1319
150 Ga0105237_10009640 3300009545 Bacteria 10335
151 Ga0105237_10026472 3300009545 Bacteria 5928
152 Ga0105238_10063652 3300009551 Bacteria 3689
153 Ga0105238_10319259 3300009551 Bacteria 1539
154 Ga0105249_10002935 3300009553 Bacteria 14709
155 Ga0105239_10114018 3300010375 Bacteria 2998
156 Ga0105239_10128853 3300010375 Bacteria 2813
157 Ga0105239_10194731 3300010375 Bacteria 2270
158 Ga0105239_10269718 3300010375 Bacteria 1914
159 Ga0105239_10286929 3300010375 Bacteria 1853
160 Ga0105239_10598748 3300010375 Bacteria 1257
161 Ga0105246_10503044 3300011119 Unclassified 1029
162 Ga0157329_1006789 3300012491 Unclassified 815
163 Ga0157373_10417961 3300013100 Bacteria 962
164 Ga0157370_10001705 3300013104 Bacteria 27045
165 Ga0157370_10008120 3300013104 Bacteria 11360
166 Ga0157370_10015648 3300013104 Bacteria 7705
167 Ga0157370_10186282 3300013104 Bacteria 1927
168 Ga0157369_10009399 3300013105 Bacteria 11178
169 Ga0157369_10026009 3300013105 Bacteria 6494
170 Ga0157374_10389473 3300013296 Bacteria 1389
171 Ga0157374_10471152 3300013296 Bacteria 1258
172 Ga0163162_10075411 3300013306 Bacteria 3433
173 Ga0157372_10011307 3300013307 Bacteria 9495
174 Ga0157372_10023472 3300013307 Bacteria 6686
175 Ga0157372_10133199 3300013307 Bacteria 2861
176 Ga0157372_10617307 3300013307 Bacteria 1264
177 Ga0157375_10067823 3300013308 Bacteria 3566
178 Ga0157375_10293934 3300013308 Bacteria 1788
179 Ga0157375_10807372 3300013308 Unclassified 1086
180 Ga0163163_10569083 3300014325 Bacteria 1196
181 Ga0157377_10210664 3300014745 Bacteria 1239
182 Ga0157376_10086587 3300014969 Bacteria 2702
183 Ga0157376_10163407 3300014969 Bacteria 2020
184 Ga0206356_10034121 3300020070 Bacteria 3563
185 Ga0206356_10058303 3300020070 Bacteria 1232
186 Ga0206350_10083145 3300020080 Bacteria 2040
187 Ga0206353_10956052 3300020082 Bacteria 1586
188 Ga0206353_11078391 3300020082 Bacteria 1218
189 Ga0224712_10012062 3300022467 Bacteria 2704
190 Ga0207692_10041656 3300025898 Unclassified 2275
191 Ga0207692_10054357 3300025898 Bacteria 2044
192 Ga0207688_10169873 3300025901 Bacteria 1296
193 Ga0207647_10134586 3300025904 Unclassified 1451
194 Ga0207685_10059778 3300025905 Unclassified 1505
195 Ga0207685_10068682 3300025905 Bacteria 1429
196 Ga0207699_10255944 3300025906 Unclassified 1208
197 Ga0207699_10437739 3300025906 Bacteria 936
198 Ga0207643_10237186 3300025908 Unclassified 1120
199 Ga0207643_10268999 3300025908 Bacteria 1054
200 Ga0207705_10137448 3300025909 Bacteria 1823
201 Ga0207705_10148324 3300025909 Bacteria 1756
202 Ga0207705_10366061 3300025909 Bacteria 1112
203 Ga0207654_10072191 3300025911 Bacteria 2054
204 Ga0207707_10021670 3300025912 Bacteria 5616
205 Ga0207707_10062364 3300025912 Bacteria 3244
206 Ga0207707_10099891 3300025912 Bacteria 2536
207 Ga0207707_10121815 3300025912 Bacteria 2281
208 Ga0207707_10150991 3300025912 Bacteria 2031
209 Ga0207707_10283943 3300025912 Bacteria 1433
210 Ga0207695_10040677 3300025913 Bacteria 4981
211 Ga0207695_10210848 3300025913 Bacteria 1853
212 Ga0207671_10032718 3300025914 Bacteria 3868
213 Ga0207693_10003543 3300025915 Bacteria 13334
214 Ga0207693_10011364 3300025915 Bacteria 7209
215 Ga0207693_10031619 3300025915 Bacteria 4182
216 Ga0207693_10036998 3300025915 Bacteria 3847
217 Ga0207693_10039554 3300025915 Bacteria 3714
218 Ga0207663_10033908 3300025916 Bacteria 3046
219 Ga0207663_10047509 3300025916 Bacteria 2650
220 Ga0207663_10275827 3300025916 Bacteria 1247
221 Ga0207660_10032860 3300025917 Bacteria 3584
222 Ga0207660_10095422 3300025917 Bacteria 2213
223 Ga0207657_10001511 3300025919 Bacteria 24895
224 Ga0207657_10020508 3300025919 Bacteria 6243
225 Ga0207657_10272334 3300025919 Bacteria 1346
226 Ga0207649_10062282 3300025920 Bacteria 2351
227 Ga0207649_10195641 3300025920 Bacteria 1425
228 Ga0207652_10034097 3300025921 Bacteria 4289
229 Ga0207652_10038093 3300025921 Bacteria 4073
230 Ga0207652_10102921 3300025921 Bacteria 2524
231 Ga0207652_10140599 3300025921 Bacteria 2158
232 Ga0207652_10273481 3300025921 Bacteria 1524
233 Ga0207652_10452364 3300025921 Bacteria 1157
234 Ga0207652_10485003 3300025921 Bacteria 1113
235 Ga0207646_10332074 3300025922 Unclassified 1374
236 Ga0207646_10378622 3300025922 Bacteria 1278
237 Ga0207694_10187658 3300025924 Bacteria 1678
238 Ga0207694_10378657 3300025924 Bacteria 1174
239 Ga0207687_10046423 3300025927 Bacteria 3007
240 Ga0207687_10148534 3300025927 Bacteria 1786
241 Ga0207687_10342806 3300025927 Unclassified 1215
242 Ga0207700_10024422 3300025928 Bacteria 4183
243 Ga0207700_10040403 3300025928 Bacteria 3405
244 Ga0207700_10061048 3300025928 Bacteria 2858
245 Ga0207664_10005471 3300025929 Bacteria 8686
246 Ga0207664_10032566 3300025929 Bacteria 3997
247 Ga0207664_10087989 3300025929 Bacteria 2541
248 Ga0207664_10195969 3300025929 Unclassified 1741
249 Ga0207664_10209670 3300025929 Bacteria 1685
250 Ga0207690_10667489 3300025932 Unclassified 853
251 Ga0207706_10463006 3300025933 Bacteria 1096
252 Ga0207706_10512782 3300025933 Bacteria 1034
253 Ga0207706_10592440 3300025933 Unclassified 953
254 Ga0207686_10105367 3300025934 Bacteria 1891
255 Ga0207686_10396706 3300025934 Unclassified 1050
256 Ga0207709_10143623 3300025935 Bacteria 1644
257 Ga0207669_10221676 3300025937 Bacteria 1388
258 Ga0207669_10250769 3300025937 Bacteria 1318
259 Ga0207704_10103487 3300025938 Bacteria 1905
260 Ga0207665_10000359 3300025939 Bacteria 31672
261 Ga0207665_10001883 3300025939 Bacteria 14141
262 Ga0207665_10310193 3300025939 Bacteria 1182
263 Ga0207691_10401178 3300025940 Unclassified 1170
264 Ga0207661_10073918 3300025944 Bacteria 2793
265 Ga0207661_10796829 3300025944 Bacteria 870
266 Ga0207679_10102966 3300025945 Bacteria 2237
267 Ga0207667_10062838 3300025949 Bacteria 3881
268 Ga0207651_10290833 3300025960 Bacteria 1355
269 Ga0207712_10017910 3300025961 Bacteria 4609
270 Ga0207712_10100461 3300025961 Bacteria 2149
271 Ga0207668_10868174 3300025972 Bacteria 802
272 Ga0207640_10817762 3300025981 Bacteria 808
273 Ga0207677_10547335 3300026023 Bacteria 1008
274 Ga0207639_10529262 3300026041 Bacteria 1080
275 Ga0207678_10106537 3300026067 Bacteria 2391
276 Ga0207678_10426770 3300026067 Bacteria 1150
277 Ga0207708_10126477 3300026075 Bacteria 1995
278 Ga0207708_10317600 3300026075 Bacteria 1270
279 Ga0207702_10003896 3300026078 Bacteria 13443
280 Ga0207702_10075803 3300026078 Bacteria 2906
281 Ga0207702_10122702 3300026078 Bacteria 2327
282 Ga0207702_10284510 3300026078 Bacteria 1564
283 Ga0207702_10625339 3300026078 Unclassified 1058
