F481817

General Info

Members Datasets Scaffolds Average Seq Length
810 517 627 226

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0014418|Ga0495684_0014418_2217_3020
Length 267
Sequence MAVDGKEDPVLARFRQMSRPMRLIYARPRTFISLGAGILACLLVPGSLRLTTRLVLGWDTLIAVYLVLVYAMMLCNDHQHIRRAAAMQDDGRFVILLVTAIGAFASIAAIVAELGAHRGAAELTIAITTIALSWAAVHTTFALHYAHDYYRHPPGGLQFPSGDKEDHADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGIVSFIYNTALLALTVNIAASAIASLRPPQSSFWRKPGRPSGEASHPTQLHTSTLASFPGPPPP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
22 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
23 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
24 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
36 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
60 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
61 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
64 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
65 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
66 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
70 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
71 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
72 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
73 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
74 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
75 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
76 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
77 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
78 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
79 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
80 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
81 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
82 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
83 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
84 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
85 2922368715
86 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
87 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
88 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
89 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
90 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
91 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
92 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
93 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
94 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
95 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
96 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
97 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
98 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
99 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
100 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
101 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
102 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
103 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
104 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
105 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
106 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
107 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
108 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
109 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
110 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
111 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
112 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
113 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
114 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
115 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
116 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
117 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
118 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
119 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
120 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
121 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
122 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
123 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
124 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
125 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
135 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
138 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
139 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
140 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
141 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
142 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
143 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
144 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
145 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
146 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
147 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
148 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
149 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
150 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
151 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
152 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
153 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
154 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
158 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
159 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
160 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
161 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
168 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
169 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
170 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
171 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
172 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
173 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
174 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
175 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
176 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
177 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
178 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
179 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
180 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
185 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
186 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
187 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
188 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
189 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
190 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
191 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
192 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
193 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
194 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
195 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
196 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
197 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
198 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
199 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
200 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
201 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
202 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
203 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
204 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
205 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
206 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
207 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
208 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
209 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
210 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
211 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
213 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
217 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
218 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
219 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
220 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
221 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
222 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
223 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
224 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
225 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
226 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
227 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
228 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
229 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
234 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
270 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
271 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
273 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
275 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
278 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
279 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
280 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
301 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
304 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
305 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
306 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
309 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
314 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
336 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
362 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
420 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
425 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
426 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
427 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
428 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
436 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
437 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
442 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
443 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
446 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
447 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
448 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
449 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
450 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
451 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
452 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
453 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
454 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
455 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
456 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
457 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
458 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
459 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
460 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
461 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
462 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
463 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
464 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
465 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
466 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
467 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
468 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
469 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
472 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
473 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
474 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
