F481904
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 387 | 1624 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0003713|Ga0501031_0003713_2904_4115 |
| Length | 403 |
| Sequence | MNAVRVSAGARRKRTGSRPSSGAASPHEETNPVIIGVPKEIKPGEQRVALTPAGVHALAGHGHRVLIEPGAGAGSGFRDDDYTQLGAVLRSAGEVWGEADLVLKVKEPIASEYPRLRDTQVLFTYLHLAAVPELTRALQKSRTVALAYETVQRADGSLPLLTPMSEVAGRLSVQEGAYYLGKAHGGRGILLAGVPGVPPGNVMIIGAGTVGLNAAKIAVGLGADVSVLDVNVDRLRHVDDLFRGQVVTLVSNAFNVARLAPRVDLLVGAVLVAGARAPVLVPEATVKTMKEGSVIVDVAVDQGGCVETMHPTTLAEPIYRVHGVVHYGVANMPALVPRTSTFALTNATLPYVLELAGKGVIPALRANPALAMGLNVCQGRIVHPGVAESVGEATTPLDACLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 157 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 185 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 186 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 189 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 190 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 248 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 267 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 268 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 269 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 270 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 271 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 272 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 273 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 274 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 275 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 276 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 277 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 278 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 279 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 280 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 281 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 282 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 283 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 284 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 285 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 286 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 287 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 288 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 289 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 290 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 291 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 292 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 293 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 294 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 295 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 296 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 297 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 298 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 299 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 300 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 301 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 302 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 303 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 304 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 305 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 306 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 307 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 308 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 309 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 310 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 311 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 312 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 313 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 314 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 315 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 316 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 317 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 318 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 319 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 320 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 321 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 322 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 323 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 324 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 325 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 326 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 327 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 328 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 329 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 330 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 331 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 332 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 333 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 334 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 335 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 336 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 337 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 338 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 339 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 340 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 341 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 342 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 343 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 344 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 345 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 346 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 347 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 348 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 349 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 350 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 351 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 352 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 353 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 354 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 355 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 356 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 357 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 358 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 359 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 360 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 361 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 362 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 363 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 364 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 365 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 366 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 367 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 368 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 369 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 370 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 371 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 372 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 373 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 374 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 375 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 376 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 377 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 378 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 379 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 380 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 381 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 382 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 383 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 384 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 385 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 386 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 387 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.67 |
| Metatranscriptomes | 2.09 |
| Isolates | 17.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0 |
| Endosphere | 3.33 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 84.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0003713 | 3300049568 | Bacteria | 9823 |
| 2 | JGI25159J45721_1006689 | 3300002987 | Bacteria | 3409 |
| 3 | JGI25159J45721_1011084 | 3300002987 | Bacteria | 2237 |
| 4 | JGI25151J46595_10000533 | 3300003187 | Bacteria | 35363 |
| 5 | JGI25151J46595_10001687 | 3300003187 | Bacteria | 14425 |
| 6 | JGI25151J46595_10013431 | 3300003187 | Bacteria | 3684 |
| 7 | JGI25151J46595_10013727 | 3300003187 | Bacteria | 3635 |
| 8 | JGI25151J46595_10019425 | 3300003187 | Bacteria | 2887 |
| 9 | rootH1_10001445 | 3300003316 | Bacteria | 56583 |
| 10 | rootL2_10013974 | 3300003322 | Bacteria | 148551 |
| 11 | rootH1_10053710 | 3300003323 | Bacteria | 5934 |
| 12 | Ga0006562J51391_1000459 | 3300003578 | Bacteria | 8870 |
| 13 | Ga0006562J51391_1001698 | 3300003578 | Bacteria | 1890 |
| 14 | Ga0006562J51391_1012090 | 3300003578 | Bacteria | 1390 |
| 15 | Ga0055528_1003542 | 3300003790 | Bacteria | 7784 |
| 16 | Ga0065707_10114142 | 3300005295 | Bacteria | 2302 |
| 17 | Ga0065707_10167548 | 3300005295 | Bacteria | 1510 |
| 18 | Ga0070676_10000180 | 3300005328 | Bacteria | 26224 |
| 19 | Ga0070676_10226166 | 3300005328 | Bacteria | 1238 |
| 20 | Ga0070670_100006546 | 3300005331 | Bacteria | 9867 |
| 21 | Ga0068869_100000723 | 3300005334 | Bacteria | 18807 |
| 22 | Ga0070666_10004839 | 3300005335 | Bacteria | 8230 |
| 23 | Ga0070680_100013896 | 3300005336 | Bacteria | 6282 |
| 24 | Ga0070680_100203284 | 3300005336 | Bacteria | 1671 |
| 25 | Ga0070682_100000622 | 3300005337 | Bacteria | 21584 |
| 26 | Ga0070660_100002171 | 3300005339 | Bacteria | 13520 |
| 27 | Ga0070689_100008079 | 3300005340 | Bacteria | 7392 |
| 28 | Ga0070689_100254197 | 3300005340 | Bacteria | 1451 |
| 29 | Ga0070687_100006063 | 3300005343 | Bacteria | 4931 |
| 30 | Ga0070661_100000211 | 3300005344 | Bacteria | 48345 |
| 31 | Ga0070692_10000947 | 3300005345 | Bacteria | 9859 |
| 32 | Ga0070668_100398961 | 3300005347 | Bacteria | 1174 |
| 33 | Ga0070669_100385812 | 3300005353 | Bacteria | 1143 |
| 34 | Ga0070675_100165867 | 3300005354 | Bacteria | 1902 |
| 35 | Ga0070671_100005118 | 3300005355 | Bacteria | 10442 |
| 36 | Ga0070673_100001462 | 3300005364 | Bacteria | 13820 |
| 37 | Ga0070659_100000204 | 3300005366 | Bacteria | 46050 |
| 38 | Ga0070703_10013650 | 3300005406 | Bacteria | 2309 |
| 39 | Ga0070701_10009895 | 3300005438 | Bacteria | 4195 |