284 Ga0207702_10794676 3300026078 Bacteria 935
285 Ga0207641_11167613 3300026088 Unclassified 769
286 Ga0207648_10145206 3300026089 Bacteria 2093
287 Ga0207648_10588185 3300026089 Unclassified 1025
288 Ga0207648_10719010 3300026089 Unclassified 926
289 Ga0207674_10170355 3300026116 Bacteria 2131
290 Ga0207674_10566676 3300026116 Bacteria 1097
291 Ga0207675_100118906 3300026118 Bacteria 2499
292 Ga0207683_10007746 3300026121 Bacteria 9194
293 Ga0207683_10166140 3300026121 Bacteria 1997
294 Ga0207683_10462649 3300026121 Bacteria 1170
295 Ga0207698_10147023 3300026142 Bacteria 2040
296 Ga0207698_10194711 3300026142 Bacteria 1809
297 Ga0207428_10011860 3300027907 Bacteria 7680
298 Ga0268265_10198622 3300028380 Unclassified 1738
299 Ga0268265_11018512 3300028380 Unclassified 819
300 Ga0268264_11781041 3300028381 Bacteria 626
301 Ga0373938_0033234 3300034957 Bacteria 1115
302 Ga0373944_0076833 3300035089 Bacteria 1097
303 Ga0373951_0033451 3300035091 Bacteria 1219
304 Ga0373952_0037827 3300035092 Bacteria 1103
305 Ga0373932_0021335 3300035112 Bacteria 1709
306 Ga0373939_0155496 3300035114 Unclassified 836
307 Ga0373941_0007480 3300035115 Bacteria 2674
308 Ga0373960_0067874 3300035121 Unclassified 1096
309 Ga0373960_0110143 3300035121 Bacteria 902
310 Ga0373943_0003569 3300035170 Bacteria 7078
311 Ga0373943_0221950 3300035170 Unclassified 1053
312 Ga0373962_0040834 3300035242 Unclassified 1306
313 Ga0373931_0006757 3300035691 Bacteria 5382
314 Ga0373935_0113294 3300035692 Bacteria 1803
315 Ga0373927_0115826 3300035695 Bacteria 1747
316 Ga0373947_0012653 3300035725 Bacteria 4838
317 Ga0395899_0001311 3300037312 Bacteria 21430
318 Ga0395899_0056346 3300037312 Bacteria 2905
319 Ga0395899_0066297 3300037312 Bacteria 2651
320 Ga0395899_0102813 3300037312 Unclassified 2061
321 Ga0395899_0547909 3300037312 Bacteria 744
322 Ga0395900_0006188 3300037418 Bacteria 12504
323 Ga0395900_0037226 3300037418 Bacteria 5018
324 Ga0395900_0067370 3300037418 Bacteria 3678
325 Ga0395900_0246413 3300037418 Bacteria 1790
326 Ga0395900_0426791 3300037418 Bacteria 1285
327 Ga0395900_0808528 3300037418 Bacteria 865
328 Ga0395898_0001816 3300037466 Bacteria 27562
329 Ga0395898_0097135 3300037466 Bacteria 2829
330 Ga0395898_0099134 3300037466 Bacteria 2798
331 Ga0395898_0204657 3300037466 Bacteria 1883
332 Ga0395898_0238746 3300037466 Bacteria 1733
333 Ga0395905_0006417 3300037471 Bacteria 11842
334 Ga0395905_0012858 3300037471 Bacteria 8046
335 Ga0395905_0042952 3300037471 Bacteria 4241
336 Ga0395905_0077452 3300037471 Bacteria 3115
337 Ga0395905_0122502 3300037471 Bacteria 2445
338 Ga0395905_0301281 3300037471 Bacteria 1490
339 Ga0395901_0005317 3300038443 Bacteria 13010
340 Ga0395901_0032040 3300038443 Bacteria 5423
341 Ga0395901_0093910 3300038443 Bacteria 3141
342 Ga0395901_0115032 3300038443 Bacteria 2825
343 Ga0395901_0170985 3300038443 Bacteria 2280
344 Ga0395901_0219500 3300038443 Bacteria 1987
345 Ga0451853_1793536 3300041512 Unclassified 2524
346 Ga0439448_0085139 3300042005 Bacteria 1065
347 Ga0450920_051450 3300042122 Bacteria 826
348 Ga0466969_0003305 3300044656 Bacteria 8575
349 Ga0466965_0047774 3300044683 Bacteria 2119
350 Ga0466965_0098566 3300044683 Bacteria 1493
351 Ga0466965_0113758 3300044683 Unclassified 1393
352 Ga0466965_0262129 3300044683 Bacteria 929
353 Ga0466966_0022666 3300044684 Bacteria 4119
354 Ga0466966_0025100 3300044684 Bacteria 3895
355 Ga0466966_0027186 3300044684 Bacteria 3731
356 Ga0466966_0046263 3300044684 Bacteria 2779
357 Ga0466961_0026155 3300044693 Bacteria 3753
358 Ga0466961_0033488 3300044693 Bacteria 3300
359 Ga0466961_0154780 3300044693 Bacteria 1430
360 Ga0466961_0222572 3300044693 Bacteria 1163
361 Ga0466963_0000048 3300044694 Bacteria 39958
362 Ga0466963_0003893 3300044694 Bacteria 8622
363 Ga0466963_0004401 3300044694 Bacteria 8182
364 Ga0466963_0007353 3300044694 Bacteria 6560
365 Ga0466963_0007773 3300044694 Bacteria 6410
366 Ga0466963_0010199 3300044694 Bacteria 5681
367 Ga0466963_0011451 3300044694 Bacteria 5402
368 Ga0466963_0013074 3300044694 Bacteria 5090
369 Ga0466963_0034913 3300044694 Bacteria 3274
370 Ga0466963_0038042 3300044694 Bacteria 3145
371 Ga0466963_0118128 3300044694 Unclassified 1823
372 Ga0466963_0122278 3300044694 Unclassified 1792
373 Ga0466963_0809891 3300044694 Bacteria 660
374 Ga0466964_0002291 3300044706 Bacteria 6786
375 Ga0466964_0002374 3300044706 Bacteria 6690
376 Ga0466964_0004438 3300044706 Bacteria 5183
377 Ga0466964_0011534 3300044706 Bacteria 3340
378 Ga0466964_0043150 3300044706 Bacteria 1829
379 Ga0466964_0057857 3300044706 Bacteria 1606
380 Ga0466964_0144996 3300044706 Bacteria 1095
381 Ga0466964_0180760 3300044706 Bacteria 1000
382 Ga0466964_0534671 3300044706 Unclassified 634
383 Ga0466971_0000420 3300044719 Bacteria 16565
384 Ga0466971_0000987 3300044719 Bacteria 11732
385 Ga0466971_0004618 3300044719 Bacteria 5948
386 Ga0466971_0023590 3300044719 Bacteria 2743
387 Ga0466971_0026285 3300044719 Bacteria 2600
388 Ga0466971_0147570 3300044719 Bacteria 1097
389 Ga0466968_0044321 3300044735 Bacteria 1885
390 Ga0466968_0051349 3300044735 Bacteria 1761
391 Ga0466968_0075118 3300044735 Bacteria 1477
392 Ga0466968_0132393 3300044735 Bacteria 1136
393 Ga0466970_0001835 3300044765 Bacteria 10267
394 Ga0466970_0069412 3300044765 Bacteria 1894
395 Ga0466957_0002892 3300044842 Bacteria 9306
396 Ga0466957_0009643 3300044842 Bacteria 5513
397 Ga0466957_0090484 3300044842 Bacteria 1916
398 Ga0466957_0140302 3300044842 Bacteria 1556
399 Ga0466957_0298169 3300044842 Bacteria 1082
400 Ga0466960_0003851 3300044901 Bacteria 5819
401 Ga0466960_0022955 3300044901 Bacteria 2795
402 Ga0466960_0095301 3300044901 Bacteria 1524
403 Ga0466960_0238636 3300044901 Unclassified 1006
404 Ga0466959_0002014 3300045049 Bacteria 12826
405 Ga0466959_0002279 3300045049 Bacteria 12241
406 Ga0466959_0015181 3300045049 Bacteria 5610
407 Ga0466959_0015407 3300045049 Bacteria 5568
408 Ga0466959_0023127 3300045049 Bacteria 4598
409 Ga0466959_0024046 3300045049 Bacteria 4511
410 Ga0466959_0050640 3300045049 Bacteria 3049
411 Ga0466959_0118991 3300045049 Unclassified 1879
412 Ga0466959_0245309 3300045049 Unclassified 1236
413 Ga0466958_0009833 3300045836 Bacteria 5337
414 Ga0466958_0016767 3300045836 Bacteria 4223
415 Ga0466958_0028044 3300045836 Bacteria 3335
416 Ga0466958_0085685 3300045836 Bacteria 1943
417 Ga0466958_0087071 3300045836 Bacteria 1928
418 Ga0466958_0099443 3300045836 Bacteria 1807
419 Ga0466958_0109034 3300045836 Bacteria 1727