475 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
476 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
477 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
478 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
479 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
480 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
481 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
482 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
483 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
486 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
487 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
488 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
489 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
490 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
491 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
492 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
493 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
494 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
495 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
496 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
497 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
498 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
499 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
500 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
501 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
502 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
503 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
504 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
505 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
506 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
507 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
508 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
509 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
510 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
511 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
512 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
513 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
514 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
515 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
516 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
517 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.38
Metatranscriptomes 0.12
Isolates 22.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.14
Nodule 17.9
Rhizoplane 3.21
Rhizosphere 46.91
Stem 0
Stem Tuber 0
Unclassified 12.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002939 3300003203 Bacteria 8034
2 JGI25153J46596_10002236 3300003215 Bacteria 11297
3 JGI25153J46596_10003534 3300003215 Bacteria 8720
4 JGI25153J46596_10051863 3300003215 Bacteria 1171
5 rootH2_10146027 3300003320 Bacteria 1438
6 rootL2_10014174 3300003322 Bacteria 1102
7 JGI25160J50197_1007311 3300003354 Bacteria 4342
8 JGI25160J50197_1008958 3300003354 Bacteria 3760
9 JGI25160J50197_1014145 3300003354 Bacteria 2683
10 JGI25404J52841_10009041 3300003659 Bacteria 2129
11 JGI25404J52841_10023969 3300003659 Bacteria 1316
12 Ga0055542_1008654 3300003762 Bacteria 1976
13 Ga0055531_10006394 3300003794 Bacteria 6700
14 Ga0055543_1001201 3300004625 Bacteria 10876
15 Ga0055543_1016667 3300004625 Bacteria 1394
16 Ga0065165_1003230 3300005262 Bacteria 11833
17 Ga0065165_1003543 3300005262 Bacteria 10800
18 Ga0065165_1068283 3300005262 Bacteria 951
19 Ga0070658_10082475 3300005327 Bacteria 2642
20 Ga0070658_10091470 3300005327 Bacteria 2507
21 Ga0070658_10104306 3300005327 Bacteria 2345
22 Ga0070658_10187977 3300005327 Bacteria 1740
23 Ga0070658_10515471 3300005327 Bacteria 1034
24 Ga0070658_10525823 3300005327 Bacteria 1023
25 Ga0070683_100104465 3300005329 Bacteria 2670
26 Ga0070670_100025237 3300005331 Bacteria 5115
27 Ga0068869_100352092 3300005334 Bacteria 1201
28 Ga0068868_100102289 3300005338 Bacteria 2320
29 Ga0070660_100302526 3300005339 Bacteria 1311
30 Ga0070660_100467162 3300005339 Bacteria 1048
31 Ga0070661_100250871 3300005344 Bacteria 1365
32 Ga0070661_100572237 3300005344 Bacteria 911
33 Ga0070668_100035201 3300005347 Bacteria 3817
34 Ga0070668_100542269 3300005347 Bacteria 1012
35 Ga0070659_100019746 3300005366 Bacteria 5113
36 Ga0070667_100347889 3300005367 Bacteria 1341
37 Ga0070709_10004296 3300005434 Bacteria 7684
38 Ga0070709_10006312 3300005434 Bacteria 6455
39 Ga0070714_100002380 3300005435 Bacteria 13846
40 Ga0070714_100043477 3300005435 Bacteria 3800
41 Ga0070714_100092324 3300005435 Bacteria 2653
42 Ga0070714_100147138 3300005435 Bacteria 2120
43 Ga0070714_101052084 3300005435 Bacteria 793
44 Ga0070713_100007138 3300005436 Bacteria 7813
45 Ga0070713_100185916 3300005436 Bacteria 1870
46 Ga0070710_10004062 3300005437 Bacteria 6946
47 Ga0070710_10255693 3300005437 Bacteria 1128
48 Ga0070711_100154851 3300005439 Bacteria 1732
49 Ga0070694_100170782 3300005444 Bacteria 1602
50 Ga0070663_100111072 3300005455 Bacteria 2060
51 Ga0070663_100269663 3300005455 Bacteria 1353
52 Ga0070663_100353457 3300005455 Bacteria 1190
53 Ga0070707_100096973 3300005468 Bacteria 2856
54 Ga0070698_100205477 3300005471 Bacteria 1905
55 Ga0070679_100401000 3300005530 Bacteria 1317
56 Ga0070665_100366299 3300005548 Bacteria 1448
57 Ga0070665_100447213 3300005548 Bacteria 1301
58 Ga0070665_100478775 3300005548 Bacteria 1255
59 Ga0068857_100133495 3300005577 Bacteria 2240
60 Ga0068857_100177179 3300005577 Bacteria 1940
61 Ga0068856_100276734 3300005614 Bacteria 1695
62 Ga0068856_100448706 3300005614 Bacteria 1310
63 Ga0070702_100614851 3300005615 Bacteria 817
64 Ga0068852_100031105 3300005616 Bacteria 4400
65 Ga0068864_100327275 3300005618 Bacteria 1441
66 Ga0068863_100436663 3300005841 Bacteria 1283
67 Ga0081455_10003129 3300005937 Bacteria 19259
68 Ga0081455_10005099 3300005937 Bacteria 14491
69 Ga0081455_10172765 3300005937 Bacteria 1644
70 Ga0081540_1008204 3300005983 Bacteria 7315
71 Ga0081540_1010671 3300005983 Bacteria 6197
72 Ga0081540_1049990 3300005983 Bacteria 2081
73 Ga0081540_1053693 3300005983 Bacteria 1974
74 Ga0081540_1071200 3300005983 Bacteria 1608
75 Ga0070717_10003247 3300006028 Bacteria 11623
76 Ga0070717_10142680 3300006028 Bacteria 2067
77 Ga0075365_10003007 3300006038 Bacteria 8543
78 Ga0075365_10028075 3300006038 Bacteria 3587
79 Ga0075365_10031542 3300006038 Bacteria 3400
80 Ga0075365_10058216 3300006038 Bacteria 2572
81 Ga0075365_10335823 3300006038 Bacteria 1065
82 Ga0075365_10349122 3300006038 Bacteria 1043
83 Ga0075368_10135139 3300006042 Bacteria 1026
84 Ga0075363_100010642 3300006048 Bacteria 4378
85 Ga0075363_100197091 3300006048 Bacteria 1150
86 Ga0075363_100244103 3300006048 Bacteria 1033
87 Ga0075364_10031981 3300006051 Bacteria 3380
88 Ga0075364_10073707 3300006051 Bacteria 2250
89 Ga0075364_10094530 3300006051 Bacteria 1986
90 Ga0075364_10171955 3300006051 Bacteria 1465
91 Ga0075364_10459824 3300006051 Bacteria 870
92 Ga0070715_10000109 3300006163 Bacteria 20240
93 Ga0070716_100043623 3300006173 Bacteria 2509
94 Ga0070716_100173005 3300006173 Bacteria 1411
95 Ga0070712_100008123 3300006175 Bacteria 6590
96 Ga0070712_100011266 3300006175 Bacteria 5664
97 Ga0070712_100117928 3300006175 Bacteria 1993
98 Ga0070712_100167898 3300006175 Bacteria 1700
99 Ga0075362_10013513 3300006177 Bacteria 3270
100 Ga0075362_10049798 3300006177 Bacteria 1872
101 Ga0075367_10074167 3300006178 Bacteria 2052
102 Ga0075366_10010771 3300006195 Bacteria 5141
103 Ga0075366_10233189 3300006195 Bacteria 1122
104 Ga0075370_10053233 3300006353 Bacteria 2297
105 Ga0075370_10120838 3300006353 Bacteria 1525
106 Ga0075370_10331425 3300006353 Bacteria 907
107 Ga0075428_100605634 3300006844 Bacteria 1170
108 Ga0075428_100641465 3300006844 Bacteria 1133
109 Ga0075428_100839863 3300006844 Bacteria 975
110 Ga0075430_100000343 3300006846 Bacteria 33706
111 Ga0075431_100719081 3300006847 Bacteria 975
112 Ga0075429_100000014 3300006880 Bacteria 79603
113 Ga0075429_100022049 3300006880 Bacteria 5524
114 Ga0099824_1011459 3300006942 Bacteria 10029
115 Ga0099824_1038190 3300006942 Bacteria 1292
116 Ga0099823_1055347 3300006944 Bacteria 2252
117 Ga0099794_10004043 3300007265 Bacteria 5703
118 Ga0099794_10078326 3300007265 Bacteria 1627
119 Ga0105240_10013956 3300009093 Bacteria 10999
120 Ga0105240_10077943 3300009093 Bacteria 4082
121 Ga0105245_10070218 3300009098 Bacteria 3178
122 Ga0114129_10055625 3300009147 Bacteria 5545
123 Ga0114129_10101957 3300009147 Bacteria 3970
124 Ga0105243_10513834 3300009148 Bacteria 1138
125 Ga0105241_10046592 3300009174 Bacteria 3293
126 Ga0105241_10232848 3300009174 Bacteria 1553
127 Ga0105248_10909424 3300009177 Bacteria 994
128 Ga0105237_10036560 3300009545 Bacteria 4970
129 Ga0105237_10071402 3300009545 Bacteria 3466
130 Ga0105237_10337386 3300009545 Bacteria 1512
131 Ga0105238_10197412 3300009551 Bacteria 1988
132 Ga0105238_10378160 3300009551 Bacteria 1407
133 Ga0105249_10461645 3300009553 Bacteria 1310
134 Ga0099796_10012847 3300010159 Bacteria 2377
135 Ga0099796_10191672 3300010159 Bacteria 825
136 Ga0105239_10063317 3300010375 Bacteria 4060
137 Ga0105239_10079841 3300010375 Bacteria 3600
138 Ga0105239_10181918 3300010375 Bacteria 2352
139 Ga0105239_10334669 3300010375 Bacteria 1708
140 Ga0105239_10603116 3300010375 Bacteria 1252
141 Ga0157370_10352394 3300013104 Bacteria 1357
142 Ga0163162_11030991 3300013306 Bacteria 931
143 Ga0157375_10284616 3300013308 Bacteria 1816
144 Ga0157375_10633899 3300013308 Bacteria 1226
145 Ga0163163_10309141 3300014325 Bacteria 1633
146 Ga0163163_10423188 3300014325 Bacteria 1391
147 Ga0157377_10352769 3300014745 Bacteria 987
148 Ga0157379_10206937 3300014968 Bacteria 1775
149 Ga0157379_10437434 3300014968 Bacteria 1206
150 Ga0182007_10097440 3300015262 Bacteria 971
151 Ga0213876_10004604 3300021384 Bacteria 7688
152 Ga0207425_1032449 3300025245 Bacteria 1034
153 Ga0209677_104344 3300025253 Bacteria 4130
154 Ga0209148_1000334 3300025254 Bacteria 64148
155 Ga0209455_1000787 3300025272 Bacteria 17683
156 Ga0209673_1041175 3300025273 Bacteria 1314
157 Ga0209758_1000015 3300025297 Bacteria 851943
158 Ga0209758_1000224 3300025297 Bacteria 121530
159 Ga0209758_1000692 3300025297 Bacteria 49946
160 Ga0209758_1007793 3300025297 Bacteria 7152
161 Ga0209758_1016910 3300025297 Bacteria 3671
162 Ga0207426_1000201 3300025302 Bacteria 143975
163 Ga0207426_1004020 3300025302 Bacteria 7460
164 Ga0207426_1004845 3300025302 Bacteria 6378
165 Ga0207426_1088282 3300025302 Bacteria 826
166 Ga0209051_1022112 3300025303 Bacteria 2686
167 Ga0209257_1006922 3300025304 Bacteria 7088
168 Ga0209257_1010082 3300025304 Bacteria 4883
169 Ga0209257_1043698 3300025304 Bacteria 1312
170 Ga0207692_10003125 3300025898 Bacteria 6425
171 Ga0207692_10016330 3300025898 Bacteria 3285
172 Ga0207688_10142213 3300025901 Bacteria 1413
173 Ga0207680_10170252 3300025903 Bacteria 1466
174 Ga0207647_10023266 3300025904 Bacteria 4100
175 Ga0207685_10227400 3300025905 Bacteria 891
176 Ga0207699_10004953 3300025906 Bacteria 6368
177 Ga0207699_10011179 3300025906 Bacteria 4524
178 Ga0207705_10063380 3300025909 Bacteria 2671
179 Ga0207705_10148279 3300025909 Bacteria 1756
180 Ga0207705_10174065 3300025909 Bacteria 1622
181 Ga0207654_10044831 3300025911 Bacteria 2514
182 Ga0207654_10306431 3300025911 Bacteria 1082
183 Ga0207695_10000065 3300025913 Bacteria 336949
184 Ga0207671_10010281 3300025914 Bacteria 7736
185 Ga0207671_10247853 3300025914 Bacteria 1400
186 Ga0207693_10000073 3300025915 Bacteria 89380
187 Ga0207693_10008082 3300025915 Bacteria 8629
188 Ga0207693_10048842 3300025915 Bacteria 3323
189 Ga0207663_10000222 3300025916 Bacteria 25394
190 Ga0207663_10050152 3300025916 Bacteria 2593
