F481817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 810 | 517 | 627 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0014418|Ga0495684_0014418_2217_3020 |
| Length | 267 |
| Sequence | MAVDGKEDPVLARFRQMSRPMRLIYARPRTFISLGAGILACLLVPGSLRLTTRLVLGWDTLIAVYLVLVYAMMLCNDHQHIRRAAAMQDDGRFVILLVTAIGAFASIAAIVAELGAHRGAAELTIAITTIALSWAAVHTTFALHYAHDYYRHPPGGLQFPSGDKEDHADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGIVSFIYNTALLALTVNIAASAIASLRPPQSSFWRKPGRPSGEASHPTQLHTSTLASFPGPPPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 60 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 61 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 64 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 65 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 66 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 70 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 71 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 72 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 73 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 74 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 75 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 76 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 77 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 78 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 79 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 80 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 81 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 82 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 83 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 84 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 85 | 2922368715 | |||
| 86 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 87 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 88 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 89 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 90 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 91 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 92 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 93 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 94 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 95 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 96 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 97 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 98 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 99 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 100 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 101 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 102 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 103 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 104 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 105 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 106 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 107 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 108 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 109 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 110 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 111 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 112 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 113 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 114 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 115 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 116 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 117 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 118 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 119 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 120 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 121 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 122 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 123 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 124 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 125 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 126 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 127 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 128 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 129 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 130 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 131 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 132 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 133 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 134 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 135 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 136 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 137 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 138 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 139 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 140 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 141 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 142 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 143 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 144 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 145 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 146 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 147 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 148 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 149 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 150 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 151 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 152 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 153 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 154 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 155 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 156 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 157 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 161 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 163 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 165 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 166 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 180 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 181 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 183 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 184 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 186 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 187 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 188 