420 Ga0466958_0477580 3300045836 Unclassified 808
421 Ga0466967_0018656 3300045976 Bacteria 5552
422 Ga0466967_0019838 3300045976 Bacteria 5416
423 Ga0466967_0022926 3300045976 Bacteria 5105
424 Ga0466967_0032684 3300045976 Bacteria 4396
425 Ga0466967_0034545 3300045976 Bacteria 4293
426 Ga0466967_0055845 3300045976 Bacteria 3479
427 Ga0466967_0061085 3300045976 Bacteria 3342
428 Ga0466967_0075743 3300045976 Bacteria 3025
429 Ga0466967_0075869 3300045976 Bacteria 3022
430 Ga0466967_0083634 3300045976 Bacteria 2886
431 Ga0466967_0118681 3300045976 Bacteria 2440
432 Ga0466967_0141109 3300045976 Bacteria 2244
433 Ga0466967_0181155 3300045976 Bacteria 1987
434 Ga0466967_0211837 3300045976 Unclassified 1838
435 Ga0466967_0252400 3300045976 Bacteria 1685
436 Ga0466967_0272368 3300045976 Bacteria 1622
437 Ga0466967_0324045 3300045976 Bacteria 1486
438 Ga0466967_0371290 3300045976 Bacteria 1388
439 Ga0466967_0430359 3300045976 Bacteria 1287
440 Ga0495592_0180357 3300046454 Bacteria 1439
441 Ga0495603_0015652 3300046455 Bacteria 4589
442 Ga0495641_0066150 3300046461 Unclassified 1627
443 Ga0495641_0104546 3300046461 Unclassified 1263
444 Ga0495651_0099831 3300046462 Bacteria 2164
445 Ga0495653_0326809 3300046463 Bacteria 992
446 Ga0495580_0129610 3300046472 Bacteria 1750
447 Ga0495582_0011730 3300046473 Bacteria 4829
448 Ga0495582_0094475 3300046473 Unclassified 1669
449 Ga0495605_0040354 3300046474 Bacteria 2331
450 Ga0495605_0140730 3300046474 Bacteria 1083
451 Ga0495605_0180376 3300046474 Bacteria 929
452 Ga0495639_0002174 3300046475 Bacteria 8641
453 Ga0495662_0000943 3300046476 Bacteria 14253
454 Ga0495664_0003309 3300046477 Bacteria 8764
455 Ga0495664_0425431 3300046477 Bacteria 796
456 Ga0495584_0224055 3300046491 Archaea 956
457 Ga0495594_0294935 3300046499 Bacteria 924
458 Ga0495607_0036609 3300046501 Bacteria 2955
459 Ga0495607_0162876 3300046501 Archaea 1132
460 Ga0495607_0262866 3300046501 Unclassified 826
461 Ga0495608_0075512 3300046511 Bacteria 2196
462 Ga0495618_0008098 3300046514 Bacteria 6364
463 Ga0495618_0210333 3300046514 Bacteria 1229
464 Ga0495628_0517935 3300046516 Bacteria 859
465 Ga0495630_0010114 3300046517 Bacteria 6798
466 Ga0495630_0019970 3300046517 Bacteria 4932
467 Ga0495630_0152532 3300046517 Bacteria 1758
468 Ga0495630_0381600 3300046517 Bacteria 1079
469 Ga0495631_0231514 3300046518 Unclassified 788
470 Ga0495644_0065218 3300046523 Unclassified 1368
471 Ga0495644_0167230 3300046523 Bacteria 844
472 Ga0495644_0224358 3300046523 Bacteria 727
473 Ga0495663_0050927 3300046525 Bacteria 1281
474 Ga0495666_0000241 3300046526 Bacteria 23544
475 Ga0495642_0042319 3300046528 Bacteria 1855
476 Ga0495652_0232525 3300046529 Unclassified 1377
477 Ga0495665_0010937 3300046531 Bacteria 4909
478 Ga0495640_0025763 3300046533 Bacteria 4260
479 Ga0495640_0306419 3300046533 Bacteria 986
480 Ga0495586_0043684 3300046535 Unclassified 2413
481 Ga0495586_0147565 3300046535 Bacteria 1322
482 Ga0495587_0105949 3300046536 Bacteria 1617
483 Ga0495609_0103056 3300046538 Bacteria 1235
484 Ga0495609_0266545 3300046538 Bacteria 703
485 Ga0495667_0147133 3300046559 Bacteria 1517
486 Ga0495656_0044640 3300046615 Bacteria 1867
487 Ga0495634_0018826 3300046642 Bacteria 4909
488 Ga0495634_0043400 3300046642 Bacteria 3047
489 Ga0495635_0079908 3300046663 Bacteria 2238
490 Ga0495635_0104638 3300046663 Bacteria 1934
491 Ga0495659_0010384 3300046664 Bacteria 2986
492 Ga0495659_0167563 3300046664 Bacteria 890
493 Ga0495588_0165576 3300046674 Unclassified 1169
494 Ga0495646_0234457 3300046680 Bacteria 988
495 Ga0495646_0235377 3300046680 Unclassified 986
496 Ga0495647_0006034 3300046681 Bacteria 3995
497 Ga0495658_0004561 3300046683 Bacteria 6811
498 Ga0495658_0022429 3300046683 Bacteria 3338
499 Ga0495613_0013632 3300046689 Bacteria 6033
500 Ga0495613_0099346 3300046689 Bacteria 2102
501 Ga0495624_0036174 3300046690 Bacteria 3185
502 Ga0495624_0069073 3300046690 Bacteria 2201
503 Ga0495670_0306154 3300046691 Bacteria 852
504 Ga0495600_0317979 3300046809 Bacteria 979
505 Ga0495660_0215717 3300046810 Bacteria 908
506 Ga0495581_0001944 3300047315 Bacteria 11591
507 Ga0495581_0030959 3300047315 Bacteria 3100
508 Ga0495581_0048263 3300047315 Bacteria 2459
509 Ga0495604_0041991 3300047317 Bacteria 3586
510 Ga0495674_0164091 3300047319 Bacteria 1857
511 Ga0495674_0506988 3300047319 Bacteria 964
512 Ga0495676_0098914 3300047321 Bacteria 2163
513 Ga0495680_0043183 3300047322 Bacteria 3571
514 Ga0495679_019402 3300047446 Bacteria 2390
515 Ga0495684_0020942 3300047471 Bacteria 5037
516 Ga0495684_0186510 3300047471 Unclassified 1535
517 Ga0495593_0027502 3300047673 Bacteria 3130
518 Ga0495593_0129059 3300047673 Unclassified 1284
519 Ga0495614_0000470 3300048089 Bacteria 16618
520 Ga0496100_0003156 3300048903 Bacteria 8544
521 Ga0496100_0058255 3300048903 Bacteria 2534
522 Ga0496100_0065838 3300048903 Bacteria 2402
523 Ga0496100_0189554 3300048903 Bacteria 1492
524 Ga0496100_0546848 3300048903 Unclassified 895
525 Ga0496101_0000373 3300048904 Bacteria 29768
526 Ga0496101_0057970 3300048904 Bacteria 2803
527 Ga0496101_0069284 3300048904 Bacteria 2580
528 Ga0496101_0108364 3300048904 Bacteria 2088
529 Ga0496101_0142186 3300048904 Bacteria 1830
530 Ga0496101_0185702 3300048904 Bacteria 1603
531 Ga0496101_0241279 3300048904 Bacteria 1406
532 Ga0496102_0008612 3300048905 Bacteria 8753
533 Ga0496102_0008634 3300048905 Bacteria 8743
534 Ga0496102_0018765 3300048905 Bacteria 6083
535 Ga0496102_0030836 3300048905 Bacteria 4802
536 Ga0496102_0048853 3300048905 Bacteria 3848
537 Ga0496102_0069435 3300048905 Bacteria 3234
538 Ga0496102_0208540 3300048905 Bacteria 1842
539 Ga0496102_0295723 3300048905 Bacteria 1526
540 Ga0496102_0302374 3300048905 Unclassified 1508
541 Ga0496102_0442618 3300048905 Bacteria 1219
542 Ga0496103_0044971 3300048906 Bacteria 2723
543 Ga0496103_0083644 3300048906 Bacteria 2009
544 Ga0496103_0117066 3300048906 Bacteria 1696
545 Ga0496103_0117856 3300048906 Bacteria 1690
546 Ga0496103_0119076 3300048906 Bacteria 1681
547 Ga0496103_0628725 3300048906 Bacteria 683
548 Ga0496104_0000614 3300048907 Bacteria 30540
549 Ga0496104_0007912 3300048907 Bacteria 9426
550 Ga0496104_0127770 3300048907 Bacteria 2441
551 Ga0496104_0567819 3300048907 Bacteria 1045
552 Ga0496104_0919719 3300048907 Unclassified 779
553 Ga0496105_0000176 3300048908 Bacteria 42647
554 Ga0496105_0001904 3300048908 Bacteria 14980
555 Ga0496105_0025432 3300048908 Bacteria 4818
556 Ga0496105_0233590 3300048908 Bacteria 1494
557 Ga0496105_0323214 3300048908 Bacteria 1236