191 Ga0207657_10006481 3300025919 Bacteria 12130
192 Ga0207681_10218006 3300025923 Bacteria 1475
193 Ga0207694_10079439 3300025924 Bacteria 2573
194 Ga0207687_10083446 3300025927 Bacteria 2313
195 Ga0207687_10197408 3300025927 Bacteria 1570
196 Ga0207700_10243506 3300025928 Bacteria 1534
197 Ga0207664_10026828 3300025929 Bacteria 4359
198 Ga0207664_10930994 3300025929 Bacteria 780
199 Ga0207644_10420317 3300025931 Bacteria 1095
200 Ga0207690_10245023 3300025932 Bacteria 1382
201 Ga0207665_10000316 3300025939 Bacteria 33366
202 Ga0207665_10069246 3300025939 Bacteria 2406
203 Ga0207689_10356269 3300025942 Bacteria 1217
204 Ga0207679_10206995 3300025945 Bacteria 1643
205 Ga0207667_10331186 3300025949 Bacteria 1554
206 Ga0207668_10197826 3300025972 Bacteria 1598
207 Ga0207640_10622721 3300025981 Bacteria 916
208 Ga0207658_10108908 3300025986 Bacteria 2186
209 Ga0207677_10154418 3300026023 Bacteria 1775
210 Ga0207677_10359139 3300026023 Bacteria 1223
211 Ga0207678_10048854 3300026067 Bacteria 3656
212 Ga0207678_10073742 3300026067 Bacteria 2925
213 Ga0207678_10139094 3300026067 Bacteria 2072
214 Ga0207678_10144836 3300026067 Bacteria 2028
215 Ga0207641_10337148 3300026088 Bacteria 1434
216 Ga0207676_10856197 3300026095 Bacteria 889
217 Ga0207698_10065694 3300026142 Bacteria 2851
218 Ga0207698_10180967 3300026142 Bacteria 1867
219 Ga0207698_10462370 3300026142 Bacteria 1227
220 Ga0207698_10782059 3300026142 Bacteria 955
221 Ga0209389_1000051 3300027296 Bacteria 110364
222 Ga0209389_1000064 3300027296 Bacteria 102177
223 Ga0209589_1000012 3300027357 Bacteria 229451
224 Ga0209589_1000013 3300027357 Bacteria 229273
225 Ga0209489_100013 3300027361 Bacteria 229831
226 Ga0209489_102226 3300027361 Bacteria 39655
227 Ga0209700_100014 3300027363 Bacteria 299349
228 Ga0209179_1004497 3300027512 Bacteria 2109
229 Ga0209813_10033212 3300027866 Bacteria 1533
230 Ga0209813_10162563 3300027866 Bacteria 806
231 Ga0268266_10361233 3300028379 Bacteria 1366
232 Ga0268265_10526921 3300028380 Bacteria 1118
233 Ga0307517_10250461 3300028786 Bacteria 1040
234 Ga0307515_10156561 3300028794 Bacteria 2348
235 Ga0265332_10016245 3300031238 Bacteria 3284
236 Ga0307408_100020929 3300031548 Bacteria 4421
237 Ga0307408_100578190 3300031548 Bacteria 995
238 Ga0265342_10105013 3300031712 Bacteria 1605
239 Ga0307405_10450849 3300031731 Bacteria 1020
240 Ga0307510_10023425 3300033180 Bacteria 7158
241 Ga0307510_10033862 3300033180 Bacteria 5730
242 Ga0307510_10408005 3300033180 Bacteria 801
243 Ga0373950_0008539 3300034818 Bacteria 1615
244 Ga0373934_0002860 3300035086 Bacteria 6318
245 Ga0373944_0043490 3300035089 Bacteria 1396
246 Ga0373953_0102426 3300035117 Bacteria 1206
247 Ga0373954_0067381 3300035118 Bacteria 1696
248 Ga0373962_0077044 3300035242 Bacteria 1006
249 Ga0373933_0000173 3300035724 Bacteria 42306
250 Ga0373933_0270831 3300035724 Bacteria 1096
251 Ga0373937_0059216 3300036401 Bacteria 3520
252 Ga0310109_024188 3300036534 Bacteria 815
253 Ga0373925_0027030 3300037068 Bacteria 4201
254 Ga0373925_0463033 3300037068 Bacteria 1039
255 Ga0395899_0045464 3300037312 Bacteria 3272
256 Ga0395899_0060576 3300037312 Bacteria 2789
257 Ga0395899_0077138 3300037312 Bacteria 2431
258 Ga0395899_0098584 3300037312 Bacteria 2111
259 Ga0395900_0000696 3300037418 Bacteria 44867
260 Ga0395900_0061239 3300037418 Bacteria 3870
261 Ga0395900_0312439 3300037418 Bacteria 1554
262 Ga0395900_0473814 3300037418 Bacteria 1205
263 Ga0395898_0008381 3300037466 Bacteria 10932
264 Ga0395898_0009029 3300037466 Bacteria 10496
265 Ga0395898_0212991 3300037466 Bacteria 1843
266 Ga0395898_0317064 3300037466 Bacteria 1487
267 Ga0395905_0002558 3300037471 Bacteria 20049
268 Ga0395905_0077822 3300037471 Bacteria 3107
269 Ga0395901_0000688 3300038443 Bacteria 38764
270 Ga0395901_0007034 3300038443 Bacteria 11371
271 Ga0395901_0027392 3300038443 Bacteria 5856
272 Ga0395901_0331349 3300038443 Bacteria 1574
273 Ga0436365_0217850 3300039437 Bacteria 2058
274 Ga0436365_1912827 3300039437 Bacteria 2944
275 Ga0436360_0696150 3300039438 Bacteria 2027
276 Ga0436361_1126767 3300039447 Bacteria 4228
277 Ga0436363_0224061 3300039450 Bacteria 1662
278 Ga0451795_0339562 3300041456 Bacteria 870
279 Ga0451833_0705105 3300041491 Bacteria 1149
280 Ga0451837_1393955 3300041494 Bacteria 820
281 Ga0451853_2342626 3300041512 Bacteria 924
282 Ga0466969_0035718 3300044656 Bacteria 2513
283 Ga0466969_0103404 3300044656 Bacteria 1339
284 Ga0466972_0000059 3300044658 Bacteria 110350
285 Ga0466972_0128821 3300044658 Bacteria 1192
286 Ga0466965_0009320 3300044683 Bacteria 4563
287 Ga0466965_0013307 3300044683 Bacteria 3881
288 Ga0466966_0000307 3300044684 Bacteria 31630
289 Ga0466961_0000019 3300044693 Bacteria 107624
290 Ga0466963_0048239 3300044694 Bacteria 2813
291 Ga0466964_0124325 3300044706 Bacteria 1167
292 Ga0466968_0121861 3300044735 Bacteria 1180
293 Ga0466960_0115953 3300044901 Bacteria 1397
294 Ga0466959_0179332 3300045049 Bacteria 1482
295 Ga0466959_0593337 3300045049 Bacteria 745
296 Ga0466958_0404400 3300045836 Bacteria 881
297 Ga0466967_0041692 3300045976 Bacteria 3960
298 Ga0466967_0412536 3300045976 Bacteria 1315
299 Ga0495592_0020048 3300046454 Bacteria 5084
300 Ga0495592_0349585 3300046454 Bacteria 948
301 Ga0495603_0022781 3300046455 Bacteria 3790
302 Ga0495603_0299061 3300046455 Bacteria 924
303 Ga0495629_0028818 3300046459 Bacteria 3941
304 Ga0495638_0053712 3300046460 Bacteria 2507
305 Ga0495638_0074116 3300046460 Bacteria 2076
306 Ga0495638_0083181 3300046460 Bacteria 1939
307 Ga0495651_0005167 3300046462 Bacteria 9956
308 Ga0495651_0181099 3300046462 Bacteria 1491
309 Ga0495653_0029583 3300046463 Bacteria 4371
310 Ga0495580_0246803 3300046472 Bacteria 1223
311 Ga0495582_0093657 3300046473 Bacteria 1677
312 Ga0495605_0118126 3300046474 Bacteria 1204
313 Ga0495664_0045743 3300046477 Bacteria 2596
314 Ga0495664_0073297 3300046477 Bacteria 2047
315 Ga0495664_0152881 3300046477 Bacteria 1400
316 Ga0495664_0331665 3300046477 Bacteria 917
317 Ga0495594_0173227 3300046499 Bacteria 1228
318 Ga0495596_0054926 3300046500 Bacteria 1557
319 Ga0495607_0017436 3300046501 Bacteria 4609
320 Ga0495583_0091173 3300046506 Bacteria 1312
321 Ga0495606_0156206 3300046507 Bacteria 1334
322 Ga0495608_0038509 3300046511 Bacteria 3210
323 Ga0495616_0034692 3300046513 Bacteria 2617
324 Ga0495616_0160150 3300046513 Bacteria 1013
325 Ga0495620_0019743 3300046515 Bacteria 3307
326 Ga0495620_0148935 3300046515 Bacteria 913
327 Ga0495628_0025666 3300046516 Bacteria 4813
328 Ga0495628_0247814 3300046516 Bacteria 1331
329 Ga0495631_0181266 3300046518 Bacteria 902
330 Ga0495643_0050132 3300046522 Bacteria 2249
331 Ga0495648_0101195 3300046524 Bacteria 1590
332 Ga0495648_0128999 3300046524 Bacteria 1347
333 Ga0495648_0193983 3300046524 Bacteria 1022
334 Ga0495652_0065462 3300046529 Bacteria 3053
335 Ga0495652_0559335 3300046529 Bacteria 785
336 Ga0495640_0035646 3300046533 Bacteria 3520
337 Ga0495587_0008436 3300046536 Bacteria 6623
338 Ga0495587_0129269 3300046536 Bacteria 1444
339 Ga0495597_0025930 3300046542 Bacteria 2695
340 Ga0495645_0016780 3300046543 Bacteria 5239
341 Ga0495622_0048778 3300046557 Bacteria 1966
342 Ga0495622_0081259 3300046557 Bacteria 1491
343 Ga0495667_0011636 3300046559 Bacteria 5957
344 Ga0495668_0134936 3300046616 Bacteria 1351
345 Ga0495668_0366170 3300046616 Bacteria 791
346 Ga0495634_0080297 3300046642 Bacteria 2135
347 Ga0495611_0181533 3300046648 Bacteria 983
348 Ga0495625_0038899 3300046660 Bacteria 3477
349 Ga0495635_0204809 3300046663 Bacteria 1337
350 Ga0495588_0015817 3300046674 Bacteria 3638
351 Ga0495657_0008544 3300046675 Bacteria 7822
352 Ga0495657_0028573 3300046675 Bacteria 3920
353 Ga0495599_0016179 3300046678 Bacteria 4629
354 Ga0495623_0020193 3300046679 Bacteria 4305
355 Ga0495623_0220248 3300046679 Bacteria 1082
356 Ga0495646_0027979 3300046680 Bacteria 3533
357 Ga0495646_0101626 3300046680 Bacteria 1648
358 Ga0495613_0023721 3300046689 Bacteria 4572
359 Ga0495613_0058263 3300046689 Bacteria 2835
360 Ga0495624_0014534 3300046690 Bacteria 5339
361 Ga0495670_0048007 3300046691 Bacteria 2135
362 Ga0495649_0056877 3300046694 Bacteria 2110
363 Ga0495589_0236348 3300046794 Bacteria 856
364 Ga0495600_0001422 3300046809 Bacteria 13229
365 Ga0495600_0040341 3300046809 Bacteria 3040
366 Ga0495660_0160016 3300046810 Bacteria 1105
367 Ga0495581_0011351 3300047315 Bacteria 5155
368 Ga0495581_0103423 3300047315 Bacteria 1655
369 Ga0495604_0006103 3300047317 Bacteria 9562
370 Ga0495604_0006283 3300047317 Bacteria 9428
371 Ga0495674_0032580 3300047319 Bacteria 4727
372 Ga0495676_0017179 3300047321 Bacteria 6403
373 Ga0495676_0396742 3300047321 Bacteria 916
374 Ga0495680_0010380 3300047322 Bacteria 8312
375 Ga0495683_0076522 3300047323 Bacteria 1637
376 Ga0495683_0103183 3300047323 Bacteria 1369
377 Ga0495687_009999 3300047443 Bacteria 5243
378 Ga0495687_020238 3300047443 Bacteria 3246
379 Ga0495675_0072871 3300047444 Bacteria 2166
380 Ga0495684_0014418 3300047471 Bacteria 6081
381 Ga0495686_0028205 3300047472 Bacteria 3657
382 Ga0495686_0038212 3300047472 Bacteria 3071
383 Ga0495686_0060394 3300047472 Bacteria 2356
384 Ga0495686_0096140 3300047472 Bacteria 1793
385 Ga0495686_0269968 3300047472 Bacteria 949
386 Ga0495686_0345848 3300047472 Bacteria 809
387 Ga0495602_0016855 3300048088 Bacteria 7334
388 Ga0495602_0632284 3300048088 Bacteria 733
389 Ga0495626_0074453 3300048091 Bacteria 1519
390 Ga0495626_0158636 3300048091 Bacteria 950
391 Ga0496100_0092496 3300048903 Bacteria 2067
392 Ga0496101_0148957 3300048904 Bacteria 1789
393 Ga0496102_0489565 3300048905 Bacteria 1151
394 Ga0496103_0002964 3300048906 Bacteria 10507
395 Ga0496103_0138332 3300048906 Bacteria 1557
396 Ga0496104_0011823 3300048907 Bacteria 7832
397 Ga0496104_0186778 3300048907 Bacteria 1983
398 Ga0496104_0328877 3300048907 Bacteria 1441
399 Ga0496105_0019349 3300048908 Bacteria 5491
400 Ga0496105_0090512 3300048908 Bacteria 2527
401 Ga0496105_0341882 3300048908 Bacteria 1196
402 Ga0496106_0099941 3300048909 Bacteria 2249
403 Ga0496106_0866678 3300048909 Bacteria 714
404 Ga0496108_0318125 3300048911 Bacteria 1357
405 Ga0496110_0186371 3300048913 Bacteria 1884
406 Ga0496111_0025336 3300048914 Bacteria 4186
407 Ga0496112_0139058 3300048915 Bacteria 2398
408 Ga0496112_0287165 3300048915 Bacteria 1591
409 Ga0496113_0261166 3300048916 Bacteria 1383
410 Ga0496113_0324375 3300048916 Bacteria 1234
411 Ga0496113_0562603 3300048916 Bacteria 914
412 Ga0496115_0025835 3300048918 Bacteria 4577
413 Ga0496115_0242677 3300048918 Bacteria 1485
414 Ga0496115_0386964 3300048918 Bacteria 1136
415 Ga0496116_0005246 3300048919 Bacteria 12113
416 Ga0496117_0027983 3300048920 Bacteria 4372
417 Ga0496118_0030470 3300048921 Bacteria 4501
418 Ga0496118_0038317 3300048921 Bacteria 3844
419 Ga0496118_0046352 3300048921 Bacteria 3383
420 Ga0496119_0012146 3300048922 Bacteria 7030
421 Ga0496119_0056994 3300048922 Bacteria 2364
422 Ga0496119_0094486 3300048922 Bacteria 1691
423 Ga0496119_0142289 3300048922 Bacteria 1294
424 Ga0496120_0024913 3300048923 Bacteria 3723
425 Ga0496120_0075570 3300048923 Bacteria 1838
426 Ga0496120_0129555 3300048923 Bacteria 1294
427 Ga0496121_0002503 3300048924 Bacteria 27924
428 Ga0496121_0009424 3300048924 Bacteria 11225
429 Ga0496121_0044951 3300048924 Bacteria 3802
430 Ga0496121_0082040 3300048924 Bacteria 2550
431 Ga0496121_0364213 3300048924 Bacteria 959
432 Ga0496122_0033320 3300048925 Bacteria 4240
433 Ga0496122_0071910 3300048925 Bacteria 2462
434 Ga0496122_0177122 3300048925 Bacteria 1277
435 Ga0496123_0023676 3300048926 Bacteria 4693
436 Ga0496123_0067667 3300048926 Bacteria 2254
437 Ga0496123_0133297 3300048926 Bacteria 1372