| 40 | Ga0070705_100001378 | 3300005440 | Bacteria | 12938 |
| 41 | Ga0070694_100001824 | 3300005444 | Bacteria | 12612 |
| 42 | Ga0070694_100005813 | 3300005444 | Bacteria | 7483 |
| 43 | Ga0070694_100049879 | 3300005444 | Bacteria | 2820 |
| 44 | Ga0070708_100008247 | 3300005445 | Bacteria | 8365 |
| 45 | Ga0070708_100026566 | 3300005445 | Bacteria | 4957 |
| 46 | Ga0070708_100043172 | 3300005445 | Bacteria | 3961 |
| 47 | Ga0070708_100089602 | 3300005445 | Bacteria | 2799 |
| 48 | Ga0070708_100123968 | 3300005445 | Bacteria | 2386 |
| 49 | Ga0070708_100150468 | 3300005445 | Bacteria | 2164 |
| 50 | Ga0070708_100165316 | 3300005445 | Bacteria | 2064 |
| 51 | Ga0070708_100197719 | 3300005445 | Bacteria | 1881 |
| 52 | Ga0070708_100314354 | 3300005445 | Bacteria | 1475 |
| 53 | Ga0070662_100031002 | 3300005457 | Bacteria | 3748 |
| 54 | Ga0070662_100218281 | 3300005457 | Bacteria | 1520 |
| 55 | Ga0070681_10216955 | 3300005458 | Bacteria | 1829 |
| 56 | Ga0068867_100000382 | 3300005459 | Bacteria | 29543 |
| 57 | Ga0070706_100000575 | 3300005467 | Bacteria | 42747 |
| 58 | Ga0070706_100005446 | 3300005467 | Bacteria | 12124 |
| 59 | Ga0070706_100016657 | 3300005467 | Bacteria | 6790 |
| 60 | Ga0070706_100025460 | 3300005467 | Bacteria | 5446 |
| 61 | Ga0070706_100029052 | 3300005467 | Bacteria | 5093 |
| 62 | Ga0070706_100099346 | 3300005467 | Bacteria | 2704 |
| 63 | Ga0070706_100296978 | 3300005467 | Bacteria | 1507 |
| 64 | Ga0070707_100003191 | 3300005468 | Bacteria | 15511 |
| 65 | Ga0070707_100005498 | 3300005468 | Bacteria | 11846 |
| 66 | Ga0070707_100006333 | 3300005468 | Bacteria | 11004 |
| 67 | Ga0070707_100014780 | 3300005468 | Bacteria | 7318 |
| 68 | Ga0070707_100035031 | 3300005468 | Bacteria | 4787 |
| 69 | Ga0070707_100036244 | 3300005468 | Bacteria | 4706 |
| 70 | Ga0070698_100004886 | 3300005471 | Bacteria | 14713 |
| 71 | Ga0070698_100012284 | 3300005471 | Bacteria | 9068 |
| 72 | Ga0070698_100027252 | 3300005471 | Bacteria | 5945 |
| 73 | Ga0070698_100131425 | 3300005471 | Bacteria | 2459 |
| 74 | Ga0070698_100142590 | 3300005471 | Bacteria | 2346 |
| 75 | Ga0070699_100005366 | 3300005518 | Bacteria | 11242 |
| 76 | Ga0070699_100020042 | 3300005518 | Bacteria | 5762 |
| 77 | Ga0070699_100024234 | 3300005518 | Bacteria | 5228 |
| 78 | Ga0070699_100085305 | 3300005518 | Bacteria | 2756 |
| 79 | Ga0070699_100093255 | 3300005518 | Bacteria | 2634 |
| 80 | Ga0070699_100392218 | 3300005518 | Bacteria | 1254 |
| 81 | Ga0070679_100063874 | 3300005530 | Bacteria | 3669 |
| 82 | Ga0070697_100005980 | 3300005536 | Bacteria | 9407 |
| 83 | Ga0070697_100012817 | 3300005536 | Bacteria | 6567 |
| 84 | Ga0070697_100051482 | 3300005536 | Bacteria | 3345 |
| 85 | Ga0070697_100134582 | 3300005536 | Bacteria | 2075 |
| 86 | Ga0070697_100219293 | 3300005536 | Bacteria | 1621 |
| 87 | Ga0070697_100326369 | 3300005536 | Bacteria | 1322 |
| 88 | Ga0070672_100007462 | 3300005543 | Bacteria | 7422 |
| 89 | Ga0070686_100079813 | 3300005544 | Bacteria | 2164 |
| 90 | Ga0070695_100000456 | 3300005545 | Bacteria | 21302 |
| 91 | Ga0070695_100001317 | 3300005545 | Bacteria | 13733 |
| 92 | Ga0070695_100004963 | 3300005545 | Bacteria | 7846 |
| 93 | Ga0070695_100033546 | 3300005545 | Bacteria | 3213 |
| 94 | Ga0070696_100024923 | 3300005546 | Bacteria | 4065 |
| 95 | Ga0070696_100032571 | 3300005546 | Bacteria | 3576 |
| 96 | Ga0070696_100083236 | 3300005546 | Bacteria | 2269 |
| 97 | Ga0070693_100000530 | 3300005547 | Bacteria | 17134 |
| 98 | Ga0070704_100024209 | 3300005549 | Bacteria | 3980 |
| 99 | Ga0070704_100059040 | 3300005549 | Bacteria | 2735 |
| 100 | Ga0070704_100280396 | 3300005549 | Bacteria | 1380 |
| 101 | Ga0068855_100000319 | 3300005563 | Bacteria | 59802 |
| 102 | Ga0068857_100011491 | 3300005577 | Bacteria | 7702 |
| 103 | Ga0068856_100006539 | 3300005614 | Bacteria | 11424 |
| 104 | Ga0068859_100168128 | 3300005617 | Bacteria | 2273 |
| 105 | Ga0068859_100206768 | 3300005617 | Bacteria | 2048 |
| 106 | Ga0068864_100009783 | 3300005618 | Bacteria | 7905 |
| 107 | Ga0068861_100024675 | 3300005719 | Bacteria | 4352 |
| 108 | Ga0068870_10002333 | 3300005840 | Bacteria | 7895 |
| 109 | Ga0068863_100034656 | 3300005841 | Bacteria | 4807 |
| 110 | Ga0068863_100047886 | 3300005841 | Bacteria | 4054 |
| 111 | Ga0068860_100006217 | 3300005843 | Bacteria | 12008 |
| 112 | Ga0068860_100091709 | 3300005843 | Bacteria | 2894 |
| 113 | Ga0068862_100000487 | 3300005844 | Bacteria | 42413 |
| 114 | Ga0068862_100043144 | 3300005844 | Bacteria | 3844 |
| 115 | Ga0081455_10001297 | 3300005937 | Bacteria | 31031 |
| 116 | Ga0081455_10024510 | 3300005937 | Bacteria | 5585 |
| 117 | Ga0081538_10024747 | 3300005981 | Bacteria | 4266 |
| 118 | Ga0081540_1011967 | 3300005983 | Bacteria | 5753 |
| 119 | Ga0081539_10000083 | 3300005985 | Bacteria | 218881 |
| 120 | Ga0070715_10013289 | 3300006163 | Bacteria | 3020 |
| 121 | Ga0070716_100013575 | 3300006173 | Bacteria | 4155 |
| 122 | Ga0070712_100030550 | 3300006175 | Bacteria | 3622 |
| 123 | Ga0075428_100000176 | 3300006844 | Bacteria | 59684 |
| 124 | Ga0075428_100005443 | 3300006844 | Bacteria | 14150 |
| 125 | Ga0075428_100013979 | 3300006844 | Bacteria | 8936 |
| 126 | Ga0075428_100016686 | 3300006844 | Bacteria | 8108 |
| 127 | Ga0075428_100026627 | 3300006844 | Bacteria | 6403 |
| 128 | Ga0075428_100048838 | 3300006844 | Bacteria | 4643 |
| 129 | Ga0075428_100079816 | 3300006844 | Bacteria | 3571 |
| 130 | Ga0075428_100093075 | 3300006844 | Bacteria | 3286 |
| 131 | Ga0075428_100153450 | 3300006844 | Bacteria | 2502 |
| 132 | Ga0075428_100163079 | 3300006844 | Bacteria | 2419 |
| 133 | Ga0075428_100195872 | 3300006844 | Bacteria | 2185 |
| 134 | Ga0075428_100202537 | 3300006844 | Bacteria | 2145 |
| 135 | Ga0075430_100000127 | 3300006846 | Bacteria | 48027 |
| 136 | Ga0075430_100001542 | 3300006846 | Bacteria | 18812 |
| 137 | Ga0075430_100009967 | 3300006846 | Bacteria | 8037 |
| 138 | Ga0075430_100038989 | 3300006846 | Bacteria | 4023 |
| 139 | Ga0075430_100125889 | 3300006846 | Bacteria | 2136 |
| 140 | Ga0075430_100189762 | 3300006846 | Bacteria | 1708 |
| 141 | Ga0075430_100263504 | 3300006846 | Bacteria | 1427 |
| 142 | Ga0075431_100000420 | 3300006847 | Bacteria | 34568 |
| 143 | Ga0075431_100001064 | 3300006847 | Bacteria | 24562 |
| 144 | Ga0075431_100002573 | 3300006847 | Bacteria | 17520 |
| 145 | Ga0075431_100002829 | 3300006847 | Bacteria | 16783 |
| 146 | Ga0075431_100014931 | 3300006847 | Bacteria | 7864 |
| 147 | Ga0075431_100019582 | 3300006847 | Bacteria | 6903 |
| 148 | Ga0075431_100025894 | 3300006847 | Bacteria | 6012 |
| 149 | Ga0075431_100039873 | 3300006847 | Bacteria | 4838 |
| 150 | Ga0075431_100048791 | 3300006847 | Bacteria | 4367 |
| 151 | Ga0075431_100121988 | 3300006847 | Bacteria | 2689 |
| 152 | Ga0075431_100125332 | 3300006847 | Bacteria | 2650 |
| 153 | Ga0075431_100167411 | 3300006847 | Bacteria | 2259 |
| 154 | Ga0075433_10000052 | 3300006852 | Bacteria | 49747 |
| 155 | Ga0075433_10003282 | 3300006852 | Bacteria | 12493 |
| 156 | Ga0075433_10009615 | 3300006852 | Bacteria | 7738 |
| 157 | Ga0075433_10011249 | 3300006852 | Bacteria | 7203 |
| 158 | Ga0075433_10041400 | 3300006852 | Bacteria | 3991 |
| 159 | Ga0075433_10042260 | 3300006852 | Bacteria | 3954 |
| 160 | Ga0075433_10042774 | 3300006852 | Bacteria | 3932 |
| 161 | Ga0075433_10084754 | 3300006852 | Bacteria | 2797 |
| 162 | Ga0075433_10149092 | 3300006852 | Bacteria | 2080 |
| 163 | Ga0075434_100000262 | 3300006871 | Bacteria | 37332 |
| 164 | Ga0075434_100005556 | 3300006871 | Bacteria | 11491 |
| 165 | Ga0075434_100024034 | 3300006871 | Bacteria | 5951 |
| 166 | Ga0075434_100026524 | 3300006871 | Bacteria | 5678 |
| 167 | Ga0075434_100041791 | 3300006871 | Bacteria | 4543 |
| 168 | Ga0075434_100049091 | 3300006871 | Bacteria | 4189 |
| 169 | Ga0075434_100069888 | 3300006871 | Bacteria | 3501 |
| 170 | Ga0075434_100110462 | 3300006871 | Bacteria | 2760 |
| 171 | Ga0075434_100249083 | 3300006871 | Bacteria | 1796 |
| 172 | Ga0075429_100000075 | 3300006880 | Bacteria | 49848 |
| 173 | Ga0075429_100001545 | 3300006880 | Bacteria | 18878 |
| 174 | Ga0075429_100002125 | 3300006880 | Bacteria | 16535 |
| 175 | Ga0075429_100005105 | 3300006880 | Bacteria | 11289 |
| 176 | Ga0075429_100009405 | 3300006880 | Bacteria | 8485 |
| 177 | Ga0075429_100020608 | 3300006880 | Bacteria | 5722 |
| 178 | Ga0075429_100084784 | 3300006880 | Bacteria | 2762 |
| 179 | Ga0075429_100130324 | 3300006880 | Bacteria | 2200 |
| 180 | Ga0075429_100217967 | 3300006880 | Bacteria | 1672 |
| 181 | Ga0068865_100004300 | 3300006881 | Bacteria | 8597 |
| 182 | Ga0075436_100004665 | 3300006914 | Bacteria | 9392 |
| 183 | Ga0075436_100033886 | 3300006914 | Bacteria | 3520 |
| 184 | Ga0075436_100215906 | 3300006914 | Bacteria | 1360 |
| 185 | Ga0097620_100168138 | 3300006931 | Bacteria | 2273 |
| 186 | Ga0097620_100206740 | 3300006931 | Bacteria | 2048 |
| 187 | Ga0075435_100004032 | 3300007076 | Bacteria | 10039 |
| 188 | Ga0075435_100016853 | 3300007076 | Bacteria | 5516 |
| 189 | Ga0075435_100021132 | 3300007076 | Bacteria | 5000 |
| 190 | Ga0075435_100031404 | 3300007076 | Bacteria | 4184 |
| 191 | Ga0075435_100031867 | 3300007076 | Bacteria | 4158 |
| 192 | Ga0075435_100036724 | 3300007076 | Bacteria | 3896 |
| 193 | Ga0075435_100179627 | 3300007076 | Bacteria | 1788 |
| 194 | Ga0099794_10000310 | 3300007265 | Bacteria | 16625 |
| 195 | Ga0111539_10000103 | 3300009094 | Bacteria | 91165 |
| 196 | Ga0111539_10000275 | 3300009094 | Bacteria | 61397 |
| 197 | Ga0111539_10002668 | 3300009094 | Bacteria | 23630 |
| 198 | Ga0111539_10011048 | 3300009094 | Bacteria | 11359 |
| 199 | Ga0111539_10045183 | 3300009094 | Bacteria | 5273 |
| 200 | Ga0111539_10059861 | 3300009094 | Bacteria | 4515 |
| 201 | Ga0111539_10113573 | 3300009094 | Bacteria | 3177 |
| 202 | Ga0111539_10137534 | 3300009094 | Bacteria | 2861 |
| 203 | Ga0111539_10221507 | 3300009094 | Bacteria | 2203 |
| 204 | Ga0105245_10020600 | 3300009098 | Bacteria | 5783 |
| 205 | Ga0105247_10010339 | 3300009101 | Bacteria | 5643 |
| 206 | Ga0114129_10001042 | 3300009147 | Bacteria | 36288 |
| 207 | Ga0114129_10001782 | 3300009147 | Bacteria | 29335 |
| 208 | Ga0114129_10001965 | 3300009147 | Bacteria | 28123 |
| 209 | Ga0114129_10002034 | 3300009147 | Bacteria | 27730 |
| 210 | Ga0114129_10009901 | 3300009147 | Bacteria | 13590 |
| 211 | Ga0114129_10025266 | 3300009147 | Bacteria | 8416 |
| 212 | Ga0114129_10029338 | 3300009147 | Bacteria | 7793 |
| 213 | Ga0114129_10032461 | 3300009147 | Bacteria | 7379 |
