F481904

General Info

Members Datasets Scaffolds Average Seq Length
812 387 1624 370

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0003713|Ga0501031_0003713_2904_4115
Length 403
Sequence MNAVRVSAGARRKRTGSRPSSGAASPHEETNPVIIGVPKEIKPGEQRVALTPAGVHALAGHGHRVLIEPGAGAGSGFRDDDYTQLGAVLRSAGEVWGEADLVLKVKEPIASEYPRLRDTQVLFTYLHLAAVPELTRALQKSRTVALAYETVQRADGSLPLLTPMSEVAGRLSVQEGAYYLGKAHGGRGILLAGVPGVPPGNVMIIGAGTVGLNAAKIAVGLGADVSVLDVNVDRLRHVDDLFRGQVVTLVSNAFNVARLAPRVDLLVGAVLVAGARAPVLVPEATVKTMKEGSVIVDVAVDQGGCVETMHPTTLAEPIYRVHGVVHYGVANMPALVPRTSTFALTNATLPYVLELAGKGVIPALRANPALAMGLNVCQGRIVHPGVAESVGEATTPLDACLAG

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
185 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
267 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
268 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
269 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
270 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
271 2554235283 Bacillus safensis VK Isolate Rhizosphere
272 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
273 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
274 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
275 2643221549 Agromyces sp. Root1464 Isolate Unclassified
276 2643221729 Bacillus sp. Root11 Isolate Unclassified
277 2643221730 Bacillus sp. Root131 Isolate Unclassified
278 2643221731 Bacillus sp. Root147 Isolate Unclassified
279 2643221732 Bacillus sp. Root239 Isolate Unclassified
280 2643221735 Bacillus sp. Root920 Isolate Unclassified
281 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
282 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
283 2684622632 Bacillus cereus 905 Isolate Unclassified
284 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
285 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
286 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
287 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
288 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
289 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
290 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
291 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
292 2738541295 Bacillus sp. OK085 Isolate Unclassified
293 2738541358 Bacillus sp. OV752 Isolate Unclassified
294 2738543006 Bacillus sp. OK077 Isolate Unclassified
295 2738543010 Bacillus sp. YR335 Isolate Unclassified
296 2738543017 Bacillus sp. OV186 Isolate Unclassified
297 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
298 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
299 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
300 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
301 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
302 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
303 2808606372 Agromyces sp. 23-23 Isolate Unclassified
304 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
305 2811994870 Bacillus sp. JB4 Isolate Unclassified
306 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
307 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
308 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
309 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
310 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
311 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
312 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
313 2842882022 Bacillus sp. R-71893 Isolate Unclassified
314 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
315 2857586860 Bacillus sp. R-71935 Isolate Unclassified
316 2860837431 Bacillus sp. WR11 Isolate Unclassified
317 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
318 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
319 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
320 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
321 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
322 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
323 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
324 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
325 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
326 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
327 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
328 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
329 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
330 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
331 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
332 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
333 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
334 2919720352 Priestia megaterium 4340 Isolate Unclassified
335 2919726948 Bacillus pumilus 4489 Isolate Unclassified
336 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
337 2929004312 Priestia megaterium 1104 Isolate Unclassified
338 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
339 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
340 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
341 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
342 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
343 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
344 2938917290 Bacillus sp. CR71 Isolate Unclassified
345 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
346 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
347 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
348 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
349 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
350 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
351 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
352 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
353 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
354 2965761152 Bacillus sp. COPE52 Isolate Unclassified
355 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
356 2969141011 Bacillus velezensis MH25 Isolate Unclassified
357 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
358 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
359 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
360 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
361 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
362 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
363 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
364 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
365 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
366 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
367 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
368 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
369 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
370 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
371 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
372 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
373 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
374 8022653035 Bacillus sp. Rc4 Isolate Unclassified
375 8022792930 Bacillus sp. Xin Isolate Rhizosphere
376 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
377 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
378 8023438354 Bacillus sp. BH2 Isolate Unclassified
379 8023444577 Bacillus sp. BH32 Isolate Unclassified
380 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
381 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
382 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
383 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
384 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
385 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
386 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
387 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.67
Metatranscriptomes 2.09
Isolates 17.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 1.48
Rhizosphere 84.48
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0003713 3300049568 Bacteria 9823
2 JGI25159J45721_1006689 3300002987 Bacteria 3409
3 JGI25159J45721_1011084 3300002987 Bacteria 2237
4 JGI25151J46595_10000533 3300003187 Bacteria 35363
5 JGI25151J46595_10001687 3300003187 Bacteria 14425
6 JGI25151J46595_10013431 3300003187 Bacteria 3684
7 JGI25151J46595_10013727 3300003187 Bacteria 3635
8 JGI25151J46595_10019425 3300003187 Bacteria 2887
9 rootH1_10001445 3300003316 Bacteria 56583