558 Ga0496106_0008508 3300048909 Bacteria 7588
559 Ga0496106_0047816 3300048909 Bacteria 3220
560 Ga0496106_0061432 3300048909 Bacteria 2850
561 Ga0496106_0082021 3300048909 Bacteria 2478
562 Ga0496106_0180168 3300048909 Bacteria 1677
563 Ga0496106_0480689 3300048909 Bacteria 998
564 Ga0496107_0002190 3300048910 Bacteria 12556
565 Ga0496107_0002871 3300048910 Bacteria 11384
566 Ga0496107_0055262 3300048910 Bacteria 2867
567 Ga0496107_0057219 3300048910 Bacteria 2819
568 Ga0496107_0120076 3300048910 Bacteria 1936
569 Ga0496107_0253813 3300048910 Unclassified 1308
570 Ga0496107_0273088 3300048910 Unclassified 1258
571 Ga0496107_0276990 3300048910 Bacteria 1249
572 Ga0496107_0598941 3300048910 Bacteria 815
573 Ga0496108_0028724 3300048911 Bacteria 4602
574 Ga0496108_0033158 3300048911 Bacteria 4290
575 Ga0496108_0136807 3300048911 Bacteria 2108
576 Ga0496108_0160206 3300048911 Bacteria 1944
577 Ga0496108_0221305 3300048911 Bacteria 1645
578 Ga0496108_0365775 3300048911 Bacteria 1259
579 Ga0496108_1105944 3300048911 Unclassified 673
580 Ga0496109_0000514 3300048912 Bacteria 32883
581 Ga0496109_0010239 3300048912 Bacteria 8009
582 Ga0496109_0028777 3300048912 Bacteria 4973
583 Ga0496109_0400848 3300048912 Unclassified 1296
584 Ga0496109_0530763 3300048912 Bacteria 1110
585 Ga0496110_0000265 3300048913 Bacteria 33861
586 Ga0496110_0015917 3300048913 Bacteria 6272
587 Ga0496110_0180800 3300048913 Bacteria 1915
588 Ga0496111_0000146 3300048914 Bacteria 31767
589 Ga0496111_0003236 3300048914 Bacteria 10048
590 Ga0496111_0005208 3300048914 Bacteria 8293
591 Ga0496111_0080326 3300048914 Bacteria 2379
592 Ga0496111_0134644 3300048914 Bacteria 1830
593 Ga0496111_0317828 3300048914 Bacteria 1153
594 Ga0496112_0001508 3300048915 Bacteria 17922
595 Ga0496112_0007627 3300048915 Bacteria 9620
596 Ga0496112_0136671 3300048915 Bacteria 2421
597 Ga0496112_0483549 3300048915 Bacteria 1174
598 Ga0496113_0011770 3300048916 Bacteria 5858
599 Ga0496113_0021064 3300048916 Bacteria 4595
600 Ga0496113_0029188 3300048916 Bacteria 3979
601 Ga0496114_0016718 3300048917 Bacteria 5916
602 Ga0496114_0029557 3300048917 Bacteria 4506
603 Ga0496114_0034098 3300048917 Bacteria 4197
604 Ga0496114_0046420 3300048917 Bacteria 3609
605 Ga0496114_0047029 3300048917 Bacteria 3587
606 Ga0496114_0059638 3300048917 Bacteria 3188
607 Ga0496114_0153084 3300048917 Unclassified 2001
608 Ga0496114_0257688 3300048917 Bacteria 1535
609 Ga0496115_0001644 3300048918 Bacteria 16074
610 Ga0496115_0036825 3300048918 Bacteria 3875
611 Ga0496115_0042180 3300048918 Bacteria 3634
612 Ga0496115_0067053 3300048918 Bacteria 2901
613 Ga0496115_0095615 3300048918 Bacteria 2432
614 Ga0501309_022029 3300049129 Bacteria 899
615 Ga0501311_031044 3300049527 Unclassified 774
616 Ga0501031_0000164 3300049568 Bacteria 37777
617 Ga0501031_0007171 3300049568 Bacteria 7272
618 Ga0501031_0008759 3300049568 Bacteria 6581
619 Ga0501031_0024664 3300049568 Bacteria 3921
620 Ga0501031_0034811 3300049568 Bacteria 3286
621 Ga0501032_0019486 3300049569 Bacteria 4745
622 Ga0501032_0037263 3300049569 Bacteria 3316
623 Ga0501032_0043851 3300049569 Bacteria 3028
624 Ga0501032_0081222 3300049569 Bacteria 2157
625 Ga0501033_0000208 3300049570 Bacteria 56046
626 Ga0501033_0002483 3300049570 Bacteria 15636
627 Ga0501034_0019034 3300049571 Bacteria 7033
628 Ga0501036_0000085 3300049572 Bacteria 58421
629 Ga0501036_0048005 3300049572 Bacteria 3615
630 Ga0501036_0067248 3300049572 Bacteria 3031
631 Ga0501036_0086086 3300049572 Bacteria 2657
632 Ga0501036_0131466 3300049572 Unclassified 2113
633 Ga0501036_0290584 3300049572 Bacteria 1368
634 Ga0501037_0002242 3300049573 Bacteria 13976
635 Ga0501037_0007515 3300049573 Bacteria 7979
636 Ga0501038_0003370 3300049574 Bacteria 14906
637 Ga0501038_0008091 3300049574 Bacteria 9676
638 Ga0501038_0178259 3300049574 Unclassified 1716
639 Ga0501038_0413698 3300049574 Unclassified 1041
640 Ga0501039_0000171 3300049575 Bacteria 45473
641 Ga0501039_0002083 3300049575 Bacteria 14830
642 Ga0501039_0026300 3300049575 Bacteria 4472
643 Ga0501039_0081355 3300049575 Bacteria 2521
644 Ga0501039_0130423 3300049575 Bacteria 1973
645 Ga0501039_0432604 3300049575 Unclassified 1033
646 Ga0501040_0000094 3300049576 Bacteria 44554
647 Ga0501040_0010978 3300049576 Bacteria 5922
648 Ga0501040_0044593 3300049576 Bacteria 3023
649 Ga0501041_0000247 3300049577 Bacteria 25322
650 Ga0501041_0012725 3300049577 Bacteria 4985
651 Ga0501041_0024201 3300049577 Bacteria 3644
652 Ga0501041_0028393 3300049577 Bacteria 3375
653 Ga0501041_0046818 3300049577 Bacteria 2631
654 Ga0501041_0588838 3300049577 Bacteria 710
655 Ga0501042_0001242 3300049578 Bacteria 14860
656 Ga0501042_0002764 3300049578 Bacteria 10835
657 Ga0501042_0006168 3300049578 Bacteria 7773
658 Ga0501042_0019505 3300049578 Bacteria 4710
659 Ga0501042_0032936 3300049578 Bacteria 3672
660 Ga0501042_0169782 3300049578 Bacteria 1574
661 Ga0501043_0000295 3300049579 Bacteria 45082
662 Ga0501043_0000789 3300049579 Bacteria 28178
663 Ga0501043_0121173 3300049579 Bacteria 2051
664 Ga0501046_0000999 3300049580 Bacteria 27627
665 Ga0501046_0001480 3300049580 Bacteria 22508
666 Ga0501046_0012237 3300049580 Bacteria 7312
667 Ga0501046_0048039 3300049580 Bacteria 3381
668 Ga0501046_0065872 3300049580 Bacteria 2825
669 Ga0501047_0001721 3300049581 Bacteria 21277
670 Ga0501048_0000790 3300049582 Bacteria 23204
671 Ga0501048_0001465 3300049582 Bacteria 17896
672 Ga0501048_0002757 3300049582 Bacteria 13403
673 Ga0501048_0017835 3300049582 Bacteria 5223
674 Ga0501048_0052982 3300049582 Bacteria 2887
675 Ga0501048_0055638 3300049582 Bacteria 2808
676 Ga0501067_0009617 3300049583 Bacteria 5354
677 Ga0501067_0144709 3300049583 Bacteria 1324
678 Ga0501068_0000052 3300049584 Bacteria 45484
679 Ga0501068_0005073 3300049584 Bacteria 7178
680 Ga0501068_0183046 3300049584 Bacteria 1325
681 Ga0501069_0000210 3300049585 Bacteria 25997
682 Ga0501069_0006810 3300049585 Bacteria 5977
683 Ga0501069_0006904 3300049585 Bacteria 5933
684 Ga0501069_0280861 3300049585 Bacteria 974
685 Ga0501070_0006667 3300049586 Bacteria 9832
686 Ga0501070_0011352 3300049586 Bacteria 7527
687 Ga0501070_0155016 3300049586 Bacteria 1889
688 Ga0501071_0001124 3300049587 Bacteria 14927
689 Ga0501071_0014500 3300049587 Bacteria 5391
690 Ga0501071_0134121 3300049587 Unclassified 1841
691 Ga0501071_0257523 3300049587 Unclassified 1317
692 Ga0501071_0267115 3300049587 Bacteria 1293
693 Ga0501071_0779242 3300049587 Unclassified 737