| 214 | Ga0114129_10032652 | 3300009147 | Bacteria | 7355 |
| 215 | Ga0114129_10102529 | 3300009147 | Bacteria | 3957 |
| 216 | Ga0114129_10134517 | 3300009147 | Bacteria | 3393 |
| 217 | Ga0114129_10224297 | 3300009147 | Bacteria | 2534 |
| 218 | Ga0114129_10247088 | 3300009147 | Bacteria | 2397 |
| 219 | Ga0105243_10026774 | 3300009148 | Bacteria | 4415 |
| 220 | Ga0105243_10089778 | 3300009148 | Bacteria | 2527 |
| 221 | Ga0105243_10109561 | 3300009148 | Bacteria | 2307 |
| 222 | Ga0105243_10246194 | 3300009148 | Bacteria | 1593 |
| 223 | Ga0105241_10001179 | 3300009174 | Bacteria | 19931 |
| 224 | Ga0105242_10020990 | 3300009176 | Bacteria | 5123 |
| 225 | Ga0105242_10183849 | 3300009176 | Bacteria | 1846 |
| 226 | Ga0105242_10199890 | 3300009176 | Bacteria | 1775 |
| 227 | Ga0105248_10118792 | 3300009177 | Bacteria | 2982 |
| 228 | Ga0105237_10248608 | 3300009545 | Bacteria | 1780 |
| 229 | Ga0105246_10007951 | 3300011119 | Bacteria | 6509 |
| 230 | Ga0105246_10017101 | 3300011119 | Bacteria | 4606 |
| 231 | Ga0105246_10045911 | 3300011119 | Bacteria | 2978 |
| 232 | Ga0157373_10004022 | 3300013100 | Bacteria | 11085 |
| 233 | Ga0157371_10002617 | 3300013102 | Bacteria | 17082 |
| 234 | Ga0157371_10117786 | 3300013102 | Bacteria | 1888 |
| 235 | Ga0157369_10145836 | 3300013105 | Bacteria | 2503 |
| 236 | Ga0157374_10103977 | 3300013296 | Bacteria | 2726 |
| 237 | Ga0157374_10163626 | 3300013296 | Bacteria | 2168 |
| 238 | Ga0157378_10007084 | 3300013297 | Bacteria | 9789 |
| 239 | Ga0157378_10124657 | 3300013297 | Bacteria | 2379 |
| 240 | Ga0157378_10204714 | 3300013297 | Bacteria | 1868 |
| 241 | Ga0163162_10081712 | 3300013306 | Bacteria | 3302 |
| 242 | Ga0157372_10006181 | 3300013307 | Bacteria | 12733 |
| 243 | Ga0157372_10115328 | 3300013307 | Bacteria | 3080 |
| 244 | Ga0157375_10084609 | 3300013308 | Bacteria | 3221 |
| 245 | Ga0163163_10049524 | 3300014325 | Bacteria | 4135 |
| 246 | Ga0157380_10258224 | 3300014326 | Bacteria | 1581 |
| 247 | Ga0157377_10025210 | 3300014745 | Bacteria | 3169 |
| 248 | Ga0163161_10040790 | 3300017792 | Bacteria | 3334 |
| 249 | Ga0209566_100709 | 3300025225 | Bacteria | 19079 |
| 250 | Ga0209147_100262 | 3300025229 | Bacteria | 48219 |
| 251 | Ga0209147_102106 | 3300025229 | Bacteria | 5558 |
| 252 | Ga0209147_102633 | 3300025229 | Bacteria | 4211 |
| 253 | Ga0209147_102729 | 3300025229 | Bacteria | 4018 |
| 254 | Ga0209437_100552 | 3300025233 | Bacteria | 24996 |
| 255 | Ga0209130_1001035 | 3300025284 | Bacteria | 21283 |
| 256 | Ga0209130_1002803 | 3300025284 | Bacteria | 8136 |
| 257 | Ga0209130_1004812 | 3300025284 | Bacteria | 4952 |
| 258 | Ga0209130_1004843 | 3300025284 | Bacteria | 4919 |
| 259 | Ga0209025_1000011 | 3300025294 | Bacteria | 976387 |
| 260 | Ga0209025_1000347 | 3300025294 | Bacteria | 100528 |
| 261 | Ga0209025_1000388 | 3300025294 | Bacteria | 91113 |
| 262 | Ga0209025_1001677 | 3300025294 | Bacteria | 27101 |
| 263 | Ga0209025_1001722 | 3300025294 | Bacteria | 26473 |
| 264 | Ga0209025_1002269 | 3300025294 | Bacteria | 21052 |
| 265 | Ga0209025_1003207 | 3300025294 | Bacteria | 15856 |
| 266 | Ga0209025_1004185 | 3300025294 | Bacteria | 12748 |
| 267 | Ga0207426_1030025 | 3300025302 | Bacteria | 1786 |
| 268 | Ga0207696_1000865 | 3300025711 | Bacteria | 18980 |
| 269 | Ga0207696_1002049 | 3300025711 | Bacteria | 10175 |
| 270 | Ga0207696_1011712 | 3300025711 | Bacteria | 3142 |
| 271 | Ga0207655_1002285 | 3300025728 | Bacteria | 15776 |
| 272 | Ga0207655_1002655 | 3300025728 | Bacteria | 14097 |
| 273 | Ga0207713_1000727 | 3300025735 | Bacteria | 30847 |
| 274 | Ga0207653_10005861 | 3300025885 | Bacteria | 3833 |
| 275 | Ga0207688_10019936 | 3300025901 | Bacteria | 3657 |
| 276 | Ga0207680_10001137 | 3300025903 | Bacteria | 12571 |
| 277 | Ga0207645_10014975 | 3300025907 | Bacteria | 5167 |
| 278 | Ga0207643_10001863 | 3300025908 | Bacteria | 11658 |
| 279 | Ga0207643_10089464 | 3300025908 | Bacteria | 1793 |
| 280 | Ga0207684_10000791 | 3300025910 | Bacteria | 36644 |
| 281 | Ga0207684_10001023 | 3300025910 | Bacteria | 31386 |
| 282 | Ga0207684_10051763 | 3300025910 | Bacteria | 3484 |
| 283 | Ga0207684_10056514 | 3300025910 | Bacteria | 3329 |
| 284 | Ga0207684_10240086 | 3300025910 | Bacteria | 1563 |
| 285 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 286 | Ga0207707_10105875 | 3300025912 | Bacteria | 2459 |
| 287 | Ga0207671_10000004 | 3300025914 | Bacteria | 1022356 |
| 288 | Ga0207671_10079923 | 3300025914 | Bacteria | 2450 |
| 289 | Ga0207693_10060883 | 3300025915 | Bacteria | 2957 |
| 290 | Ga0207660_10002889 | 3300025917 | Bacteria | 11226 |
| 291 | Ga0207660_10035684 | 3300025917 | Bacteria | 3454 |
| 292 | Ga0207662_10140571 | 3300025918 | Bacteria | 1529 |
| 293 | Ga0207657_10002084 | 3300025919 | Bacteria | 21638 |
| 294 | Ga0207649_10001837 | 3300025920 | Bacteria | 12126 |
| 295 | Ga0207652_10003098 | 3300025921 | Bacteria | 13862 |
| 296 | Ga0207646_10000699 | 3300025922 | Bacteria | 43480 |
| 297 | Ga0207646_10001026 | 3300025922 | Bacteria | 35667 |
| 298 | Ga0207646_10005460 | 3300025922 | Bacteria | 13365 |
| 299 | Ga0207646_10009250 | 3300025922 | Bacteria | 9757 |
| 300 | Ga0207646_10016411 | 3300025922 | Bacteria | 6948 |
| 301 | Ga0207646_10084601 | 3300025922 | Bacteria | 2838 |
| 302 | Ga0207646_10103196 | 3300025922 | Bacteria | 2557 |
| 303 | Ga0207646_10104687 | 3300025922 | Bacteria | 2538 |
| 304 | Ga0207646_10105059 | 3300025922 | Bacteria | 2532 |
| 305 | Ga0207646_10223467 | 3300025922 | Bacteria | 1701 |
| 306 | Ga0207681_10015108 | 3300025923 | Bacteria | 4814 |
| 307 | Ga0207681_10044083 | 3300025923 | Bacteria | 2989 |
| 308 | Ga0207681_10253309 | 3300025923 | Bacteria | 1375 |
| 309 | Ga0207650_10058472 | 3300025925 | Bacteria | 2870 |
| 310 | Ga0207687_10056051 | 3300025927 | Bacteria | 2763 |
| 311 | Ga0207687_10062108 | 3300025927 | Bacteria | 2640 |
| 312 | Ga0207706_10005422 | 3300025933 | Bacteria | 11888 |
| 313 | Ga0207706_10007465 | 3300025933 | Bacteria | 10110 |
| 314 | Ga0207686_10087504 | 3300025934 | Bacteria | 2049 |
| 315 | Ga0207709_10109139 | 3300025935 | Bacteria | 1846 |
| 316 | Ga0207704_10012977 | 3300025938 | Bacteria | 4153 |
| 317 | Ga0207704_10045818 | 3300025938 | Bacteria | 2601 |
| 318 | Ga0207665_10002315 | 3300025939 | Bacteria | 12857 |
| 319 | Ga0207691_10013829 | 3300025940 | Bacteria | 7706 |
| 320 | Ga0207689_10000058 | 3300025942 | Bacteria | 86234 |
| 321 | Ga0207689_10000942 | 3300025942 | Bacteria | 27963 |
| 322 | Ga0207661_10136346 | 3300025944 | Bacteria | 2108 |
| 323 | Ga0207679_10002446 | 3300025945 | Bacteria | 11435 |
| 324 | Ga0207667_10000342 | 3300025949 | Bacteria | 63745 |
| 325 | Ga0207712_10172180 | 3300025961 | Bacteria | 1693 |
| 326 | Ga0207678_10000501 | 3300026067 | Bacteria | 35486 |
| 327 | Ga0207702_10002217 | 3300026078 | Bacteria | 18618 |
| 328 | Ga0207648_10006801 | 3300026089 | Bacteria | 11336 |
| 329 | Ga0207648_10130282 | 3300026089 | Bacteria | 2214 |
| 330 | Ga0207676_10069053 | 3300026095 | Bacteria | 2828 |
| 331 | Ga0207674_10002881 | 3300026116 | Bacteria | 21377 |
| 332 | Ga0207675_100023622 | 3300026118 | Bacteria | 5719 |
| 333 | Ga0207675_100138013 | 3300026118 | Bacteria | 2315 |
| 334 | Ga0207675_100153769 | 3300026118 | Bacteria | 2191 |
| 335 | Ga0207683_10306608 | 3300026121 | Bacteria | 1453 |
| 336 | Ga0207698_10102499 | 3300026142 | Bacteria | 2376 |
| 337 | Ga0209967_1004631 | 3300027364 | Bacteria | 1832 |
| 338 | Ga0209968_1000806 | 3300027526 | Bacteria | 4841 |
| 339 | Ga0209999_1001372 | 3300027543 | Bacteria | 4171 |
| 340 | Ga0209983_1000013 | 3300027665 | Bacteria | 22196 |
| 341 | Ga0209588_1018913 | 3300027671 | Bacteria | 2146 |
| 342 | Ga0209971_1000042 | 3300027682 | Bacteria | 41413 |
| 343 | Ga0209966_1000026 | 3300027695 | Bacteria | 66086 |
| 344 | Ga0209998_10000004 | 3300027717 | Bacteria | 104862 |
| 345 | Ga0207428_10000362 | 3300027907 | Bacteria | 58443 |
| 346 | Ga0207428_10000725 | 3300027907 | Bacteria | 38077 |
| 347 | Ga0207428_10004772 | 3300027907 | Bacteria | 12803 |
| 348 | Ga0207428_10007573 | 3300027907 | Bacteria | 9897 |
| 349 | Ga0207428_10064694 | 3300027907 | Bacteria | 2887 |
| 350 | Ga0268265_10025321 | 3300028380 | Bacteria | 4209 |
| 351 | Ga0268265_10157504 | 3300028380 | Bacteria | 1924 |
| 352 | Ga0268265_10218025 | 3300028380 | Bacteria | 1667 |
| 353 | Ga0268264_10011418 | 3300028381 | Bacteria | 7336 |
| 354 | Ga0237817_10260 | 3300030083 | Bacteria | 12515 |
| 355 | Ga0307408_100006448 | 3300031548 | Bacteria | 7778 |
| 356 | Ga0307408_100012648 | 3300031548 | Bacteria | 5597 |
| 357 | Ga0307408_100053321 | 3300031548 | Bacteria | 2919 |
| 358 | Ga0316575_10000015 | 3300031665 | Bacteria | 44411 |
| 359 | Ga0316579_10024153 | 3300031691 | Bacteria | 2735 |
| 360 | Ga0307405_10113639 | 3300031731 | Bacteria | 1839 |
| 361 | Ga0307410_10053802 | 3300031852 | Bacteria | 2726 |
| 362 | Ga0307406_10017580 | 3300031901 | Bacteria | 4166 |
| 363 | Ga0307406_10064264 | 3300031901 | Bacteria | 2381 |
| 364 | Ga0307407_10184290 | 3300031903 | Bacteria | 1386 |
| 365 | Ga0307409_100022958 | 3300031995 | Bacteria | 4312 |
| 366 | Ga0307409_100023445 | 3300031995 | Bacteria | 4277 |
| 367 | Ga0307416_100017473 | 3300032002 | Bacteria | 5022 |
| 368 | Ga0307416_100131739 | 3300032002 | Bacteria | 2252 |
| 369 | Ga0307411_10215515 | 3300032005 | Bacteria | 1486 |
| 370 | Ga0373926_0026563 | 3300035083 | Bacteria | 2026 |
| 371 | Ga0373934_0011489 | 3300035086 | Bacteria | 3329 |
| 372 | Ga0373940_0014932 | 3300035088 | Bacteria | 1902 |
| 373 | Ga0373949_0003723 | 3300035090 | Bacteria | 3565 |
| 374 | Ga0373932_0009309 | 3300035112 | Bacteria | 2360 |
| 375 | Ga0373932_0015532 | 3300035112 | Bacteria | 1931 |
| 376 | Ga0373941_0008061 | 3300035115 | Bacteria | 2604 |
| 377 | Ga0373960_0010159 | 3300035121 | Bacteria | 2294 |
| 378 | Ga0373942_0029573 | 3300035207 | Bacteria | 1439 |
| 379 | Ga0316574_0056237 | 3300035398 | Bacteria | 2461 |
| 380 | Ga0373931_0006289 | 3300035691 | Bacteria | 5542 |
| 381 | Ga0373931_0058970 | 3300035691 | Bacteria | 2063 |
| 382 | Ga0373931_0090580 | 3300035691 | Bacteria | 1703 |
| 383 | Ga0373927_0007561 | 3300035695 | Bacteria | 7352 |
| 384 | Ga0373947_0000119 | 3300035725 | Bacteria | 39799 |
| 385 | Ga0316584_0123445 | 3300036712 | Bacteria | 1935 |
| 386 | Ga0316584_0243415 | 3300036712 | Unclassified | 1316 |
| 387 | Ga0373925_0000296 | 3300037068 | Bacteria | 52149 |
| 388 | Ga0395899_0023769 | 3300037312 | Bacteria | 4638 |
| 389 | Ga0395899_0178737 | 3300037312 | Bacteria | 1491 |