10 rootL2_10013974 3300003322 Bacteria 148551
11 rootH1_10053710 3300003323 Bacteria 5934
12 Ga0006562J51391_1000459 3300003578 Bacteria 8870
13 Ga0006562J51391_1001698 3300003578 Bacteria 1890
14 Ga0006562J51391_1012090 3300003578 Bacteria 1390
15 Ga0055528_1003542 3300003790 Bacteria 7784
16 Ga0065707_10114142 3300005295 Bacteria 2302
17 Ga0065707_10167548 3300005295 Bacteria 1510
18 Ga0070676_10000180 3300005328 Bacteria 26224
19 Ga0070676_10226166 3300005328 Bacteria 1238
20 Ga0070670_100006546 3300005331 Bacteria 9867
21 Ga0068869_100000723 3300005334 Bacteria 18807
22 Ga0070666_10004839 3300005335 Bacteria 8230
23 Ga0070680_100013896 3300005336 Bacteria 6282
24 Ga0070680_100203284 3300005336 Bacteria 1671
25 Ga0070682_100000622 3300005337 Bacteria 21584
26 Ga0070660_100002171 3300005339 Bacteria 13520
27 Ga0070689_100008079 3300005340 Bacteria 7392
28 Ga0070689_100254197 3300005340 Bacteria 1451
29 Ga0070687_100006063 3300005343 Bacteria 4931
30 Ga0070661_100000211 3300005344 Bacteria 48345
31 Ga0070692_10000947 3300005345 Bacteria 9859
32 Ga0070668_100398961 3300005347 Bacteria 1174
33 Ga0070669_100385812 3300005353 Bacteria 1143
34 Ga0070675_100165867 3300005354 Bacteria 1902
35 Ga0070671_100005118 3300005355 Bacteria 10442
36 Ga0070673_100001462 3300005364 Bacteria 13820
37 Ga0070659_100000204 3300005366 Bacteria 46050
38 Ga0070703_10013650 3300005406 Bacteria 2309
39 Ga0070701_10009895 3300005438 Bacteria 4195
40 Ga0070705_100001378 3300005440 Bacteria 12938
41 Ga0070694_100001824 3300005444 Bacteria 12612
42 Ga0070694_100005813 3300005444 Bacteria 7483
43 Ga0070694_100049879 3300005444 Bacteria 2820
44 Ga0070708_100008247 3300005445 Bacteria 8365
45 Ga0070708_100026566 3300005445 Bacteria 4957
46 Ga0070708_100043172 3300005445 Bacteria 3961
47 Ga0070708_100089602 3300005445 Bacteria 2799
48 Ga0070708_100123968 3300005445 Bacteria 2386
49 Ga0070708_100150468 3300005445 Bacteria 2164
50 Ga0070708_100165316 3300005445 Bacteria 2064
51 Ga0070708_100197719 3300005445 Bacteria 1881
52 Ga0070708_100314354 3300005445 Bacteria 1475
53 Ga0070662_100031002 3300005457 Bacteria 3748
54 Ga0070662_100218281 3300005457 Bacteria 1520
55 Ga0070681_10216955 3300005458 Bacteria 1829
56 Ga0068867_100000382 3300005459 Bacteria 29543
57 Ga0070706_100000575 3300005467 Bacteria 42747
58 Ga0070706_100005446 3300005467 Bacteria 12124
59 Ga0070706_100016657 3300005467 Bacteria 6790
60 Ga0070706_100025460 3300005467 Bacteria 5446
61 Ga0070706_100029052 3300005467 Bacteria 5093
62 Ga0070706_100099346 3300005467 Bacteria 2704
63 Ga0070706_100296978 3300005467 Bacteria 1507
64 Ga0070707_100003191 3300005468 Bacteria 15511
65 Ga0070707_100005498 3300005468 Bacteria 11846
66 Ga0070707_100006333 3300005468 Bacteria 11004
67 Ga0070707_100014780 3300005468 Bacteria 7318
68 Ga0070707_100035031 3300005468 Bacteria 4787
69 Ga0070707_100036244 3300005468 Bacteria 4706
70 Ga0070698_100004886 3300005471 Bacteria 14713
71 Ga0070698_100012284 3300005471 Bacteria 9068
72 Ga0070698_100027252 3300005471 Bacteria 5945
73 Ga0070698_100131425 3300005471 Bacteria 2459
74 Ga0070698_100142590 3300005471 Bacteria 2346
75 Ga0070699_100005366 3300005518 Bacteria 11242
76 Ga0070699_100020042 3300005518 Bacteria 5762
77 Ga0070699_100024234 3300005518 Bacteria 5228
78 Ga0070699_100085305 3300005518 Bacteria 2756
79 Ga0070699_100093255 3300005518 Bacteria 2634
80 Ga0070699_100392218 3300005518 Bacteria 1254
81 Ga0070679_100063874 3300005530 Bacteria 3669
82 Ga0070697_100005980 3300005536 Bacteria 9407
83 Ga0070697_100012817 3300005536 Bacteria 6567
84 Ga0070697_100051482 3300005536 Bacteria 3345
85 Ga0070697_100134582 3300005536 Bacteria 2075
86 Ga0070697_100219293 3300005536 Bacteria 1621
87 Ga0070697_100326369 3300005536 Bacteria 1322
88 Ga0070672_100007462 3300005543 Bacteria 7422
89 Ga0070686_100079813 3300005544 Bacteria 2164
90 Ga0070695_100000456 3300005545 Bacteria 21302
91 Ga0070695_100001317 3300005545 Bacteria 13733
92 Ga0070695_100004963 3300005545 Bacteria 7846
93 Ga0070695_100033546 3300005545 Bacteria 3213
94 Ga0070696_100024923 3300005546 Bacteria 4065
95 Ga0070696_100032571 3300005546 Bacteria 3576
96 Ga0070696_100083236 3300005546 Bacteria 2269
97 Ga0070693_100000530 3300005547 Bacteria 17134
98 Ga0070704_100024209 3300005549 Bacteria 3980
99 Ga0070704_100059040 3300005549 Bacteria 2735
100 Ga0070704_100280396 3300005549 Bacteria 1380
101 Ga0068855_100000319 3300005563 Bacteria 59802
102 Ga0068857_100011491 3300005577 Bacteria 7702
103 Ga0068856_100006539 3300005614 Bacteria 11424
104 Ga0068859_100168128 3300005617 Bacteria 2273
105 Ga0068859_100206768 3300005617 Bacteria 2048
106 Ga0068864_100009783 3300005618 Bacteria 7905
107 Ga0068861_100024675 3300005719 Bacteria 4352
108 Ga0068870_10002333 3300005840 Bacteria 7895
109 Ga0068863_100034656 3300005841 Bacteria 4807
110 Ga0068863_100047886 3300005841 Bacteria 4054
111 Ga0068860_100006217 3300005843 Bacteria 12008
112 Ga0068860_100091709 3300005843 Bacteria 2894
113 Ga0068862_100000487 3300005844 Bacteria 42413
114 Ga0068862_100043144 3300005844 Bacteria 3844
115 Ga0081455_10001297 3300005937 Bacteria 31031
116 Ga0081455_10024510 3300005937 Bacteria 5585
117 Ga0081538_10024747 3300005981 Bacteria 4266
118 Ga0081540_1011967 3300005983 Bacteria 5753
119 Ga0081539_10000083 3300005985 Bacteria 218881
120 Ga0070715_10013289 3300006163 Bacteria 3020
121 Ga0070716_100013575 3300006173 Bacteria 4155
122 Ga0070712_100030550 3300006175 Bacteria 3622
123 Ga0075428_100000176 3300006844 Bacteria 59684
124 Ga0075428_100005443 3300006844 Bacteria 14150
125 Ga0075428_100013979 3300006844 Bacteria 8936
126 Ga0075428_100016686 3300006844 Bacteria 8108
127 Ga0075428_100026627 3300006844 Bacteria 6403
128 Ga0075428_100048838 3300006844 Bacteria 4643
129 Ga0075428_100079816 3300006844 Bacteria 3571
130 Ga0075428_100093075 3300006844 Bacteria 3286
131 Ga0075428_100153450 3300006844 Bacteria 2502
132 Ga0075428_100163079 3300006844 Bacteria 2419
133 Ga0075428_100195872 3300006844 Bacteria 2185
134 Ga0075428_100202537 3300006844 Bacteria 2145
135 Ga0075430_100000127 3300006846 Bacteria 48027
136 Ga0075430_100001542 3300006846 Bacteria 18812
137 Ga0075430_100009967 3300006846 Bacteria 8037
138 Ga0075430_100038989 3300006846 Bacteria 4023
139 Ga0075430_100125889 3300006846 Bacteria 2136
140 Ga0075430_100189762 3300006846 Bacteria 1708
141 Ga0075430_100263504 3300006846 Bacteria 1427
142 Ga0075431_100000420 3300006847 Bacteria 34568
143 Ga0075431_100001064 3300006847 Bacteria 24562
144 Ga0075431_100002573 3300006847 Bacteria 17520
145 Ga0075431_100002829 3300006847 Bacteria 16783
146 Ga0075431_100014931 3300006847 Bacteria 7864
147 Ga0075431_100019582 3300006847 Bacteria 6903
148 Ga0075431_100025894 3300006847 Bacteria 6012
149 Ga0075431_100039873 3300006847 Bacteria 4838
150 Ga0075431_100048791 3300006847 Bacteria 4367
151 Ga0075431_100121988 3300006847 Bacteria 2689
152 Ga0075431_100125332 3300006847 Bacteria 2650
153 Ga0075431_100167411 3300006847 Bacteria 2259
154 Ga0075433_10000052 3300006852 Bacteria 49747
155 Ga0075433_10003282 3300006852 Bacteria 12493
156 Ga0075433_10009615 3300006852 Bacteria 7738
157 Ga0075433_10011249 3300006852 Bacteria 7203
158 Ga0075433_10041400 3300006852 Bacteria 3991
159 Ga0075433_10042260 3300006852 Bacteria 3954
160 Ga0075433_10042774 3300006852 Bacteria 3932
161 Ga0075433_10084754 3300006852 Bacteria 2797
162 Ga0075433_10149092 3300006852 Bacteria 2080
163 Ga0075434_100000262 3300006871 Bacteria 37332
164 Ga0075434_100005556 3300006871 Bacteria 11491
165 Ga0075434_100024034 3300006871 Bacteria 5951
166 Ga0075434_100026524 3300006871 Bacteria 5678
167 Ga0075434_100041791 3300006871 Bacteria 4543
168 Ga0075434_100049091 3300006871 Bacteria 4189
169 Ga0075434_100069888 3300006871 Bacteria 3501
170 Ga0075434_100110462 3300006871 Bacteria 2760
171 Ga0075434_100249083 3300006871 Bacteria 1796
172 Ga0075429_100000075 3300006880 Bacteria 49848
173 Ga0075429_100001545 3300006880 Bacteria 18878
174 Ga0075429_100002125 3300006880 Bacteria 16535
175 Ga0075429_100005105 3300006880 Bacteria 11289
176 Ga0075429_100009405 3300006880 Bacteria 8485
177 Ga0075429_100020608 3300006880 Bacteria 5722
178 Ga0075429_100084784 3300006880 Bacteria 2762
179 Ga0075429_100130324 3300006880 Bacteria 2200