694 Ga0501071_0854826 3300049587 Bacteria 702
695 Ga0501072_0011287 3300049588 Bacteria 6822
696 Ga0501072_0017332 3300049588 Bacteria 5534
697 Ga0501072_0022606 3300049588 Bacteria 4877
698 Ga0501072_0036935 3300049588 Bacteria 3831
699 Ga0501072_0096870 3300049588 Bacteria 2344
700 Ga0501072_0148242 3300049588 Bacteria 1871
701 Ga0501072_0191970 3300049588 Bacteria 1629
702 Ga0501073_0002697 3300049589 Bacteria 13294
703 Ga0501073_0344691 3300049589 Bacteria 1028
704 Ga0501074_0003275 3300049590 Bacteria 11449
705 Ga0501074_0007040 3300049590 Bacteria 8123
706 Ga0501074_0009193 3300049590 Bacteria 7179
707 Ga0501074_0063202 3300049590 Bacteria 2667
708 Ga0501075_0000109 3300049591 Bacteria 38985
709 Ga0501075_0011827 3300049591 Bacteria 6190
710 Ga0501075_0014313 3300049591 Bacteria 5684
711 Ga0501075_0172174 3300049591 Unclassified 1652
712 Ga0501075_0182995 3300049591 Unclassified 1599
713 Ga0501075_0328983 3300049591 Bacteria 1164
714 Ga0501075_0662744 3300049591 Bacteria 795
715 Ga0501076_0000554 3300049592 Bacteria 23855
716 Ga0501076_0004193 3300049592 Bacteria 10205
717 Ga0501076_0007063 3300049592 Bacteria 8160
718 Ga0501076_0035608 3300049592 Bacteria 3895
719 Ga0501076_0057153 3300049592 Bacteria 3097
720 Ga0501076_0133077 3300049592 Bacteria 2017
721 Ga0501076_0391266 3300049592 Unclassified 1143
722 Ga0501077_0000809 3300049593 Bacteria 18979
723 Ga0501077_0023355 3300049593 Bacteria 3921
724 Ga0501077_0080248 3300049593 Bacteria 2067
725 Ga0501077_0184854 3300049593 Bacteria 1324
726 Ga0501079_0000099 3300049741 Bacteria 43513
727 Ga0501079_0020669 3300049741 Bacteria 5032
728 Ga0501079_0063618 3300049741 Bacteria 2846
729 Ga0501079_0128000 3300049741 Bacteria 1975
730 Ga0501079_0169270 3300049741 Bacteria 1704
731 Ga0501079_0209805 3300049741 Unclassified 1521
732 Ga0501079_0661342 3300049741 Bacteria 822
733 Ga0501080_0000768 3300049742 Bacteria 26067
734 Ga0501080_0009951 3300049742 Bacteria 8689
735 Ga0501080_0520441 3300049742 Unclassified 1061
736 Ga0501081_0010244 3300049743 Bacteria 6120
737 Ga0501081_0013305 3300049743 Bacteria 5412
738 Ga0501081_0020877 3300049743 Bacteria 4370
739 Ga0501081_0033563 3300049743 Bacteria 3488
740 Ga0501081_0052676 3300049743 Bacteria 2809
741 Ga0501081_0176517 3300049743 Bacteria 1544
742 Ga0501081_0891244 3300049743 Unclassified 671
743 Ga0501083_0000227 3300049744 Bacteria 36195
744 Ga0501083_0000261 3300049744 Bacteria 33465
745 Ga0501035_0002978 3300049822 Bacteria 16287
746 Ga0501035_0005322 3300049822 Bacteria 12174
747 Ga0501035_0076680 3300049822 Bacteria 2956
748 Ga0501035_0130317 3300049822 Bacteria 2193
749 Ga0501044_0017382 3300049823 Bacteria 7715
750 Ga0501044_0199942 3300049823 Bacteria 1957
751 Ga0501044_0594352 3300049823 Unclassified 1000
752 Ga0501045_0008557 3300049824 Bacteria 7130
753 Ga0501045_0032119 3300049824 Bacteria 3803
754 Ga0501045_0077342 3300049824 Bacteria 2452
755 Ga0501045_0104007 3300049824 Bacteria 2103
756 Ga0501045_0108085 3300049824 Bacteria 2061
757 Ga0501045_0303380 3300049824 Bacteria 1188
758 Ga0501045_0309528 3300049824 Bacteria 1176
759 Ga0501045_0794731 3300049824 Unclassified 697
760 nmdc:mga00v17_59827_c1 3300050491 Bacteria 2339
761 nmdc:mga0yw44_119978_c1 3300050492 Bacteria 1693
762 nmdc:mga0k408_91658_c1 3300050493 Bacteria 1785
763 nmdc:mga05p37_27625_c1 3300050507 Bacteria 6911
764 nmdc:mga05p37_672774_c1 3300050507 Bacteria 1155
765 nmdc:mga05p37_826568_c1 3300050507 Bacteria 1010
766 nmdc:mga09592_1045066_c1 3300050508 Bacteria 681
767 nmdc:mga09592_160851_c1 3300050508 Bacteria 1940
768 nmdc:mga0qj67_48226_c1 3300050509 Bacteria 3365
769 nmdc:mga08y16_187773_c1 3300050511 Bacteria 2144
770 nmdc:mga08y16_72441_c1 3300050511 Bacteria 3591
771 nmdc:mga0n895_243336_c1 3300050512 Bacteria 1826
772 nmdc:mga0n895_328592_c1 3300050512 Archaea 1549
773 nmdc:mga0n895_399836_c1 3300050512 Bacteria 1389
774 nmdc:mga0n895_840435_c1 3300050512 Unclassified 906
775 nmdc:mga0n895_88124_c1 3300050512 Bacteria 3103
776 nmdc:mga0n895_941228_c1 3300050512 Bacteria 848
777 nmdc:mga0rr50_327024_c1 3300050513 Bacteria 1286
778 nmdc:mga0rr50_752409_c1 3300050513 Bacteria 832
779 nmdc:mga08x19_659280_c1 3300050514 Unclassified 742
780 nmdc:mga0a205_299899_c1 3300050515 Bacteria 1480
781 Ga0495601_0015474 3300053077 Bacteria 4609
782 Ga0495601_0109234 3300053077 Bacteria 1790
783 Ga0495601_0573022 3300053077 Bacteria 725
784 Ga0495612_0011200 3300053078 Bacteria 3620
785 Ga0495655_0051595 3300053083 Bacteria 1091
786 Ga0495595_0004031 3300053084 Bacteria 5877
787 Ga0500566_0027221 3300053094 Bacteria 3346
788 Ga0501084_0001093 3300054114 Bacteria 21105
789 Ga0501084_0011779 3300054114 Bacteria 7240
790 Ga0501084_0012517 3300054114 Bacteria 7026
791 Ga0501084_0045249 3300054114 Bacteria 3685
792 Ga0501084_0060876 3300054114 Bacteria 3161
793 Ga0501084_0070049 3300054114 Bacteria 2936
794 Ga0501084_0277174 3300054114 Bacteria 1416
795 Ga0590077_075824 3300059426 Archaea 771
796 Ga0587073_0027293 3300059492 Bacteria 1151
797 Ga0501082_0000563 3300060353 Bacteria 32925
798 Ga0501082_0026919 3300060353 Bacteria 4955
799 Ga0501082_0036310 3300060353 Bacteria 4245
800 Ga0501082_0040068 3300060353 Bacteria 4041
801 Ga0501082_0068895 3300060353 Bacteria 3046
802 Ga0501082_0076693 3300060353 Bacteria 2881
803 Ga0501082_0276131 3300060353 Bacteria 1463
804 Ga0466962_0003286 3300061719 Bacteria 7680
805 Ga0466962_0004357 3300061719 Bacteria 6787
806 Ga0466962_0008091 3300061719 Bacteria 5041
807 Ga0466962_0107600 3300061719 Bacteria 1341
808 Ga0466962_0178715 3300061719 Bacteria 1034
809 Ga0530510_0001992 3300061734 Bacteria 14003
810 Ga0530510_0004150 3300061734 Bacteria 10001
811 Ga0530510_0392125 3300061734 Bacteria 1046
812 Ga0530510_0402812 3300061734 Bacteria 1031
813 Ga0530510_0700080 3300061734 Unclassified 772
814 Ga0466962_0100638
815 Ga0070658_10048475
816 Ga0070658_10163814
817 Ga0070676_10293742
818 Ga0070683_100009898
819 Ga0070683_100017148
820 Ga0070683_100591634
821 Ga0070680_100013850
822 Ga0070680_100015369
823 Ga0070680_100512736
824 Ga0070682_100181559
825 Ga0068868_100453446
826 Ga0070660_100003547
827 Ga0070660_100057819
828 Ga0070660_100308239
829 Ga0070691_10353023
830 Ga0070661_100018395
831 Ga0070692_10143624
832 Ga0070669_100577997
833 Ga0070675_100349037
834 Ga0070671_100083566
835 Ga0070674_100268799
836 Ga0070674_100436076
837 Ga0070674_100500709
838 Ga0070674_100918299
839 Ga0070673_100327387
840 Ga0070688_100440589
841 Ga0070659_101196149
842 Ga0070709_10034207
843 Ga0070714_100022116