438 Ga0496124_0058566 3300048927 Bacteria 3239
439 Ga0496124_0146701 3300048927 Bacteria 1856
440 Ga0496124_0201280 3300048927 Bacteria 1514
441 Ga0496124_0220903 3300048927 Bacteria 1425
442 Ga0496125_0000398 3300048928 Bacteria 81112
443 Ga0496125_0004399 3300048928 Bacteria 16305
444 Ga0496125_0009727 3300048928 Bacteria 9817
445 Ga0496125_0121204 3300048928 Bacteria 1865
446 Ga0496125_0142854 3300048928 Bacteria 1661
447 Ga0496126_0003241 3300048929 Bacteria 20805
448 Ga0496126_0007757 3300048929 Bacteria 11698
449 Ga0496126_0020992 3300048929 Bacteria 6391
450 Ga0496126_0039870 3300048929 Bacteria 4355
451 Ga0496126_0041384 3300048929 Bacteria 4264
452 Ga0496126_0135121 3300048929 Bacteria 2128
453 Ga0496126_0163053 3300048929 Bacteria 1904
454 Ga0496126_0282974 3300048929 Bacteria 1373
455 Ga0496126_0312080 3300048929 Bacteria 1294
456 Ga0496126_0462381 3300048929 Bacteria 1019
457 Ga0496126_0651959 3300048929 Bacteria 823
458 Ga0501031_0045037 3300049568 Bacteria 2879
459 Ga0501031_0132018 3300049568 Bacteria 1631
460 Ga0501032_0295519 3300049569 Bacteria 1047
461 Ga0501033_0025424 3300049570 Bacteria 4461
462 Ga0501033_0029630 3300049570 Bacteria 4113
463 Ga0501033_0054593 3300049570 Bacteria 2955
464 Ga0501033_0055615 3300049570 Bacteria 2926
465 Ga0501034_0220436 3300049571 Bacteria 1849
466 Ga0501034_0231809 3300049571 Bacteria 1795
467 Ga0501034_0352834 3300049571 Bacteria 1399
468 Ga0501034_0477484 3300049571 Bacteria 1162
469 Ga0501036_0040405 3300049572 Bacteria 3945
470 Ga0501036_0063511 3300049572 Bacteria 3126
471 Ga0501037_0064363 3300049573 Bacteria 2672
472 Ga0501037_0072169 3300049573 Bacteria 2511
473 Ga0501037_0127352 3300049573 Bacteria 1827
474 Ga0501038_0004453 3300049574 Bacteria 13020
475 Ga0501038_0069403 3300049574 Bacteria 2994
476 Ga0501038_0256777 3300049574 Bacteria 1382
477 Ga0501038_0740997 3300049574 Bacteria 733
478 Ga0501039_0251179 3300049575 Bacteria 1390
479 Ga0501039_0364939 3300049575 Bacteria 1134
480 Ga0501043_0005382 3300049579 Bacteria 10337
481 Ga0501043_0044939 3300049579 Bacteria 3474
482 Ga0501043_0241646 3300049579 Bacteria 1392
483 Ga0501043_0266432 3300049579 Bacteria 1316
484 Ga0501046_0012839 3300049580 Bacteria 7124
485 Ga0501046_0036217 3300049580 Bacteria 3973
486 Ga0501047_0023211 3300049581 Bacteria 5956
487 Ga0501047_0165409 3300049581 Bacteria 2082
488 Ga0501047_0183872 3300049581 Bacteria 1956
489 Ga0501047_0253123 3300049581 Bacteria 1609
490 Ga0501047_0263994 3300049581 Bacteria 1569
491 Ga0501047_0315296 3300049581 Bacteria 1404
492 Ga0501048_0016045 3300049582 Bacteria 5524
493 Ga0501070_0127813 3300049586 Bacteria 2100
494 Ga0501070_0285000 3300049586 Bacteria 1347
495 Ga0501073_0449453 3300049589 Bacteria 891
496 Ga0501079_0456727 3300049741 Bacteria 1003
497 Ga0501080_0051614 3300049742 Bacteria 3827
498 Ga0501080_0079803 3300049742 Bacteria 3042
499 Ga0501035_0050067 3300049822 Bacteria 3744
500 Ga0501035_0061642 3300049822 Bacteria 3338
501 Ga0501035_0077755 3300049822 Bacteria 2932
502 Ga0501035_0122926 3300049822 Bacteria 2267
503 Ga0501035_0183198 3300049822 Bacteria 1803
504 Ga0501044_0002617 3300049823 Bacteria 20451
505 Ga0501044_0007879 3300049823 Bacteria 11709
506 Ga0501044_0009525 3300049823 Bacteria 10574
507 Ga0501044_0034204 3300049823 Bacteria 5332
508 Ga0501044_0052414 3300049823 Bacteria 4204
509 Ga0501044_0075196 3300049823 Bacteria 3429
510 Ga0501044_0118516 3300049823 Bacteria 2650
511 Ga0501044_0238966 3300049823 Bacteria 1761
512 Ga0501044_0272752 3300049823 Bacteria 1627
513 Ga0501044_0404330 3300049823 Bacteria 1277
514 nmdc:mga03683_74374_c1 3300050489 Bacteria 1457
515 nmdc:mga03n38_111393_c1 3300050490 Bacteria 1333
516 nmdc:mga03n38_204226_c1 3300050490 Bacteria 1024
517 nmdc:mga03n38_3019_c1 3300050490 Bacteria 5331
518 nmdc:mga00v17_29286_c1 3300050491 Bacteria 3231
519 nmdc:mga00v17_424279_c1 3300050491 Bacteria 864
520 nmdc:mga00v17_82252_c1 3300050491 Bacteria 2012
521 nmdc:mga0yw44_100757_c1 3300050492 Bacteria 1840
522 nmdc:mga0yw44_128862_c1 3300050492 Bacteria 1636
523 nmdc:mga0yw44_218233_c2 3300050492 Bacteria 951
524 nmdc:mga0yw44_292730_c1 3300050492 Bacteria 1090
525 nmdc:mga0yw44_386378_c1 3300050492 Bacteria 945
526 nmdc:mga0yw44_45427_c1 3300050492 Bacteria 2633
527 nmdc:mga0yw44_70594_c1 3300050492 Bacteria 2166
528 nmdc:mga0k408_219068_c1 3300050493 Bacteria 1136
529 nmdc:mga0k408_6697_c1 3300050493 Bacteria 6141
530 nmdc:mga06z11_160979_c1 3300050494 Bacteria 1283
531 nmdc:mga06z11_22732_c1 3300050494 Bacteria 2934
532 nmdc:mga06z11_291154_c1 3300050494 Bacteria 969
533 nmdc:mga06z11_53578_c1 3300050494 Bacteria 2075
534 nmdc:mga06z11_60407_c1 3300050494 Bacteria 1973
535 nmdc:mga04h51_161773_c1 3300050495 Bacteria 862
536 nmdc:mga07m45_124902_c1 3300050496 Bacteria 1488
537 nmdc:mga07m45_19585_c1 3300050496 Bacteria 3668
538 nmdc:mga07m45_218943_c1 3300050496 Bacteria 1107
539 nmdc:mga07m45_27605_c1 3300050496 Bacteria 3128
540 nmdc:mga07m45_34927_c1 3300050496 Bacteria 2795
541 nmdc:mga05p37_174021_c1 3300050507 Bacteria 2624
542 nmdc:mga05p37_240581_c1 3300050507 Bacteria 2177
543 nmdc:mga09592_30553_c1 3300050508 Bacteria 4483
544 nmdc:mga09592_4123_c1 3300050508 Bacteria 11741
545 nmdc:mga0qj67_257_c1 3300050509 Bacteria 36250
546 nmdc:mga06r32_9197_c1 3300050510 Bacteria 8907
547 nmdc:mga0n895_150416_c1 3300050512 Bacteria 2358
548 nmdc:mga0n895_195018_c1 3300050512 Bacteria 2056
549 nmdc:mga0a205_86915_c1 3300050515 Bacteria 3020
550 nmdc:mga0sz30_73294_c1 3300050516 Bacteria 1476
551 Ga0495601_0033060 3300053077 Bacteria 3222
552 Ga0495601_0506956 3300053077 Bacteria 778
553 Ga0495612_0217938 3300053078 Bacteria 844
554 Ga0500635_0027829 3300053080 Bacteria 1800
555 Ga0500635_0106737 3300053080 Bacteria 1036
556 Ga0495655_0086886 3300053083 Bacteria 904
557 Ga0495619_0114415 3300053085 Bacteria 1846
558 Ga0500578_0388521 3300053086 Bacteria 807
559 Ga0500643_000163 3300053087 Bacteria 66676
560 Ga0500644_0200910 3300053088 Bacteria 824
561 Ga0500646_0016674 3300053090 Bacteria 1920
562 Ga0500646_0019969 3300053090 Bacteria 1776
563 Ga0500647_0041005 3300053091 Bacteria 2221
564 Ga0500651_0013593 3300053093 Bacteria 4963
565 Ga0500651_0372351 3300053093 Bacteria 807
566 Ga0500566_0000224 3300053094 Bacteria 30350
567 Ga0500566_0001842 3300053094 Bacteria 12474
568 Ga0500566_0134777 3300053094 Bacteria 1317
569 Ga0500640_022067 3300053095 Bacteria 2749
570 Ga0500555_000884 3300053103 Bacteria 10656
571 Ga0500556_0000012 3300053104 Bacteria 250391
572 Ga0500556_0103283 3300053104 Bacteria 1099
573 Ga0500556_0114936 3300053104 Bacteria 1046
574 Ga0500557_000051 3300053105 Bacteria 51214
575 Ga0500557_136894 3300053105 Bacteria 810
576 Ga0500569_025542 3300053109 Bacteria 1609
577 Ga0500572_147906 3300053111 Bacteria 766
578 Ga0500592_010930 3300053116 Bacteria 1449
579 Ga0500595_001454 3300053119 Bacteria 12621
580 Ga0500595_002517 3300053119 Bacteria 9047
581 Ga0500595_025410 3300053119 Bacteria 2053
582 Ga0500607_094992 3300053121 Bacteria 1492
583 Ga0500607_158935 3300053121 Bacteria 1035
584 Ga0500608_046176 3300053122 Bacteria 2092
585 Ga0500608_046742 3300053122 Bacteria 2079
586 Ga0500618_017773 3300053125 Bacteria 1766
587 Ga0500621_186776 3300053126 Bacteria 746
588 Ga0500642_0000055 3300053130 Bacteria 68809
589 Ga0500642_0000117 3300053130 Bacteria 36211
590 Ga0500652_000373 3300053131 Bacteria 16097
591 Ga0500655_026635 3300053133 Bacteria 1101
592 Ga0500658_0070331 3300053134 Bacteria 1475
593 Ga0500559_0000268 3300053136 Bacteria 40472
594 Ga0500559_0011309 3300053136 Bacteria 3814
595 Ga0500559_0028889 3300053136 Bacteria 2371
596 Ga0500564_106525 3300053138 Bacteria 1234
597 Ga0500568_0004979 3300053139 Bacteria 6968
598 Ga0500568_0019783 3300053139 Bacteria 2919
599 Ga0500568_0136082 3300053139 Bacteria 912
600 Ga0500577_0073150 3300053142 Bacteria 1349
601 Ga0500577_0075168 3300053142 Bacteria 1334
602 Ga0500586_006324 3300053145 Bacteria 3069
603 Ga0500588_0050955 3300053146 Bacteria 1290
604 Ga0500589_106367 3300053147 Bacteria 1211
605 Ga0500590_025050 3300053148 Bacteria 3097
606 Ga0500603_000204 3300053150 Bacteria 15582
607 Ga0500604_0017960 3300053151 Bacteria 1965
608 Ga0500604_0028984 3300053151 Bacteria 1610
609 Ga0500616_0000035 3300053153 Bacteria 394242
610 Ga0500616_0000038 3300053153 Bacteria 386801
611 Ga0500619_127736 3300053154 Bacteria 866
612 Ga0500622_0016210 3300053156 Bacteria 3983
613 Ga0500622_0068137 3300053156 Bacteria 1803
614 Ga0500627_0054862 3300053158 Bacteria 1743
615 Ga0500633_0010105 3300053160 Bacteria 2510
616 Ga0500633_0039689 3300053160 Bacteria 1575
617 Ga0500634_0022109 3300053161 Bacteria 3449
618 Ga0500636_0001663 3300053177 Bacteria 12175
619 Ga0500636_0008037 3300053177 Bacteria 6104
620 Ga0500636_0135817 3300053177 Bacteria 1366
621 Ga0500637_0000531 3300053178 Bacteria 14845
622 Ga0500649_118707 3300053722 Bacteria 1012
623 Ga0500625_015823 3300053729 Bacteria 3504
624 Ga0500645_055614 3300053730 Bacteria 1149
625 Ga0500645_056543 3300053730 Bacteria 1138
626 Ga0500601_000760 3300053737 Bacteria 4166
627 Ga0501082_0413245 3300060353 Bacteria 1178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016630954 8016636016 185
2 3300049573 Ga0501037_0127352 Ga0501037_0127352_1177_1740 186
3 3300037466 Ga0395898_0008381 Ga0395898_0008381_5585_6193 187
4 3300038443 Ga0395901_0000688 Ga0395901_0000688_23545_24153 187
5 3300053104 Ga0500556_0000012 Ga0500556_0000012_196234_196932 193
6 3300053139 Ga0500568_0136082 Ga0500568_0136082_18_599 193
7 iso_pu_bacteria 8019638758 8019640131 193
8 3300048916 Ga0496113_0562603 Ga0496113_0562603_273_860 195
9 3300049574 Ga0501038_0740997 Ga0501038_0740997_31_705 196
10 3300049579 Ga0501043_0044939 Ga0501043_0044939_494_1168 196
11 3300049580 Ga0501046_0012839 Ga0501046_0012839_1375_2049 196
12 3300049589 Ga0501073_0449453 Ga0501073_0449453_33_707 196
13 3300049742 Ga0501080_0079803 Ga0501080_0079803_1262_1936 196
14 3300049822 Ga0501035_0122926 Ga0501035_0122926_868_1542 196
15 3300049823 Ga0501044_0002617 Ga0501044_0002617_15508_16182 196
16 3300003215 JGI25153J46596_10003534 JGI25153J46596_100035347 199
17 3300006844 Ga0075428_100839863 Ga0075428_1008398632 199
18 3300006846 Ga0075430_100000343 Ga0075430_10000034326 199
19 3300006847 Ga0075431_100719081 Ga0075431_1007190812 199
20 3300006880 Ga0075429_100000014 Ga0075429_10000001465 199
21 3300009147 Ga0114129_10055625 Ga0114129_100556253 199
22 3300025297 Ga0209758_1000224 Ga0209758_10002247 199
23 3300050507 nmdc:mga05p37_174021_c1 nmdc:mga05p37_174021_c1_1247_1879 199
24 3300050508 nmdc:mga09592_4123_c1 nmdc:mga09592_4123_c1_273_905 199
25 3300050509 nmdc:mga0qj67_257_c1 nmdc:mga0qj67_257_c1_2014_2646 199
26 3300050510 nmdc:mga06r32_9197_c1 nmdc:mga06r32_9197_c1_4886_5518 199
27 3300026067 Ga0207678_10048854 Ga0207678_100488543 202
28 3300046460 Ga0495638_0083181 Ga0495638_0083181_604_1302 202
29 3300046506 Ga0495583_0091173 Ga0495583_0091173_478_1176 202
30 3300046518 Ga0495631_0181266 Ga0495631_0181266_117_815 202
31 3300046524 Ga0495648_0128999 Ga0495648_0128999_327_1025 202
32 3300046616 Ga0495668_0134936 Ga0495668_0134936_127_825 202
33 3300046691 Ga0495670_0048007 Ga0495670_0048007_846_1544 202
34 3300047472 Ga0495686_0028205 Ga0495686_0028205_1170_1868 202
35 3300048923 Ga0496120_0024913 Ga0496120_0024913_1377_2075 202
36 3300048924 Ga0496121_0082040 Ga0496121_0082040_1473_2171 202
37 3300048925 Ga0496122_0177122 Ga0496122_0177122_30_728 202
38 3300048926 Ga0496123_0067667 Ga0496123_0067667_1138_1836 202
39 3300048928 Ga0496125_0004399 Ga0496125_0004399_11270_11968 202
40 3300048929 Ga0496126_0312080 Ga0496126_0312080_356_1054 202
41 3300053090 Ga0500646_0016674 Ga0500646_0016674_965_1663 202