| 390 | Ga0395900_0009304 | 3300037418 | Bacteria | 10073 |
| 391 | Ga0395898_0013990 | 3300037466 | Bacteria | 8245 |
| 392 | Ga0395905_0229960 | 3300037471 | Bacteria | 1734 |
| 393 | Ga0395901_0001591 | 3300038443 | Bacteria | 23497 |
| 394 | Ga0237819_00149 | 3300038705 | Bacteria | 25643 |
| 395 | Ga0237819_00173 | 3300038705 | Bacteria | 24004 |
| 396 | Ga0400489_63543 | 3300039093 | Bacteria | 130825 |
| 397 | Ga0439448_0001756 | 3300042005 | Bacteria | 5729 |
| 398 | Ga0439449_0007338 | 3300042007 | Bacteria | 4189 |
| 399 | Ga0450903_015402 | 3300042138 | Bacteria | 1205 |
| 400 | Ga0439435_0041304 | 3300042436 | Bacteria | 1292 |
| 401 | Ga0439460_0005173 | 3300042461 | Bacteria | 3197 |
| 402 | Ga0451577_0000254 | 3300042876 | Bacteria | 105712 |
| 403 | Ga0451577_0000807 | 3300042876 | Bacteria | 47174 |
| 404 | Ga0451577_0006179 | 3300042876 | Bacteria | 12037 |
| 405 | Ga0451577_0011400 | 3300042876 | Bacteria | 8411 |
| 406 | Ga0451577_0015473 | 3300042876 | Bacteria | 7097 |
| 407 | Ga0451577_0029889 | 3300042876 | Bacteria | 4923 |
| 408 | Ga0451577_0201785 | 3300042876 | Bacteria | 1795 |
| 409 | Ga0453683_0081301 | 3300044673 | Bacteria | 2029 |
| 410 | Ga0453684_0000177 | 3300044712 | Bacteria | 282969 |
| 411 | Ga0453684_0000521 | 3300044712 | Bacteria | 147189 |
| 412 | Ga0453684_0036531 | 3300044712 | Bacteria | 6769 |
| 413 | Ga0453684_0120871 | 3300044712 | Bacteria | 3163 |
| 414 | Ga0453684_0196602 | 3300044712 | Bacteria | 2354 |
| 415 | Ga0466960_0022141 | 3300044901 | Bacteria | 2838 |
| 416 | Ga0466960_0035408 | 3300044901 | Bacteria | 2333 |
| 417 | Ga0451576_0005053 | 3300045051 | Bacteria | 16728 |
| 418 | Ga0451576_0053415 | 3300045051 | Bacteria | 4232 |
| 419 | Ga0451576_0074153 | 3300045051 | Bacteria | 3541 |
| 420 | Ga0451576_0379220 | 3300045051 | Bacteria | 1482 |
| 421 | Ga0466967_0000623 | 3300045976 | Bacteria | 17703 |
| 422 | Ga0466967_0011821 | 3300045976 | Bacteria | 6638 |
| 423 | Ga0495580_0014869 | 3300046472 | Bacteria | 5896 |
| 424 | Ga0495584_0102081 | 3300046491 | Bacteria | 1450 |
| 425 | Ga0495665_0048643 | 3300046531 | Bacteria | 2248 |
| 426 | Ga0496102_0009055 | 3300048905 | Bacteria | 8543 |
| 427 | Ga0496102_0233068 | 3300048905 | Bacteria | 1736 |
| 428 | Ga0496104_0008096 | 3300048907 | Bacteria | 9325 |
| 429 | Ga0496106_0000224 | 3300048909 | Bacteria | 39551 |
| 430 | Ga0496107_0011410 | 3300048910 | Bacteria | 6188 |
| 431 | Ga0496107_0116394 | 3300048910 | Bacteria | 1968 |
| 432 | Ga0496108_0002369 | 3300048911 | Bacteria | 15094 |
| 433 | Ga0496109_0003788 | 3300048912 | Bacteria | 12621 |
| 434 | Ga0496111_0001047 | 3300048914 | Bacteria | 15233 |
| 435 | Ga0496112_0036159 | 3300048915 | Bacteria | 4816 |
| 436 | Ga0496112_0291378 | 3300048915 | Bacteria | 1578 |
| 437 | Ga0496118_0087869 | 3300048921 | Bacteria | 2153 |
| 438 | Ga0496120_0043874 | 3300048923 | Bacteria | 2602 |
| 439 | Ga0496123_0049803 | 3300048926 | Bacteria | 2805 |
| 440 | Ga0496124_0022607 | 3300048927 | Bacteria | 5759 |
| 441 | Ga0496125_0006100 | 3300048928 | Bacteria | 13156 |
| 442 | Ga0501343_003403 | 3300049132 | Bacteria | 1167 |
| 443 | Ga0501345_00134 | 3300049134 | Bacteria | 2010 |
| 444 | Ga0501305_002424 | 3300049161 | Bacteria | 2009 |
| 445 | Ga0501315_008731 | 3300049531 | Bacteria | 1184 |
| 446 | Ga0501316_001034 | 3300049532 | Bacteria | 2229 |
| 447 | Ga0501317_001707 | 3300049533 | Bacteria | 1952 |
| 448 | Ga0501317_009014 | 3300049533 | Bacteria | 1163 |
| 449 | Ga0501321_002237 | 3300049537 | Bacteria | 1652 |
| 450 | Ga0501333_000393 | 3300049549 | Bacteria | 1960 |
| 451 | Ga0501334_00268 | 3300049550 | Bacteria | 2179 |
| 452 | Ga0501335_002446 | 3300049551 | Bacteria | 1509 |
| 453 | Ga0501336_000403 | 3300049552 | Bacteria | 2105 |
| 454 | Ga0501337_001621 | 3300049553 | Bacteria | 1304 |
| 455 | Ga0501338_00318 | 3300049554 | Bacteria | 2062 |
| 456 | Ga0501032_0054797 | 3300049569 | Bacteria | 2684 |
| 457 | Ga0501033_0124880 | 3300049570 | Bacteria | 1866 |
| 458 | Ga0501034_0022032 | 3300049571 | Bacteria | 6491 |
| 459 | Ga0501034_0424939 | 3300049571 | Bacteria | 1249 |
| 460 | Ga0501036_0001372 | 3300049572 | Bacteria | 18676 |
| 461 | Ga0501036_0054566 | 3300049572 | Bacteria | 3385 |
| 462 | Ga0501036_0124414 | 3300049572 | Bacteria | 2178 |
| 463 | Ga0501036_0188360 | 3300049572 | Bacteria | 1736 |
| 464 | Ga0501037_0250361 | 3300049573 | Bacteria | 1240 |
| 465 | Ga0501038_0006167 | 3300049574 | Bacteria | 11089 |
| 466 | Ga0501038_0026494 | 3300049574 | Bacteria | 5163 |
| 467 | Ga0501039_0000732 | 3300049575 | Bacteria | 23687 |
| 468 | Ga0501039_0001276 | 3300049575 | Bacteria | 18409 |
| 469 | Ga0501039_0108628 | 3300049575 | Bacteria | 2168 |
| 470 | Ga0501040_0001412 | 3300049576 | Bacteria | 15196 |
| 471 | Ga0501040_0020581 | 3300049576 | Bacteria | 4398 |
| 472 | Ga0501040_0030755 | 3300049576 | Bacteria | 3627 |
| 473 | Ga0501040_0045597 | 3300049576 | Bacteria | 2991 |
| 474 | Ga0501040_0081324 | 3300049576 | Bacteria | 2245 |
| 475 | Ga0501040_0105814 | 3300049576 | Bacteria | 1966 |
| 476 | Ga0501040_0183043 | 3300049576 | Bacteria | 1485 |
| 477 | Ga0501040_0293598 | 3300049576 | Bacteria | 1162 |
| 478 | Ga0501041_0001736 | 3300049577 | Bacteria | 12245 |
| 479 | Ga0501041_0001961 | 3300049577 | Bacteria | 11563 |
| 480 | Ga0501041_0008896 | 3300049577 | Bacteria | 5909 |
| 481 | Ga0501041_0030385 | 3300049577 | Bacteria | 3260 |
| 482 | Ga0501041_0033360 | 3300049577 | Bacteria | 3114 |
| 483 | Ga0501041_0034594 | 3300049577 | Bacteria | 3059 |
| 484 | Ga0501041_0053370 | 3300049577 | Bacteria | 2465 |
| 485 | Ga0501041_0075834 | 3300049577 | Bacteria | 2068 |
| 486 | Ga0501042_0000612 | 3300049578 | Bacteria | 19007 |
| 487 | Ga0501042_0011683 | 3300049578 | Bacteria | 5932 |
| 488 | Ga0501042_0111678 | 3300049578 | Bacteria | 1968 |
| 489 | Ga0501042_0124885 | 3300049578 | Bacteria | 1853 |
| 490 | Ga0501046_0000569 | 3300049580 | Bacteria | 36558 |
| 491 | Ga0501046_0023086 | 3300049580 | Bacteria | 5122 |
| 492 | Ga0501046_0050256 | 3300049580 | Bacteria | 3294 |
| 493 | Ga0501046_0093767 | 3300049580 | Bacteria | 2308 |
| 494 | Ga0501046_0163079 | 3300049580 | Bacteria | 1675 |
| 495 | Ga0501048_0010098 | 3300049582 | Bacteria | 7064 |
| 496 | Ga0501048_0012603 | 3300049582 | Bacteria | 6287 |
| 497 | Ga0501048_0049651 | 3300049582 | Bacteria | 2990 |
| 498 | Ga0501067_0009258 | 3300049583 | Bacteria | 5455 |
| 499 | Ga0501068_0018610 | 3300049584 | Bacteria | 4022 |
| 500 | Ga0501071_0024984 | 3300049587 | Bacteria | 4182 |
| 501 | Ga0501071_0057465 | 3300049587 | Bacteria | 2812 |
| 502 | Ga0501071_0070526 | 3300049587 | Bacteria | 2546 |
| 503 | Ga0501071_0098163 | 3300049587 | Bacteria | 2157 |
| 504 | Ga0501072_0001347 | 3300049588 | Bacteria | 18406 |
| 505 | Ga0501072_0003106 | 3300049588 | Bacteria | 12502 |
| 506 | Ga0501072_0036536 | 3300049588 | Bacteria | 3851 |
| 507 | Ga0501072_0046054 | 3300049588 | Bacteria | 3431 |
| 508 | Ga0501072_0064458 | 3300049588 | Bacteria | 2889 |
| 509 | Ga0501073_0097233 | 3300049589 | Bacteria | 2045 |
| 510 | Ga0501074_0080564 | 3300049590 | Bacteria | 2336 |
| 511 | Ga0501075_0005765 | 3300049591 | Bacteria | 8472 |
| 512 | Ga0501075_0008362 | 3300049591 | Bacteria | 7216 |
| 513 | Ga0501075_0012802 | 3300049591 | Bacteria | 5970 |
| 514 | Ga0501075_0018641 | 3300049591 | Bacteria | 5025 |
| 515 | Ga0501075_0024428 | 3300049591 | Bacteria | 4432 |
| 516 | Ga0501075_0047343 | 3300049591 | Bacteria | 3232 |
| 517 | Ga0501075_0053650 | 3300049591 | Bacteria | 3032 |
| 518 | Ga0501075_0094442 | 3300049591 | Bacteria | 2270 |
| 519 | Ga0501075_0103809 | 3300049591 | Bacteria | 2160 |
| 520 | Ga0501075_0133149 | 3300049591 | Bacteria | 1894 |
| 521 | Ga0501075_0152331 | 3300049591 | Bacteria | 1762 |
| 522 | Ga0501075_0156881 | 3300049591 | Bacteria | 1735 |
| 523 | Ga0501075_0191037 | 3300049591 | Bacteria | 1562 |
| 524 | Ga0501076_0003600 | 3300049592 | Bacteria | 10885 |
| 525 | Ga0501076_0006299 | 3300049592 | Bacteria | 8600 |
| 526 | Ga0501076_0006927 | 3300049592 | Bacteria | 8234 |
| 527 | Ga0501076_0009215 | 3300049592 | Bacteria | 7279 |
| 528 | Ga0501076_0011783 | 3300049592 | Bacteria | 6529 |
| 529 | Ga0501076_0058249 | 3300049592 | Bacteria | 3070 |
| 530 | Ga0501076_0059692 | 3300049592 | Bacteria | 3034 |
| 531 | Ga0501076_0065959 | 3300049592 | Bacteria | 2888 |
| 532 | Ga0501076_0102596 | 3300049592 | Bacteria | 2306 |
| 533 | Ga0501076_0127521 | 3300049592 | Bacteria | 2063 |
| 534 | Ga0501076_0259376 | 3300049592 | Bacteria | 1423 |
| 535 | Ga0501077_0002373 | 3300049593 | Bacteria | 11305 |
| 536 | Ga0501077_0008127 | 3300049593 | Bacteria | 6487 |
| 537 | Ga0501077_0011985 | 3300049593 | Bacteria | 5425 |
| 538 | Ga0501077_0019307 | 3300049593 | Bacteria | 4311 |
| 539 | Ga0501077_0020362 | 3300049593 | Bacteria | 4198 |
| 540 | Ga0501077_0030055 | 3300049593 | Bacteria | 3456 |
| 541 | Ga0501077_0040264 | 3300049593 | Bacteria | 2978 |
| 542 | Ga0501077_0103170 | 3300049593 | Bacteria | 1807 |
| 543 | Ga0501077_0111175 | 3300049593 | Bacteria | 1736 |
| 544 | Ga0501217_010474 | 3300049661 | Bacteria | 2031 |
| 545 | Ga0501234_005621 | 3300049707 | Bacteria | 1960 |
| 546 | Ga0501079_0001721 | 3300049741 | Bacteria | 15606 |
| 547 | Ga0501079_0002033 | 3300049741 | Bacteria | 14484 |
| 548 | Ga0501079_0002716 | 3300049741 | Bacteria | 12894 |
| 549 | Ga0501079_0016969 | 3300049741 | Bacteria | 5562 |
| 550 | Ga0501079_0017072 | 3300049741 | Bacteria | 5543 |
| 551 | Ga0501079_0041821 | 3300049741 | Bacteria | 3538 |
| 552 | Ga0501079_0046539 | 3300049741 | Bacteria | 3347 |
| 553 | Ga0501079_0138277 | 3300049741 | Bacteria | 1897 |
| 554 | Ga0501079_0173335 | 3300049741 | Bacteria | 1682 |
| 555 | Ga0501080_0002636 | 3300049742 | Bacteria | 15701 |
| 556 | Ga0501080_0010554 | 3300049742 | Bacteria | 8461 |
| 557 | Ga0501080_0010775 | 3300049742 | Bacteria | 8366 |
| 558 | Ga0501080_0015311 | 3300049742 | Bacteria | 7069 |
| 559 | Ga0501080_0157765 | 3300049742 | Bacteria | 2096 |
| 560 | Ga0501080_0338555 | 3300049742 | Bacteria | 1360 |
| 561 | Ga0501081_0000748 | 3300049743 | Bacteria | 18977 |
| 562 | Ga0501081_0001683 | 3300049743 | Bacteria | 13689 |
| 563 | Ga0501081_0005714 | 3300049743 | Bacteria | 8049 |
| 564 | Ga0501081_0007899 | 3300049743 | Bacteria | 6902 |
| 565 | Ga0501081_0007939 | 3300049743 | Bacteria | 6883 |
| 566 | Ga0501081_0014410 | 3300049743 | Bacteria | 5215 |
| 567 | Ga0501081_0084147 | 3300049743 | Bacteria | 2231 |
| 568 | Ga0501081_0133800 | 3300049743 | Bacteria | 1773 |