844 Ga0070714_100133574
845 Ga0070714_100821152
846 Ga0070714_101037263
847 Ga0070713_100017782
848 Ga0070713_100075810
849 Ga0070713_100209377
850 Ga0070713_101020081
851 Ga0070710_10036401
852 Ga0070710_10045878
853 Ga0070710_10148554
854 Ga0070711_100076689
855 Ga0070711_100232682
856 Ga0070705_100274395
857 Ga0070700_100039513
858 Ga0070700_100379139
859 Ga0070694_100231589
860 Ga0070678_100262606
861 Ga0070678_100669297
862 Ga0070681_10024831
863 Ga0070681_10068898
864 Ga0070681_10208689
865 Ga0070681_10217146
866 Ga0070681_10278532
867 Ga0068867_100502034
868 Ga0068867_100637546
869 Ga0070698_100006851
870 Ga0070699_100552965
871 Ga0070679_100047736
872 Ga0070679_100062622
873 Ga0070679_100065001
874 Ga0070679_100067929
875 Ga0070679_100226034
876 Ga0070679_100250880
877 Ga0070679_100515486
878 Ga0070679_100564451
879 Ga0070684_100057735
880 Ga0070684_100105667
881 Ga0070684_100340102
882 Ga0068853_100178017
883 Ga0070686_100212391
884 Ga0070695_100000363
885 Ga0070695_100196744
886 Ga0070693_100021474
887 Ga0070693_100023834
888 Ga0070665_100016660
889 Ga0070704_100168968
890 Ga0068855_100047632
891 Ga0068855_100195121
892 Ga0068855_100532543
893 Ga0068855_100679051
894 Ga0070664_100780376
895 Ga0068854_100090519
896 Ga0068856_100022903
897 Ga0068856_100316926
898 Ga0068852_100003792
899 Ga0068852_100181461
900 Ga0068852_101090172
901 Ga0068852_101437806
902 Ga0068866_10410789
903 Ga0068861_100071059
904 Ga0068851_10140072
905 Ga0068863_101183346
906 Ga0068862_100351162
907 Ga0081455_10053251
908 Ga0081455_10089780
909 Ga0081455_10099186
910 Ga0081538_10002117
911 Ga0081539_10000781
912 Ga0070717_10009169
913 Ga0075364_10131550
914 Ga0070715_10010483
915 Ga0070715_10039362
916 Ga0070716_100016356
917 Ga0070716_100034338
918 Ga0070712_100018844
919 Ga0070712_100076773
920 Ga0070712_100106221
921 Ga0070712_100127803
922 Ga0070712_100182671
923 Ga0070712_100560644
924 Ga0075362_10024646
925 Ga0075366_10075782
926 Ga0097621_100444910
927 Ga0097621_100602040
928 Ga0075428_100099811
929 Ga0075430_100050445
930 Ga0075431_100165737
931 Ga0075431_100221813
932 Ga0075433_10208699
933 Ga0075433_10390743
934 Ga0075433_10458814
935 Ga0075434_100016720
936 Ga0075434_100104006
937 Ga0075434_101024992
938 Ga0075429_100306874
939 Ga0068865_100087649
940 Ga0068865_100365557
941 Ga0068865_100574582
942 Ga0075436_100206274
943 Ga0075435_100058951
944 Ga0099795_10102231
945 Ga0105251_10293718
946 Ga0105240_10162039
947 Ga0111539_10078401
948 Ga0111539_10096130
949 Ga0111539_11516519
950 Ga0105245_10057981
951 Ga0105245_10151345
952 Ga0105245_10281352
953 Ga0105245_10338716
954 Ga0105245_10983485
955 Ga0114129_10904995
956 Ga0105243_10101793
957 Ga0105241_10411291
958 Ga0105242_10057932
959 Ga0105242_10380666
960 Ga0105242_10652556
961 Ga0105242_10731576
962 Ga0105248_10537006
963 Ga0105237_10009640
964 Ga0105237_10026472
965 Ga0105238_10063652
966 Ga0105238_10319259
967 Ga0105249_10002935
968 Ga0105239_10114018
969 Ga0105239_10128853
970 Ga0105239_10194731
971 Ga0105239_10269718
972 Ga0105239_10286929
973 Ga0105239_10598748
974 Ga0105246_10503044
975 Ga0157329_1006789
976 Ga0157373_10417961
977 Ga0157370_10001705
978 Ga0157370_10008120
979 Ga0157370_10015648
980 Ga0157370_10186282
981 Ga0157369_10009399
982 Ga0157369_10026009
983 Ga0157374_10389473
984 Ga0157374_10471152
985 Ga0163162_10075411
986 Ga0157372_10011307
987 Ga0157372_10023472
988 Ga0157372_10133199
989 Ga0157372_10617307
990 Ga0157375_10067823
991 Ga0157375_10293934
992 Ga0157375_10807372
993 Ga0163163_10569083
994 Ga0157377_10210664
995 Ga0157376_10086587
996 Ga0157376_10163407
997 Ga0206356_10034121
998 Ga0206356_10058303
999 Ga0206350_10083145
1000 Ga0206353_10956052
1001 Ga0206353_11078391
1002 Ga0224712_10012062
1003 Ga0207692_10041656
1004 Ga0207692_10054357
1005 Ga0207688_10169873
1006 Ga0207647_10134586
1007 Ga0207685_10059778
1008 Ga0207685_10068682
1009 Ga0207699_10255944
1010 Ga0207699_10437739
1011 Ga0207643_10237186
1012 Ga0207643_10268999
1013 Ga0207705_10137448
1014 Ga0207705_10148324
1015 Ga0207705_10366061
1016 Ga0207654_10072191
1017 Ga0207707_10021670
1018 Ga0207707_10062364
1019 Ga0207707_10099891
1020 Ga0207707_10121815
1021 Ga0207707_10150991
1022 Ga0207707_10283943
1023 Ga0207695_10040677
1024 Ga0207695_10210848
1025 Ga0207671_10032718
1026 Ga0207693_10003543
1027 Ga0207693_10011364
1028 Ga0207693_10031619
1029 Ga0207693_10036998
1030 Ga0207693_10039554
1031 Ga0207663_10033908
1032 Ga0207663_10047509
1033 Ga0207663_10275827
1034 Ga0207660_10032860
1035 Ga0207660_10095422
1036 Ga0207657_10001511
1037 Ga0207657_10020508
1038 Ga0207657_10272334
1039 Ga0207649_10062282
1040 Ga0207649_10195641
1041 Ga0207652_10034097
1042 Ga0207652_10038093
1043 Ga0207652_10102921
1044 Ga0207652_10140599
1045 Ga0207652_10273481
1046 Ga0207652_10452364
1047 Ga0207652_10485003
1048 Ga0207646_10332074
1049 Ga0207646_10378622
1050 Ga0207694_10187658
1051 Ga0207694_10378657
1052 Ga0207687_10046423
1053 Ga0207687_10148534
1054 Ga0207687_10342806
1055 Ga0207700_10024422
1056 Ga0207700_10040403
1057 Ga0207700_10061048
1058 Ga0207664_10005471
1059 Ga0207664_10032566
1060 Ga0207664_10087989
1061 Ga0207664_10195969
1062 Ga0207664_10209670
1063 Ga0207690_10667489
1064 Ga0207706_10463006
1065 Ga0207706_10512782
1066 Ga0207706_10592440
1067 Ga0207686_10105367
1068 Ga0207686_10396706
1069 Ga0207709_10143623
1070 Ga0207669_10221676
1071 Ga0207669_10250769
1072 Ga0207704_10103487
1073 Ga0207665_10000359
1074 Ga0207665_10001883
1075 Ga0207665_10310193
1076 Ga0207691_10401178
1077 Ga0207661_10073918
1078 Ga0207661_10796829
1079 Ga0207679_10102966
1080 Ga0207667_10062838
1081 Ga0207651_10290833
1082 Ga0207712_10017910
1083 Ga0207712_10100461
1084 Ga0207668_10868174
1085 Ga0207640_10817762
1086 Ga0207677_10547335
1087 Ga0207639_10529262
1088 Ga0207678_10106537
1089 Ga0207678_10426770
1090 Ga0207708_10126477
1091 Ga0207708_10317600
1092 Ga0207702_10003896
1093 Ga0207702_10075803
1094 Ga0207702_10122702
1095 Ga0207702_10284510
1096 Ga0207702_10625339
1097 Ga0207702_10794676
1098 Ga0207641_11167613
1099 Ga0207648_10145206
1100 Ga0207648_10588185
1101 Ga0207648_10719010
1102 Ga0207674_10170355
1103 Ga0207674_10566676
1104 Ga0207675_100118906
1105 Ga0207683_10007746
1106 Ga0207683_10166140
1107 Ga0207683_10462649
1108 Ga0207698_10147023
1109 Ga0207698_10194711
1110 Ga0207428_10011860
1111 Ga0268265_10198622
1112 Ga0268265_11018512
1113 Ga0268264_11781041
1114 Ga0373938_0033234
1115 Ga0373944_0076833
1116 Ga0373951_0033451
1117 Ga0373952_0037827