42 3300053093 Ga0500651_0013593 Ga0500651_0013593_507_1205 202
43 3300053105 Ga0500557_136894 Ga0500557_136894_82_780 202
44 3300053116 Ga0500592_010930 Ga0500592_010930_667_1365 202
45 3300053130 Ga0500642_0000055 Ga0500642_0000055_41159_41857 202
46 3300053131 Ga0500652_000373 Ga0500652_000373_3236_3934 202
47 3300053142 Ga0500577_0073150 Ga0500577_0073150_123_821 202
48 3300053153 Ga0500616_0000035 Ga0500616_0000035_187330_188028 202
49 3300053156 Ga0500622_0068137 Ga0500622_0068137_96_794 202
50 3300053160 Ga0500633_0039689 Ga0500633_0039689_519_1217 202
51 3300053161 Ga0500634_0022109 Ga0500634_0022109_1731_2429 202
52 3300053730 Ga0500645_055614 Ga0500645_055614_57_755 202
53 3300006844 Ga0075428_100605634 Ga0075428_1006056342 208
54 3300006880 Ga0075429_100022049 Ga0075429_1000220494 208
55 3300037312 Ga0395899_0077138 Ga0395899_0077138_1423_2094 208
56 3300037418 Ga0395900_0473814 Ga0395900_0473814_413_1084 208
57 3300050507 nmdc:mga05p37_240581_c1 nmdc:mga05p37_240581_c1_536_1207 208
58 3300050508 nmdc:mga09592_30553_c1 nmdc:mga09592_30553_c1_974_1645 208
59 3300050512 nmdc:mga0n895_195018_c1 nmdc:mga0n895_195018_c1_656_1327 208
60 3300050515 nmdc:mga0a205_86915_c1 nmdc:mga0a205_86915_c1_1759_2430 208
61 iso_pu_bacteria 2849076700 2849082742 208
62 3300009147 Ga0114129_10101957 Ga0114129_101019572 209
63 3300025931 Ga0207644_10420317 Ga0207644_104203171 209
64 3300049823 Ga0501044_0118516 Ga0501044_0118516_27_674 209
65 3300053088 Ga0500644_0200910 Ga0500644_0200910_17_646 209
66 3300006844 Ga0075428_100641465 Ga0075428_1006414652 211
67 3300046648 Ga0495611_0181533 Ga0495611_0181533_20_661 211
68 3300048929 Ga0496126_0003241 Ga0496126_0003241_43_678 211
69 3300048929 Ga0496126_0651959 Ga0496126_0651959_13_654 211
70 3300010159 Ga0099796_10191672 Ga0099796_101916721 212
71 3300025905 Ga0207685_10227400 Ga0207685_102274001 212
72 3300045049 Ga0466959_0593337 Ga0466959_0593337_17_661 212
73 3300048909 Ga0496106_0866678 Ga0496106_0866678_15_659 212
74 3300046616 Ga0495668_0366170 Ga0495668_0366170_40_723 214
75 3300009551 Ga0105238_10197412 Ga0105238_101974122 218
76 3300025924 Ga0207694_10079439 Ga0207694_100794392 218
77 3300026142 Ga0207698_10782059 Ga0207698_107820591 218
78 3300049570 Ga0501033_0055615 Ga0501033_0055615_863_1537 218
79 iso_pu_bacteria 2932794094 2932794622 219
80 iso_pu_bacteria 2932801729 2932806903 219
81 iso_pu_bacteria 2513237104 2513718778 220
82 iso_pu_bacteria 2508501128 2509150104 221
83 iso_pu_bacteria 2513237094 2513639618 221
84 iso_pu_bacteria 2513237141 2513890371 221
85 iso_pu_bacteria 2643221651 2644290743 221
86 iso_pu_bacteria 2847930680 2847931402 221
87 iso_pu_bacteria 2874612657 2874619043 221
88 iso_pu_bacteria 2879083081 2879087562 221
89 iso_pu_bacteria 2906643746 2906652346 221
90 iso_pu_bacteria 3005594810 3005602228 221
91 iso_pu_bacteria 8056967851 8056970983 221
92 3300006038 Ga0075365_10058216 Ga0075365_100582163 222
93 3300006048 Ga0075363_100197091 Ga0075363_1001970912 222
94 3300006048 Ga0075363_100244103 Ga0075363_1002441032 222
95 3300006051 Ga0075364_10031981 Ga0075364_100319812 222
96 3300006177 Ga0075362_10049798 Ga0075362_100497982 222
97 3300006178 Ga0075367_10074167 Ga0075367_100741673 222
98 3300006353 Ga0075370_10120838 Ga0075370_101208381 222
99 3300037068 Ga0373925_0463033 Ga0373925_0463033_330_998 222
100 3300050490 nmdc:mga03n38_111393_c1 nmdc:mga03n38_111393_c1_151_819 222
101 3300050490 nmdc:mga03n38_204226_c1 nmdc:mga03n38_204226_c1_252_920 222
102 3300050491 nmdc:mga00v17_29286_c1 nmdc:mga00v17_29286_c1_439_1107 222
103 3300050494 nmdc:mga06z11_60407_c1 nmdc:mga06z11_60407_c1_1087_1755 222
104 3300050496 nmdc:mga07m45_218943_c1 nmdc:mga07m45_218943_c1_14_682 222
105 iso_pu_bacteria 2513237095 2513647895 222
106 iso_pu_bacteria 2528768022 2528851660 222
107 iso_pu_bacteria 2791355196 2793063044 222
108 iso_pu_bacteria 2816332527 2818237348 222
109 iso_pu_bacteria 2824661429 2824664799 222
110 iso_pu_bacteria 2844315083 2844321890 222
111 iso_pu_bacteria 2874628541 2874629154 222
112 iso_pu_bacteria 2876761206 2876764008 222
113 iso_pu_bacteria 2879099564 2879107295 222
114 iso_pu_bacteria 2885366525 2885371333 222
115 iso_pu_bacteria 2888378607 2888379895 222
116 iso_pu_bacteria 2888388044 2888390969 222
117 iso_pu_bacteria 2903727486 2903727560 222
118 iso_pu_bacteria 2906602504 2906602950 222
119 iso_pu_bacteria 2922368715 2922378277 222
120 iso_pu_bacteria 2929615660 2929623826 222
121 iso_pu_bacteria 2929624759 2929629057 222
122 iso_pu_bacteria 2932784394 2932786416 222
123 iso_pu_bacteria 2932809354 2932812509 222
124 iso_pu_bacteria 2932818245 2932822871 222
125 iso_pu_bacteria 2932828146 2932829654 222
126 iso_pu_bacteria 2933577622 2933585653 222
127 iso_pu_bacteria 2935616580 2935618172 222
128 iso_pu_bacteria 2935638405 2935641430 222
129 iso_pu_bacteria 2935665750 2935669512 222
130 iso_pu_bacteria 2935675223 2935677890 222
131 iso_pu_bacteria 2935684952 2935689661 222
132 iso_pu_bacteria 2935694250 2935698198 222
133 iso_pu_bacteria 2935703347 2935707337 222
134 iso_pu_bacteria 2935713505 2935717181 222
135 iso_pu_bacteria 2935722832 2935729985 222
136 iso_pu_bacteria 2935732158 2935738596 222
137 iso_pu_bacteria 2935741537 2935749156 222
138 iso_pu_bacteria 2935750917 2935757015 222
139 iso_pu_bacteria 2935760218 2935764374 222
140 iso_pu_bacteria 2935801545 2935804284 222
141 iso_pu_bacteria 2935810662 2935815368 222
142 iso_pu_bacteria 2935827899 2935831161 222
143 iso_pu_bacteria 2935837841 2935841770 222
144 iso_pu_bacteria 2935855204 2935856329 222
145 iso_pu_bacteria 2935864058 2935866339 222
146 iso_pu_bacteria 2935873716 2935874645 222
147 iso_pu_bacteria 2935883170 2935890315 222
148 iso_pu_bacteria 2935959822 2935962346 222
149 iso_pu_bacteria 2935992306 2935994106 222
150 iso_pu_bacteria 2936002035 2936004883 222
151 iso_pu_bacteria 2936037263 2936045023 222
152 iso_pu_bacteria 2940556831 2940562929 222
153 iso_pu_bacteria 2941538514 2941543843 222
154 iso_pu_bacteria 3005718088 3005725015 222
155 iso_pu_bacteria 8016511872 8016518549 222
156 iso_pu_bacteria 8017057580 8017058116 222
157 iso_pu_bacteria 8019576017 8019577613 222
158 iso_pu_bacteria 8019586578 8019595710 222
159 iso_pu_bacteria 8019597564 8019606053 222
160 iso_pu_bacteria 8019608314 8019612477 222
161 iso_pu_bacteria 8055742211 8055751075 222
162 3300009551 Ga0105238_10378160 Ga0105238_103781602 223
163 3300025297 Ga0209758_1007793 Ga0209758_10077934 223
164 3300031731 Ga0307405_10450849 Ga0307405_104508492 223
165 3300046454 Ga0495592_0349585 Ga0495592_0349585_20_691 223
166 3300046459 Ga0495629_0028818 Ga0495629_0028818_3132_3809 223
167 3300046473 Ga0495582_0093657 Ga0495582_0093657_378_1055 223
168 3300046499 Ga0495594_0173227 Ga0495594_0173227_426_1103 223
169 3300046529 Ga0495652_0559335 Ga0495652_0559335_49_726 223
170 3300046536 Ga0495587_0129269 Ga0495587_0129269_755_1432 223
171 3300046642 Ga0495634_0080297 Ga0495634_0080297_561_1238 223
172 3300046675 Ga0495657_0028573 Ga0495657_0028573_41_718 223
173 3300046680 Ga0495646_0101626 Ga0495646_0101626_725_1402 223
174 3300046689 Ga0495613_0023721 Ga0495613_0023721_783_1460 223
175 3300046809 Ga0495600_0001422 Ga0495600_0001422_12270_12947 223
176 3300047315 Ga0495581_0011351 Ga0495581_0011351_3539_4216 223
177 3300047317 Ga0495604_0006283 Ga0495604_0006283_4389_5066 223
178 3300047321 Ga0495676_0017179 Ga0495676_0017179_1989_2666 223
179 3300048904 Ga0496101_0148957 Ga0496101_0148957_559_1236 223
180 3300048907 Ga0496104_0011823 Ga0496104_0011823_5482_6159 223
181 3300048908 Ga0496105_0019349 Ga0496105_0019349_133_810 223
182 3300048918 Ga0496115_0025835 Ga0496115_0025835_815_1492 223
183 3300048922 Ga0496119_0012146 Ga0496119_0012146_5097_5774 223
184 3300048923 Ga0496120_0075570 Ga0496120_0075570_132_809 223
185 3300048927 Ga0496124_0058566 Ga0496124_0058566_443_1120 223
186 3300048929 Ga0496126_0041384 Ga0496126_0041384_3093_3770 223
187 3300053077 Ga0495601_0506956 Ga0495601_0506956_25_702 223
188 3300053086 Ga0500578_0388521 Ga0500578_0388521_74_751 223
189 3300053136 Ga0500559_0028889 Ga0500559_0028889_1587_2264 223
190 iso_pu_bacteria 2507262055 2507504911 223
191 iso_pu_bacteria 2511231028 2511398329 223
192 iso_pu_bacteria 2513237139 2513873842 223
193 iso_pu_bacteria 2524023205 2524440024 223
194 iso_pu_bacteria 2744054633 2745077864 223
195 iso_pu_bacteria 2802429603 2805915925 223
196 iso_pu_bacteria 2881665667 2881665762 223
197 iso_pu_bacteria 2935608549 2935614891 223
198 iso_pu_bacteria 2935769743 2935772710 223
199 iso_pu_bacteria 2935777560 2935778154 223
200 iso_pu_bacteria 2935785616 2935787381 223
201 iso_pu_bacteria 2935793552 2935795831 223
202 iso_pu_bacteria 2935819856 2935826069 223
203 iso_pu_bacteria 2935847175 2935851688 223
204 iso_pu_bacteria 2935908558 2935910290 223
205 iso_pu_bacteria 2935916978 2935918424 223
206 iso_pu_bacteria 2935926038 2935927799 223
207 iso_pu_bacteria 2935934488 2935936329 223
208 iso_pu_bacteria 2935942939 2935944118 223
209 iso_pu_bacteria 2935951376 2935952555 223
210 iso_pu_bacteria 2935967501 2935969395 223
211 iso_pu_bacteria 8006926726 8006931133 223
212 iso_pu_bacteria 8016522445 8016526525 223
213 iso_pu_bacteria 8016530956 8016531605 223
214 iso_pu_bacteria 8016539877 8016544810 223
215 iso_pu_bacteria 8016548790 8016557269 223
216 iso_pu_bacteria 8016557553 8016565621 223
217 iso_pu_bacteria 8016566248 8016569868 223
218 iso_pu_bacteria 8016575299 8016582465 223
219 iso_pu_bacteria 8016595262 8016603231 223
220 iso_pu_bacteria 8016603502 8016606159 223
221 iso_pu_bacteria 8016613128 8016618035 223
222 iso_pu_bacteria 8016622563 8016623536 223
223 iso_pu_bacteria 8019530166 8019531434 223
224 iso_pu_bacteria 8019538911 8019540092 223
225 iso_pu_bacteria 8019547302 8019550557 223
226 iso_pu_bacteria 8019648815 8019652806 223
227 iso_pu_bacteria 8019687851 8019696627 223
228 3300038443 Ga0395901_0331349 Ga0395901_0331349_233_925 224
229 3300046516 Ga0495628_0247814 Ga0495628_0247814_72_752 224
230 3300046690 Ga0495624_0014534 Ga0495624_0014534_4204_4884 224
231 iso_pu_bacteria 2508501009 2508546261 224
232 iso_pu_bacteria 2508501042 2508695193 224
233 iso_pu_bacteria 2513237102 2513699661 224
234 iso_pu_bacteria 2513237161 2514012813 224
235 iso_pu_bacteria 2515154112 2515625794 224
236 iso_pu_bacteria 2617270735 2617351775 224
237 iso_pu_bacteria 2824600985 2824602643 224
238 iso_pu_bacteria 2824609381 2824617090 224
239 iso_pu_bacteria 2824617872 2824621040 224
240 iso_pu_bacteria 2824626560 2824630047 224
241 iso_pu_bacteria 2824635225 2824637937 224
242 iso_pu_bacteria 2824644064 2824652252 224
243 iso_pu_bacteria 2824653114 2824654392 224
244 iso_pu_bacteria 2824671348 2824679551 224
245 iso_pu_bacteria 2824679649 2824682106 224
246 iso_pu_bacteria 2824687955 2824692977 224
247 iso_pu_bacteria 2824696289 2824704491 224
248 iso_pu_bacteria 2824714736 2824719904 224
249 iso_pu_bacteria 2824723954 2824726326 224
250 iso_pu_bacteria 2824773399 2824774870 224
251 iso_pu_bacteria 2838122688 2838124187 224
252 iso_pu_bacteria 2841941048 2841944535 224
253 iso_pu_bacteria 2841949485 2841951673 224
254 iso_pu_bacteria 2841957949 2841964817 224
255 iso_pu_bacteria 2841966195 2841969311 224
256 iso_pu_bacteria 2841974524 2841980290 224
257 iso_pu_bacteria 2841983080 2841985542 224
258 iso_pu_bacteria 2842038055 2842043810 224
259 iso_pu_bacteria 2842045827 2842052200 224
260 iso_pu_bacteria 2847939898 2847941826 224
261 iso_pu_bacteria 2857509624 2857511637 224
262 iso_pu_bacteria 2874590934 2874596907 224
263 iso_pu_bacteria 2874620515 2874624484 224
264 iso_pu_bacteria 2874645413 2874648712 224
265 iso_pu_bacteria 2876771140 2876777371 224