| 569 | Ga0501083_0018906 | 3300049744 | Bacteria | 4796 |
| 570 | Ga0501083_0021069 | 3300049744 | Bacteria | 4531 |
| 571 | Ga0501083_0167078 | 3300049744 | Bacteria | 1438 |
| 572 | Ga0501035_0039014 | 3300049822 | Bacteria | 4300 |
| 573 | Ga0501035_0042299 | 3300049822 | Bacteria | 4110 |
| 574 | Ga0501045_0004910 | 3300049824 | Bacteria | 9262 |
| 575 | Ga0501045_0007926 | 3300049824 | Bacteria | 7394 |
| 576 | Ga0501045_0051357 | 3300049824 | Bacteria | 3009 |
| 577 | Ga0501045_0060448 | 3300049824 | Bacteria | 2778 |
| 578 | Ga0501045_0131983 | 3300049824 | Bacteria | 1857 |
| 579 | Ga0501045_0135931 | 3300049824 | Bacteria | 1828 |
| 580 | Ga0501045_0141757 | 3300049824 | Bacteria | 1787 |
| 581 | nmdc:mga05p37_169602_c1 | 3300050507 | Bacteria | 2662 |
| 582 | nmdc:mga05p37_176129_c1 | 3300050507 | Bacteria | 2605 |
| 583 | nmdc:mga05p37_201439_c1 | 3300050507 | Bacteria | 2411 |
| 584 | nmdc:mga05p37_2470_c1 | 3300050507 | Bacteria | 21509 |
| 585 | nmdc:mga05p37_2665_c1 | 3300050507 | Bacteria | 20797 |
| 586 | nmdc:mga05p37_297300_c1 | 3300050507 | Bacteria | 1920 |
| 587 | nmdc:mga05p37_3353_c1 | 3300050507 | Bacteria | 18683 |
| 588 | nmdc:mga05p37_4677_c1 | 3300050507 | Bacteria | 15992 |
| 589 | nmdc:mga05p37_47945_c1 | 3300050507 | Bacteria | 5254 |
| 590 | nmdc:mga05p37_50895_c1 | 3300050507 | Bacteria | 5094 |
| 591 | nmdc:mga05p37_510_c1 | 3300050507 | Bacteria | 42907 |
| 592 | nmdc:mga05p37_5932_c1 | 3300050507 | Bacteria | 14373 |
| 593 | nmdc:mga05p37_65451_c1 | 3300050507 | Bacteria | 3901 |
| 594 | nmdc:mga09592_2520_c1 | 3300050508 | Bacteria | 14820 |
| 595 | nmdc:mga09592_4797_c1 | 3300050508 | Bacteria | 10957 |
| 596 | nmdc:mga09592_5719_c1 | 3300050508 | Bacteria | 10140 |
| 597 | nmdc:mga09592_62770_c1 | 3300050508 | Bacteria | 3143 |
| 598 | nmdc:mga09592_6985_c1 | 3300050508 | Bacteria | 9181 |
| 599 | nmdc:mga09592_7229_c1 | 3300050508 | Bacteria | 9021 |
| 600 | nmdc:mga09592_73542_c1 | 3300050508 | Bacteria | 2904 |
| 601 | nmdc:mga09592_73718_c1 | 3300050508 | Bacteria | 2901 |
| 602 | nmdc:mga0qj67_200361_c1 | 3300050509 | Bacteria | 1622 |
| 603 | nmdc:mga0qj67_226955_c1 | 3300050509 | Bacteria | 1516 |
| 604 | nmdc:mga0qj67_368_c1 | 3300050509 | Bacteria | 30906 |
| 605 | nmdc:mga0qj67_434_c1 | 3300050509 | Bacteria | 28562 |
| 606 | nmdc:mga06r32_10643_c1 | 3300050510 | Bacteria | 8297 |
| 607 | nmdc:mga06r32_149714_c1 | 3300050510 | Bacteria | 2312 |
| 608 | nmdc:mga06r32_156640_c1 | 3300050510 | Bacteria | 2259 |
| 609 | nmdc:mga06r32_236125_c1 | 3300050510 | Bacteria | 1816 |
| 610 | nmdc:mga06r32_310_c1 | 3300050510 | Bacteria | 40451 |
| 611 | nmdc:mga06r32_36381_c1 | 3300050510 | Bacteria | 4651 |
| 612 | nmdc:mga06r32_372752_c1 | 3300050510 | Bacteria | 1410 |
| 613 | nmdc:mga06r32_383692_c1 | 3300050510 | Bacteria | 1388 |
| 614 | nmdc:mga06r32_946_c1 | 3300050510 | Bacteria | 25849 |
| 615 | nmdc:mga08y16_15283_c1 | 3300050511 | Bacteria | 8076 |
| 616 | nmdc:mga08y16_17465_c1 | 3300050511 | Bacteria | 7556 |
| 617 | nmdc:mga08y16_1893_c1 | 3300050511 | Bacteria | 21306 |
| 618 | nmdc:mga08y16_214656_c1 | 3300050511 | Bacteria | 1992 |
| 619 | nmdc:mga08y16_262381_c1 | 3300050511 | Bacteria | 1784 |
| 620 | nmdc:mga08y16_3612_c1 | 3300050511 | Bacteria | 16067 |
| 621 | nmdc:mga0n895_100327_c1 | 3300050512 | Bacteria | 2904 |
| 622 | nmdc:mga0n895_1004_c1 | 3300050512 | Bacteria | 20486 |
| 623 | nmdc:mga0n895_11003_c1 | 3300050512 | Bacteria | 8042 |
| 624 | nmdc:mga0n895_1147_c1 | 3300050512 | Bacteria | 19405 |
| 625 | nmdc:mga0n895_14820_c1 | 3300050512 | Bacteria | 7093 |
| 626 | nmdc:mga0n895_24482_c1 | 3300050512 | Bacteria | 5690 |
| 627 | nmdc:mga0n895_300911_c1 | 3300050512 | Bacteria | 1626 |
| 628 | nmdc:mga0n895_59918_c1 | 3300050512 | Bacteria | 3756 |
| 629 | nmdc:mga0n895_75238_c1 | 3300050512 | Bacteria | 3356 |
| 630 | nmdc:mga0rr50_119086_c1 | 3300050513 | Bacteria | 2099 |
| 631 | nmdc:mga0rr50_3299_c1 | 3300050513 | Bacteria | 9265 |
| 632 | nmdc:mga0rr50_52175_c1 | 3300050513 | Bacteria | 3038 |
| 633 | nmdc:mga0rr50_95909_c1 | 3300050513 | Bacteria | 2319 |
| 634 | nmdc:mga08x19_29101_c1 | 3300050514 | Bacteria | 3464 |
| 635 | nmdc:mga08x19_34912_c1 | 3300050514 | Bacteria | 3181 |
| 636 | nmdc:mga08x19_61153_c1 | 3300050514 | Bacteria | 2440 |
| 637 | nmdc:mga08x19_7241_c1 | 3300050514 | Bacteria | 6591 |
| 638 | nmdc:mga0a205_13854_c1 | 3300050515 | Bacteria | 7515 |
| 639 | nmdc:mga0a205_202547_c1 | 3300050515 | Bacteria | 1875 |
| 640 | nmdc:mga0a205_2566_c1 | 3300050515 | Bacteria | 16012 |
| 641 | nmdc:mga0a205_3241_c1 | 3300050515 | Bacteria | 14472 |
| 642 | nmdc:mga0a205_37303_c1 | 3300050515 | Bacteria | 4674 |
| 643 | nmdc:mga0a205_51372_c1 | 3300050515 | Bacteria | 3979 |
| 644 | nmdc:mga0a205_60239_c1 | 3300050515 | Bacteria | 3666 |
| 645 | nmdc:mga0a205_631_c1 | 3300050515 | Bacteria | 20134 |
| 646 | Ga0501084_0000275 | 3300054114 | Bacteria | 38937 |
| 647 | Ga0501084_0006119 | 3300054114 | Bacteria | 9893 |
| 648 | Ga0501084_0007853 | 3300054114 | Bacteria | 8780 |
| 649 | Ga0501084_0008159 | 3300054114 | Bacteria | 8634 |
| 650 | Ga0501084_0015096 | 3300054114 | Bacteria | 6406 |
| 651 | Ga0501084_0059633 | 3300054114 | Bacteria | 3194 |
| 652 | Ga0501084_0062518 | 3300054114 | Bacteria | 3117 |
| 653 | Ga0501084_0177820 | 3300054114 | Bacteria | 1796 |
| 654 | Ga0501084_0202037 | 3300054114 | Unclassified | 1677 |
| 655 | Ga0501082_0003916 | 3300060353 | Bacteria | 12992 |
| 656 | Ga0501082_0008743 | 3300060353 | Bacteria | 8728 |
| 657 | Ga0501082_0011181 | 3300060353 | Bacteria | 7714 |
| 658 | Ga0501082_0037933 | 3300060353 | Bacteria | 4156 |
| 659 | Ga0501082_0048265 | 3300060353 | Bacteria | 3670 |
| 660 | Ga0501082_0059701 | 3300060353 | Bacteria | 3286 |
| 661 | Ga0501082_0061108 | 3300060353 | Bacteria | 3243 |
| 662 | Ga0501082_0288454 | 3300060353 | Bacteria | 1429 |
| 663 | Ga0530510_0000095 | 3300061734 | Bacteria | 48147 |
| 664 | Ga0530510_0000627 | 3300061734 | Bacteria | 22781 |
| 665 | Ga0530510_0010758 | 3300061734 | Bacteria | 6420 |
| 666 | Ga0530510_0018005 | 3300061734 | Bacteria | 5007 |
| 667 | Ga0530510_0028157 | 3300061734 | Bacteria | 4029 |
| 668 | Ga0530510_0033521 | 3300061734 | Bacteria | 3697 |
| 669 | Ga0530510_0079740 | 3300061734 | Bacteria | 2381 |
| 670 | Ga0530510_0120033 | 3300061734 | Bacteria | 1929 |
| 671 | Ga0530510_0130991 | 3300061734 | Bacteria | 1845 |
| 672 | Ga0530510_0170606 | 3300061734 | Bacteria | 1611 |
| 673 | 2511700901 | 2511231119 | Bacteria | 4019861 |
| 674 | 2540608101 | 2540341094 | Bacteria | 4061186 |
| 675 | 2545559097 | 2545555800 | Bacteria | 4222588 |
| 676 | 2553395940 | 2551306519 | Bacteria | 5465154 |
| 677 | 2553396418 | 2551306519 | Bacteria | 5465154 |
| 678 | 2555468112 | 2554235283 | Bacteria | 3683090 |
| 679 | 2578933550 | 2576861599 | Bacteria | 4217202 |
| 680 | 2595090752 | 2593339131 | Bacteria | 5116855 |
| 681 | 2631985246 | 2630968484 | Bacteria | 3876276 |
| 682 | 2643766170 | 2643221549 | Bacteria | 4042819 |
| 683 | 2644706398 | 2643221729 | Bacteria | 6621700 |
| 684 | 2644708382 | 2643221729 | Bacteria | 6621700 |
| 685 | 2644713079 | 2643221730 | Bacteria | 6523787 |
| 686 | 2644714980 | 2643221730 | Bacteria | 6523787 |
| 687 | 2644715529 | 2643221731 | Bacteria | 5623886 |
| 688 | 2644726833 | 2643221732 | Bacteria | 5756404 |
| 689 | 2644739066 | 2643221735 | Bacteria | 3676263 |
| 690 | 2651530522 | 2648501850 | Bacteria | 3975476 |
| 691 | 2674422164 | 2671180844 | Bacteria | 4164150 |
| 692 | 2685148512 | 2684622632 | Bacteria | 5380049 |
| 693 | 2685152592 | 2684622632 | Bacteria | 5380049 |
| 694 | 2686998277 | 2684623153 | Bacteria | 3878815 |
| 695 | 2687499553 | 2687453109 | Bacteria | 3860091 |
| 696 | 2695628863 | 2695420354 | Bacteria | 3922431 |
| 697 | 2698320580 | 2695420987 | Bacteria | 6152737 |
| 698 | 2698324663 | 2695420987 | Bacteria | 6152737 |
| 699 | 2705992447 | 2703719227 | Bacteria | 5631989 |
| 700 | 2705996513 | 2703719227 | Bacteria | 5631989 |
| 701 | 2717915451 | 2716884898 | Bacteria | 3928789 |
| 702 | 2721503894 | 2718218445 | Bacteria | 5113413 |
| 703 | 2721507751 | 2718218445 | Bacteria | 5113413 |
| 704 | 2723641356 | 2721755702 | Bacteria | 4373124 |
| 705 | 2738815504 | 2738541295 | Bacteria | 5730091 |
| 706 | 2739157621 | 2738541358 | Bacteria | 5932299 |
| 707 | 2739158338 | 2738541358 | Bacteria | 5932299 |
| 708 | 2739209713 | 2738543006 | Bacteria | 5904091 |
| 709 | 2739211251 | 2738543006 | Bacteria | 5904091 |
| 710 | 2739229876 | 2738543010 | Bacteria | 5583595 |
| 711 | 2739270680 | 2738543017 | Bacteria | 4271950 |
| 712 | 2745165653 | 2744054657 | Bacteria | 5016802 |
| 713 | 2757568671 | 2757320391 | Bacteria | 4746095 |
| 714 | 2777763663 | 2775507177 | Bacteria | 4384303 |
| 715 | 2777836452 | 2775507192 | Bacteria | 4622234 |
| 716 | 2791214817 | 2788500588 | Bacteria | 4584915 |
| 717 | 2808867882 | 2808606364 | Bacteria | 4465927 |
| 718 | 2808901266 | 2808606372 | Bacteria | 4649509 |
| 719 | 2809053230 | 2808606399 | Bacteria | 4021018 |
| 720 | 2812317402 | 2811994870 | Bacteria | 3776934 |
| 721 | 2817481497 | 2816332295 | Bacteria | 4352468 |
| 722 | 2817617322 | 2816332336 | Bacteria | 5207640 |
| 723 | 2819581505 | 2818991443 | Bacteria | 6598732 |
| 724 | 2819583314 | 2818991443 | Bacteria | 6598732 |
| 725 | 2819628308 | 2818991451 | Bacteria | 4697364 |
| 726 | 2819708997 | 2818991465 | Bacteria | 5388835 |
| 727 | 2819722460 | 2818991468 | Bacteria | 3723169 |
| 728 | 2823529368 | 2823526263 | Bacteria | 3765752 |
| 729 | 2842884764 | 2842882022 | Bacteria | 6158489 |
| 730 | 2852675971 | 2852673933 | Bacteria | 3347676 |
| 731 | 2857589154 | 2857586860 | Bacteria | 4354574 |
| 732 | 2860840891 | 2860837431 | Bacteria | 4202080 |
| 733 | 2865004522 | 2865002811 | Bacteria | 6333767 |
| 734 | 2877771785 | 2877768649 | Bacteria | 3957164 |
| 735 | 2880172627 | 2880169592 | Bacteria | 3900066 |
| 736 | 2889043674 | 2889042446 | Bacteria | 7618936 |
| 737 | 2897112899 | 2897109615 | Bacteria | 4009619 |
| 738 | 2904495131 | 2904490793 | Bacteria | 7046938 |
| 739 | 2904524206 | 2904524088 | Bacteria | 5887454 |
| 740 | 2904563771 | 2904560550 | Bacteria | 4029838 |
| 741 | 2904609603 | 2904606771 | Bacteria | 4684500 |
| 742 | 2907207080 | 2907202186 | Bacteria | 6632024 |
| 743 | 2908666740 | 2908665501 | Bacteria | 3678115 |
| 744 | 2919095242 | 2919093281 | Bacteria | 3660974 |
| 745 | 2919147217 | 2919143609 | Bacteria | 6219228 |
| 746 | 2919163672 | 2919160200 | Bacteria | 6929020 |