180 Ga0075429_100217967 3300006880 Bacteria 1672
181 Ga0068865_100004300 3300006881 Bacteria 8597
182 Ga0075436_100004665 3300006914 Bacteria 9392
183 Ga0075436_100033886 3300006914 Bacteria 3520
184 Ga0075436_100215906 3300006914 Bacteria 1360
185 Ga0097620_100168138 3300006931 Bacteria 2273
186 Ga0097620_100206740 3300006931 Bacteria 2048
187 Ga0075435_100004032 3300007076 Bacteria 10039
188 Ga0075435_100016853 3300007076 Bacteria 5516
189 Ga0075435_100021132 3300007076 Bacteria 5000
190 Ga0075435_100031404 3300007076 Bacteria 4184
191 Ga0075435_100031867 3300007076 Bacteria 4158
192 Ga0075435_100036724 3300007076 Bacteria 3896
193 Ga0075435_100179627 3300007076 Bacteria 1788
194 Ga0099794_10000310 3300007265 Bacteria 16625
195 Ga0111539_10000103 3300009094 Bacteria 91165
196 Ga0111539_10000275 3300009094 Bacteria 61397
197 Ga0111539_10002668 3300009094 Bacteria 23630
198 Ga0111539_10011048 3300009094 Bacteria 11359
199 Ga0111539_10045183 3300009094 Bacteria 5273
200 Ga0111539_10059861 3300009094 Bacteria 4515
201 Ga0111539_10113573 3300009094 Bacteria 3177
202 Ga0111539_10137534 3300009094 Bacteria 2861
203 Ga0111539_10221507 3300009094 Bacteria 2203
204 Ga0105245_10020600 3300009098 Bacteria 5783
205 Ga0105247_10010339 3300009101 Bacteria 5643
206 Ga0114129_10001042 3300009147 Bacteria 36288
207 Ga0114129_10001782 3300009147 Bacteria 29335
208 Ga0114129_10001965 3300009147 Bacteria 28123
209 Ga0114129_10002034 3300009147 Bacteria 27730
210 Ga0114129_10009901 3300009147 Bacteria 13590
211 Ga0114129_10025266 3300009147 Bacteria 8416
212 Ga0114129_10029338 3300009147 Bacteria 7793
213 Ga0114129_10032461 3300009147 Bacteria 7379
214 Ga0114129_10032652 3300009147 Bacteria 7355
215 Ga0114129_10102529 3300009147 Bacteria 3957
216 Ga0114129_10134517 3300009147 Bacteria 3393
217 Ga0114129_10224297 3300009147 Bacteria 2534
218 Ga0114129_10247088 3300009147 Bacteria 2397
219 Ga0105243_10026774 3300009148 Bacteria 4415
220 Ga0105243_10089778 3300009148 Bacteria 2527
221 Ga0105243_10109561 3300009148 Bacteria 2307
222 Ga0105243_10246194 3300009148 Bacteria 1593
223 Ga0105241_10001179 3300009174 Bacteria 19931
224 Ga0105242_10020990 3300009176 Bacteria 5123
225 Ga0105242_10183849 3300009176 Bacteria 1846
226 Ga0105242_10199890 3300009176 Bacteria 1775
227 Ga0105248_10118792 3300009177 Bacteria 2982
228 Ga0105237_10248608 3300009545 Bacteria 1780
229 Ga0105246_10007951 3300011119 Bacteria 6509
230 Ga0105246_10017101 3300011119 Bacteria 4606
231 Ga0105246_10045911 3300011119 Bacteria 2978
232 Ga0157373_10004022 3300013100 Bacteria 11085
233 Ga0157371_10002617 3300013102 Bacteria 17082
234 Ga0157371_10117786 3300013102 Bacteria 1888
235 Ga0157369_10145836 3300013105 Bacteria 2503
236 Ga0157374_10103977 3300013296 Bacteria 2726
237 Ga0157374_10163626 3300013296 Bacteria 2168
238 Ga0157378_10007084 3300013297 Bacteria 9789
239 Ga0157378_10124657 3300013297 Bacteria 2379
240 Ga0157378_10204714 3300013297 Bacteria 1868
241 Ga0163162_10081712 3300013306 Bacteria 3302
242 Ga0157372_10006181 3300013307 Bacteria 12733
243 Ga0157372_10115328 3300013307 Bacteria 3080
244 Ga0157375_10084609 3300013308 Bacteria 3221
245 Ga0163163_10049524 3300014325 Bacteria 4135
246 Ga0157380_10258224 3300014326 Bacteria 1581
247 Ga0157377_10025210 3300014745 Bacteria 3169
248 Ga0163161_10040790 3300017792 Bacteria 3334
249 Ga0209566_100709 3300025225 Bacteria 19079
250 Ga0209147_100262 3300025229 Bacteria 48219
251 Ga0209147_102106 3300025229 Bacteria 5558
252 Ga0209147_102633 3300025229 Bacteria 4211
253 Ga0209147_102729 3300025229 Bacteria 4018
254 Ga0209437_100552 3300025233 Bacteria 24996
255 Ga0209130_1001035 3300025284 Bacteria 21283
256 Ga0209130_1002803 3300025284 Bacteria 8136
257 Ga0209130_1004812 3300025284 Bacteria 4952
258 Ga0209130_1004843 3300025284 Bacteria 4919
259 Ga0209025_1000011 3300025294 Bacteria 976387
260 Ga0209025_1000347 3300025294 Bacteria 100528
261 Ga0209025_1000388 3300025294 Bacteria 91113
262 Ga0209025_1001677 3300025294 Bacteria 27101
263 Ga0209025_1001722 3300025294 Bacteria 26473
264 Ga0209025_1002269 3300025294 Bacteria 21052
265 Ga0209025_1003207 3300025294 Bacteria 15856
266 Ga0209025_1004185 3300025294 Bacteria 12748
267 Ga0207426_1030025 3300025302 Bacteria 1786
268 Ga0207696_1000865 3300025711 Bacteria 18980
269 Ga0207696_1002049 3300025711 Bacteria 10175
270 Ga0207696_1011712 3300025711 Bacteria 3142
271 Ga0207655_1002285 3300025728 Bacteria 15776
272 Ga0207655_1002655 3300025728 Bacteria 14097
273 Ga0207713_1000727 3300025735 Bacteria 30847
274 Ga0207653_10005861 3300025885 Bacteria 3833
275 Ga0207688_10019936 3300025901 Bacteria 3657
276 Ga0207680_10001137 3300025903 Bacteria 12571
277 Ga0207645_10014975 3300025907 Bacteria 5167
278 Ga0207643_10001863 3300025908 Bacteria 11658
279 Ga0207643_10089464 3300025908 Bacteria 1793
280 Ga0207684_10000791 3300025910 Bacteria 36644
281 Ga0207684_10001023 3300025910 Bacteria 31386
282 Ga0207684_10051763 3300025910 Bacteria 3484
283 Ga0207684_10056514 3300025910 Bacteria 3329
284 Ga0207684_10240086 3300025910 Bacteria 1563
285 Ga0207707_10000116 3300025912 Bacteria 81364
286 Ga0207707_10105875 3300025912 Bacteria 2459
287 Ga0207671_10000004 3300025914 Bacteria 1022356
288 Ga0207671_10079923 3300025914 Bacteria 2450
289 Ga0207693_10060883 3300025915 Bacteria 2957
290 Ga0207660_10002889 3300025917 Bacteria 11226
291 Ga0207660_10035684 3300025917 Bacteria 3454
292 Ga0207662_10140571 3300025918 Bacteria 1529
293 Ga0207657_10002084 3300025919 Bacteria 21638
294 Ga0207649_10001837 3300025920 Bacteria 12126
295 Ga0207652_10003098 3300025921 Bacteria 13862
296 Ga0207646_10000699 3300025922 Bacteria 43480
297 Ga0207646_10001026 3300025922 Bacteria 35667
298 Ga0207646_10005460 3300025922 Bacteria 13365
299 Ga0207646_10009250 3300025922 Bacteria 9757
300 Ga0207646_10016411 3300025922 Bacteria 6948
301 Ga0207646_10084601 3300025922 Bacteria 2838
302 Ga0207646_10103196 3300025922 Bacteria 2557
303 Ga0207646_10104687 3300025922 Bacteria 2538
304 Ga0207646_10105059 3300025922 Bacteria 2532
305 Ga0207646_10223467 3300025922 Bacteria 1701
306 Ga0207681_10015108 3300025923 Bacteria 4814
307 Ga0207681_10044083 3300025923 Bacteria 2989
308 Ga0207681_10253309 3300025923 Bacteria 1375
309 Ga0207650_10058472 3300025925 Bacteria 2870
310 Ga0207687_10056051 3300025927 Bacteria 2763
311 Ga0207687_10062108 3300025927 Bacteria 2640
312 Ga0207706_10005422 3300025933 Bacteria 11888
313 Ga0207706_10007465 3300025933 Bacteria 10110
314 Ga0207686_10087504 3300025934 Bacteria 2049
315 Ga0207709_10109139 3300025935 Bacteria 1846
316 Ga0207704_10012977 3300025938 Bacteria 4153
317 Ga0207704_10045818 3300025938 Bacteria 2601
318 Ga0207665_10002315 3300025939 Bacteria 12857
319 Ga0207691_10013829 3300025940 Bacteria 7706
320 Ga0207689_10000058 3300025942 Bacteria 86234
321 Ga0207689_10000942 3300025942 Bacteria 27963
322 Ga0207661_10136346 3300025944 Bacteria 2108
323 Ga0207679_10002446 3300025945 Bacteria 11435
324 Ga0207667_10000342 3300025949 Bacteria 63745
325 Ga0207712_10172180 3300025961 Bacteria 1693
326 Ga0207678_10000501 3300026067 Bacteria 35486
327 Ga0207702_10002217 3300026078 Bacteria 18618
328 Ga0207648_10006801 3300026089 Bacteria 11336
329 Ga0207648_10130282 3300026089 Bacteria 2214
330 Ga0207676_10069053 3300026095 Bacteria 2828
331 Ga0207674_10002881 3300026116 Bacteria 21377
332 Ga0207675_100023622 3300026118 Bacteria 5719
333 Ga0207675_100138013 3300026118 Bacteria 2315
334 Ga0207675_100153769 3300026118 Bacteria 2191
335 Ga0207683_10306608 3300026121 Bacteria 1453
336 Ga0207698_10102499 3300026142 Bacteria 2376
337 Ga0209967_1004631 3300027364 Bacteria 1832
338 Ga0209968_1000806 3300027526 Bacteria 4841
339 Ga0209999_1001372 3300027543 Bacteria 4171
340 Ga0209983_1000013 3300027665 Bacteria 22196
341 Ga0209588_1018913 3300027671 Bacteria 2146
342 Ga0209971_1000042 3300027682 Bacteria 41413
343 Ga0209966_1000026 3300027695 Bacteria 66086
344 Ga0209998_10000004 3300027717 Bacteria 104862
345 Ga0207428_10000362 3300027907 Bacteria 58443
346 Ga0207428_10000725 3300027907 Bacteria 38077
347 Ga0207428_10004772 3300027907 Bacteria 12803
348 Ga0207428_10007573 3300027907 Bacteria 9897
349 Ga0207428_10064694 3300027907 Bacteria 2887
350 Ga0268265_10025321 3300028380 Bacteria 4209