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 189 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 190 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 192 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 193 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 194 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 195 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 199 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 200 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 201 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 202 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 203 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 204 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 205 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 206 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 207 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 208 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 209 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 219 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 227 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 228 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 270 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 278 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 279 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 281 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 295 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 296 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 297 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 305 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 306 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 309 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 310 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 318 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 319 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 382 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 390 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 391 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 392 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 393 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 394 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 395 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 396 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 420 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 426 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 437 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 450 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 451 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 453 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 454 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 455 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 458 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 459 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 460 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 461 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 463 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 467 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 468 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 469 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 475 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 477 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 480 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 482 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 483 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 486 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 487 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 488 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 489 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 490 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 491 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 492 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 493 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 494 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 495 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 496 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 497 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 498 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 499 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 500 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 501 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 502 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 503 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 504 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 505 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 506 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 507 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 508 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 509 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 510 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 511 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 512 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 513 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 514 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 515 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 516 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 517 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.38 |
| Metatranscriptomes | 0.12 |
| Isolates | 22.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.14 |
| Nodule | 17.9 |
| Rhizoplane | 3.21 |
| Rhizosphere | 46.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002939 | 3300003203 | Bacteria | 8034 |
| 2 | JGI25153J46596_10002236 | 3300003215 | Bacteria | 11297 |
| 3 | JGI25153J46596_10003534 | 3300003215 | Bacteria | 8720 |
| 4 | JGI25153J46596_10051863 | 3300003215 | Bacteria | 1171 |
| 5 | rootH2_10146027 | 3300003320 | Bacteria | 1438 |
| 6 | rootL2_10014174 | 3300003322 | Bacteria | 1102 |
| 7 | JGI25160J50197_1007311 | 3300003354 | Bacteria | 4342 |
| 8 | JGI25160J50197_1008958 | 3300003354 | Bacteria | 3760 |
| 9 | JGI25160J50197_1014145 | 3300003354 | Bacteria | 2683 |
| 10 | JGI25404J52841_10009041 | 3300003659 | Bacteria | 2129 |
| 11 | JGI25404J52841_10023969 | 3300003659 | Bacteria | 1316 |
| 12 | Ga0055542_1008654 | 3300003762 | Bacteria | 1976 |