266 iso_pu_bacteria 2876818435 2876825453 224
267 iso_pu_bacteria 2879074833 2879077702 224
268 iso_pu_bacteria 2879127579 2879131416 224
269 iso_pu_bacteria 2879142872 2879144376 224
270 iso_pu_bacteria 2881364244 2881370935 224
271 iso_pu_bacteria 2888419890 2888420703 224
272 iso_pu_bacteria 2904666416 2904672177 224
273 iso_pu_bacteria 2922393267 2922396642 224
274 iso_pu_bacteria 2935648319 2935652922 224
275 iso_pu_bacteria 2935656913 2935661505 224
276 iso_pu_bacteria 2935975950 2935977837 224
277 iso_pu_bacteria 2935984226 2935984854 224
278 iso_pu_bacteria 2936011229 2936015766 224
279 iso_pu_bacteria 2936019824 2936024400 224
280 iso_pu_bacteria 2936028420 2936031713 224
281 iso_pu_bacteria 2936046547 2936051535 224
282 iso_pu_bacteria 2936055302 2936056025 224
283 iso_pu_bacteria 3005506211 3005509476 224
284 iso_pu_bacteria 8019619141 8019622632 224
285 iso_pu_bacteria 8019629233 8019630476 224
286 iso_pu_bacteria 8019659431 8019667308 224
287 iso_pu_bacteria 8019668869 8019677077 224
288 iso_pu_bacteria 8019678201 8019678904 224
289 3300003762 Ga0055542_1008654 Ga0055542_10086542 225
290 3300005435 Ga0070714_100147138 Ga0070714_1001471382 225
291 3300005548 Ga0070665_100366299 Ga0070665_1003662992 225
292 3300005616 Ga0068852_100031105 Ga0068852_1000311054 225
293 3300009093 Ga0105240_10077943 Ga0105240_100779433 225
294 3300009098 Ga0105245_10070218 Ga0105245_100702182 225
295 3300009174 Ga0105241_10046592 Ga0105241_100465922 225
296 3300009545 Ga0105237_10036560 Ga0105237_100365606 225
297 3300009545 Ga0105237_10337386 Ga0105237_103373862 225
298 3300010375 Ga0105239_10079841 Ga0105239_100798412 225
299 3300014968 Ga0157379_10437434 Ga0157379_104374342 225
300 3300025254 Ga0209148_1000334 Ga0209148_100033418 225
301 3300025272 Ga0209455_1000787 Ga0209455_10007878 225
302 3300025911 Ga0207654_10044831 Ga0207654_100448312 225
303 3300025913 Ga0207695_10000065 Ga0207695_10000065239 225
304 3300025914 Ga0207671_10010281 Ga0207671_100102818 225
305 3300025923 Ga0207681_10218006 Ga0207681_102180061 225
306 3300025927 Ga0207687_10083446 Ga0207687_100834462 225
307 3300025929 Ga0207664_10930994 Ga0207664_109309941 225
308 3300026142 Ga0207698_10065694 Ga0207698_100656942 225
309 3300026142 Ga0207698_10462370 Ga0207698_104623702 225
310 3300028379 Ga0268266_10361233 Ga0268266_103612332 225
311 3300031548 Ga0307408_100020929 Ga0307408_1000209296 225
312 3300034818 Ga0373950_0008539 Ga0373950_0008539_134_841 225
313 3300037418 Ga0395900_0061239 Ga0395900_0061239_1516_2220 225
314 3300037466 Ga0395898_0212991 Ga0395898_0212991_14_718 225
315 3300038443 Ga0395901_0007034 Ga0395901_0007034_9151_9855 225
316 3300044656 Ga0466969_0035718 Ga0466969_0035718_546_1229 225
317 3300044684 Ga0466966_0000307 Ga0466966_0000307_20913_21596 225
318 3300044693 Ga0466961_0000019 Ga0466961_0000019_74670_75353 225
319 3300044694 Ga0466963_0048239 Ga0466963_0048239_1076_1759 225
320 3300045049 Ga0466959_0179332 Ga0466959_0179332_352_1035 225
321 3300045836 Ga0466958_0404400 Ga0466958_0404400_139_822 225
322 3300045976 Ga0466967_0041692 Ga0466967_0041692_3011_3694 225
323 3300046513 Ga0495616_0160150 Ga0495616_0160150_170_853 225
324 3300046524 Ga0495648_0193983 Ga0495648_0193983_209_892 225
325 3300046660 Ga0495625_0038899 Ga0495625_0038899_1693_2376 225
326 3300047472 Ga0495686_0269968 Ga0495686_0269968_151_828 225
327 3300048923 Ga0496120_0129555 Ga0496120_0129555_537_1220 225
328 3300048924 Ga0496121_0044951 Ga0496121_0044951_1928_2605 225
329 3300048929 Ga0496126_0135121 Ga0496126_0135121_29_712 225
330 3300049568 Ga0501031_0045037 Ga0501031_0045037_490_1194 225
331 3300049570 Ga0501033_0054593 Ga0501033_0054593_46_753 225
332 3300049571 Ga0501034_0220436 Ga0501034_0220436_949_1653 225
333 3300049571 Ga0501034_0477484 Ga0501034_0477484_184_891 225
334 3300049572 Ga0501036_0040405 Ga0501036_0040405_1985_2689 225
335 3300049574 Ga0501038_0069403 Ga0501038_0069403_1519_2226 225
336 3300049579 Ga0501043_0266432 Ga0501043_0266432_523_1302 225
337 3300049581 Ga0501047_0023211 Ga0501047_0023211_3436_4143 225
338 3300049582 Ga0501048_0016045 Ga0501048_0016045_633_1337 225
339 3300049822 Ga0501035_0050067 Ga0501035_0050067_1203_1907 225
340 3300049822 Ga0501035_0183198 Ga0501035_0183198_484_1191 225
341 3300049823 Ga0501044_0052414 Ga0501044_0052414_3021_3728 225
342 3300049823 Ga0501044_0238966 Ga0501044_0238966_283_1062 225
343 3300049823 Ga0501044_0272752 Ga0501044_0272752_825_1532 225
344 3300053093 Ga0500651_0372351 Ga0500651_0372351_53_736 225
345 3300053119 Ga0500595_002517 Ga0500595_002517_497_1183 225
346 3300053153 Ga0500616_0000038 Ga0500616_0000038_125725_126432 225
347 iso_pu_bacteria 2602042107 2603857854 225
348 iso_pu_bacteria 2857524615 2857527229 225
349 iso_pu_bacteria 2893066018 2893067997 225
350 iso_pu_bacteria 2919073203 2919078344 225
351 3300003354 JGI25160J50197_1008958 JGI25160J50197_10089584 226
352 3300003354 JGI25160J50197_1014145 JGI25160J50197_10141453 226
353 3300004625 Ga0055543_1001201 Ga0055543_10012019 226
354 3300005262 Ga0065165_1003230 Ga0065165_10032302 226
355 3300005262 Ga0065165_1068283 Ga0065165_10682831 226
356 3300005327 Ga0070658_10525823 Ga0070658_105258232 226
357 3300005331 Ga0070670_100025237 Ga0070670_1000252373 226
358 3300005334 Ga0068869_100352092 Ga0068869_1003520922 226
359 3300005338 Ga0068868_100102289 Ga0068868_1001022892 226
360 3300005344 Ga0070661_100250871 Ga0070661_1002508712 226
361 3300005347 Ga0070668_100035201 Ga0070668_1000352012 226
362 3300005367 Ga0070667_100347889 Ga0070667_1003478892 226
363 3300005435 Ga0070714_100092324 Ga0070714_1000923242 226
364 3300005444 Ga0070694_100170782 Ga0070694_1001707822 226
365 3300005455 Ga0070663_100111072 Ga0070663_1001110722 226
366 3300005455 Ga0070663_100269663 Ga0070663_1002696631 226
367 3300005455 Ga0070663_100353457 Ga0070663_1003534572 226
368 3300005468 Ga0070707_100096973 Ga0070707_1000969732 226
369 3300005548 Ga0070665_100447213 Ga0070665_1004472132 226
370 3300005548 Ga0070665_100478775 Ga0070665_1004787752 226
371 3300005577 Ga0068857_100133495 Ga0068857_1001334952 226
372 3300005614 Ga0068856_100448706 Ga0068856_1004487062 226
373 3300005615 Ga0070702_100614851 Ga0070702_1006148511 226
374 3300005618 Ga0068864_100327275 Ga0068864_1003272752 226
375 3300005841 Ga0068863_100436663 Ga0068863_1004366631 226
376 3300006038 Ga0075365_10003007 Ga0075365_100030072 226
377 3300006048 Ga0075363_100010642 Ga0075363_1000106422 226
378 3300006051 Ga0075364_10073707 Ga0075364_100737073 226
379 3300006177 Ga0075362_10013513 Ga0075362_100135133 226
380 3300006195 Ga0075366_10010771 Ga0075366_100107712 226
381 3300009148 Ga0105243_10513834 Ga0105243_105138342 226
382 3300009174 Ga0105241_10232848 Ga0105241_102328482 226
383 3300009545 Ga0105237_10071402 Ga0105237_100714022 226
384 3300009553 Ga0105249_10461645 Ga0105249_104616451 226
385 3300010375 Ga0105239_10063317 Ga0105239_100633172 226
386 3300010375 Ga0105239_10334669 Ga0105239_103346692 226
387 3300010375 Ga0105239_10603116 Ga0105239_106031161 226
388 3300013306 Ga0163162_11030991 Ga0163162_110309911 226
389 3300013308 Ga0157375_10284616 Ga0157375_102846162 226
390 3300014325 Ga0163163_10309141 Ga0163163_103091412 226
391 3300014325 Ga0163163_10423188 Ga0163163_104231882 226
392 3300014745 Ga0157377_10352769 Ga0157377_103527692 226
393 3300014968 Ga0157379_10206937 Ga0157379_102069372 226
394 3300015262 Ga0182007_10097440 Ga0182007_100974401 226
395 3300025253 Ga0209677_104344 Ga0209677_1043442 226
396 3300025297 Ga0209758_1016910 Ga0209758_10169102 226
397 3300025302 Ga0207426_1004845 Ga0207426_10048454 226
398 3300025302 Ga0207426_1088282 Ga0207426_10882822 226
399 3300025304 Ga0209257_1010082 Ga0209257_10100822 226
400 3300025901 Ga0207688_10142213 Ga0207688_101422132 226
401 3300025903 Ga0207680_10170252 Ga0207680_101702522 226
402 3300025904 Ga0207647_10023266 Ga0207647_100232662 226
403 3300025911 Ga0207654_10306431 Ga0207654_103064311 226
404 3300025914 Ga0207671_10247853 Ga0207671_102478532 226
405 3300025929 Ga0207664_10026828 Ga0207664_100268282 226
406 3300025942 Ga0207689_10356269 Ga0207689_103562692 226
407 3300025945 Ga0207679_10206995 Ga0207679_102069952 226
408 3300025949 Ga0207667_10331186 Ga0207667_103311862 226
409 3300025972 Ga0207668_10197826 Ga0207668_101978262 226
410 3300025981 Ga0207640_10622721 Ga0207640_106227211 226
411 3300025986 Ga0207658_10108908 Ga0207658_101089083 226
412 3300026023 Ga0207677_10359139 Ga0207677_103591391 226
413 3300026067 Ga0207678_10139094 Ga0207678_101390942 226
414 3300026067 Ga0207678_10144836 Ga0207678_101448361 226
415 3300026088 Ga0207641_10337148 Ga0207641_103371482 226
416 3300026095 Ga0207676_10856197 Ga0207676_108561972 226
417 3300027866 Ga0209813_10033212 Ga0209813_100332122 226
418 3300028786 Ga0307517_10250461 Ga0307517_102504611 226
419 3300031548 Ga0307408_100578190 Ga0307408_1005781901 226
420 3300033180 Ga0307510_10023425 Ga0307510_100234252 226
421 3300033180 Ga0307510_10408005 Ga0307510_104080051 226
422 3300037312 Ga0395899_0045464 Ga0395899_0045464_2488_3174 226
423 3300037418 Ga0395900_0000696 Ga0395900_0000696_4934_5620 226
424 3300037466 Ga0395898_0009029 Ga0395898_0009029_2470_3156 226
425 3300038443 Ga0395901_0027392 Ga0395901_0027392_2511_3197 226
426 3300046454 Ga0495592_0020048 Ga0495592_0020048_1883_2569 226
427 3300046455 Ga0495603_0022781 Ga0495603_0022781_624_1304 226
428 3300046455 Ga0495603_0299061 Ga0495603_0299061_146_832 226
429 3300046460 Ga0495638_0053712 Ga0495638_0053712_233_919 226
430 3300046462 Ga0495651_0005167 Ga0495651_0005167_4176_4862 226
431 3300046463 Ga0495653_0029583 Ga0495653_0029583_1976_2662 226
432 3300046474 Ga0495605_0118126 Ga0495605_0118126_80_766 226
433 3300046477 Ga0495664_0045743 Ga0495664_0045743_1636_2322 226
434 3300046477 Ga0495664_0152881 Ga0495664_0152881_14_724 226
435 3300046500 Ga0495596_0054926 Ga0495596_0054926_20_706 226
436 3300046511 Ga0495608_0038509 Ga0495608_0038509_2425_3111 226
437 3300046513 Ga0495616_0034692 Ga0495616_0034692_110_796 226
438 3300046515 Ga0495620_0019743 Ga0495620_0019743_570_1256 226
439 3300046515 Ga0495620_0148935 Ga0495620_0148935_89_775 226
440 3300046516 Ga0495628_0025666 Ga0495628_0025666_2700_3386 226
441 3300046522 Ga0495643_0050132 Ga0495643_0050132_741_1427 226
442 3300046524 Ga0495648_0101195 Ga0495648_0101195_574_1260 226
443 3300046529 Ga0495652_0065462 Ga0495652_0065462_276_962 226
444 3300046533 Ga0495640_0035646 Ga0495640_0035646_1945_2631 226
445 3300046536 Ga0495587_0008436 Ga0495587_0008436_2787_3473 226
446 3300046542 Ga0495597_0025930 Ga0495597_0025930_1250_1936 226
447 3300046543 Ga0495645_0016780 Ga0495645_0016780_101_787 226
448 3300046557 Ga0495622_0048778 Ga0495622_0048778_771_1457 226
449 3300046559 Ga0495667_0011636 Ga0495667_0011636_119_805 226
450 3300046663 Ga0495635_0204809 Ga0495635_0204809_495_1181 226
451 3300046674 Ga0495588_0015817 Ga0495588_0015817_254_940 226
452 3300046675 Ga0495657_0008544 Ga0495657_0008544_1358_2044 226
453 3300046678 Ga0495599_0016179 Ga0495599_0016179_3225_3911 226
454 3300046679 Ga0495623_0020193 Ga0495623_0020193_1477_2163 226
455 3300046680 Ga0495646_0027979 Ga0495646_0027979_2636_3322 226
456 3300046689 Ga0495613_0058263 Ga0495613_0058263_1169_1855 226
457 3300046694 Ga0495649_0056877 Ga0495649_0056877_665_1351 226
458 3300046809 Ga0495600_0040341 Ga0495600_0040341_1487_2173 226
459 3300046810 Ga0495660_0160016 Ga0495660_0160016_242_928 226
460 3300047317 Ga0495604_0006103 Ga0495604_0006103_276_962 226
461 3300047319 Ga0495674_0032580 Ga0495674_0032580_914_1600 226
462 3300047321 Ga0495676_0396742 Ga0495676_0396742_82_768 226