351 Ga0268265_10157504 3300028380 Bacteria 1924
352 Ga0268265_10218025 3300028380 Bacteria 1667
353 Ga0268264_10011418 3300028381 Bacteria 7336
354 Ga0237817_10260 3300030083 Bacteria 12515
355 Ga0307408_100006448 3300031548 Bacteria 7778
356 Ga0307408_100012648 3300031548 Bacteria 5597
357 Ga0307408_100053321 3300031548 Bacteria 2919
358 Ga0316575_10000015 3300031665 Bacteria 44411
359 Ga0316579_10024153 3300031691 Bacteria 2735
360 Ga0307405_10113639 3300031731 Bacteria 1839
361 Ga0307410_10053802 3300031852 Bacteria 2726
362 Ga0307406_10017580 3300031901 Bacteria 4166
363 Ga0307406_10064264 3300031901 Bacteria 2381
364 Ga0307407_10184290 3300031903 Bacteria 1386
365 Ga0307409_100022958 3300031995 Bacteria 4312
366 Ga0307409_100023445 3300031995 Bacteria 4277
367 Ga0307416_100017473 3300032002 Bacteria 5022
368 Ga0307416_100131739 3300032002 Bacteria 2252
369 Ga0307411_10215515 3300032005 Bacteria 1486
370 Ga0373926_0026563 3300035083 Bacteria 2026
371 Ga0373934_0011489 3300035086 Bacteria 3329
372 Ga0373940_0014932 3300035088 Bacteria 1902
373 Ga0373949_0003723 3300035090 Bacteria 3565
374 Ga0373932_0009309 3300035112 Bacteria 2360
375 Ga0373932_0015532 3300035112 Bacteria 1931
376 Ga0373941_0008061 3300035115 Bacteria 2604
377 Ga0373960_0010159 3300035121 Bacteria 2294
378 Ga0373942_0029573 3300035207 Bacteria 1439
379 Ga0316574_0056237 3300035398 Bacteria 2461
380 Ga0373931_0006289 3300035691 Bacteria 5542
381 Ga0373931_0058970 3300035691 Bacteria 2063
382 Ga0373931_0090580 3300035691 Bacteria 1703
383 Ga0373927_0007561 3300035695 Bacteria 7352
384 Ga0373947_0000119 3300035725 Bacteria 39799
385 Ga0316584_0123445 3300036712 Bacteria 1935
386 Ga0316584_0243415 3300036712 Unclassified 1316
387 Ga0373925_0000296 3300037068 Bacteria 52149
388 Ga0395899_0023769 3300037312 Bacteria 4638
389 Ga0395899_0178737 3300037312 Bacteria 1491
390 Ga0395900_0009304 3300037418 Bacteria 10073
391 Ga0395898_0013990 3300037466 Bacteria 8245
392 Ga0395905_0229960 3300037471 Bacteria 1734
393 Ga0395901_0001591 3300038443 Bacteria 23497
394 Ga0237819_00149 3300038705 Bacteria 25643
395 Ga0237819_00173 3300038705 Bacteria 24004
396 Ga0400489_63543 3300039093 Bacteria 130825
397 Ga0439448_0001756 3300042005 Bacteria 5729
398 Ga0439449_0007338 3300042007 Bacteria 4189
399 Ga0450903_015402 3300042138 Bacteria 1205
400 Ga0439435_0041304 3300042436 Bacteria 1292
401 Ga0439460_0005173 3300042461 Bacteria 3197
402 Ga0451577_0000254 3300042876 Bacteria 105712
403 Ga0451577_0000807 3300042876 Bacteria 47174
404 Ga0451577_0006179 3300042876 Bacteria 12037
405 Ga0451577_0011400 3300042876 Bacteria 8411
406 Ga0451577_0015473 3300042876 Bacteria 7097
407 Ga0451577_0029889 3300042876 Bacteria 4923
408 Ga0451577_0201785 3300042876 Bacteria 1795
409 Ga0453683_0081301 3300044673 Bacteria 2029
410 Ga0453684_0000177 3300044712 Bacteria 282969
411 Ga0453684_0000521 3300044712 Bacteria 147189
412 Ga0453684_0036531 3300044712 Bacteria 6769
413 Ga0453684_0120871 3300044712 Bacteria 3163
414 Ga0453684_0196602 3300044712 Bacteria 2354
415 Ga0466960_0022141 3300044901 Bacteria 2838
416 Ga0466960_0035408 3300044901 Bacteria 2333
417 Ga0451576_0005053 3300045051 Bacteria 16728
418 Ga0451576_0053415 3300045051 Bacteria 4232
419 Ga0451576_0074153 3300045051 Bacteria 3541
420 Ga0451576_0379220 3300045051 Bacteria 1482
421 Ga0466967_0000623 3300045976 Bacteria 17703
422 Ga0466967_0011821 3300045976 Bacteria 6638
423 Ga0495580_0014869 3300046472 Bacteria 5896
424 Ga0495584_0102081 3300046491 Bacteria 1450
425 Ga0495665_0048643 3300046531 Bacteria 2248
426 Ga0496102_0009055 3300048905 Bacteria 8543
427 Ga0496102_0233068 3300048905 Bacteria 1736
428 Ga0496104_0008096 3300048907 Bacteria 9325
429 Ga0496106_0000224 3300048909 Bacteria 39551
430 Ga0496107_0011410 3300048910 Bacteria 6188
431 Ga0496107_0116394 3300048910 Bacteria 1968
432 Ga0496108_0002369 3300048911 Bacteria 15094
433 Ga0496109_0003788 3300048912 Bacteria 12621
434 Ga0496111_0001047 3300048914 Bacteria 15233
435 Ga0496112_0036159 3300048915 Bacteria 4816
436 Ga0496112_0291378 3300048915 Bacteria 1578
437 Ga0496118_0087869 3300048921 Bacteria 2153
438 Ga0496120_0043874 3300048923 Bacteria 2602
439 Ga0496123_0049803 3300048926 Bacteria 2805
440 Ga0496124_0022607 3300048927 Bacteria 5759
441 Ga0496125_0006100 3300048928 Bacteria 13156
442 Ga0501343_003403 3300049132 Bacteria 1167
443 Ga0501345_00134 3300049134 Bacteria 2010
444 Ga0501305_002424 3300049161 Bacteria 2009
445 Ga0501315_008731 3300049531 Bacteria 1184
446 Ga0501316_001034 3300049532 Bacteria 2229
447 Ga0501317_001707 3300049533 Bacteria 1952
448 Ga0501317_009014 3300049533 Bacteria 1163
449 Ga0501321_002237 3300049537 Bacteria 1652
450 Ga0501333_000393 3300049549 Bacteria 1960
451 Ga0501334_00268 3300049550 Bacteria 2179
452 Ga0501335_002446 3300049551 Bacteria 1509
453 Ga0501336_000403 3300049552 Bacteria 2105
454 Ga0501337_001621 3300049553 Bacteria 1304
455 Ga0501338_00318 3300049554 Bacteria 2062
456 Ga0501032_0054797 3300049569 Bacteria 2684
457 Ga0501033_0124880 3300049570 Bacteria 1866
458 Ga0501034_0022032 3300049571 Bacteria 6491
459 Ga0501034_0424939 3300049571 Bacteria 1249
460 Ga0501036_0001372 3300049572 Bacteria 18676
461 Ga0501036_0054566 3300049572 Bacteria 3385
462 Ga0501036_0124414 3300049572 Bacteria 2178
463 Ga0501036_0188360 3300049572 Bacteria 1736
464 Ga0501037_0250361 3300049573 Bacteria 1240
465 Ga0501038_0006167 3300049574 Bacteria 11089
466 Ga0501038_0026494 3300049574 Bacteria 5163
467 Ga0501039_0000732 3300049575 Bacteria 23687
468 Ga0501039_0001276 3300049575 Bacteria 18409
469 Ga0501039_0108628 3300049575 Bacteria 2168
470 Ga0501040_0001412 3300049576 Bacteria 15196
471 Ga0501040_0020581 3300049576 Bacteria 4398
472 Ga0501040_0030755 3300049576 Bacteria 3627
473 Ga0501040_0045597 3300049576 Bacteria 2991
474 Ga0501040_0081324 3300049576 Bacteria 2245
475 Ga0501040_0105814 3300049576 Bacteria 1966
476 Ga0501040_0183043 3300049576 Bacteria 1485
477 Ga0501040_0293598 3300049576 Bacteria 1162
478 Ga0501041_0001736 3300049577 Bacteria 12245
479 Ga0501041_0001961 3300049577 Bacteria 11563
480 Ga0501041_0008896 3300049577 Bacteria 5909
481 Ga0501041_0030385 3300049577 Bacteria 3260
482 Ga0501041_0033360 3300049577 Bacteria 3114
483 Ga0501041_0034594 3300049577 Bacteria 3059
484 Ga0501041_0053370 3300049577 Bacteria 2465
485 Ga0501041_0075834 3300049577 Bacteria 2068
486 Ga0501042_0000612 3300049578 Bacteria 19007
487 Ga0501042_0011683 3300049578 Bacteria 5932
488 Ga0501042_0111678 3300049578 Bacteria 1968
489 Ga0501042_0124885 3300049578 Bacteria 1853
490 Ga0501046_0000569 3300049580 Bacteria 36558
491 Ga0501046_0023086 3300049580 Bacteria 5122
492 Ga0501046_0050256 3300049580 Bacteria 3294
493 Ga0501046_0093767 3300049580 Bacteria 2308
494 Ga0501046_0163079 3300049580 Bacteria 1675
495 Ga0501048_0010098 3300049582 Bacteria 7064
496 Ga0501048_0012603 3300049582 Bacteria 6287
497 Ga0501048_0049651 3300049582 Bacteria 2990
498 Ga0501067_0009258 3300049583 Bacteria 5455
499 Ga0501068_0018610 3300049584 Bacteria 4022
500 Ga0501071_0024984 3300049587 Bacteria 4182
501 Ga0501071_0057465 3300049587 Bacteria 2812
502 Ga0501071_0070526 3300049587 Bacteria 2546
503 Ga0501071_0098163 3300049587 Bacteria 2157
504 Ga0501072_0001347 3300049588 Bacteria 18406
505 Ga0501072_0003106 3300049588 Bacteria 12502
506 Ga0501072_0036536 3300049588 Bacteria 3851
507 Ga0501072_0046054 3300049588 Bacteria 3431
508 Ga0501072_0064458 3300049588 Bacteria 2889
509 Ga0501073_0097233 3300049589 Bacteria 2045
510 Ga0501074_0080564 3300049590 Bacteria 2336
511 Ga0501075_0005765 3300049591 Bacteria 8472
512 Ga0501075_0008362 3300049591 Bacteria 7216
513 Ga0501075_0012802 3300049591 Bacteria 5970
514 Ga0501075_0018641 3300049591 Bacteria 5025
515 Ga0501075_0024428 3300049591 Bacteria 4432
516 Ga0501075_0047343 3300049591 Bacteria 3232
517 Ga0501075_0053650 3300049591 Bacteria 3032
518 Ga0501075_0094442 3300049591 Bacteria 2270
519 Ga0501075_0103809 3300049591 Bacteria 2160
520 Ga0501075_0133149 3300049591 Bacteria 1894
521 Ga0501075_0152331 3300049591 Bacteria 1762
522 Ga0501075_0156881 3300049591 Bacteria 1735
523 Ga0501075_0191037 3300049591 Bacteria 1562
524 Ga0501076_0003600 3300049592 Bacteria 10885
525 Ga0501076_0006299 3300049592 Bacteria 8600