| 747 | 2919417621 | 2919414237 | Bacteria | 5429133 |
| 748 | 2919429726 | 2919425241 | Bacteria | 8055701 |
| 749 | 2919519121 | 2919517244 | Bacteria | 5858162 |
| 750 | 2919723489 | 2919720352 | Bacteria | 5986006 |
| 751 | 2919727807 | 2919726948 | Bacteria | 3696050 |
| 752 | 2928095984 | 2928093941 | Bacteria | 5965005 |
| 753 | 2929006644 | 2929004312 | Bacteria | 5678476 |
| 754 | 2929233765 | 2929233124 | Bacteria | 5948380 |
| 755 | 2929238295 | 2929233124 | Bacteria | 5948380 |
| 756 | 2931387135 | 2931384279 | Bacteria | 7299545 |
| 757 | 2935410775 | 2935409751 | Bacteria | 4179611 |
| 758 | 2935891863 | 2935890801 | Bacteria | 4593001 |
| 759 | 2936342730 | 2936340661 | Bacteria | 5139038 |
| 760 | 2936362106 | 2936361878 | Bacteria | 5632809 |
| 761 | 2938917933 | 2938917290 | Bacteria | 5914775 |
| 762 | 2938922491 | 2938917290 | Bacteria | 5914775 |
| 763 | 2939595334 | 2939593269 | Bacteria | 4798695 |
| 764 | 2945994276 | 2945991243 | Bacteria | 7008369 |
| 765 | 2946057036 | 2946053406 | Bacteria | 6978655 |
| 766 | 2947427253 | 2947426588 | Bacteria | 5357194 |
| 767 | 2947431380 | 2947426588 | Bacteria | 5357194 |
| 768 | 2954777091 | 2954773129 | Bacteria | 3741715 |
| 769 | 2956897710 | 2956897341 | Bacteria | 5447711 |
| 770 | 2960319603 | 2960319331 | Bacteria | 5502575 |
| 771 | 2960381186 | 2960375949 | Bacteria | 5361395 |
| 772 | 2962294118 | 2962290636 | Bacteria | 4072939 |
| 773 | 2965761820 | 2965761152 | Bacteria | 5806513 |
| 774 | 2965765875 | 2965761152 | Bacteria | 5806513 |
| 775 | 2969140099 | 2969136845 | Bacteria | 3923176 |
| 776 | 2969144339 | 2969141011 | Bacteria | 4118468 |
| 777 | 2969769140 | 2969765954 | Bacteria | 4216713 |
| 778 | 2969771455 | 2969770375 | Bacteria | 4271280 |
| 779 | 2971896451 | 2971893375 | Bacteria | 3929648 |
| 780 | 2977256302 | 2977254563 | Bacteria | 4828420 |
| 781 | 2979084246 | 2979083700 | Bacteria | 5894929 |
| 782 | 2979088281 | 2979083700 | Bacteria | 5894929 |
| 783 | 2980495886 | 2980492589 | Bacteria | 4072961 |
| 784 | 2984530846 | 2984527788 | Bacteria | 5288478 |
| 785 | 2984536955 | 2984532647 | Bacteria | 5288506 |
| 786 | 2990277181 | 2990275345 | Bacteria | 4887158 |
| 787 | 3001897491 | 3001892409 | Bacteria | 6328293 |
| 788 | 3006861922 | 3006858327 | Bacteria | 4317835 |
| 789 | 3006882609 | 3006879489 | Bacteria | 4064221 |
| 790 | 3006971887 | 3006969106 | Bacteria | 4739423 |
| 791 | 3006976216 | 3006973921 | Bacteria | 4423788 |
| 792 | 3006981199 | 3006978542 | Bacteria | 5328100 |
| 793 | 8022621690 | 8022621104 | Bacteria | 5241040 |
| 794 | 8022624545 | 8022621104 | Bacteria | 5241040 |
| 795 | 8022633050 | 8022630665 | Bacteria | 3886130 |
| 796 | 8022655766 | 8022653035 | Bacteria | 4035078 |
| 797 | 8022797987 | 8022792930 | Bacteria | 5693794 |
| 798 | 8022898467 | 8022893055 | Bacteria | 5300455 |
| 799 | 8022917618 | 8022914991 | Bacteria | 5584517 |
| 800 | 8023438907 | 8023438354 | Bacteria | 5779374 |
| 801 | 8023443685 | 8023438354 | Bacteria | 5779374 |
| 802 | 8023445490 | 8023444577 | Bacteria | 5661597 |
| 803 | 8023450380 | 8023444577 | Bacteria | 5661597 |
| 804 | 8046353574 | 8046352972 | Bacteria | 3613806 |
| 805 | 8051954596 | 8051952484 | Bacteria | 3926774 |
| 806 | 8052175317 | 8052174270 | Bacteria | 3881265 |
| 807 | 8054282492 | 8054280661 | Bacteria | 4232245 |
| 808 | 8055535889 | 8055531788 | Bacteria | 5249694 |
| 809 | 8057583322 | 8057582654 | Bacteria | 5218944 |
| 810 | 8057587044 | 8057582654 | Bacteria | 5218944 |
| 811 | 8057636061 | 8057632132 | Bacteria | 4726859 |
| 812 | 8057733828 | 8057733483 | Bacteria | 6578323 |
| 813 | Ga0501031_0003713 | |||
| 814 | JGI25159J45721_1006689 | |||
| 815 | JGI25159J45721_1011084 | |||
| 816 | JGI25151J46595_10000533 | |||
| 817 | JGI25151J46595_10001687 | |||
| 818 | JGI25151J46595_10013431 | |||
| 819 | JGI25151J46595_10013727 | |||
| 820 | JGI25151J46595_10019425 | |||
| 821 | rootH1_10001445 | |||
| 822 | rootL2_10013974 | |||
| 823 | rootH1_10053710 | |||
| 824 | Ga0006562J51391_1000459 | |||
| 825 | Ga0006562J51391_1001698 | |||
| 826 | Ga0006562J51391_1012090 | |||
| 827 | Ga0055528_1003542 | |||
| 828 | Ga0065707_10114142 | |||
| 829 | Ga0065707_10167548 | |||
| 830 | Ga0070676_10000180 | |||
| 831 | Ga0070676_10226166 | |||
| 832 | Ga0070670_100006546 | |||
| 833 | Ga0068869_100000723 | |||
| 834 | Ga0070666_10004839 | |||
| 835 | Ga0070680_100013896 | |||
| 836 | Ga0070680_100203284 | |||
| 837 | Ga0070682_100000622 | |||
| 838 | Ga0070660_100002171 | |||
| 839 | Ga0070689_100008079 | |||
| 840 | Ga0070689_100254197 | |||
| 841 | Ga0070687_100006063 | |||
| 842 | Ga0070661_100000211 | |||
| 843 | Ga0070692_10000947 | |||
| 844 | Ga0070668_100398961 | |||
| 845 | Ga0070669_100385812 | |||
| 846 | Ga0070675_100165867 | |||
| 847 | Ga0070671_100005118 | |||
| 848 | Ga0070673_100001462 | |||
| 849 | Ga0070659_100000204 | |||
| 850 | Ga0070703_10013650 | |||
| 851 | Ga0070701_10009895 | |||
| 852 | Ga0070705_100001378 | |||
| 853 | Ga0070694_100001824 | |||
| 854 | Ga0070694_100005813 | |||
| 855 | Ga0070694_100049879 | |||
| 856 | Ga0070708_100008247 | |||
| 857 | Ga0070708_100026566 | |||
| 858 | Ga0070708_100043172 | |||
| 859 | Ga0070708_100089602 | |||
| 860 | Ga0070708_100123968 | |||
| 861 | Ga0070708_100150468 | |||
| 862 | Ga0070708_100165316 | |||
| 863 | Ga0070708_100197719 | |||
| 864 | Ga0070708_100314354 | |||
| 865 | Ga0070662_100031002 | |||
| 866 | Ga0070662_100218281 | |||
| 867 | Ga0070681_10216955 | |||
| 868 | Ga0068867_100000382 | |||
| 869 | Ga0070706_100000575 | |||
| 870 | Ga0070706_100005446 | |||
| 871 | Ga0070706_100016657 | |||
| 872 | Ga0070706_100025460 | |||
| 873 | Ga0070706_100029052 | |||
| 874 | Ga0070706_100099346 | |||
| 875 | Ga0070706_100296978 | |||
| 876 | Ga0070707_100003191 | |||
| 877 | Ga0070707_100005498 | |||
| 878 | Ga0070707_100006333 | |||
| 879 | Ga0070707_100014780 | |||
| 880 | Ga0070707_100035031 | |||
| 881 | Ga0070707_100036244 | |||
| 882 | Ga0070698_100004886 | |||
| 883 | Ga0070698_100012284 | |||
| 884 | Ga0070698_100027252 | |||
| 885 | Ga0070698_100131425 | |||
| 886 | Ga0070698_100142590 | |||
| 887 | Ga0070699_100005366 | |||
| 888 | Ga0070699_100020042 | |||
| 889 | Ga0070699_100024234 | |||
| 890 | Ga0070699_100085305 | |||
| 891 | Ga0070699_100093255 | |||
| 892 | Ga0070699_100392218 | |||
| 893 | Ga0070679_100063874 | |||
| 894 | Ga0070697_100005980 | |||
| 895 | Ga0070697_100012817 | |||
| 896 | Ga0070697_100051482 | |||
| 897 | Ga0070697_100134582 | |||
| 898 | Ga0070697_100219293 | |||
| 899 | Ga0070697_100326369 | |||
| 900 | Ga0070672_100007462 | |||
| 901 | Ga0070686_100079813 | |||
| 902 | Ga0070695_100000456 | |||
| 903 | Ga0070695_100001317 | |||
| 904 | Ga0070695_100004963 | |||
| 905 | Ga0070695_100033546 | |||
| 906 | Ga0070696_100024923 | |||
| 907 | Ga0070696_100032571 | |||
| 908 | Ga0070696_100083236 | |||
| 909 | Ga0070693_100000530 | |||
| 910 | Ga0070704_100024209 | |||
| 911 | Ga0070704_100059040 | |||
| 912 | Ga0070704_100280396 | |||
| 913 | Ga0068855_100000319 | |||
| 914 | Ga0068857_100011491 | |||
| 915 | Ga0068856_100006539 | |||
| 916 | Ga0068859_100168128 | |||
| 917 | Ga0068859_100206768 | |||
| 918 | Ga0068864_100009783 | |||
| 919 | Ga0068861_100024675 | |||
| 920 | Ga0068870_10002333 | |||
| 921 | Ga0068863_100034656 | |||
| 922 | Ga0068863_100047886 | |||
| 923 | Ga0068860_100006217 | |||
| 924 | Ga0068860_100091709 | |||
| 925 | Ga0068862_100000487 | |||
| 926 | Ga0068862_100043144 | |||
| 927 | Ga0081455_10001297 | |||
| 928 | Ga0081455_10024510 | |||
| 929 | Ga0081538_10024747 | |||
| 930 | Ga0081540_1011967 | |||
| 931 | Ga0081539_10000083 | |||
| 932 | Ga0070715_10013289 | |||
| 933 | Ga0070716_100013575 | |||
| 934 | Ga0070712_100030550 | |||
| 935 | Ga0075428_100000176 | |||
| 936 | Ga0075428_100005443 | |||
| 937 | Ga0075428_100013979 | |||
| 938 | Ga0075428_100016686 | |||
| 939 | Ga0075428_100026627 | |||
| 940 | Ga0075428_100048838 | |||
| 941 | Ga0075428_100079816 | |||
| 942 | Ga0075428_100093075 | |||
| 943 | Ga0075428_100153450 | |||
| 944 | Ga0075428_100163079 | |||
| 945 | Ga0075428_100195872 | |||
| 946 | Ga0075428_100202537 | |||
| 947 | Ga0075430_100000127 | |||
| 948 | Ga0075430_100001542 | |||
| 949 | Ga0075430_100009967 | |||
| 950 | Ga0075430_100038989 | |||
| 951 | Ga0075430_100125889 | |||
| 952 | Ga0075430_100189762 | |||
| 953 | Ga0075430_100263504 | |||
| 954 | Ga0075431_100000420 | |||
| 955 | Ga0075431_100001064 | |||
| 956 | Ga0075431_100002573 | |||
| 957 | Ga0075431_100002829 | |||
| 958 | Ga0075431_100014931 | |||
| 959 | Ga0075431_100019582 | |||
| 960 | Ga0075431_100025894 | |||
| 961 | Ga0075431_100039873 | |||
| 962 | Ga0075431_100048791 | |||
| 963 | Ga0075431_100121988 | |||
| 964 | Ga0075431_100125332 | |||
| 965 | Ga0075431_100167411 | |||
| 966 | Ga0075433_10000052 | |||
| 967 | Ga0075433_10003282 | |||
| 968 | Ga0075433_10009615 | |||
| 969 | Ga0075433_10011249 | |||
| 970 | Ga0075433_10041400 | |||
| 971 | Ga0075433_10042260 | |||
| 972 | Ga0075433_10042774 | |||
| 973 | Ga0075433_10084754 | |||
| 974 | Ga0075433_10149092 | |||
| 975 | Ga0075434_100000262 | |||
| 976 | Ga0075434_100005556 | |||
| 977 | Ga0075434_100024034 | |||
| 978 | Ga0075434_100026524 | |||
| 979 | Ga0075434_100041791 | |||
| 980 | Ga0075434_100049091 | |||
| 981 | Ga0075434_100069888 | |||
| 982 | Ga0075434_100110462 | |||
| 983 | Ga0075434_100249083 | |||
| 984 | Ga0075429_100000075 | |||
| 985 | Ga0075429_100001545 | |||
| 986 | Ga0075429_100002125 | |||
| 987 | Ga0075429_100005105 | |||
| 988 | Ga0075429_100009405 | |||
| 989 | Ga0075429_100020608 | |||
| 990 | Ga0075429_100084784 | |||
| 991 | Ga0075429_100130324 | |||
| 992 | Ga0075429_100217967 | |||
| 993 | Ga0068865_100004300 | |||
| 994 | Ga0075436_100004665 | |||
| 995 | Ga0075436_100033886 | |||
| 996 | Ga0075436_100215906 | |||
| 997 | Ga0097620_100168138 | |||
| 998 | Ga0097620_100206740 | |||
| 999 | Ga0075435_100004032 | |||
| 1000 | Ga0075435_100016853 | |||
| 1001 | Ga0075435_100021132 | |||
| 1002 | Ga0075435_100031404 | |||
| 1003 | Ga0075435_100031867 | |||
| 1004 | Ga0075435_100036724 | |||
| 1005 | Ga0075435_100179627 | |||
| 1006 | Ga0099794_10000310 | |||
| 1007 | Ga0111539_10000103 | |||
| 1008 | Ga0111539_10000275 | |||
| 1009 | Ga0111539_10002668 | |||
| 1010 | Ga0111539_10011048 | |||
| 1011 | Ga0111539_10045183 | |||
| 1012 | Ga0111539_10059861 | |||
| 1013 | Ga0111539_10113573 | |||
| 1014 | Ga0111539_10137534 | |||
| 1015 | Ga0111539_10221507 | |||
| 1016 | Ga0105245_10020600 | |||