1118 Ga0373932_0021335
1119 Ga0373939_0155496
1120 Ga0373941_0007480
1121 Ga0373960_0067874
1122 Ga0373960_0110143
1123 Ga0373943_0003569
1124 Ga0373943_0221950
1125 Ga0373962_0040834
1126 Ga0373931_0006757
1127 Ga0373935_0113294
1128 Ga0373927_0115826
1129 Ga0373947_0012653
1130 Ga0395899_0001311
1131 Ga0395899_0056346
1132 Ga0395899_0066297
1133 Ga0395899_0102813
1134 Ga0395899_0547909
1135 Ga0395900_0006188
1136 Ga0395900_0037226
1137 Ga0395900_0067370
1138 Ga0395900_0246413
1139 Ga0395900_0426791
1140 Ga0395900_0808528
1141 Ga0395898_0001816
1142 Ga0395898_0097135
1143 Ga0395898_0099134
1144 Ga0395898_0204657
1145 Ga0395898_0238746
1146 Ga0395905_0006417
1147 Ga0395905_0012858
1148 Ga0395905_0042952
1149 Ga0395905_0077452
1150 Ga0395905_0122502
1151 Ga0395905_0301281
1152 Ga0395901_0005317
1153 Ga0395901_0032040
1154 Ga0395901_0093910
1155 Ga0395901_0115032
1156 Ga0395901_0170985
1157 Ga0395901_0219500
1158 Ga0451853_1793536
1159 Ga0439448_0085139
1160 Ga0450920_051450
1161 Ga0466969_0003305
1162 Ga0466965_0047774
1163 Ga0466965_0098566
1164 Ga0466965_0113758
1165 Ga0466965_0262129
1166 Ga0466966_0022666
1167 Ga0466966_0025100
1168 Ga0466966_0027186
1169 Ga0466966_0046263
1170 Ga0466961_0026155
1171 Ga0466961_0033488
1172 Ga0466961_0154780
1173 Ga0466961_0222572
1174 Ga0466963_0000048
1175 Ga0466963_0003893
1176 Ga0466963_0004401
1177 Ga0466963_0007353
1178 Ga0466963_0007773
1179 Ga0466963_0010199
1180 Ga0466963_0011451
1181 Ga0466963_0013074
1182 Ga0466963_0034913
1183 Ga0466963_0038042
1184 Ga0466963_0118128
1185 Ga0466963_0122278
1186 Ga0466963_0809891
1187 Ga0466964_0002291
1188 Ga0466964_0002374
1189 Ga0466964_0004438
1190 Ga0466964_0011534
1191 Ga0466964_0043150
1192 Ga0466964_0057857
1193 Ga0466964_0144996
1194 Ga0466964_0180760
1195 Ga0466964_0534671
1196 Ga0466971_0000420
1197 Ga0466971_0000987
1198 Ga0466971_0004618
1199 Ga0466971_0023590
1200 Ga0466971_0026285
1201 Ga0466971_0147570
1202 Ga0466968_0044321
1203 Ga0466968_0051349
1204 Ga0466968_0075118
1205 Ga0466968_0132393
1206 Ga0466970_0001835
1207 Ga0466970_0069412
1208 Ga0466957_0002892
1209 Ga0466957_0009643
1210 Ga0466957_0090484
1211 Ga0466957_0140302
1212 Ga0466957_0298169
1213 Ga0466960_0003851
1214 Ga0466960_0022955
1215 Ga0466960_0095301
1216 Ga0466960_0238636
1217 Ga0466959_0002014
1218 Ga0466959_0002279
1219 Ga0466959_0015181
1220 Ga0466959_0015407
1221 Ga0466959_0023127
1222 Ga0466959_0024046
1223 Ga0466959_0050640
1224 Ga0466959_0118991
1225 Ga0466959_0245309
1226 Ga0466958_0009833
1227 Ga0466958_0016767
1228 Ga0466958_0028044
1229 Ga0466958_0085685
1230 Ga0466958_0087071
1231 Ga0466958_0099443
1232 Ga0466958_0109034
1233 Ga0466958_0477580
1234 Ga0466967_0018656
1235 Ga0466967_0019838
1236 Ga0466967_0022926
1237 Ga0466967_0032684
1238 Ga0466967_0034545
1239 Ga0466967_0055845
1240 Ga0466967_0061085
1241 Ga0466967_0075743
1242 Ga0466967_0075869
1243 Ga0466967_0083634
1244 Ga0466967_0118681
1245 Ga0466967_0141109
1246 Ga0466967_0181155
1247 Ga0466967_0211837
1248 Ga0466967_0252400
1249 Ga0466967_0272368
1250 Ga0466967_0324045
1251 Ga0466967_0371290
1252 Ga0466967_0430359
1253 Ga0495592_0180357
1254 Ga0495603_0015652
1255 Ga0495641_0066150
1256 Ga0495641_0104546
1257 Ga0495651_0099831
1258 Ga0495653_0326809
1259 Ga0495580_0129610
1260 Ga0495582_0011730
1261 Ga0495582_0094475
1262 Ga0495605_0040354
1263 Ga0495605_0140730
1264 Ga0495605_0180376
1265 Ga0495639_0002174
1266 Ga0495662_0000943
1267 Ga0495664_0003309
1268 Ga0495664_0425431
1269 Ga0495584_0224055
1270 Ga0495594_0294935
1271 Ga0495607_0036609
1272 Ga0495607_0162876
1273 Ga0495607_0262866
1274 Ga0495608_0075512
1275 Ga0495618_0008098
1276 Ga0495618_0210333
1277 Ga0495628_0517935
1278 Ga0495630_0010114
1279 Ga0495630_0019970
1280 Ga0495630_0152532
1281 Ga0495630_0381600
1282 Ga0495631_0231514
1283 Ga0495644_0065218
1284 Ga0495644_0167230
1285 Ga0495644_0224358
1286 Ga0495663_0050927
1287 Ga0495666_0000241
1288 Ga0495642_0042319
1289 Ga0495652_0232525
1290 Ga0495665_0010937
1291 Ga0495640_0025763
1292 Ga0495640_0306419
1293 Ga0495586_0043684
1294 Ga0495586_0147565
1295 Ga0495587_0105949
1296 Ga0495609_0103056
1297 Ga0495609_0266545
1298 Ga0495667_0147133
1299 Ga0495656_0044640
1300 Ga0495634_0018826
1301 Ga0495634_0043400
1302 Ga0495635_0079908
1303 Ga0495635_0104638
1304 Ga0495659_0010384
1305 Ga0495659_0167563
1306 Ga0495588_0165576
1307 Ga0495646_0234457
1308 Ga0495646_0235377
1309 Ga0495647_0006034
1310 Ga0495658_0004561
1311 Ga0495658_0022429
1312 Ga0495613_0013632
1313 Ga0495613_0099346
1314 Ga0495624_0036174
1315 Ga0495624_0069073
1316 Ga0495670_0306154
1317 Ga0495600_0317979
1318 Ga0495660_0215717
1319 Ga0495581_0001944
1320 Ga0495581_0030959
1321 Ga0495581_0048263
1322 Ga0495604_0041991
1323 Ga0495674_0164091
1324 Ga0495674_0506988
1325 Ga0495676_0098914
1326 Ga0495680_0043183
1327 Ga0495679_019402
1328 Ga0495684_0020942
1329 Ga0495684_0186510
1330 Ga0495593_0027502
1331 Ga0495593_0129059
1332 Ga0495614_0000470
1333 Ga0496100_0003156
1334 Ga0496100_0058255
1335 Ga0496100_0065838
1336 Ga0496100_0189554
1337 Ga0496100_0546848
1338 Ga0496101_0000373
1339 Ga0496101_0057970
1340 Ga0496101_0069284
1341 Ga0496101_0108364
1342 Ga0496101_0142186
1343 Ga0496101_0185702
1344 Ga0496101_0241279
1345 Ga0496102_0008612
1346 Ga0496102_0008634
1347 Ga0496102_0018765
1348 Ga0496102_0030836
1349 Ga0496102_0048853
1350 Ga0496102_0069435
1351 Ga0496102_0208540
1352 Ga0496102_0295723
1353 Ga0496102_0302374
1354 Ga0496102_0442618
1355 Ga0496103_0044971
1356 Ga0496103_0083644
1357 Ga0496103_0117066
1358 Ga0496103_0117856
1359 Ga0496103_0119076
1360 Ga0496103_0628725
1361 Ga0496104_0000614
1362 Ga0496104_0007912
1363 Ga0496104_0127770
1364 Ga0496104_0567819
1365 Ga0496104_0919719
1366 Ga0496105_0000176
1367 Ga0496105_0001904
1368 Ga0496105_0025432
1369 Ga0496105_0233590
1370 Ga0496105_0323214
1371 Ga0496106_0008508
1372 Ga0496106_0047816
1373 Ga0496106_0061432
1374 Ga0496106_0082021
1375 Ga0496106_0180168
1376 Ga0496106_0480689
1377 Ga0496107_0002190
1378 Ga0496107_0002871
1379 Ga0496107_0055262
1380 Ga0496107_0057219
1381 Ga0496107_0120076
1382 Ga0496107_0253813
1383 Ga0496107_0273088
1384 Ga0496107_0276990
1385 Ga0496107_0598941
1386 Ga0496108_0028724
1387 Ga0496108_0033158
1388 Ga0496108_0136807
1389 Ga0496108_0160206
1390 Ga0496108_0221305
1391 Ga0496108_0365775
1392 Ga0496108_1105944
1393 Ga0496109_0000514
1394 Ga0496109_0010239
1395 Ga0496109_0028777
1396 Ga0496109_0400848
1397 Ga0496109_0530763
1398 Ga0496110_0000265
1399 Ga0496110_0015917
1400 Ga0496110_0180800