526 Ga0501076_0006927 3300049592 Bacteria 8234
527 Ga0501076_0009215 3300049592 Bacteria 7279
528 Ga0501076_0011783 3300049592 Bacteria 6529
529 Ga0501076_0058249 3300049592 Bacteria 3070
530 Ga0501076_0059692 3300049592 Bacteria 3034
531 Ga0501076_0065959 3300049592 Bacteria 2888
532 Ga0501076_0102596 3300049592 Bacteria 2306
533 Ga0501076_0127521 3300049592 Bacteria 2063
534 Ga0501076_0259376 3300049592 Bacteria 1423
535 Ga0501077_0002373 3300049593 Bacteria 11305
536 Ga0501077_0008127 3300049593 Bacteria 6487
537 Ga0501077_0011985 3300049593 Bacteria 5425
538 Ga0501077_0019307 3300049593 Bacteria 4311
539 Ga0501077_0020362 3300049593 Bacteria 4198
540 Ga0501077_0030055 3300049593 Bacteria 3456
541 Ga0501077_0040264 3300049593 Bacteria 2978
542 Ga0501077_0103170 3300049593 Bacteria 1807
543 Ga0501077_0111175 3300049593 Bacteria 1736
544 Ga0501217_010474 3300049661 Bacteria 2031
545 Ga0501234_005621 3300049707 Bacteria 1960
546 Ga0501079_0001721 3300049741 Bacteria 15606
547 Ga0501079_0002033 3300049741 Bacteria 14484
548 Ga0501079_0002716 3300049741 Bacteria 12894
549 Ga0501079_0016969 3300049741 Bacteria 5562
550 Ga0501079_0017072 3300049741 Bacteria 5543
551 Ga0501079_0041821 3300049741 Bacteria 3538
552 Ga0501079_0046539 3300049741 Bacteria 3347
553 Ga0501079_0138277 3300049741 Bacteria 1897
554 Ga0501079_0173335 3300049741 Bacteria 1682
555 Ga0501080_0002636 3300049742 Bacteria 15701
556 Ga0501080_0010554 3300049742 Bacteria 8461
557 Ga0501080_0010775 3300049742 Bacteria 8366
558 Ga0501080_0015311 3300049742 Bacteria 7069
559 Ga0501080_0157765 3300049742 Bacteria 2096
560 Ga0501080_0338555 3300049742 Bacteria 1360
561 Ga0501081_0000748 3300049743 Bacteria 18977
562 Ga0501081_0001683 3300049743 Bacteria 13689
563 Ga0501081_0005714 3300049743 Bacteria 8049
564 Ga0501081_0007899 3300049743 Bacteria 6902
565 Ga0501081_0007939 3300049743 Bacteria 6883
566 Ga0501081_0014410 3300049743 Bacteria 5215
567 Ga0501081_0084147 3300049743 Bacteria 2231
568 Ga0501081_0133800 3300049743 Bacteria 1773
569 Ga0501083_0018906 3300049744 Bacteria 4796
570 Ga0501083_0021069 3300049744 Bacteria 4531
571 Ga0501083_0167078 3300049744 Bacteria 1438
572 Ga0501035_0039014 3300049822 Bacteria 4300
573 Ga0501035_0042299 3300049822 Bacteria 4110
574 Ga0501045_0004910 3300049824 Bacteria 9262
575 Ga0501045_0007926 3300049824 Bacteria 7394
576 Ga0501045_0051357 3300049824 Bacteria 3009
577 Ga0501045_0060448 3300049824 Bacteria 2778
578 Ga0501045_0131983 3300049824 Bacteria 1857
579 Ga0501045_0135931 3300049824 Bacteria 1828
580 Ga0501045_0141757 3300049824 Bacteria 1787
581 nmdc:mga05p37_169602_c1 3300050507 Bacteria 2662
582 nmdc:mga05p37_176129_c1 3300050507 Bacteria 2605
583 nmdc:mga05p37_201439_c1 3300050507 Bacteria 2411
584 nmdc:mga05p37_2470_c1 3300050507 Bacteria 21509
585 nmdc:mga05p37_2665_c1 3300050507 Bacteria 20797
586 nmdc:mga05p37_297300_c1 3300050507 Bacteria 1920
587 nmdc:mga05p37_3353_c1 3300050507 Bacteria 18683
588 nmdc:mga05p37_4677_c1 3300050507 Bacteria 15992
589 nmdc:mga05p37_47945_c1 3300050507 Bacteria 5254
590 nmdc:mga05p37_50895_c1 3300050507 Bacteria 5094
591 nmdc:mga05p37_510_c1 3300050507 Bacteria 42907
592 nmdc:mga05p37_5932_c1 3300050507 Bacteria 14373
593 nmdc:mga05p37_65451_c1 3300050507 Bacteria 3901
594 nmdc:mga09592_2520_c1 3300050508 Bacteria 14820
595 nmdc:mga09592_4797_c1 3300050508 Bacteria 10957
596 nmdc:mga09592_5719_c1 3300050508 Bacteria 10140
597 nmdc:mga09592_62770_c1 3300050508 Bacteria 3143
598 nmdc:mga09592_6985_c1 3300050508 Bacteria 9181
599 nmdc:mga09592_7229_c1 3300050508 Bacteria 9021
600 nmdc:mga09592_73542_c1 3300050508 Bacteria 2904
601 nmdc:mga09592_73718_c1 3300050508 Bacteria 2901
602 nmdc:mga0qj67_200361_c1 3300050509 Bacteria 1622
603 nmdc:mga0qj67_226955_c1 3300050509 Bacteria 1516
604 nmdc:mga0qj67_368_c1 3300050509 Bacteria 30906
605 nmdc:mga0qj67_434_c1 3300050509 Bacteria 28562
606 nmdc:mga06r32_10643_c1 3300050510 Bacteria 8297
607 nmdc:mga06r32_149714_c1 3300050510 Bacteria 2312
608 nmdc:mga06r32_156640_c1 3300050510 Bacteria 2259
609 nmdc:mga06r32_236125_c1 3300050510 Bacteria 1816
610 nmdc:mga06r32_310_c1 3300050510 Bacteria 40451
611 nmdc:mga06r32_36381_c1 3300050510 Bacteria 4651
612 nmdc:mga06r32_372752_c1 3300050510 Bacteria 1410
613 nmdc:mga06r32_383692_c1 3300050510 Bacteria 1388
614 nmdc:mga06r32_946_c1 3300050510 Bacteria 25849
615 nmdc:mga08y16_15283_c1 3300050511 Bacteria 8076
616 nmdc:mga08y16_17465_c1 3300050511 Bacteria 7556
617 nmdc:mga08y16_1893_c1 3300050511 Bacteria 21306
618 nmdc:mga08y16_214656_c1 3300050511 Bacteria 1992
619 nmdc:mga08y16_262381_c1 3300050511 Bacteria 1784
620 nmdc:mga08y16_3612_c1 3300050511 Bacteria 16067
621 nmdc:mga0n895_100327_c1 3300050512 Bacteria 2904
622 nmdc:mga0n895_1004_c1 3300050512 Bacteria 20486
623 nmdc:mga0n895_11003_c1 3300050512 Bacteria 8042
624 nmdc:mga0n895_1147_c1 3300050512 Bacteria 19405
625 nmdc:mga0n895_14820_c1 3300050512 Bacteria 7093
626 nmdc:mga0n895_24482_c1 3300050512 Bacteria 5690
627 nmdc:mga0n895_300911_c1 3300050512 Bacteria 1626
628 nmdc:mga0n895_59918_c1 3300050512 Bacteria 3756
629 nmdc:mga0n895_75238_c1 3300050512 Bacteria 3356
630 nmdc:mga0rr50_119086_c1 3300050513 Bacteria 2099
631 nmdc:mga0rr50_3299_c1 3300050513 Bacteria 9265
632 nmdc:mga0rr50_52175_c1 3300050513 Bacteria 3038
633 nmdc:mga0rr50_95909_c1 3300050513 Bacteria 2319
634 nmdc:mga08x19_29101_c1 3300050514 Bacteria 3464
635 nmdc:mga08x19_34912_c1 3300050514 Bacteria 3181
636 nmdc:mga08x19_61153_c1 3300050514 Bacteria 2440
637 nmdc:mga08x19_7241_c1 3300050514 Bacteria 6591
638 nmdc:mga0a205_13854_c1 3300050515 Bacteria 7515
639 nmdc:mga0a205_202547_c1 3300050515 Bacteria 1875
640 nmdc:mga0a205_2566_c1 3300050515 Bacteria 16012
641 nmdc:mga0a205_3241_c1 3300050515 Bacteria 14472
642 nmdc:mga0a205_37303_c1 3300050515 Bacteria 4674
643 nmdc:mga0a205_51372_c1 3300050515 Bacteria 3979
644 nmdc:mga0a205_60239_c1 3300050515 Bacteria 3666
645 nmdc:mga0a205_631_c1 3300050515 Bacteria 20134
646 Ga0501084_0000275 3300054114 Bacteria 38937
647 Ga0501084_0006119 3300054114 Bacteria 9893
648 Ga0501084_0007853 3300054114 Bacteria 8780
649 Ga0501084_0008159 3300054114 Bacteria 8634
650 Ga0501084_0015096 3300054114 Bacteria 6406
651 Ga0501084_0059633 3300054114 Bacteria 3194
652 Ga0501084_0062518 3300054114 Bacteria 3117
653 Ga0501084_0177820 3300054114 Bacteria 1796
654 Ga0501084_0202037 3300054114 Unclassified 1677
655 Ga0501082_0003916 3300060353 Bacteria 12992
656 Ga0501082_0008743 3300060353 Bacteria 8728
657 Ga0501082_0011181 3300060353 Bacteria 7714
658 Ga0501082_0037933 3300060353 Bacteria 4156
659 Ga0501082_0048265 3300060353 Bacteria 3670
660 Ga0501082_0059701 3300060353 Bacteria 3286
661 Ga0501082_0061108 3300060353 Bacteria 3243
662 Ga0501082_0288454 3300060353 Bacteria 1429
663 Ga0530510_0000095 3300061734 Bacteria 48147
664 Ga0530510_0000627 3300061734 Bacteria 22781
665 Ga0530510_0010758 3300061734 Bacteria 6420
666 Ga0530510_0018005 3300061734 Bacteria 5007
667 Ga0530510_0028157 3300061734 Bacteria 4029
668 Ga0530510_0033521 3300061734 Bacteria 3697
669 Ga0530510_0079740 3300061734 Bacteria 2381
670 Ga0530510_0120033 3300061734 Bacteria 1929
671 Ga0530510_0130991 3300061734 Bacteria 1845
672 Ga0530510_0170606 3300061734 Bacteria 1611
673 2511700901 2511231119 Bacteria 4019861
674 2540608101 2540341094 Bacteria 4061186
675 2545559097 2545555800 Bacteria 4222588
676 2553395940 2551306519 Bacteria 5465154
677 2553396418 2551306519 Bacteria 5465154
678 2555468112 2554235283 Bacteria 3683090
679 2578933550 2576861599 Bacteria 4217202
680 2595090752 2593339131 Bacteria 5116855
681 2631985246 2630968484 Bacteria 3876276
682 2643766170 2643221549 Bacteria 4042819
683 2644706398 2643221729 Bacteria 6621700
684 2644708382 2643221729 Bacteria 6621700
685 2644713079 2643221730 Bacteria 6523787
686 2644714980 2643221730 Bacteria 6523787
687 2644715529 2643221731 Bacteria 5623886
688 2644726833 2643221732 Bacteria 5756404
689 2644739066 2643221735 Bacteria 3676263
690 2651530522 2648501850 Bacteria 3975476
691 2674422164 2671180844 Bacteria 4164150
692 2685148512 2684622632 Bacteria 5380049
693 2685152592 2684622632 Bacteria 5380049
694 2686998277 2684623153 Bacteria 3878815
695 2687499553 2687453109 Bacteria 3860091