| 1017 | Ga0105247_10010339 | |||
| 1018 | Ga0114129_10001042 | |||
| 1019 | Ga0114129_10001782 | |||
| 1020 | Ga0114129_10001965 | |||
| 1021 | Ga0114129_10002034 | |||
| 1022 | Ga0114129_10009901 | |||
| 1023 | Ga0114129_10025266 | |||
| 1024 | Ga0114129_10029338 | |||
| 1025 | Ga0114129_10032461 | |||
| 1026 | Ga0114129_10032652 | |||
| 1027 | Ga0114129_10102529 | |||
| 1028 | Ga0114129_10134517 | |||
| 1029 | Ga0114129_10224297 | |||
| 1030 | Ga0114129_10247088 | |||
| 1031 | Ga0105243_10026774 | |||
| 1032 | Ga0105243_10089778 | |||
| 1033 | Ga0105243_10109561 | |||
| 1034 | Ga0105243_10246194 | |||
| 1035 | Ga0105241_10001179 | |||
| 1036 | Ga0105242_10020990 | |||
| 1037 | Ga0105242_10183849 | |||
| 1038 | Ga0105242_10199890 | |||
| 1039 | Ga0105248_10118792 | |||
| 1040 | Ga0105237_10248608 | |||
| 1041 | Ga0105246_10007951 | |||
| 1042 | Ga0105246_10017101 | |||
| 1043 | Ga0105246_10045911 | |||
| 1044 | Ga0157373_10004022 | |||
| 1045 | Ga0157371_10002617 | |||
| 1046 | Ga0157371_10117786 | |||
| 1047 | Ga0157369_10145836 | |||
| 1048 | Ga0157374_10103977 | |||
| 1049 | Ga0157374_10163626 | |||
| 1050 | Ga0157378_10007084 | |||
| 1051 | Ga0157378_10124657 | |||
| 1052 | Ga0157378_10204714 | |||
| 1053 | Ga0163162_10081712 | |||
| 1054 | Ga0157372_10006181 | |||
| 1055 | Ga0157372_10115328 | |||
| 1056 | Ga0157375_10084609 | |||
| 1057 | Ga0163163_10049524 | |||
| 1058 | Ga0157380_10258224 | |||
| 1059 | Ga0157377_10025210 | |||
| 1060 | Ga0163161_10040790 | |||
| 1061 | Ga0209566_100709 | |||
| 1062 | Ga0209147_100262 | |||
| 1063 | Ga0209147_102106 | |||
| 1064 | Ga0209147_102633 | |||
| 1065 | Ga0209147_102729 | |||
| 1066 | Ga0209437_100552 | |||
| 1067 | Ga0209130_1001035 | |||
| 1068 | Ga0209130_1002803 | |||
| 1069 | Ga0209130_1004812 | |||
| 1070 | Ga0209130_1004843 | |||
| 1071 | Ga0209025_1000011 | |||
| 1072 | Ga0209025_1000347 | |||
| 1073 | Ga0209025_1000388 | |||
| 1074 | Ga0209025_1001677 | |||
| 1075 | Ga0209025_1001722 | |||
| 1076 | Ga0209025_1002269 | |||
| 1077 | Ga0209025_1003207 | |||
| 1078 | Ga0209025_1004185 | |||
| 1079 | Ga0207426_1030025 | |||
| 1080 | Ga0207696_1000865 | |||
| 1081 | Ga0207696_1002049 | |||
| 1082 | Ga0207696_1011712 | |||
| 1083 | Ga0207655_1002285 | |||
| 1084 | Ga0207655_1002655 | |||
| 1085 | Ga0207713_1000727 | |||
| 1086 | Ga0207653_10005861 | |||
| 1087 | Ga0207688_10019936 | |||
| 1088 | Ga0207680_10001137 | |||
| 1089 | Ga0207645_10014975 | |||
| 1090 | Ga0207643_10001863 | |||
| 1091 | Ga0207643_10089464 | |||
| 1092 | Ga0207684_10000791 | |||
| 1093 | Ga0207684_10001023 | |||
| 1094 | Ga0207684_10051763 | |||
| 1095 | Ga0207684_10056514 | |||
| 1096 | Ga0207684_10240086 | |||
| 1097 | Ga0207707_10000116 | |||
| 1098 | Ga0207707_10105875 | |||
| 1099 | Ga0207671_10000004 | |||
| 1100 | Ga0207671_10079923 | |||
| 1101 | Ga0207693_10060883 | |||
| 1102 | Ga0207660_10002889 | |||
| 1103 | Ga0207660_10035684 | |||
| 1104 | Ga0207662_10140571 | |||
| 1105 | Ga0207657_10002084 | |||
| 1106 | Ga0207649_10001837 | |||
| 1107 | Ga0207652_10003098 | |||
| 1108 | Ga0207646_10000699 | |||
| 1109 | Ga0207646_10001026 | |||
| 1110 | Ga0207646_10005460 | |||
| 1111 | Ga0207646_10009250 | |||
| 1112 | Ga0207646_10016411 | |||
| 1113 | Ga0207646_10084601 | |||
| 1114 | Ga0207646_10103196 | |||
| 1115 | Ga0207646_10104687 | |||
| 1116 | Ga0207646_10105059 | |||
| 1117 | Ga0207646_10223467 | |||
| 1118 | Ga0207681_10015108 | |||
| 1119 | Ga0207681_10044083 | |||
| 1120 | Ga0207681_10253309 | |||
| 1121 | Ga0207650_10058472 | |||
| 1122 | Ga0207687_10056051 | |||
| 1123 | Ga0207687_10062108 | |||
| 1124 | Ga0207706_10005422 | |||
| 1125 | Ga0207706_10007465 | |||
| 1126 | Ga0207686_10087504 | |||
| 1127 | Ga0207709_10109139 | |||
| 1128 | Ga0207704_10012977 | |||
| 1129 | Ga0207704_10045818 | |||
| 1130 | Ga0207665_10002315 | |||
| 1131 | Ga0207691_10013829 | |||
| 1132 | Ga0207689_10000058 | |||
| 1133 | Ga0207689_10000942 | |||
| 1134 | Ga0207661_10136346 | |||
| 1135 | Ga0207679_10002446 | |||
| 1136 | Ga0207667_10000342 | |||
| 1137 | Ga0207712_10172180 | |||
| 1138 | Ga0207678_10000501 | |||
| 1139 | Ga0207702_10002217 | |||
| 1140 | Ga0207648_10006801 | |||
| 1141 | Ga0207648_10130282 | |||
| 1142 | Ga0207676_10069053 | |||
| 1143 | Ga0207674_10002881 | |||
| 1144 | Ga0207675_100023622 | |||
| 1145 | Ga0207675_100138013 | |||
| 1146 | Ga0207675_100153769 | |||
| 1147 | Ga0207683_10306608 | |||
| 1148 | Ga0207698_10102499 | |||
| 1149 | Ga0209967_1004631 | |||
| 1150 | Ga0209968_1000806 | |||
| 1151 | Ga0209999_1001372 | |||
| 1152 | Ga0209983_1000013 | |||
| 1153 | Ga0209588_1018913 | |||
| 1154 | Ga0209971_1000042 | |||
| 1155 | Ga0209966_1000026 | |||
| 1156 | Ga0209998_10000004 | |||
| 1157 | Ga0207428_10000362 | |||
| 1158 | Ga0207428_10000725 | |||
| 1159 | Ga0207428_10004772 | |||
| 1160 | Ga0207428_10007573 | |||
| 1161 | Ga0207428_10064694 | |||
| 1162 | Ga0268265_10025321 | |||
| 1163 | Ga0268265_10157504 | |||
| 1164 | Ga0268265_10218025 | |||
| 1165 | Ga0268264_10011418 | |||
| 1166 | Ga0237817_10260 | |||
| 1167 | Ga0307408_100006448 | |||
| 1168 | Ga0307408_100012648 | |||
| 1169 | Ga0307408_100053321 | |||
| 1170 | Ga0316575_10000015 | |||
| 1171 | Ga0316579_10024153 | |||
| 1172 | Ga0307405_10113639 | |||
| 1173 | Ga0307410_10053802 | |||
| 1174 | Ga0307406_10017580 | |||
| 1175 | Ga0307406_10064264 | |||
| 1176 | Ga0307407_10184290 | |||
| 1177 | Ga0307409_100022958 | |||
| 1178 | Ga0307409_100023445 | |||
| 1179 | Ga0307416_100017473 | |||
| 1180 | Ga0307416_100131739 | |||
| 1181 | Ga0307411_10215515 | |||
| 1182 | Ga0373926_0026563 | |||
| 1183 | Ga0373934_0011489 | |||
| 1184 | Ga0373940_0014932 | |||
| 1185 | Ga0373949_0003723 | |||
| 1186 | Ga0373932_0009309 | |||
| 1187 | Ga0373932_0015532 | |||
| 1188 | Ga0373941_0008061 | |||
| 1189 | Ga0373960_0010159 | |||
| 1190 | Ga0373942_0029573 | |||
| 1191 | Ga0316574_0056237 | |||
| 1192 | Ga0373931_0006289 | |||
| 1193 | Ga0373931_0058970 | |||
| 1194 | Ga0373931_0090580 | |||
| 1195 | Ga0373927_0007561 | |||
| 1196 | Ga0373947_0000119 | |||
| 1197 | Ga0316584_0123445 | |||
| 1198 | Ga0316584_0243415 | |||
| 1199 | Ga0373925_0000296 | |||
| 1200 | Ga0395899_0023769 | |||
| 1201 | Ga0395899_0178737 | |||
| 1202 | Ga0395900_0009304 | |||
| 1203 | Ga0395898_0013990 | |||
| 1204 | Ga0395905_0229960 | |||
| 1205 | Ga0395901_0001591 | |||
| 1206 | Ga0237819_00149 | |||
| 1207 | Ga0237819_00173 | |||
| 1208 | Ga0400489_63543 | |||
| 1209 | Ga0439448_0001756 | |||
| 1210 | Ga0439449_0007338 | |||
| 1211 | Ga0450903_015402 | |||
| 1212 | Ga0439435_0041304 | |||
| 1213 | Ga0439460_0005173 | |||
| 1214 | Ga0451577_0000254 | |||
| 1215 | Ga0451577_0000807 | |||
| 1216 | Ga0451577_0006179 | |||
| 1217 | Ga0451577_0011400 | |||
| 1218 | Ga0451577_0015473 | |||
| 1219 | Ga0451577_0029889 | |||
| 1220 | Ga0451577_0201785 | |||
| 1221 | Ga0453683_0081301 | |||
| 1222 | Ga0453684_0000177 | |||
| 1223 | Ga0453684_0000521 | |||
| 1224 | Ga0453684_0036531 | |||
| 1225 | Ga0453684_0120871 | |||
| 1226 | Ga0453684_0196602 | |||
| 1227 | Ga0466960_0022141 | |||
| 1228 | Ga0466960_0035408 | |||
| 1229 | Ga0451576_0005053 | |||
| 1230 | Ga0451576_0053415 | |||
| 1231 | Ga0451576_0074153 | |||
| 1232 | Ga0451576_0379220 | |||
| 1233 | Ga0466967_0000623 | |||
| 1234 | Ga0466967_0011821 | |||
| 1235 | Ga0495580_0014869 | |||
| 1236 | Ga0495584_0102081 | |||
| 1237 | Ga0495665_0048643 | |||
| 1238 | Ga0496102_0009055 | |||
| 1239 | Ga0496102_0233068 | |||
| 1240 | Ga0496104_0008096 | |||
| 1241 | Ga0496106_0000224 | |||
| 1242 | Ga0496107_0011410 | |||
| 1243 | Ga0496107_0116394 | |||
| 1244 | Ga0496108_0002369 | |||
| 1245 | Ga0496109_0003788 | |||
| 1246 | Ga0496111_0001047 | |||
| 1247 | Ga0496112_0036159 | |||
| 1248 | Ga0496112_0291378 | |||
| 1249 | Ga0496118_0087869 | |||
| 1250 | Ga0496120_0043874 | |||
| 1251 | Ga0496123_0049803 | |||
| 1252 | Ga0496124_0022607 | |||
| 1253 | Ga0496125_0006100 | |||
| 1254 | Ga0501343_003403 | |||
| 1255 | Ga0501345_00134 | |||
| 1256 | Ga0501305_002424 | |||
| 1257 | Ga0501315_008731 | |||
| 1258 | Ga0501316_001034 | |||
| 1259 | Ga0501317_001707 | |||
| 1260 | Ga0501317_009014 | |||
| 1261 | Ga0501321_002237 | |||
| 1262 | Ga0501333_000393 | |||
| 1263 | Ga0501334_00268 | |||
| 1264 | Ga0501335_002446 | |||
| 1265 | Ga0501336_000403 | |||
| 1266 | Ga0501337_001621 | |||
| 1267 | Ga0501338_00318 | |||
| 1268 | Ga0501032_0054797 | |||
| 1269 | Ga0501033_0124880 | |||
| 1270 | Ga0501034_0022032 | |||
| 1271 | Ga0501034_0424939 | |||
| 1272 | Ga0501036_0001372 | |||
| 1273 | Ga0501036_0054566 | |||
| 1274 | Ga0501036_0124414 | |||
| 1275 | Ga0501036_0188360 | |||
| 1276 | Ga0501037_0250361 | |||
| 1277 | Ga0501038_0006167 | |||
| 1278 | Ga0501038_0026494 | |||
| 1279 | Ga0501039_0000732 | |||
| 1280 | Ga0501039_0001276 | |||
| 1281 | Ga0501039_0108628 | |||
| 1282 | Ga0501040_0001412 | |||
| 1283 | Ga0501040_0020581 | |||
| 1284 | Ga0501040_0030755 | |||
| 1285 | Ga0501040_0045597 | |||
| 1286 | Ga0501040_0081324 | |||
| 1287 | Ga0501040_0105814 | |||
| 1288 | Ga0501040_0183043 | |||
| 1289 | Ga0501040_0293598 | |||
| 1290 | Ga0501041_0001736 | |||
| 1291 | Ga0501041_0001961 | |||
| 1292 | Ga0501041_0008896 | |||
| 1293 | Ga0501041_0030385 | |||
| 1294 | Ga0501041_0033360 | |||
| 1295 | Ga0501041_0034594 | |||
| 1296 | Ga0501041_0053370 | |||
| 1297 | Ga0501041_0075834 | |||
| 1298 | Ga0501042_0000612 | |||
| 1299 | Ga0501042_0011683 | |||
| 1300 | Ga0501042_0111678 | |||
| 1301 | Ga0501042_0124885 | |||
| 1302 | Ga0501046_0000569 | |||
| 1303 | Ga0501046_0023086 | |||
| 1304 | Ga0501046_0050256 | |||
| 1305 | Ga0501046_0093767 | |||
| 1306 | Ga0501046_0163079 | |||
| 1307 | Ga0501048_0010098 | |||
| 1308 | Ga0501048_0012603 | |||
| 1309 | Ga0501048_0049651 | |||
| 1310 | Ga0501067_0009258 | |||
| 1311 | Ga0501068_0018610 | |||
| 1312 | Ga0501071_0024984 | |||
| 1313 | Ga0501071_0057465 | |||
| 1314 | Ga0501071_0070526 | |||
| 1315 | Ga0501071_0098163 | |||
| 1316 | Ga0501072_0001347 | |||
| 1317 | Ga0501072_0003106 | |||
| 1318 | Ga0501072_0036536 | |||
| 1319 | Ga0501072_0046054 | |||
| 1320 | Ga0501072_0064458 | |||
| 1321 | Ga0501073_0097233 | |||
| 1322 | Ga0501074_0080564 | |||
| 1323 | Ga0501075_0005765 | |||
| 1324 | Ga0501075_0008362 | |||
| 1325 | Ga0501075_0012802 | |||
| 1326 | Ga0501075_0018641 | |||
| 1327 | Ga0501075_0024428 | |||
| 1328 | Ga0501075_0047343 | |||
| 1329 | Ga0501075_0053650 | |||
| 1330 | Ga0501075_0094442 | |||
| 1331 | Ga0501075_0103809 | |||
| 1332 | Ga0501075_0133149 | |||
| 1333 | Ga0501075_0152331 | |||