463 3300047322 Ga0495680_0010380 Ga0495680_0010380_5116_5802 226
464 3300047323 Ga0495683_0076522 Ga0495683_0076522_784_1470 226
465 3300047323 Ga0495683_0103183 Ga0495683_0103183_124_810 226
466 3300047443 Ga0495687_009999 Ga0495687_009999_285_971 226
467 3300047444 Ga0495675_0072871 Ga0495675_0072871_1144_1830 226
468 3300047471 Ga0495684_0014418 Ga0495684_0014418_2217_3020 226
469 3300047472 Ga0495686_0096140 Ga0495686_0096140_1019_1705 226
470 3300047472 Ga0495686_0345848 Ga0495686_0345848_97_783 226
471 3300048088 Ga0495602_0016855 Ga0495602_0016855_3077_3763 226
472 3300048088 Ga0495602_0632284 Ga0495602_0632284_18_698 226
473 3300048091 Ga0495626_0158636 Ga0495626_0158636_215_901 226
474 3300048903 Ga0496100_0092496 Ga0496100_0092496_681_1367 226
475 3300048905 Ga0496102_0489565 Ga0496102_0489565_364_1050 226
476 3300048906 Ga0496103_0002964 Ga0496103_0002964_1642_2328 226
477 3300048906 Ga0496103_0138332 Ga0496103_0138332_579_1265 226
478 3300048907 Ga0496104_0186778 Ga0496104_0186778_1093_1779 226
479 3300048907 Ga0496104_0328877 Ga0496104_0328877_270_956 226
480 3300048908 Ga0496105_0341882 Ga0496105_0341882_248_934 226
481 3300048909 Ga0496106_0099941 Ga0496106_0099941_1145_1831 226
482 3300048911 Ga0496108_0318125 Ga0496108_0318125_375_1061 226
483 3300048913 Ga0496110_0186371 Ga0496110_0186371_320_1006 226
484 3300048914 Ga0496111_0025336 Ga0496111_0025336_2979_3665 226
485 3300048915 Ga0496112_0287165 Ga0496112_0287165_520_1206 226
486 3300048916 Ga0496113_0261166 Ga0496113_0261166_107_793 226
487 3300048916 Ga0496113_0324375 Ga0496113_0324375_292_978 226
488 3300048918 Ga0496115_0386964 Ga0496115_0386964_132_818 226
489 3300048919 Ga0496116_0005246 Ga0496116_0005246_2255_2950 226
490 3300048921 Ga0496118_0046352 Ga0496118_0046352_1236_1922 226
491 3300048922 Ga0496119_0056994 Ga0496119_0056994_1202_1888 226
492 3300048922 Ga0496119_0142289 Ga0496119_0142289_187_873 226
493 3300048927 Ga0496124_0146701 Ga0496124_0146701_749_1435 226
494 3300048928 Ga0496125_0121204 Ga0496125_0121204_322_1008 226
495 3300048928 Ga0496125_0142854 Ga0496125_0142854_822_1508 226
496 3300048929 Ga0496126_0282974 Ga0496126_0282974_597_1283 226
497 3300048929 Ga0496126_0462381 Ga0496126_0462381_254_940 226
498 3300050489 nmdc:mga03683_74374_c1 nmdc:mga03683_74374_c1_640_1326 226
499 3300050490 nmdc:mga03n38_3019_c1 nmdc:mga03n38_3019_c1_2947_3633 226
500 3300050491 nmdc:mga00v17_82252_c1 nmdc:mga00v17_82252_c1_893_1579 226
501 3300050492 nmdc:mga0yw44_100757_c1 nmdc:mga0yw44_100757_c1_880_1566 226
502 3300050492 nmdc:mga0yw44_70594_c1 nmdc:mga0yw44_70594_c1_1059_1745 226
503 3300050493 nmdc:mga0k408_6697_c1 nmdc:mga0k408_6697_c1_4830_5516 226
504 3300050494 nmdc:mga06z11_22732_c1 nmdc:mga06z11_22732_c1_2198_2884 226
505 3300050494 nmdc:mga06z11_53578_c1 nmdc:mga06z11_53578_c1_1115_1801 226
506 3300050496 nmdc:mga07m45_19585_c1 nmdc:mga07m45_19585_c1_1854_2540 226
507 3300050516 nmdc:mga0sz30_73294_c1 nmdc:mga0sz30_73294_c1_240_926 226
508 3300053080 Ga0500635_0106737 Ga0500635_0106737_140_820 226
509 3300053083 Ga0495655_0086886 Ga0495655_0086886_49_735 226
510 3300053090 Ga0500646_0019969 Ga0500646_0019969_92_778 226
511 3300053094 Ga0500566_0000224 Ga0500566_0000224_27699_28385 226
512 3300053104 Ga0500556_0103283 Ga0500556_0103283_136_822 226
513 3300053119 Ga0500595_025410 Ga0500595_025410_1291_1977 226
514 3300053125 Ga0500618_017773 Ga0500618_017773_1043_1735 226
515 3300053126 Ga0500621_186776 Ga0500621_186776_13_699 226
516 3300053136 Ga0500559_0011309 Ga0500559_0011309_1014_1709 226
517 3300053146 Ga0500588_0050955 Ga0500588_0050955_13_699 226
518 3300053150 Ga0500603_000204 Ga0500603_000204_7324_8004 226
519 3300053156 Ga0500622_0016210 Ga0500622_0016210_602_1288 226
520 3300053160 Ga0500633_0010105 Ga0500633_0010105_1455_2141 226
521 3300053177 Ga0500636_0135817 Ga0500636_0135817_169_855 226
522 3300053178 Ga0500637_0000531 Ga0500637_0000531_771_1451 226
523 3300053730 Ga0500645_056543 Ga0500645_056543_79_765 226
524 iso_pu_bacteria 2941531003 2941532410 226
525 3300003215 JGI25153J46596_10002236 JGI25153J46596_100022363 227
526 3300003215 JGI25153J46596_10051863 JGI25153J46596_100518632 227
527 3300003320 rootH2_10146027 rootH2_101460272 227
528 3300003794 Ga0055531_10006394 Ga0055531_100063945 227
529 3300004625 Ga0055543_1016667 Ga0055543_10166672 227
530 3300005262 Ga0065165_1003543 Ga0065165_10035432 227
531 3300005327 Ga0070658_10091470 Ga0070658_100914702 227
532 3300005327 Ga0070658_10104306 Ga0070658_101043062 227
533 3300005327 Ga0070658_10187977 Ga0070658_101879772 227
534 3300005329 Ga0070683_100104465 Ga0070683_1001044653 227
535 3300005339 Ga0070660_100467162 Ga0070660_1004671622 227
536 3300005347 Ga0070668_100542269 Ga0070668_1005422691 227
537 3300005434 Ga0070709_10004296 Ga0070709_100042967 227
538 3300005435 Ga0070714_100002380 Ga0070714_10000238012 227
539 3300005435 Ga0070714_100043477 Ga0070714_1000434772 227
540 3300005436 Ga0070713_100007138 Ga0070713_1000071387 227
541 3300005437 Ga0070710_10004062 Ga0070710_100040624 227
542 3300005577 Ga0068857_100177179 Ga0068857_1001771792 227
543 3300006028 Ga0070717_10003247 Ga0070717_100032473 227
544 3300006028 Ga0070717_10142680 Ga0070717_101426801 227
545 3300006038 Ga0075365_10028075 Ga0075365_100280752 227
546 3300006038 Ga0075365_10335823 Ga0075365_103358232 227
547 3300006042 Ga0075368_10135139 Ga0075368_101351392 227
548 3300006163 Ga0070715_10000109 Ga0070715_100001094 227
549 3300006173 Ga0070716_100043623 Ga0070716_1000436232 227
550 3300006175 Ga0070712_100011266 Ga0070712_1000112666 227
551 3300006175 Ga0070712_100117928 Ga0070712_1001179282 227
552 3300006353 Ga0075370_10331425 Ga0075370_103314252 227
553 3300006942 Ga0099824_1011459 Ga0099824_10114593 227
554 3300007265 Ga0099794_10004043 Ga0099794_100040431 227
555 3300007265 Ga0099794_10078326 Ga0099794_100783262 227
556 3300009093 Ga0105240_10013956 Ga0105240_100139568 227
557 3300009177 Ga0105248_10909424 Ga0105248_109094242 227
558 3300010375 Ga0105239_10181918 Ga0105239_101819183 227
559 3300021384 Ga0213876_10004604 Ga0213876_100046046 227
560 3300025245 Ga0207425_1032449 Ga0207425_10324492 227
561 3300025297 Ga0209758_1000015 Ga0209758_1000015102 227
562 3300025302 Ga0207426_1004020 Ga0207426_10040206 227
563 3300025303 Ga0209051_1022112 Ga0209051_10221122 227
564 3300025304 Ga0209257_1006922 Ga0209257_10069225 227
565 3300025898 Ga0207692_10016330 Ga0207692_100163304 227
566 3300025906 Ga0207699_10004953 Ga0207699_100049534 227
567 3300025909 Ga0207705_10063380 Ga0207705_100633802 227
568 3300025915 Ga0207693_10000073 Ga0207693_1000007362 227
569 3300025915 Ga0207693_10048842 Ga0207693_100488421 227
570 3300025916 Ga0207663_10000222 Ga0207663_1000022211 227
571 3300025927 Ga0207687_10197408 Ga0207687_101974082 227
572 3300025939 Ga0207665_10000316 Ga0207665_1000031612 227
573 3300026023 Ga0207677_10154418 Ga0207677_101544182 227
574 3300026067 Ga0207678_10073742 Ga0207678_100737422 227
575 3300026142 Ga0207698_10180967 Ga0207698_101809672 227
576 3300027296 Ga0209389_1000051 Ga0209389_100005186 227
577 3300027357 Ga0209589_1000012 Ga0209589_1000012121 227
578 3300027357 Ga0209589_1000013 Ga0209589_100001385 227
579 3300027361 Ga0209489_100013 Ga0209489_100013122 227
580 3300027866 Ga0209813_10162563 Ga0209813_101625631 227
581 3300028380 Ga0268265_10526921 Ga0268265_105269212 227
582 3300028794 Ga0307515_10156561 Ga0307515_101565613 227
583 3300033180 Ga0307510_10033862 Ga0307510_100338623 227
584 3300035089 Ga0373944_0043490 Ga0373944_0043490_643_1338 227
585 3300035117 Ga0373953_0102426 Ga0373953_0102426_224_907 227
586 3300035118 Ga0373954_0067381 Ga0373954_0067381_279_962 227
587 3300035724 Ga0373933_0270831 Ga0373933_0270831_160_852 227
588 3300036401 Ga0373937_0059216 Ga0373937_0059216_2164_2856 227
589 3300037312 Ga0395899_0060576 Ga0395899_0060576_1405_2094 227
590 3300037471 Ga0395905_0002558 Ga0395905_0002558_7500_8189 227
591 3300037471 Ga0395905_0077822 Ga0395905_0077822_1858_2547 227
592 3300039437 Ga0436365_0217850 Ga0436365_0217850_1343_2032 227
593 3300039437 Ga0436365_1912827 Ga0436365_1912827_1925_2614 227
594 3300039438 Ga0436360_0696150 Ga0436360_0696150_781_1473 227
595 3300039447 Ga0436361_1126767 Ga0436361_1126767_169_861 227
596 3300039450 Ga0436363_0224061 Ga0436363_0224061_950_1639 227
597 3300044656 Ga0466969_0103404 Ga0466969_0103404_358_1047 227
598 3300044658 Ga0466972_0000059 Ga0466972_0000059_2084_2773 227
599 3300044658 Ga0466972_0128821 Ga0466972_0128821_294_983 227
600 3300044683 Ga0466965_0009320 Ga0466965_0009320_173_862 227
601 3300044706 Ga0466964_0124325 Ga0466964_0124325_334_1023 227
602 3300044735 Ga0466968_0121861 Ga0466968_0121861_121_810 227
603 3300046460 Ga0495638_0074116 Ga0495638_0074116_1338_2036 227
604 3300046462 Ga0495651_0181099 Ga0495651_0181099_399_1091 227
605 3300046477 Ga0495664_0073297 Ga0495664_0073297_611_1294 227
606 3300046501 Ga0495607_0017436 Ga0495607_0017436_3512_4210 227
607 3300046507 Ga0495606_0156206 Ga0495606_0156206_612_1301 227
608 3300046557 Ga0495622_0081259 Ga0495622_0081259_95_793 227
609 3300047315 Ga0495581_0103423 Ga0495581_0103423_747_1436 227
610 3300047443 Ga0495687_020238 Ga0495687_020238_1692_2381 227
611 3300047472 Ga0495686_0038212 Ga0495686_0038212_1373_2062 227
612 3300047472 Ga0495686_0060394 Ga0495686_0060394_360_1097 227
613 3300048091 Ga0495626_0074453 Ga0495626_0074453_460_1158 227
614 3300048920 Ga0496117_0027983 Ga0496117_0027983_2990_3688 227
615 3300048921 Ga0496118_0030470 Ga0496118_0030470_3477_4175 227
616 3300048921 Ga0496118_0038317 Ga0496118_0038317_868_1566 227
617 3300048922 Ga0496119_0094486 Ga0496119_0094486_515_1213 227
618 3300048924 Ga0496121_0002503 Ga0496121_0002503_22457_23170 227
619 3300048924 Ga0496121_0009424 Ga0496121_0009424_2269_3006 227
620 3300048924 Ga0496121_0364213 Ga0496121_0364213_38_727 227
621 3300048925 Ga0496122_0033320 Ga0496122_0033320_1046_1741 227
622 3300048925 Ga0496122_0071910 Ga0496122_0071910_48_746 227
623 3300048926 Ga0496123_0023676 Ga0496123_0023676_55_753 227
624 3300048926 Ga0496123_0133297 Ga0496123_0133297_72_767 227
625 3300048927 Ga0496124_0220903 Ga0496124_0220903_270_968 227
626 3300048928 Ga0496125_0000398 Ga0496125_0000398_58558_59253 227
627 3300048928 Ga0496125_0009727 Ga0496125_0009727_8224_8919 227
628 3300048929 Ga0496126_0163053 Ga0496126_0163053_381_1064 227
629 3300050492 nmdc:mga0yw44_218233_c2 nmdc:mga0yw44_218233_c2_213_902 227
630 3300050492 nmdc:mga0yw44_292730_c1 nmdc:mga0yw44_292730_c1_212_910 227
631 3300050494 nmdc:mga06z11_291154_c1 nmdc:mga06z11_291154_c1_232_930 227
632 3300050495 nmdc:mga04h51_161773_c1 nmdc:mga04h51_161773_c1_126_824 227
633 3300050496 nmdc:mga07m45_27605_c1 nmdc:mga07m45_27605_c1_1672_2370 227
634 3300053077 Ga0495601_0033060 Ga0495601_0033060_769_1452 227
635 3300053078 Ga0495612_0217938 Ga0495612_0217938_16_699 227
636 3300053080 Ga0500635_0027829 Ga0500635_0027829_11_700 227
637 3300053087 Ga0500643_000163 Ga0500643_000163_64984_65673 227
638 3300053091 Ga0500647_0041005 Ga0500647_0041005_1050_1739 227
639 3300053094 Ga0500566_0001842 Ga0500566_0001842_11523_12221 227
640 3300053094 Ga0500566_0134777 Ga0500566_0134777_14_703 227
641 3300053095 Ga0500640_022067 Ga0500640_022067_1644_2333 227
642 3300053103 Ga0500555_000884 Ga0500555_000884_3124_3813 227
643 3300053104 Ga0500556_0114936 Ga0500556_0114936_183_872 227
644 3300053105 Ga0500557_000051 Ga0500557_000051_8162_8851 227
645 3300053109 Ga0500569_025542 Ga0500569_025542_686_1375 227
646 3300053111 Ga0500572_147906 Ga0500572_147906_54_743 227
647 3300053119 Ga0500595_001454 Ga0500595_001454_4791_5528 227
648 3300053121 Ga0500607_094992 Ga0500607_094992_755_1453 227