696 2695628863 2695420354 Bacteria 3922431
697 2698320580 2695420987 Bacteria 6152737
698 2698324663 2695420987 Bacteria 6152737
699 2705992447 2703719227 Bacteria 5631989
700 2705996513 2703719227 Bacteria 5631989
701 2717915451 2716884898 Bacteria 3928789
702 2721503894 2718218445 Bacteria 5113413
703 2721507751 2718218445 Bacteria 5113413
704 2723641356 2721755702 Bacteria 4373124
705 2738815504 2738541295 Bacteria 5730091
706 2739157621 2738541358 Bacteria 5932299
707 2739158338 2738541358 Bacteria 5932299
708 2739209713 2738543006 Bacteria 5904091
709 2739211251 2738543006 Bacteria 5904091
710 2739229876 2738543010 Bacteria 5583595
711 2739270680 2738543017 Bacteria 4271950
712 2745165653 2744054657 Bacteria 5016802
713 2757568671 2757320391 Bacteria 4746095
714 2777763663 2775507177 Bacteria 4384303
715 2777836452 2775507192 Bacteria 4622234
716 2791214817 2788500588 Bacteria 4584915
717 2808867882 2808606364 Bacteria 4465927
718 2808901266 2808606372 Bacteria 4649509
719 2809053230 2808606399 Bacteria 4021018
720 2812317402 2811994870 Bacteria 3776934
721 2817481497 2816332295 Bacteria 4352468
722 2817617322 2816332336 Bacteria 5207640
723 2819581505 2818991443 Bacteria 6598732
724 2819583314 2818991443 Bacteria 6598732
725 2819628308 2818991451 Bacteria 4697364
726 2819708997 2818991465 Bacteria 5388835
727 2819722460 2818991468 Bacteria 3723169
728 2823529368 2823526263 Bacteria 3765752
729 2842884764 2842882022 Bacteria 6158489
730 2852675971 2852673933 Bacteria 3347676
731 2857589154 2857586860 Bacteria 4354574
732 2860840891 2860837431 Bacteria 4202080
733 2865004522 2865002811 Bacteria 6333767
734 2877771785 2877768649 Bacteria 3957164
735 2880172627 2880169592 Bacteria 3900066
736 2889043674 2889042446 Bacteria 7618936
737 2897112899 2897109615 Bacteria 4009619
738 2904495131 2904490793 Bacteria 7046938
739 2904524206 2904524088 Bacteria 5887454
740 2904563771 2904560550 Bacteria 4029838
741 2904609603 2904606771 Bacteria 4684500
742 2907207080 2907202186 Bacteria 6632024
743 2908666740 2908665501 Bacteria 3678115
744 2919095242 2919093281 Bacteria 3660974
745 2919147217 2919143609 Bacteria 6219228
746 2919163672 2919160200 Bacteria 6929020
747 2919417621 2919414237 Bacteria 5429133
748 2919429726 2919425241 Bacteria 8055701
749 2919519121 2919517244 Bacteria 5858162
750 2919723489 2919720352 Bacteria 5986006
751 2919727807 2919726948 Bacteria 3696050
752 2928095984 2928093941 Bacteria 5965005
753 2929006644 2929004312 Bacteria 5678476
754 2929233765 2929233124 Bacteria 5948380
755 2929238295 2929233124 Bacteria 5948380
756 2931387135 2931384279 Bacteria 7299545
757 2935410775 2935409751 Bacteria 4179611
758 2935891863 2935890801 Bacteria 4593001
759 2936342730 2936340661 Bacteria 5139038
760 2936362106 2936361878 Bacteria 5632809
761 2938917933 2938917290 Bacteria 5914775
762 2938922491 2938917290 Bacteria 5914775
763 2939595334 2939593269 Bacteria 4798695
764 2945994276 2945991243 Bacteria 7008369
765 2946057036 2946053406 Bacteria 6978655
766 2947427253 2947426588 Bacteria 5357194
767 2947431380 2947426588 Bacteria 5357194
768 2954777091 2954773129 Bacteria 3741715
769 2956897710 2956897341 Bacteria 5447711
770 2960319603 2960319331 Bacteria 5502575
771 2960381186 2960375949 Bacteria 5361395
772 2962294118 2962290636 Bacteria 4072939
773 2965761820 2965761152 Bacteria 5806513
774 2965765875 2965761152 Bacteria 5806513
775 2969140099 2969136845 Bacteria 3923176
776 2969144339 2969141011 Bacteria 4118468
777 2969769140 2969765954 Bacteria 4216713
778 2969771455 2969770375 Bacteria 4271280
779 2971896451 2971893375 Bacteria 3929648
780 2977256302 2977254563 Bacteria 4828420
781 2979084246 2979083700 Bacteria 5894929
782 2979088281 2979083700 Bacteria 5894929
783 2980495886 2980492589 Bacteria 4072961
784 2984530846 2984527788 Bacteria 5288478
785 2984536955 2984532647 Bacteria 5288506
786 2990277181 2990275345 Bacteria 4887158
787 3001897491 3001892409 Bacteria 6328293
788 3006861922 3006858327 Bacteria 4317835
789 3006882609 3006879489 Bacteria 4064221
790 3006971887 3006969106 Bacteria 4739423
791 3006976216 3006973921 Bacteria 4423788
792 3006981199 3006978542 Bacteria 5328100
793 8022621690 8022621104 Bacteria 5241040
794 8022624545 8022621104 Bacteria 5241040
795 8022633050 8022630665 Bacteria 3886130
796 8022655766 8022653035 Bacteria 4035078
797 8022797987 8022792930 Bacteria 5693794
798 8022898467 8022893055 Bacteria 5300455
799 8022917618 8022914991 Bacteria 5584517
800 8023438907 8023438354 Bacteria 5779374
801 8023443685 8023438354 Bacteria 5779374
802 8023445490 8023444577 Bacteria 5661597
803 8023450380 8023444577 Bacteria 5661597
804 8046353574 8046352972 Bacteria 3613806
805 8051954596 8051952484 Bacteria 3926774
806 8052175317 8052174270 Bacteria 3881265
807 8054282492 8054280661 Bacteria 4232245
808 8055535889 8055531788 Bacteria 5249694
809 8057583322 8057582654 Bacteria 5218944
810 8057587044 8057582654 Bacteria 5218944
811 8057636061 8057632132 Bacteria 4726859
812 8057733828 8057733483 Bacteria 6578323
813 Ga0501031_0003713
814 JGI25159J45721_1006689
815 JGI25159J45721_1011084
816 JGI25151J46595_10000533
817 JGI25151J46595_10001687
818 JGI25151J46595_10013431
819 JGI25151J46595_10013727
820 JGI25151J46595_10019425
821 rootH1_10001445
822 rootL2_10013974
823 rootH1_10053710
824 Ga0006562J51391_1000459
825 Ga0006562J51391_1001698
826 Ga0006562J51391_1012090
827 Ga0055528_1003542
828 Ga0065707_10114142
829 Ga0065707_10167548
830 Ga0070676_10000180
831 Ga0070676_10226166
832 Ga0070670_100006546
833 Ga0068869_100000723
834 Ga0070666_10004839
835 Ga0070680_100013896
836 Ga0070680_100203284
837 Ga0070682_100000622
838 Ga0070660_100002171
839 Ga0070689_100008079
840 Ga0070689_100254197
841 Ga0070687_100006063
842 Ga0070661_100000211
843 Ga0070692_10000947
844 Ga0070668_100398961
845 Ga0070669_100385812
846 Ga0070675_100165867
847 Ga0070671_100005118
848 Ga0070673_100001462
849 Ga0070659_100000204
850 Ga0070703_10013650
851 Ga0070701_10009895
852 Ga0070705_100001378
853 Ga0070694_100001824
854 Ga0070694_100005813
855 Ga0070694_100049879
856 Ga0070708_100008247
857 Ga0070708_100026566
858 Ga0070708_100043172
859 Ga0070708_100089602
860 Ga0070708_100123968
861 Ga0070708_100150468
862 Ga0070708_100165316
863 Ga0070708_100197719
864 Ga0070708_100314354
865 Ga0070662_100031002
866 Ga0070662_100218281
867 Ga0070681_10216955
868 Ga0068867_100000382
869 Ga0070706_100000575
870 Ga0070706_100005446
871 Ga0070706_100016657
872 Ga0070706_100025460
873 Ga0070706_100029052
874 Ga0070706_100099346
875 Ga0070706_100296978
876 Ga0070707_100003191
877 Ga0070707_100005498
878 Ga0070707_100006333
879 Ga0070707_100014780
880 Ga0070707_100035031
881 Ga0070707_100036244
882 Ga0070698_100004886
883 Ga0070698_100012284
884 Ga0070698_100027252
885 Ga0070698_100131425
886 Ga0070698_100142590
887 Ga0070699_100005366
888 Ga0070699_100020042
889 Ga0070699_100024234
890 Ga0070699_100085305
891 Ga0070699_100093255
892 Ga0070699_100392218
893 Ga0070679_100063874
894 Ga0070697_100005980
895 Ga0070697_100012817
896 Ga0070697_100051482
897 Ga0070697_100134582
898 Ga0070697_100219293
899 Ga0070697_100326369
900 Ga0070672_100007462
901 Ga0070686_100079813
902 Ga0070695_100000456
903 Ga0070695_100001317
904 Ga0070695_100004963
905 Ga0070695_100033546
906 Ga0070696_100024923
907 Ga0070696_100032571
908 Ga0070696_100083236
909 Ga0070693_100000530
910 Ga0070704_100024209
911 Ga0070704_100059040
912 Ga0070704_100280396
913 Ga0068855_100000319
914 Ga0068857_100011491
915 Ga0068856_100006539
916 Ga0068859_100168128
917 Ga0068859_100206768
918 Ga0068864_100009783
919 Ga0068861_100024675
920 Ga0068870_10002333
921 Ga0068863_100034656
922 Ga0068863_100047886
923 Ga0068860_100006217
924 Ga0068860_100091709
925 Ga0068862_100000487
926 Ga0068862_100043144
927 Ga0081455_10001297
928 Ga0081455_10024510
929 Ga0081538_10024747
930 Ga0081540_1011967
931 Ga0081539_10000083
932 Ga0070715_10013289
933 Ga0070716_100013575
934 Ga0070712_100030550
935 Ga0075428_100000176
936 Ga0075428_100005443
937 Ga0075428_100013979
938 Ga0075428_100016686
939 Ga0075428_100026627
940 Ga0075428_100048838
941 Ga0075428_100079816
942 Ga0075428_100093075
943 Ga0075428_100153450
944 Ga0075428_100163079
945 Ga0075428_100195872
946 Ga0075428_100202537