1401 Ga0496111_0000146
1402 Ga0496111_0003236
1403 Ga0496111_0005208
1404 Ga0496111_0080326
1405 Ga0496111_0134644
1406 Ga0496111_0317828
1407 Ga0496112_0001508
1408 Ga0496112_0007627
1409 Ga0496112_0136671
1410 Ga0496112_0483549
1411 Ga0496113_0011770
1412 Ga0496113_0021064
1413 Ga0496113_0029188
1414 Ga0496114_0016718
1415 Ga0496114_0029557
1416 Ga0496114_0034098
1417 Ga0496114_0046420
1418 Ga0496114_0047029
1419 Ga0496114_0059638
1420 Ga0496114_0153084
1421 Ga0496114_0257688
1422 Ga0496115_0001644
1423 Ga0496115_0036825
1424 Ga0496115_0042180
1425 Ga0496115_0067053
1426 Ga0496115_0095615
1427 Ga0501309_022029
1428 Ga0501311_031044
1429 Ga0501031_0000164
1430 Ga0501031_0007171
1431 Ga0501031_0008759
1432 Ga0501031_0024664
1433 Ga0501031_0034811
1434 Ga0501032_0019486
1435 Ga0501032_0037263
1436 Ga0501032_0043851
1437 Ga0501032_0081222
1438 Ga0501033_0000208
1439 Ga0501033_0002483
1440 Ga0501034_0019034
1441 Ga0501036_0000085
1442 Ga0501036_0048005
1443 Ga0501036_0067248
1444 Ga0501036_0086086
1445 Ga0501036_0131466
1446 Ga0501036_0290584
1447 Ga0501037_0002242
1448 Ga0501037_0007515
1449 Ga0501038_0003370
1450 Ga0501038_0008091
1451 Ga0501038_0178259
1452 Ga0501038_0413698
1453 Ga0501039_0000171
1454 Ga0501039_0002083
1455 Ga0501039_0026300
1456 Ga0501039_0081355
1457 Ga0501039_0130423
1458 Ga0501039_0432604
1459 Ga0501040_0000094
1460 Ga0501040_0010978
1461 Ga0501040_0044593
1462 Ga0501041_0000247
1463 Ga0501041_0012725
1464 Ga0501041_0024201
1465 Ga0501041_0028393
1466 Ga0501041_0046818
1467 Ga0501041_0588838
1468 Ga0501042_0001242
1469 Ga0501042_0002764
1470 Ga0501042_0006168
1471 Ga0501042_0019505
1472 Ga0501042_0032936
1473 Ga0501042_0169782
1474 Ga0501043_0000295
1475 Ga0501043_0000789
1476 Ga0501043_0121173
1477 Ga0501046_0000999
1478 Ga0501046_0001480
1479 Ga0501046_0012237
1480 Ga0501046_0048039
1481 Ga0501046_0065872
1482 Ga0501047_0001721
1483 Ga0501048_0000790
1484 Ga0501048_0001465
1485 Ga0501048_0002757
1486 Ga0501048_0017835
1487 Ga0501048_0052982
1488 Ga0501048_0055638
1489 Ga0501067_0009617
1490 Ga0501067_0144709
1491 Ga0501068_0000052
1492 Ga0501068_0005073
1493 Ga0501068_0183046
1494 Ga0501069_0000210
1495 Ga0501069_0006810
1496 Ga0501069_0006904
1497 Ga0501069_0280861
1498 Ga0501070_0006667
1499 Ga0501070_0011352
1500 Ga0501070_0155016
1501 Ga0501071_0001124
1502 Ga0501071_0014500
1503 Ga0501071_0134121
1504 Ga0501071_0257523
1505 Ga0501071_0267115
1506 Ga0501071_0779242
1507 Ga0501071_0854826
1508 Ga0501072_0011287
1509 Ga0501072_0017332
1510 Ga0501072_0022606
1511 Ga0501072_0036935
1512 Ga0501072_0096870
1513 Ga0501072_0148242
1514 Ga0501072_0191970
1515 Ga0501073_0002697
1516 Ga0501073_0344691
1517 Ga0501074_0003275
1518 Ga0501074_0007040
1519 Ga0501074_0009193
1520 Ga0501074_0063202
1521 Ga0501075_0000109
1522 Ga0501075_0011827
1523 Ga0501075_0014313
1524 Ga0501075_0172174
1525 Ga0501075_0182995
1526 Ga0501075_0328983
1527 Ga0501075_0662744
1528 Ga0501076_0000554
1529 Ga0501076_0004193
1530 Ga0501076_0007063
1531 Ga0501076_0035608
1532 Ga0501076_0057153
1533 Ga0501076_0133077
1534 Ga0501076_0391266
1535 Ga0501077_0000809
1536 Ga0501077_0023355
1537 Ga0501077_0080248
1538 Ga0501077_0184854
1539 Ga0501079_0000099
1540 Ga0501079_0020669
1541 Ga0501079_0063618
1542 Ga0501079_0128000
1543 Ga0501079_0169270
1544 Ga0501079_0209805
1545 Ga0501079_0661342
1546 Ga0501080_0000768
1547 Ga0501080_0009951
1548 Ga0501080_0520441
1549 Ga0501081_0010244
1550 Ga0501081_0013305
1551 Ga0501081_0020877
1552 Ga0501081_0033563
1553 Ga0501081_0052676
1554 Ga0501081_0176517
1555 Ga0501081_0891244
1556 Ga0501083_0000227
1557 Ga0501083_0000261
1558 Ga0501035_0002978
1559 Ga0501035_0005322
1560 Ga0501035_0076680
1561 Ga0501035_0130317
1562 Ga0501044_0017382
1563 Ga0501044_0199942
1564 Ga0501044_0594352
1565 Ga0501045_0008557
1566 Ga0501045_0032119
1567 Ga0501045_0077342
1568 Ga0501045_0104007
1569 Ga0501045_0108085
1570 Ga0501045_0303380
1571 Ga0501045_0309528
1572 Ga0501045_0794731
1573 nmdc:mga00v17_59827_c1
1574 nmdc:mga0yw44_119978_c1
1575 nmdc:mga0k408_91658_c1
1576 nmdc:mga05p37_27625_c1
1577 nmdc:mga05p37_672774_c1
1578 nmdc:mga05p37_826568_c1
1579 nmdc:mga09592_1045066_c1
1580 nmdc:mga09592_160851_c1
1581 nmdc:mga0qj67_48226_c1
1582 nmdc:mga08y16_187773_c1
1583 nmdc:mga08y16_72441_c1
1584 nmdc:mga0n895_243336_c1
1585 nmdc:mga0n895_328592_c1
1586 nmdc:mga0n895_399836_c1
1587 nmdc:mga0n895_840435_c1
1588 nmdc:mga0n895_88124_c1
1589 nmdc:mga0n895_941228_c1
1590 nmdc:mga0rr50_327024_c1
1591 nmdc:mga0rr50_752409_c1
1592 nmdc:mga08x19_659280_c1
1593 nmdc:mga0a205_299899_c1
1594 Ga0495601_0015474
1595 Ga0495601_0109234
1596 Ga0495601_0573022
1597 Ga0495612_0011200
1598 Ga0495655_0051595
1599 Ga0495595_0004031
1600 Ga0500566_0027221
1601 Ga0501084_0001093
1602 Ga0501084_0011779
1603 Ga0501084_0012517
1604 Ga0501084_0045249
1605 Ga0501084_0060876
1606 Ga0501084_0070049
1607 Ga0501084_0277174
1608 Ga0590077_075824
1609 Ga0587073_0027293
1610 Ga0501082_0000563
1611 Ga0501082_0026919
1612 Ga0501082_0036310
1613 Ga0501082_0040068
1614 Ga0501082_0068895
1615 Ga0501082_0076693
1616 Ga0501082_0276131
1617 Ga0466962_0003286
1618 Ga0466962_0004357
1619 Ga0466962_0008091
1620 Ga0466962_0107600
1621 Ga0466962_0178715
1622 Ga0530510_0001992
1623 Ga0530510_0004150
1624 Ga0530510_0392125
1625 Ga0530510_0402812
1626 Ga0530510_0700080

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

33

104

0.96

PF02311

AraC_binding

AraC-like ligand binding domain

37

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9551 28 106
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9485 28 106
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.9364 5 109
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.934 15 106
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9325 5 111
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9552 27 107 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 15 105 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9266 13 104 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.926 14 105 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9199 13 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7J9YU69-F1-model_v4 Cupin domain-containing protein 0.9973 1 181
AF-A0A6J4TIX3-F1-model_v4 Cupin type-2 domain-containing protein 0.994 2 181
AF-A0A1H0Y6C5-F1-model_v4 Cupin domain-containing protein 0.9875 1 178
AF-A0A536DMS4-F1-model_v4 Cupin domain-containing protein 0.9854 3 178
AF-A0A7K0A3J6-F1-model_v4 Cupin domain-containing protein 0.9852 1 178

Map