| 1334 | Ga0501075_0156881 | |||
| 1335 | Ga0501075_0191037 | |||
| 1336 | Ga0501076_0003600 | |||
| 1337 | Ga0501076_0006299 | |||
| 1338 | Ga0501076_0006927 | |||
| 1339 | Ga0501076_0009215 | |||
| 1340 | Ga0501076_0011783 | |||
| 1341 | Ga0501076_0058249 | |||
| 1342 | Ga0501076_0059692 | |||
| 1343 | Ga0501076_0065959 | |||
| 1344 | Ga0501076_0102596 | |||
| 1345 | Ga0501076_0127521 | |||
| 1346 | Ga0501076_0259376 | |||
| 1347 | Ga0501077_0002373 | |||
| 1348 | Ga0501077_0008127 | |||
| 1349 | Ga0501077_0011985 | |||
| 1350 | Ga0501077_0019307 | |||
| 1351 | Ga0501077_0020362 | |||
| 1352 | Ga0501077_0030055 | |||
| 1353 | Ga0501077_0040264 | |||
| 1354 | Ga0501077_0103170 | |||
| 1355 | Ga0501077_0111175 | |||
| 1356 | Ga0501217_010474 | |||
| 1357 | Ga0501234_005621 | |||
| 1358 | Ga0501079_0001721 | |||
| 1359 | Ga0501079_0002033 | |||
| 1360 | Ga0501079_0002716 | |||
| 1361 | Ga0501079_0016969 | |||
| 1362 | Ga0501079_0017072 | |||
| 1363 | Ga0501079_0041821 | |||
| 1364 | Ga0501079_0046539 | |||
| 1365 | Ga0501079_0138277 | |||
| 1366 | Ga0501079_0173335 | |||
| 1367 | Ga0501080_0002636 | |||
| 1368 | Ga0501080_0010554 | |||
| 1369 | Ga0501080_0010775 | |||
| 1370 | Ga0501080_0015311 | |||
| 1371 | Ga0501080_0157765 | |||
| 1372 | Ga0501080_0338555 | |||
| 1373 | Ga0501081_0000748 | |||
| 1374 | Ga0501081_0001683 | |||
| 1375 | Ga0501081_0005714 | |||
| 1376 | Ga0501081_0007899 | |||
| 1377 | Ga0501081_0007939 | |||
| 1378 | Ga0501081_0014410 | |||
| 1379 | Ga0501081_0084147 | |||
| 1380 | Ga0501081_0133800 | |||
| 1381 | Ga0501083_0018906 | |||
| 1382 | Ga0501083_0021069 | |||
| 1383 | Ga0501083_0167078 | |||
| 1384 | Ga0501035_0039014 | |||
| 1385 | Ga0501035_0042299 | |||
| 1386 | Ga0501045_0004910 | |||
| 1387 | Ga0501045_0007926 | |||
| 1388 | Ga0501045_0051357 | |||
| 1389 | Ga0501045_0060448 | |||
| 1390 | Ga0501045_0131983 | |||
| 1391 | Ga0501045_0135931 | |||
| 1392 | Ga0501045_0141757 | |||
| 1393 | nmdc:mga05p37_169602_c1 | |||
| 1394 | nmdc:mga05p37_176129_c1 | |||
| 1395 | nmdc:mga05p37_201439_c1 | |||
| 1396 | nmdc:mga05p37_2470_c1 | |||
| 1397 | nmdc:mga05p37_2665_c1 | |||
| 1398 | nmdc:mga05p37_297300_c1 | |||
| 1399 | nmdc:mga05p37_3353_c1 | |||
| 1400 | nmdc:mga05p37_4677_c1 | |||
| 1401 | nmdc:mga05p37_47945_c1 | |||
| 1402 | nmdc:mga05p37_50895_c1 | |||
| 1403 | nmdc:mga05p37_510_c1 | |||
| 1404 | nmdc:mga05p37_5932_c1 | |||
| 1405 | nmdc:mga05p37_65451_c1 | |||
| 1406 | nmdc:mga09592_2520_c1 | |||
| 1407 | nmdc:mga09592_4797_c1 | |||
| 1408 | nmdc:mga09592_5719_c1 | |||
| 1409 | nmdc:mga09592_62770_c1 | |||
| 1410 | nmdc:mga09592_6985_c1 | |||
| 1411 | nmdc:mga09592_7229_c1 | |||
| 1412 | nmdc:mga09592_73542_c1 | |||
| 1413 | nmdc:mga09592_73718_c1 | |||
| 1414 | nmdc:mga0qj67_200361_c1 | |||
| 1415 | nmdc:mga0qj67_226955_c1 | |||
| 1416 | nmdc:mga0qj67_368_c1 | |||
| 1417 | nmdc:mga0qj67_434_c1 | |||
| 1418 | nmdc:mga06r32_10643_c1 | |||
| 1419 | nmdc:mga06r32_149714_c1 | |||
| 1420 | nmdc:mga06r32_156640_c1 | |||
| 1421 | nmdc:mga06r32_236125_c1 | |||
| 1422 | nmdc:mga06r32_310_c1 | |||
| 1423 | nmdc:mga06r32_36381_c1 | |||
| 1424 | nmdc:mga06r32_372752_c1 | |||
| 1425 | nmdc:mga06r32_383692_c1 | |||
| 1426 | nmdc:mga06r32_946_c1 | |||
| 1427 | nmdc:mga08y16_15283_c1 | |||
| 1428 | nmdc:mga08y16_17465_c1 | |||
| 1429 | nmdc:mga08y16_1893_c1 | |||
| 1430 | nmdc:mga08y16_214656_c1 | |||
| 1431 | nmdc:mga08y16_262381_c1 | |||
| 1432 | nmdc:mga08y16_3612_c1 | |||
| 1433 | nmdc:mga0n895_100327_c1 | |||
| 1434 | nmdc:mga0n895_1004_c1 | |||
| 1435 | nmdc:mga0n895_11003_c1 | |||
| 1436 | nmdc:mga0n895_1147_c1 | |||
| 1437 | nmdc:mga0n895_14820_c1 | |||
| 1438 | nmdc:mga0n895_24482_c1 | |||
| 1439 | nmdc:mga0n895_300911_c1 | |||
| 1440 | nmdc:mga0n895_59918_c1 | |||
| 1441 | nmdc:mga0n895_75238_c1 | |||
| 1442 | nmdc:mga0rr50_119086_c1 | |||
| 1443 | nmdc:mga0rr50_3299_c1 | |||
| 1444 | nmdc:mga0rr50_52175_c1 | |||
| 1445 | nmdc:mga0rr50_95909_c1 | |||
| 1446 | nmdc:mga08x19_29101_c1 | |||
| 1447 | nmdc:mga08x19_34912_c1 | |||
| 1448 | nmdc:mga08x19_61153_c1 | |||
| 1449 | nmdc:mga08x19_7241_c1 | |||
| 1450 | nmdc:mga0a205_13854_c1 | |||
| 1451 | nmdc:mga0a205_202547_c1 | |||
| 1452 | nmdc:mga0a205_2566_c1 | |||
| 1453 | nmdc:mga0a205_3241_c1 | |||
| 1454 | nmdc:mga0a205_37303_c1 | |||
| 1455 | nmdc:mga0a205_51372_c1 | |||
| 1456 | nmdc:mga0a205_60239_c1 | |||
| 1457 | nmdc:mga0a205_631_c1 | |||
| 1458 | Ga0501084_0000275 | |||
| 1459 | Ga0501084_0006119 | |||
| 1460 | Ga0501084_0007853 | |||
| 1461 | Ga0501084_0008159 | |||
| 1462 | Ga0501084_0015096 | |||
| 1463 | Ga0501084_0059633 | |||
| 1464 | Ga0501084_0062518 | |||
| 1465 | Ga0501084_0177820 | |||
| 1466 | Ga0501084_0202037 | |||
| 1467 | Ga0501082_0003916 | |||
| 1468 | Ga0501082_0008743 | |||
| 1469 | Ga0501082_0011181 | |||
| 1470 | Ga0501082_0037933 | |||
| 1471 | Ga0501082_0048265 | |||
| 1472 | Ga0501082_0059701 | |||
| 1473 | Ga0501082_0061108 | |||
| 1474 | Ga0501082_0288454 | |||
| 1475 | Ga0530510_0000095 | |||
| 1476 | Ga0530510_0000627 | |||
| 1477 | Ga0530510_0010758 | |||
| 1478 | Ga0530510_0018005 | |||
| 1479 | Ga0530510_0028157 | |||
| 1480 | Ga0530510_0033521 | |||
| 1481 | Ga0530510_0079740 | |||
| 1482 | Ga0530510_0120033 | |||
| 1483 | Ga0530510_0130991 | |||
| 1484 | Ga0530510_0170606 | |||
| 1485 | 2511700901 | |||
| 1486 | 2540608101 | |||
| 1487 | 2545559097 | |||
| 1488 | 2553395940 | |||
| 1489 | 2553396418 | |||
| 1490 | 2555468112 | |||
| 1491 | 2578933550 | |||
| 1492 | 2595090752 | |||
| 1493 | 2631985246 | |||
| 1494 | 2643766170 | |||
| 1495 | 2644706398 | |||
| 1496 | 2644708382 | |||
| 1497 | 2644713079 | |||
| 1498 | 2644714980 | |||
| 1499 | 2644715529 | |||
| 1500 | 2644726833 | |||
| 1501 | 2644739066 | |||
| 1502 | 2651530522 | |||
| 1503 | 2674422164 | |||
| 1504 | 2685148512 | |||
| 1505 | 2685152592 | |||
| 1506 | 2686998277 | |||
| 1507 | 2687499553 | |||
| 1508 | 2695628863 | |||
| 1509 | 2698320580 | |||
| 1510 | 2698324663 | |||
| 1511 | 2705992447 | |||
| 1512 | 2705996513 | |||
| 1513 | 2717915451 | |||
| 1514 | 2721503894 | |||
| 1515 | 2721507751 | |||
| 1516 | 2723641356 | |||
| 1517 | 2738815504 | |||
| 1518 | 2739157621 | |||
| 1519 | 2739158338 | |||
| 1520 | 2739209713 | |||
| 1521 | 2739211251 | |||
| 1522 | 2739229876 | |||
| 1523 | 2739270680 | |||
| 1524 | 2745165653 | |||
| 1525 | 2757568671 | |||
| 1526 | 2777763663 | |||
| 1527 | 2777836452 | |||
| 1528 | 2791214817 | |||
| 1529 | 2808867882 | |||
| 1530 | 2808901266 | |||
| 1531 | 2809053230 | |||
| 1532 | 2812317402 | |||
| 1533 | 2817481497 | |||
| 1534 | 2817617322 | |||
| 1535 | 2819581505 | |||
| 1536 | 2819583314 | |||
| 1537 | 2819628308 | |||
| 1538 | 2819708997 | |||
| 1539 | 2819722460 | |||
| 1540 | 2823529368 | |||
| 1541 | 2842884764 | |||
| 1542 | 2852675971 | |||
| 1543 | 2857589154 | |||
| 1544 | 2860840891 | |||
| 1545 | 2865004522 | |||
| 1546 | 2877771785 | |||
| 1547 | 2880172627 | |||
| 1548 | 2889043674 | |||
| 1549 | 2897112899 | |||
| 1550 | 2904495131 | |||
| 1551 | 2904524206 | |||
| 1552 | 2904563771 | |||
| 1553 | 2904609603 | |||
| 1554 | 2907207080 | |||
| 1555 | 2908666740 | |||
| 1556 | 2919095242 | |||
| 1557 | 2919147217 | |||
| 1558 | 2919163672 | |||
| 1559 | 2919417621 | |||
| 1560 | 2919429726 | |||
| 1561 | 2919519121 | |||
| 1562 | 2919723489 | |||
| 1563 | 2919727807 | |||
| 1564 | 2928095984 | |||
| 1565 | 2929006644 | |||
| 1566 | 2929233765 | |||
| 1567 | 2929238295 | |||
| 1568 | 2931387135 | |||
| 1569 | 2935410775 | |||
| 1570 | 2935891863 | |||
| 1571 | 2936342730 | |||
| 1572 | 2936362106 | |||
| 1573 | 2938917933 | |||
| 1574 | 2938922491 | |||
| 1575 | 2939595334 | |||
| 1576 | 2945994276 | |||
| 1577 | 2946057036 | |||
| 1578 | 2947427253 | |||
| 1579 | 2947431380 | |||
| 1580 | 2954777091 | |||
| 1581 | 2956897710 | |||
| 1582 | 2960319603 | |||
| 1583 | 2960381186 | |||
| 1584 | 2962294118 | |||
| 1585 | 2965761820 | |||
| 1586 | 2965765875 | |||
| 1587 | 2969140099 | |||
| 1588 | 2969144339 | |||
| 1589 | 2969769140 | |||
| 1590 | 2969771455 | |||
| 1591 | 2971896451 | |||
| 1592 | 2977256302 | |||
| 1593 | 2979084246 | |||
| 1594 | 2979088281 | |||
| 1595 | 2980495886 | |||
| 1596 | 2984530846 | |||
| 1597 | 2984536955 | |||
| 1598 | 2990277181 | |||
| 1599 | 3001897491 | |||
| 1600 | 3006861922 | |||
| 1601 | 3006882609 | |||
| 1602 | 3006971887 | |||
| 1603 | 3006976216 | |||
| 1604 | 3006981199 | |||
| 1605 | 8022621690 | |||
| 1606 | 8022624545 | |||
| 1607 | 8022633050 | |||
| 1608 | 8022655766 | |||
| 1609 | 8022797987 | |||
| 1610 | 8022898467 | |||
| 1611 | 8022917618 | |||
| 1612 | 8023438907 | |||
| 1613 | 8023443685 | |||
| 1614 | 8023445490 | |||
| 1615 | 8023450380 | |||
| 1616 | 8046353574 | |||
| 1617 | 8051954596 | |||
| 1618 | 8052175317 | |||
| 1619 | 8054282492 | |||
| 1620 | 8055535889 | |||
| 1621 | 8057583322 | |||
| 1622 | 8057587044 | |||
| 1623 | 8057636061 | |||
| 1624 | 8057733828 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hye-assembly1.cif.gz_C-2 | structure of amino acid dehydrogenase-2752 with ligand | 0.9823 | 1 | 362 |
| 8hye-assembly1.cif.gz_B-2 | structure of amino acid dehydrogenase-2752 with ligand | 0.9795 | 1 | 362 |
| 2vhx-assembly1.cif.gz_A | crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate | 0.9782 | 1 | 362 |
| 2vhx-assembly1.cif.gz_D | crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate | 0.9742 | 1 | 361 |
| 8hye-assembly1.cif.gz_A-2 | structure of amino acid dehydrogenase-2752 with ligand | 0.9679 | 1 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXL7_2_109_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9989 | 3 | 105 | 3.40.50.720 |
| af_P9WQB1_2_113_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9908 | 2 | 108 | 3.40.50.720 |
| af_Q2FYJ2_1_126_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9795 | 1 | 118 | 3.40.50.720 |
| 2vhxC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9621 | 124 | 297 | 3.40.50.720 |
| 2vhxC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9566 | 124 | 297 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3UQK1-F1-model_v4 | deleted | 1.008 | 1 | 76 |
|
| AF-A0A6M0AUB3-F1-model_v4 | Alanine dehydrogenase | 1.007 | 1 | 76 |
GO:0000286
GO:0005886 GO:0006524 |
| AF-A0A0J1FRW9-F1-model_v4 | Alanine dehydrogenase 2 (EC 1.4.1.1) | 1.005 | 1 | 76 |
GO:0000286
GO:0005886 GO:0006524 |
| AF-A0A4U3A395-F1-model_v4 | Alanine dehydrogenase | 1.004 | 1 | 129 |
GO:0000286
GO:0005886 GO:0006524 |
| AF-A0A6I3FG25-F1-model_v4 | Alanine dehydrogenase | 1.004 | 2 | 76 |
GO:0000286
GO:0005886 GO:0006524 |