947 Ga0075430_100000127
948 Ga0075430_100001542
949 Ga0075430_100009967
950 Ga0075430_100038989
951 Ga0075430_100125889
952 Ga0075430_100189762
953 Ga0075430_100263504
954 Ga0075431_100000420
955 Ga0075431_100001064
956 Ga0075431_100002573
957 Ga0075431_100002829
958 Ga0075431_100014931
959 Ga0075431_100019582
960 Ga0075431_100025894
961 Ga0075431_100039873
962 Ga0075431_100048791
963 Ga0075431_100121988
964 Ga0075431_100125332
965 Ga0075431_100167411
966 Ga0075433_10000052
967 Ga0075433_10003282
968 Ga0075433_10009615
969 Ga0075433_10011249
970 Ga0075433_10041400
971 Ga0075433_10042260
972 Ga0075433_10042774
973 Ga0075433_10084754
974 Ga0075433_10149092
975 Ga0075434_100000262
976 Ga0075434_100005556
977 Ga0075434_100024034
978 Ga0075434_100026524
979 Ga0075434_100041791
980 Ga0075434_100049091
981 Ga0075434_100069888
982 Ga0075434_100110462
983 Ga0075434_100249083
984 Ga0075429_100000075
985 Ga0075429_100001545
986 Ga0075429_100002125
987 Ga0075429_100005105
988 Ga0075429_100009405
989 Ga0075429_100020608
990 Ga0075429_100084784
991 Ga0075429_100130324
992 Ga0075429_100217967
993 Ga0068865_100004300
994 Ga0075436_100004665
995 Ga0075436_100033886
996 Ga0075436_100215906
997 Ga0097620_100168138
998 Ga0097620_100206740
999 Ga0075435_100004032
1000 Ga0075435_100016853
1001 Ga0075435_100021132
1002 Ga0075435_100031404
1003 Ga0075435_100031867
1004 Ga0075435_100036724
1005 Ga0075435_100179627
1006 Ga0099794_10000310
1007 Ga0111539_10000103
1008 Ga0111539_10000275
1009 Ga0111539_10002668
1010 Ga0111539_10011048
1011 Ga0111539_10045183
1012 Ga0111539_10059861
1013 Ga0111539_10113573
1014 Ga0111539_10137534
1015 Ga0111539_10221507
1016 Ga0105245_10020600
1017 Ga0105247_10010339
1018 Ga0114129_10001042
1019 Ga0114129_10001782
1020 Ga0114129_10001965
1021 Ga0114129_10002034
1022 Ga0114129_10009901
1023 Ga0114129_10025266
1024 Ga0114129_10029338
1025 Ga0114129_10032461
1026 Ga0114129_10032652
1027 Ga0114129_10102529
1028 Ga0114129_10134517
1029 Ga0114129_10224297
1030 Ga0114129_10247088
1031 Ga0105243_10026774
1032 Ga0105243_10089778
1033 Ga0105243_10109561
1034 Ga0105243_10246194
1035 Ga0105241_10001179
1036 Ga0105242_10020990
1037 Ga0105242_10183849
1038 Ga0105242_10199890
1039 Ga0105248_10118792
1040 Ga0105237_10248608
1041 Ga0105246_10007951
1042 Ga0105246_10017101
1043 Ga0105246_10045911
1044 Ga0157373_10004022
1045 Ga0157371_10002617
1046 Ga0157371_10117786
1047 Ga0157369_10145836
1048 Ga0157374_10103977
1049 Ga0157374_10163626
1050 Ga0157378_10007084
1051 Ga0157378_10124657
1052 Ga0157378_10204714
1053 Ga0163162_10081712
1054 Ga0157372_10006181
1055 Ga0157372_10115328
1056 Ga0157375_10084609
1057 Ga0163163_10049524
1058 Ga0157380_10258224
1059 Ga0157377_10025210
1060 Ga0163161_10040790
1061 Ga0209566_100709
1062 Ga0209147_100262
1063 Ga0209147_102106
1064 Ga0209147_102633
1065 Ga0209147_102729
1066 Ga0209437_100552
1067 Ga0209130_1001035
1068 Ga0209130_1002803
1069 Ga0209130_1004812
1070 Ga0209130_1004843
1071 Ga0209025_1000011
1072 Ga0209025_1000347
1073 Ga0209025_1000388
1074 Ga0209025_1001677
1075 Ga0209025_1001722
1076 Ga0209025_1002269
1077 Ga0209025_1003207
1078 Ga0209025_1004185
1079 Ga0207426_1030025
1080 Ga0207696_1000865
1081 Ga0207696_1002049
1082 Ga0207696_1011712
1083 Ga0207655_1002285
1084 Ga0207655_1002655
1085 Ga0207713_1000727
1086 Ga0207653_10005861
1087 Ga0207688_10019936
1088 Ga0207680_10001137
1089 Ga0207645_10014975
1090 Ga0207643_10001863
1091 Ga0207643_10089464
1092 Ga0207684_10000791
1093 Ga0207684_10001023
1094 Ga0207684_10051763
1095 Ga0207684_10056514
1096 Ga0207684_10240086
1097 Ga0207707_10000116
1098 Ga0207707_10105875
1099 Ga0207671_10000004
1100 Ga0207671_10079923
1101 Ga0207693_10060883
1102 Ga0207660_10002889
1103 Ga0207660_10035684
1104 Ga0207662_10140571
1105 Ga0207657_10002084
1106 Ga0207649_10001837
1107 Ga0207652_10003098
1108 Ga0207646_10000699
1109 Ga0207646_10001026
1110 Ga0207646_10005460
1111 Ga0207646_10009250
1112 Ga0207646_10016411
1113 Ga0207646_10084601
1114 Ga0207646_10103196
1115 Ga0207646_10104687
1116 Ga0207646_10105059
1117 Ga0207646_10223467
1118 Ga0207681_10015108
1119 Ga0207681_10044083
1120 Ga0207681_10253309
1121 Ga0207650_10058472
1122 Ga0207687_10056051
1123 Ga0207687_10062108
1124 Ga0207706_10005422
1125 Ga0207706_10007465
1126 Ga0207686_10087504
1127 Ga0207709_10109139
1128 Ga0207704_10012977
1129 Ga0207704_10045818
1130 Ga0207665_10002315
1131 Ga0207691_10013829
1132 Ga0207689_10000058
1133 Ga0207689_10000942
1134 Ga0207661_10136346
1135 Ga0207679_10002446
1136 Ga0207667_10000342
1137 Ga0207712_10172180
1138 Ga0207678_10000501
1139 Ga0207702_10002217
1140 Ga0207648_10006801
1141 Ga0207648_10130282
1142 Ga0207676_10069053
1143 Ga0207674_10002881
1144 Ga0207675_100023622
1145 Ga0207675_100138013
1146 Ga0207675_100153769
1147 Ga0207683_10306608
1148 Ga0207698_10102499
1149 Ga0209967_1004631
1150 Ga0209968_1000806
1151 Ga0209999_1001372
1152 Ga0209983_1000013
1153 Ga0209588_1018913
1154 Ga0209971_1000042
1155 Ga0209966_1000026
1156 Ga0209998_10000004
1157 Ga0207428_10000362
1158 Ga0207428_10000725
1159 Ga0207428_10004772
1160 Ga0207428_10007573
1161 Ga0207428_10064694
1162 Ga0268265_10025321
1163 Ga0268265_10157504
1164 Ga0268265_10218025
1165 Ga0268264_10011418
1166 Ga0237817_10260
1167 Ga0307408_100006448
1168 Ga0307408_100012648
1169 Ga0307408_100053321
1170 Ga0316575_10000015
1171 Ga0316579_10024153
1172 Ga0307405_10113639
1173 Ga0307410_10053802
1174 Ga0307406_10017580
1175 Ga0307406_10064264
1176 Ga0307407_10184290
1177 Ga0307409_100022958
1178 Ga0307409_100023445
1179 Ga0307416_100017473
1180 Ga0307416_100131739
1181 Ga0307411_10215515
1182 Ga0373926_0026563
1183 Ga0373934_0011489
1184 Ga0373940_0014932
1185 Ga0373949_0003723
1186 Ga0373932_0009309
1187 Ga0373932_0015532
1188 Ga0373941_0008061
1189 Ga0373960_0010159
1190 Ga0373942_0029573
1191 Ga0316574_0056237
1192 Ga0373931_0006289
1193 Ga0373931_0058970
1194 Ga0373931_0090580
1195 Ga0373927_0007561
1196 Ga0373947_0000119
1197 Ga0316584_0123445
1198 Ga0316584_0243415
1199 Ga0373925_0000296
1200 Ga0395899_0023769
1201 Ga0395899_0178737
1202 Ga0395900_0009304
1203 Ga0395898_0013990
1204 Ga0395905_0229960
1205 Ga0395901_0001591
1206 Ga0237819_00149
1207 Ga0237819_00173
1208 Ga0400489_63543
1209 Ga0439448_0001756
1210 Ga0439449_0007338
1211 Ga0450903_015402
1212 Ga0439435_0041304
1213 Ga0439460_0005173
1214 Ga0451577_0000254
1215 Ga0451577_0000807
1216 Ga0451577_0006179
1217 Ga0451577_0011400
1218 Ga0451577_0015473
1219 Ga0451577_0029889
1220 Ga0451577_0201785
1221 Ga0453683_0081301
1222 Ga0453684_0000177
1223 Ga0453684_0000521
1224 Ga0453684_0036531
1225 Ga0453684_0120871
1226 Ga0453684_0196602
1227 Ga0466960_0022141
1228 Ga0466960_0035408
1229 Ga0451576_0005053
1230 Ga0451576_0053415
1231 Ga0451576_0074153
1232 Ga0451576_0379220
1233 Ga0466967_0000623
1234 Ga0466967_0011821
1235 Ga0495580_0014869
1236 Ga0495584_0102081
1237 Ga0495665_0048643
1238 Ga0496102_0009055
1239 Ga0496102_0233068
1240 Ga0496104_0008096
1241 Ga0496106_0000224
1242 Ga0496107_0011410
1243 Ga0496107_0116394
1244 Ga0496108_0002369
1245 Ga0496109_0003788
1246 Ga0496111_0001047
1247 Ga0496112_0036159
1248 Ga0496112_0291378
1249 Ga0496118_0087869
1250 Ga0496120_0043874
1251 Ga0496123_0049803
1252 Ga0496124_0022607
1253 Ga0496125_0006100
1254 Ga0501343_003403
1255 Ga0501345_00134
1256 Ga0501305_002424
1257 Ga0501315_008731
1258 Ga0501316_001034
1259 Ga0501317_001707
1260 Ga0501317_009014
1261 Ga0501321_002237
1262 Ga0501333_000393
1263 Ga0501334_00268
1264 Ga0501335_002446
1265 Ga0501336_000403
1266 Ga0501337_001621
1267 Ga0501338_00318
1268 Ga0501032_0054797
1269 Ga0501033_0124880
1270 Ga0501034_0022032
1271 Ga0501034_0424939
1272 Ga0501036_0001372
1273 Ga0501036_0054566
1274 Ga0501036_0124414
1275 Ga0501036_0188360
1276 Ga0501037_0250361
1277 Ga0501038_0006167
1278 Ga0501038_0026494
1279 Ga0501039_0000732
1280 Ga0501039_0001276
1281 Ga0501039_0108628
1282 Ga0501040_0001412
1283 Ga0501040_0020581
1284 Ga0501040_0030755
1285 Ga0501040_0045597
1286 Ga0501040_0081324
1287 Ga0501040_0105814
1288 Ga0501040_0183043
1289 Ga0501040_0293598
1290 Ga0501041_0001736
1291 Ga0501041_0001961
1292 Ga0501041_0008896
1293 Ga0501041_0030385
1294 Ga0501041_0033360
1295 Ga0501041_0034594
1296 Ga0501041_0053370
1297 Ga0501041_0075834
1298 Ga0501042_0000612