649 3300053121 Ga0500607_158935 Ga0500607_158935_171_860 227
650 3300053122 Ga0500608_046176 Ga0500608_046176_1053_1742 227
651 3300053122 Ga0500608_046742 Ga0500608_046742_699_1397 227
652 3300053133 Ga0500655_026635 Ga0500655_026635_57_746 227
653 3300053134 Ga0500658_0070331 Ga0500658_0070331_749_1438 227
654 3300053136 Ga0500559_0000268 Ga0500559_0000268_17259_17957 227
655 3300053138 Ga0500564_106525 Ga0500564_106525_381_1070 227
656 3300053139 Ga0500568_0004979 Ga0500568_0004979_2386_3084 227
657 3300053139 Ga0500568_0019783 Ga0500568_0019783_678_1367 227
658 3300053142 Ga0500577_0075168 Ga0500577_0075168_601_1296 227
659 3300053145 Ga0500586_006324 Ga0500586_006324_369_1067 227
660 3300053147 Ga0500589_106367 Ga0500589_106367_315_1004 227
661 3300053148 Ga0500590_025050 Ga0500590_025050_1614_2303 227
662 3300053151 Ga0500604_0017960 Ga0500604_0017960_972_1661 227
663 3300053151 Ga0500604_0028984 Ga0500604_0028984_40_738 227
664 3300053154 Ga0500619_127736 Ga0500619_127736_166_855 227
665 3300053158 Ga0500627_0054862 Ga0500627_0054862_999_1688 227
666 3300053177 Ga0500636_0001663 Ga0500636_0001663_7432_8121 227
667 3300053177 Ga0500636_0008037 Ga0500636_0008037_1237_1935 227
668 3300053722 Ga0500649_118707 Ga0500649_118707_249_938 227
669 3300053729 Ga0500625_015823 Ga0500625_015823_2637_3326 227
670 3300053737 Ga0500601_000760 Ga0500601_000760_2305_2994 227
671 iso_pu_bacteria 3005710791 3005717992 227
672 iso_pu_bacteria 8016583857 8016586709 227
673 3300003203 JGI25406J46586_10002939 JGI25406J46586_1000293912 228
674 3300003322 rootL2_10014174 rootL2_100141741 228
675 3300003354 JGI25160J50197_1007311 JGI25160J50197_10073112 228
676 3300003659 JGI25404J52841_10009041 JGI25404J52841_100090412 228
677 3300003659 JGI25404J52841_10023969 JGI25404J52841_100239692 228
678 3300005327 Ga0070658_10082475 Ga0070658_100824753 228
679 3300005327 Ga0070658_10515471 Ga0070658_105154711 228
680 3300005339 Ga0070660_100302526 Ga0070660_1003025261 228
681 3300005344 Ga0070661_100572237 Ga0070661_1005722371 228
682 3300005366 Ga0070659_100019746 Ga0070659_1000197465 228
683 3300005434 Ga0070709_10006312 Ga0070709_100063124 228
684 3300005435 Ga0070714_101052084 Ga0070714_1010520841 228
685 3300005436 Ga0070713_100185916 Ga0070713_1001859162 228
686 3300005437 Ga0070710_10255693 Ga0070710_102556932 228
687 3300005439 Ga0070711_100154851 Ga0070711_1001548512 228
688 3300005471 Ga0070698_100205477 Ga0070698_1002054772 228
689 3300005530 Ga0070679_100401000 Ga0070679_1004010002 228
690 3300005614 Ga0068856_100276734 Ga0068856_1002767342 228
691 3300005937 Ga0081455_10003129 Ga0081455_100031297 228
692 3300005937 Ga0081455_10005099 Ga0081455_1000509911 228
693 3300005937 Ga0081455_10172765 Ga0081455_101727652 228
694 3300005983 Ga0081540_1008204 Ga0081540_10082045 228
695 3300005983 Ga0081540_1010671 Ga0081540_10106711 228
696 3300005983 Ga0081540_1049990 Ga0081540_10499902 228
697 3300005983 Ga0081540_1053693 Ga0081540_10536931 228
698 3300005983 Ga0081540_1071200 Ga0081540_10712002 228
699 3300006038 Ga0075365_10031542 Ga0075365_100315422 228
700 3300006038 Ga0075365_10349122 Ga0075365_103491222 228
701 3300006051 Ga0075364_10094530 Ga0075364_100945302 228
702 3300006051 Ga0075364_10171955 Ga0075364_101719552 228
703 3300006051 Ga0075364_10459824 Ga0075364_104598242 228
704 3300006173 Ga0070716_100173005 Ga0070716_1001730052 228
705 3300006175 Ga0070712_100008123 Ga0070712_1000081232 228
706 3300006175 Ga0070712_100167898 Ga0070712_1001678982 228
707 3300006195 Ga0075366_10233189 Ga0075366_102331892 228
708 3300006353 Ga0075370_10053233 Ga0075370_100532332 228
709 3300006942 Ga0099824_1038190 Ga0099824_10381902 228
710 3300006944 Ga0099823_1055347 Ga0099823_10553472 228
711 3300010159 Ga0099796_10012847 Ga0099796_100128472 228
712 3300013104 Ga0157370_10352394 Ga0157370_103523942 228
713 3300013308 Ga0157375_10633899 Ga0157375_106338993 228
714 3300025273 Ga0209673_1041175 Ga0209673_10411752 228
715 3300025297 Ga0209758_1000692 Ga0209758_100069235 228
716 3300025302 Ga0207426_1000201 Ga0207426_100020167 228
717 3300025304 Ga0209257_1043698 Ga0209257_10436982 228
718 3300025898 Ga0207692_10003125 Ga0207692_100031253 228
719 3300025906 Ga0207699_10011179 Ga0207699_100111792 228
720 3300025909 Ga0207705_10148279 Ga0207705_101482792 228
721 3300025909 Ga0207705_10174065 Ga0207705_101740652 228
722 3300025915 Ga0207693_10008082 Ga0207693_100080827 228
723 3300025916 Ga0207663_10050152 Ga0207663_100501523 228
724 3300025919 Ga0207657_10006481 Ga0207657_1000648110 228
725 3300025928 Ga0207700_10243506 Ga0207700_102435062 228
726 3300025932 Ga0207690_10245023 Ga0207690_102450232 228
727 3300025939 Ga0207665_10069246 Ga0207665_100692462 228
728 3300027296 Ga0209389_1000064 Ga0209389_100006444 228
729 3300027361 Ga0209489_102226 Ga0209489_10222626 228
730 3300027363 Ga0209700_100014 Ga0209700_100014167 228
731 3300027512 Ga0209179_1004497 Ga0209179_10044971 228
732 3300031238 Ga0265332_10016245 Ga0265332_100162455 228
733 3300031712 Ga0265342_10105013 Ga0265342_101050132 228
734 3300035086 Ga0373934_0002860 Ga0373934_0002860_1086_1772 228
735 3300035242 Ga0373962_0077044 Ga0373962_0077044_109_795 228
736 3300035724 Ga0373933_0000173 Ga0373933_0000173_22226_22918 228
737 3300036534 Ga0310109_024188 Ga0310109_024188_97_789 228
738 3300037068 Ga0373925_0027030 Ga0373925_0027030_1728_2414 228
739 3300037312 Ga0395899_0098584 Ga0395899_0098584_14_703 228
740 3300037418 Ga0395900_0312439 Ga0395900_0312439_371_1060 228
741 3300037466 Ga0395898_0317064 Ga0395898_0317064_471_1160 228
742 3300041456 Ga0451795_0339562 Ga0451795_0339562_102_797 228
743 3300041491 Ga0451833_0705105 Ga0451833_0705105_433_1125 228
744 3300041494 Ga0451837_1393955 Ga0451837_1393955_54_746 228
745 3300041512 Ga0451853_2342626 Ga0451853_2342626_61_753 228
746 3300044683 Ga0466965_0013307 Ga0466965_0013307_2136_2828 228
747 3300044901 Ga0466960_0115953 Ga0466960_0115953_144_836 228
748 3300045976 Ga0466967_0412536 Ga0466967_0412536_258_950 228
749 3300046472 Ga0495580_0246803 Ga0495580_0246803_357_1043 228
750 3300046477 Ga0495664_0331665 Ga0495664_0331665_50_736 228
751 3300046679 Ga0495623_0220248 Ga0495623_0220248_331_1017 228
752 3300046794 Ga0495589_0236348 Ga0495589_0236348_76_765 228
753 3300048908 Ga0496105_0090512 Ga0496105_0090512_122_814 228
754 3300048915 Ga0496112_0139058 Ga0496112_0139058_236_922 228
755 3300048918 Ga0496115_0242677 Ga0496115_0242677_700_1386 228
756 3300048927 Ga0496124_0201280 Ga0496124_0201280_23_715 228
757 3300048929 Ga0496126_0007757 Ga0496126_0007757_410_1102 228
758 3300048929 Ga0496126_0020992 Ga0496126_0020992_3045_3755 228
759 3300048929 Ga0496126_0039870 Ga0496126_0039870_1043_1729 228
760 3300049568 Ga0501031_0132018 Ga0501031_0132018_505_1197 228
761 3300049569 Ga0501032_0295519 Ga0501032_0295519_161_850 228
762 3300049570 Ga0501033_0025424 Ga0501033_0025424_413_1102 228
763 3300049570 Ga0501033_0029630 Ga0501033_0029630_856_1548 228
764 3300049571 Ga0501034_0231809 Ga0501034_0231809_88_777 228
765 3300049571 Ga0501034_0352834 Ga0501034_0352834_36_725 228
766 3300049572 Ga0501036_0063511 Ga0501036_0063511_2162_2851 228
767 3300049573 Ga0501037_0064363 Ga0501037_0064363_1797_2489 228
768 3300049573 Ga0501037_0072169 Ga0501037_0072169_1161_1850 228
769 3300049574 Ga0501038_0004453 Ga0501038_0004453_8686_9378 228
770 3300049574 Ga0501038_0256777 Ga0501038_0256777_560_1252 228
771 3300049575 Ga0501039_0251179 Ga0501039_0251179_281_973 228
772 3300049575 Ga0501039_0364939 Ga0501039_0364939_329_1021 228
773 3300049579 Ga0501043_0005382 Ga0501043_0005382_8898_9590 228
774 3300049579 Ga0501043_0241646 Ga0501043_0241646_141_833 228
775 3300049580 Ga0501046_0036217 Ga0501046_0036217_1634_2323 228
776 3300049581 Ga0501047_0165409 Ga0501047_0165409_951_1640 228
777 3300049581 Ga0501047_0183872 Ga0501047_0183872_367_1059 228
778 3300049581 Ga0501047_0253123 Ga0501047_0253123_748_1440 228
779 3300049581 Ga0501047_0263994 Ga0501047_0263994_344_1036 228
780 3300049581 Ga0501047_0315296 Ga0501047_0315296_581_1270 228
781 3300049586 Ga0501070_0127813 Ga0501070_0127813_984_1676 228
782 3300049586 Ga0501070_0285000 Ga0501070_0285000_576_1265 228
783 3300049741 Ga0501079_0456727 Ga0501079_0456727_197_886 228
784 3300049742 Ga0501080_0051614 Ga0501080_0051614_555_1247 228
785 3300049822 Ga0501035_0061642 Ga0501035_0061642_1087_1779 228
786 3300049822 Ga0501035_0077755 Ga0501035_0077755_2118_2807 228
787 3300049823 Ga0501044_0007879 Ga0501044_0007879_2410_3102 228
788 3300049823 Ga0501044_0009525 Ga0501044_0009525_660_1352 228
789 3300049823 Ga0501044_0034204 Ga0501044_0034204_4472_5161 228
790 3300049823 Ga0501044_0075196 Ga0501044_0075196_730_1419 228
791 3300049823 Ga0501044_0404330 Ga0501044_0404330_445_1137 228
792 3300050491 nmdc:mga00v17_424279_c1 nmdc:mga00v17_424279_c1_51_743 228
793 3300050492 nmdc:mga0yw44_128862_c1 nmdc:mga0yw44_128862_c1_671_1363 228
794 3300050492 nmdc:mga0yw44_386378_c1 nmdc:mga0yw44_386378_c1_223_915 228
795 3300050492 nmdc:mga0yw44_45427_c1 nmdc:mga0yw44_45427_c1_893_1585 228
796 3300050493 nmdc:mga0k408_219068_c1 nmdc:mga0k408_219068_c1_249_941 228
797 3300050494 nmdc:mga06z11_160979_c1 nmdc:mga06z11_160979_c1_540_1232 228
798 3300050496 nmdc:mga07m45_124902_c1 nmdc:mga07m45_124902_c1_52_744 228
799 3300050496 nmdc:mga07m45_34927_c1 nmdc:mga07m45_34927_c1_848_1540 228
800 3300050512 nmdc:mga0n895_150416_c1 nmdc:mga0n895_150416_c1_1170_1856 228
801 3300053085 Ga0495619_0114415 Ga0495619_0114415_344_1030 228
802 3300053130 Ga0500642_0000117 Ga0500642_0000117_6659_7351 228
803 3300060353 Ga0501082_0413245 Ga0501082_0413245_35_727 228
804 iso_pu_bacteria 2513237092 2513626695 228
805 iso_pu_bacteria 2517093001 2517102316 228
806 iso_pu_bacteria 2824704595 2824713993 228
807 iso_pu_bacteria 2824753945 2824757051 228
808 iso_pu_bacteria 2824763712 2824768387 228
809 iso_pu_bacteria 2885409591 2885411237 228
810 iso_pu_bacteria 2904711408 2904716246 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

50

217

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lp8-assembly1.cif.gz_A a novel open-state crystal structure of the prokaryotic inward rectifier kirbac3.1 0.8563 125 222
2wlj-assembly1.cif.gz_A-2 potassium channel from magnetospirillum magnetotacticum 0.8205 128 220
2wln-assembly1.cif.gz_A potassium channel from magnetospirillum magnetotacticum 0.8193 125 222
2wlk-assembly1.cif.gz_A structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum 0.8171 125 220
7cal-assembly1.cif.gz_A cryo-em structure of the hyperpolarization-activated inwardly rectifying potassium channel kat1 from arabidopsis 0.8149 123 226
ID Description Score Start End Superfamily
af_K7KPW5_139_236_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8456 131 227 1.10.287.70
af_F1RB62_245_342_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8253 125 227 1.10.287.70
af_F1Q5A8_239_336_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8248 125 227 1.10.287.70
2wlkA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7906 125 222 1.10.287.70
2wllA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7887 125 222 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6P1BG24-F1-model_v4 DUF1345 domain-containing protein 0.949 6 228 GO:0016020
AF-A0A257QQL1-F1-model_v4 DUF1345 domain-containing protein 0.9442 18 151 GO:0016020
AF-A0A3S0F7T0-F1-model_v4 DUF1345 domain-containing protein 0.9346 17 227 GO:0016020
AF-A0A6P1BG24-F1-model_v4 DUF1345 domain-containing protein 0.9328 6 228 GO:0016020
AF-A0A258EF71-F1-model_v4 DUF1345 domain-containing protein 0.9304 29 227 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.46 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map