1299 Ga0501042_0011683
1300 Ga0501042_0111678
1301 Ga0501042_0124885
1302 Ga0501046_0000569
1303 Ga0501046_0023086
1304 Ga0501046_0050256
1305 Ga0501046_0093767
1306 Ga0501046_0163079
1307 Ga0501048_0010098
1308 Ga0501048_0012603
1309 Ga0501048_0049651
1310 Ga0501067_0009258
1311 Ga0501068_0018610
1312 Ga0501071_0024984
1313 Ga0501071_0057465
1314 Ga0501071_0070526
1315 Ga0501071_0098163
1316 Ga0501072_0001347
1317 Ga0501072_0003106
1318 Ga0501072_0036536
1319 Ga0501072_0046054
1320 Ga0501072_0064458
1321 Ga0501073_0097233
1322 Ga0501074_0080564
1323 Ga0501075_0005765
1324 Ga0501075_0008362
1325 Ga0501075_0012802
1326 Ga0501075_0018641
1327 Ga0501075_0024428
1328 Ga0501075_0047343
1329 Ga0501075_0053650
1330 Ga0501075_0094442
1331 Ga0501075_0103809
1332 Ga0501075_0133149
1333 Ga0501075_0152331
1334 Ga0501075_0156881
1335 Ga0501075_0191037
1336 Ga0501076_0003600
1337 Ga0501076_0006299
1338 Ga0501076_0006927
1339 Ga0501076_0009215
1340 Ga0501076_0011783
1341 Ga0501076_0058249
1342 Ga0501076_0059692
1343 Ga0501076_0065959
1344 Ga0501076_0102596
1345 Ga0501076_0127521
1346 Ga0501076_0259376
1347 Ga0501077_0002373
1348 Ga0501077_0008127
1349 Ga0501077_0011985
1350 Ga0501077_0019307
1351 Ga0501077_0020362
1352 Ga0501077_0030055
1353 Ga0501077_0040264
1354 Ga0501077_0103170
1355 Ga0501077_0111175
1356 Ga0501217_010474
1357 Ga0501234_005621
1358 Ga0501079_0001721
1359 Ga0501079_0002033
1360 Ga0501079_0002716
1361 Ga0501079_0016969
1362 Ga0501079_0017072
1363 Ga0501079_0041821
1364 Ga0501079_0046539
1365 Ga0501079_0138277
1366 Ga0501079_0173335
1367 Ga0501080_0002636
1368 Ga0501080_0010554
1369 Ga0501080_0010775
1370 Ga0501080_0015311
1371 Ga0501080_0157765
1372 Ga0501080_0338555
1373 Ga0501081_0000748
1374 Ga0501081_0001683
1375 Ga0501081_0005714
1376 Ga0501081_0007899
1377 Ga0501081_0007939
1378 Ga0501081_0014410
1379 Ga0501081_0084147
1380 Ga0501081_0133800
1381 Ga0501083_0018906
1382 Ga0501083_0021069
1383 Ga0501083_0167078
1384 Ga0501035_0039014
1385 Ga0501035_0042299
1386 Ga0501045_0004910
1387 Ga0501045_0007926
1388 Ga0501045_0051357
1389 Ga0501045_0060448
1390 Ga0501045_0131983
1391 Ga0501045_0135931
1392 Ga0501045_0141757
1393 nmdc:mga05p37_169602_c1
1394 nmdc:mga05p37_176129_c1
1395 nmdc:mga05p37_201439_c1
1396 nmdc:mga05p37_2470_c1
1397 nmdc:mga05p37_2665_c1
1398 nmdc:mga05p37_297300_c1
1399 nmdc:mga05p37_3353_c1
1400 nmdc:mga05p37_4677_c1
1401 nmdc:mga05p37_47945_c1
1402 nmdc:mga05p37_50895_c1
1403 nmdc:mga05p37_510_c1
1404 nmdc:mga05p37_5932_c1
1405 nmdc:mga05p37_65451_c1
1406 nmdc:mga09592_2520_c1
1407 nmdc:mga09592_4797_c1
1408 nmdc:mga09592_5719_c1
1409 nmdc:mga09592_62770_c1
1410 nmdc:mga09592_6985_c1
1411 nmdc:mga09592_7229_c1
1412 nmdc:mga09592_73542_c1
1413 nmdc:mga09592_73718_c1
1414 nmdc:mga0qj67_200361_c1
1415 nmdc:mga0qj67_226955_c1
1416 nmdc:mga0qj67_368_c1
1417 nmdc:mga0qj67_434_c1
1418 nmdc:mga06r32_10643_c1
1419 nmdc:mga06r32_149714_c1
1420 nmdc:mga06r32_156640_c1
1421 nmdc:mga06r32_236125_c1
1422 nmdc:mga06r32_310_c1
1423 nmdc:mga06r32_36381_c1
1424 nmdc:mga06r32_372752_c1
1425 nmdc:mga06r32_383692_c1
1426 nmdc:mga06r32_946_c1
1427 nmdc:mga08y16_15283_c1
1428 nmdc:mga08y16_17465_c1
1429 nmdc:mga08y16_1893_c1
1430 nmdc:mga08y16_214656_c1
1431 nmdc:mga08y16_262381_c1
1432 nmdc:mga08y16_3612_c1
1433 nmdc:mga0n895_100327_c1
1434 nmdc:mga0n895_1004_c1
1435 nmdc:mga0n895_11003_c1
1436 nmdc:mga0n895_1147_c1
1437 nmdc:mga0n895_14820_c1
1438 nmdc:mga0n895_24482_c1
1439 nmdc:mga0n895_300911_c1
1440 nmdc:mga0n895_59918_c1
1441 nmdc:mga0n895_75238_c1
1442 nmdc:mga0rr50_119086_c1
1443 nmdc:mga0rr50_3299_c1
1444 nmdc:mga0rr50_52175_c1
1445 nmdc:mga0rr50_95909_c1
1446 nmdc:mga08x19_29101_c1
1447 nmdc:mga08x19_34912_c1
1448 nmdc:mga08x19_61153_c1
1449 nmdc:mga08x19_7241_c1
1450 nmdc:mga0a205_13854_c1
1451 nmdc:mga0a205_202547_c1
1452 nmdc:mga0a205_2566_c1
1453 nmdc:mga0a205_3241_c1
1454 nmdc:mga0a205_37303_c1
1455 nmdc:mga0a205_51372_c1
1456 nmdc:mga0a205_60239_c1
1457 nmdc:mga0a205_631_c1
1458 Ga0501084_0000275
1459 Ga0501084_0006119
1460 Ga0501084_0007853
1461 Ga0501084_0008159
1462 Ga0501084_0015096
1463 Ga0501084_0059633
1464 Ga0501084_0062518
1465 Ga0501084_0177820
1466 Ga0501084_0202037
1467 Ga0501082_0003916
1468 Ga0501082_0008743
1469 Ga0501082_0011181
1470 Ga0501082_0037933
1471 Ga0501082_0048265
1472 Ga0501082_0059701
1473 Ga0501082_0061108
1474 Ga0501082_0288454
1475 Ga0530510_0000095
1476 Ga0530510_0000627
1477 Ga0530510_0010758
1478 Ga0530510_0018005
1479 Ga0530510_0028157
1480 Ga0530510_0033521
1481 Ga0530510_0079740
1482 Ga0530510_0120033
1483 Ga0530510_0130991
1484 Ga0530510_0170606
1485 2511700901
1486 2540608101
1487 2545559097
1488 2553395940
1489 2553396418
1490 2555468112
1491 2578933550
1492 2595090752
1493 2631985246
1494 2643766170
1495 2644706398
1496 2644708382
1497 2644713079
1498 2644714980
1499 2644715529
1500 2644726833
1501 2644739066
1502 2651530522
1503 2674422164
1504 2685148512
1505 2685152592
1506 2686998277
1507 2687499553
1508 2695628863
1509 2698320580
1510 2698324663
1511 2705992447
1512 2705996513
1513 2717915451
1514 2721503894
1515 2721507751
1516 2723641356
1517 2738815504
1518 2739157621
1519 2739158338
1520 2739209713
1521 2739211251
1522 2739229876
1523 2739270680
1524 2745165653
1525 2757568671
1526 2777763663
1527 2777836452
1528 2791214817
1529 2808867882
1530 2808901266
1531 2809053230
1532 2812317402
1533 2817481497
1534 2817617322
1535 2819581505
1536 2819583314
1537 2819628308
1538 2819708997
1539 2819722460
1540 2823529368
1541 2842884764
1542 2852675971
1543 2857589154
1544 2860840891
1545 2865004522
1546 2877771785
1547 2880172627
1548 2889043674
1549 2897112899
1550 2904495131
1551 2904524206
1552 2904563771
1553 2904609603
1554 2907207080
1555 2908666740
1556 2919095242
1557 2919147217
1558 2919163672
1559 2919417621
1560 2919429726
1561 2919519121
1562 2919723489
1563 2919727807
1564 2928095984
1565 2929006644
1566 2929233765
1567 2929238295
1568 2931387135
1569 2935410775
1570 2935891863
1571 2936342730
1572 2936362106
1573 2938917933
1574 2938922491
1575 2939595334
1576 2945994276
1577 2946057036
1578 2947427253
1579 2947431380
1580 2954777091
1581 2956897710
1582 2960319603
1583 2960381186
1584 2962294118
1585 2965761820
1586 2965765875
1587 2969140099
1588 2969144339
1589 2969769140
1590 2969771455
1591 2971896451
1592 2977256302
1593 2979084246
1594 2979088281
1595 2980495886
1596 2984530846
1597 2984536955
1598 2990277181
1599 3001897491
1600 3006861922
1601 3006882609
1602 3006971887
1603 3006976216
1604 3006981199
1605 8022621690
1606 8022624545
1607 8022633050
1608 8022655766
1609 8022797987
1610 8022898467
1611 8022917618
1612 8023438907
1613 8023443685
1614 8023445490
1615 8023450380
1616 8046353574
1617 8051954596
1618 8052175317
1619 8054282492
1620 8055535889
1621 8057583322
1622 8057587044
1623 8057636061
1624 8057733828

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

172

384

0.99

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

36

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hye-assembly1.cif.gz_C-2 structure of amino acid dehydrogenase-2752 with ligand 0.9823 1 362
8hye-assembly1.cif.gz_B-2 structure of amino acid dehydrogenase-2752 with ligand 0.9795 1 362
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9782 1 362
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9742 1 361
8hye-assembly1.cif.gz_A-2 structure of amino acid dehydrogenase-2752 with ligand 0.9679 1 362
ID Description Score Start End Superfamily
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9989 3 105 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9908 2 108 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 1 118 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 124 297 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 124 297 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I3UQK1-F1-model_v4 deleted 1.008 1 76
AF-A0A6M0AUB3-F1-model_v4 Alanine dehydrogenase 1.007 1 76 GO:0000286
GO:0005886
GO:0006524
AF-A0A0J1FRW9-F1-model_v4 Alanine dehydrogenase 2 (EC 1.4.1.1) 1.005 1 76 GO:0000286
GO:0005886
GO:0006524
AF-A0A4U3A395-F1-model_v4 Alanine dehydrogenase 1.004 1 129 GO:0000286
GO:0005886
GO:0006524
AF-A0A6I3FG25-F1-model_v4 Alanine dehydrogenase 1.004 2 76 GO:0000286
GO:0005886
GO:0006524

Map