| 13 | Ga0055531_10006394 | 3300003794 | Bacteria | 6700 |
| 14 | Ga0055543_1001201 | 3300004625 | Bacteria | 10876 |
| 15 | Ga0055543_1016667 | 3300004625 | Bacteria | 1394 |
| 16 | Ga0065165_1003230 | 3300005262 | Bacteria | 11833 |
| 17 | Ga0065165_1003543 | 3300005262 | Bacteria | 10800 |
| 18 | Ga0065165_1068283 | 3300005262 | Bacteria | 951 |
| 19 | Ga0070658_10082475 | 3300005327 | Bacteria | 2642 |
| 20 | Ga0070658_10091470 | 3300005327 | Bacteria | 2507 |
| 21 | Ga0070658_10104306 | 3300005327 | Bacteria | 2345 |
| 22 | Ga0070658_10187977 | 3300005327 | Bacteria | 1740 |
| 23 | Ga0070658_10515471 | 3300005327 | Bacteria | 1034 |
| 24 | Ga0070658_10525823 | 3300005327 | Bacteria | 1023 |
| 25 | Ga0070683_100104465 | 3300005329 | Bacteria | 2670 |
| 26 | Ga0070670_100025237 | 3300005331 | Bacteria | 5115 |
| 27 | Ga0068869_100352092 | 3300005334 | Bacteria | 1201 |
| 28 | Ga0068868_100102289 | 3300005338 | Bacteria | 2320 |
| 29 | Ga0070660_100302526 | 3300005339 | Bacteria | 1311 |
| 30 | Ga0070660_100467162 | 3300005339 | Bacteria | 1048 |
| 31 | Ga0070661_100250871 | 3300005344 | Bacteria | 1365 |
| 32 | Ga0070661_100572237 | 3300005344 | Bacteria | 911 |
| 33 | Ga0070668_100035201 | 3300005347 | Bacteria | 3817 |
| 34 | Ga0070668_100542269 | 3300005347 | Bacteria | 1012 |
| 35 | Ga0070659_100019746 | 3300005366 | Bacteria | 5113 |
| 36 | Ga0070667_100347889 | 3300005367 | Bacteria | 1341 |
| 37 | Ga0070709_10004296 | 3300005434 | Bacteria | 7684 |
| 38 | Ga0070709_10006312 | 3300005434 | Bacteria | 6455 |
| 39 | Ga0070714_100002380 | 3300005435 | Bacteria | 13846 |
| 40 | Ga0070714_100043477 | 3300005435 | Bacteria | 3800 |
| 41 | Ga0070714_100092324 | 3300005435 | Bacteria | 2653 |
| 42 | Ga0070714_100147138 | 3300005435 | Bacteria | 2120 |
| 43 | Ga0070714_101052084 | 3300005435 | Bacteria | 793 |
| 44 | Ga0070713_100007138 | 3300005436 | Bacteria | 7813 |
| 45 | Ga0070713_100185916 | 3300005436 | Bacteria | 1870 |
| 46 | Ga0070710_10004062 | 3300005437 | Bacteria | 6946 |
| 47 | Ga0070710_10255693 | 3300005437 | Bacteria | 1128 |
| 48 | Ga0070711_100154851 | 3300005439 | Bacteria | 1732 |
| 49 | Ga0070694_100170782 | 3300005444 | Bacteria | 1602 |
| 50 | Ga0070663_100111072 | 3300005455 | Bacteria | 2060 |
| 51 | Ga0070663_100269663 | 3300005455 | Bacteria | 1353 |
| 52 | Ga0070663_100353457 | 3300005455 | Bacteria | 1190 |
| 53 | Ga0070707_100096973 | 3300005468 | Bacteria | 2856 |
| 54 | Ga0070698_100205477 | 3300005471 | Bacteria | 1905 |
| 55 | Ga0070679_100401000 | 3300005530 | Bacteria | 1317 |
| 56 | Ga0070665_100366299 | 3300005548 | Bacteria | 1448 |
| 57 | Ga0070665_100447213 | 3300005548 | Bacteria | 1301 |
| 58 | Ga0070665_100478775 | 3300005548 | Bacteria | 1255 |
| 59 | Ga0068857_100133495 | 3300005577 | Bacteria | 2240 |
| 60 | Ga0068857_100177179 | 3300005577 | Bacteria | 1940 |
| 61 | Ga0068856_100276734 | 3300005614 | Bacteria | 1695 |
| 62 | Ga0068856_100448706 | 3300005614 | Bacteria | 1310 |
| 63 | Ga0070702_100614851 | 3300005615 | Bacteria | 817 |
| 64 | Ga0068852_100031105 | 3300005616 | Bacteria | 4400 |
| 65 | Ga0068864_100327275 | 3300005618 | Bacteria | 1441 |
| 66 | Ga0068863_100436663 | 3300005841 | Bacteria | 1283 |
| 67 | Ga0081455_10003129 | 3300005937 | Bacteria | 19259 |
| 68 | Ga0081455_10005099 | 3300005937 | Bacteria | 14491 |
| 69 | Ga0081455_10172765 | 3300005937 | Bacteria | 1644 |
| 70 | Ga0081540_1008204 | 3300005983 | Bacteria | 7315 |
| 71 | Ga0081540_1010671 | 3300005983 | Bacteria | 6197 |
| 72 | Ga0081540_1049990 | 3300005983 | Bacteria | 2081 |
| 73 | Ga0081540_1053693 | 3300005983 | Bacteria | 1974 |
| 74 | Ga0081540_1071200 | 3300005983 | Bacteria | 1608 |
| 75 | Ga0070717_10003247 | 3300006028 | Bacteria | 11623 |
| 76 | Ga0070717_10142680 | 3300006028 | Bacteria | 2067 |
| 77 | Ga0075365_10003007 | 3300006038 | Bacteria | 8543 |
| 78 | Ga0075365_10028075 | 3300006038 | Bacteria | 3587 |
| 79 | Ga0075365_10031542 | 3300006038 | Bacteria | 3400 |
| 80 | Ga0075365_10058216 | 3300006038 | Bacteria | 2572 |
| 81 | Ga0075365_10335823 | 3300006038 | Bacteria | 1065 |
| 82 | Ga0075365_10349122 | 3300006038 | Bacteria | 1043 |
| 83 | Ga0075368_10135139 | 3300006042 | Bacteria | 1026 |
| 84 | Ga0075363_100010642 | 3300006048 | Bacteria | 4378 |
| 85 | Ga0075363_100197091 | 3300006048 | Bacteria | 1150 |
| 86 | Ga0075363_100244103 | 3300006048 | Bacteria | 1033 |
| 87 | Ga0075364_10031981 | 3300006051 | Bacteria | 3380 |
| 88 | Ga0075364_10073707 | 3300006051 | Bacteria | 2250 |
| 89 | Ga0075364_10094530 | 3300006051 | Bacteria | 1986 |
| 90 | Ga0075364_10171955 | 3300006051 | Bacteria | 1465 |
| 91 | Ga0075364_10459824 | 3300006051 | Bacteria | 870 |
| 92 | Ga0070715_10000109 | 3300006163 | Bacteria | 20240 |
| 93 | Ga0070716_100043623 | 3300006173 | Bacteria | 2509 |
| 94 | Ga0070716_100173005 | 3300006173 | Bacteria | 1411 |
| 95 | Ga0070712_100008123 | 3300006175 | Bacteria | 6590 |
| 96 | Ga0070712_100011266 | 3300006175 | Bacteria | 5664 |
| 97 | Ga0070712_100117928 | 3300006175 | Bacteria | 1993 |
| 98 | Ga0070712_100167898 | 3300006175 | Bacteria | 1700 |
| 99 | Ga0075362_10013513 | 3300006177 | Bacteria | 3270 |
| 100 | Ga0075362_10049798 | 3300006177 | Bacteria | 1872 |
| 101 | Ga0075367_10074167 | 3300006178 | Bacteria | 2052 |
| 102 | Ga0075366_10010771 | 3300006195 | Bacteria | 5141 |
| 103 | Ga0075366_10233189 | 3300006195 | Bacteria | 1122 |
| 104 | Ga0075370_10053233 | 3300006353 | Bacteria | 2297 |
| 105 | Ga0075370_10120838 | 3300006353 | Bacteria | 1525 |
| 106 | Ga0075370_10331425 | 3300006353 | Bacteria | 907 |
| 107 | Ga0075428_100605634 | 3300006844 | Bacteria | 1170 |
| 108 | Ga0075428_100641465 | 3300006844 | Bacteria | 1133 |
| 109 | Ga0075428_100839863 | 3300006844 | Bacteria | 975 |
| 110 | Ga0075430_100000343 | 3300006846 | Bacteria | 33706 |
| 111 | Ga0075431_100719081 | 3300006847 | Bacteria | 975 |
| 112 | Ga0075429_100000014 | 3300006880 | Bacteria | 79603 |
| 113 | Ga0075429_100022049 | 3300006880 | Bacteria | 5524 |
| 114 | Ga0099824_1011459 | 3300006942 | Bacteria | 10029 |
| 115 | Ga0099824_1038190 | 3300006942 | Bacteria | 1292 |
| 116 | Ga0099823_1055347 | 3300006944 | Bacteria | 2252 |
| 117 | Ga0099794_10004043 | 3300007265 | Bacteria | 5703 |
| 118 | Ga0099794_10078326 | 3300007265 | Bacteria | 1627 |
| 119 | Ga0105240_10013956 | 3300009093 | Bacteria | 10999 |
| 120 | Ga0105240_10077943 | 3300009093 | Bacteria | 4082 |
| 121 | Ga0105245_10070218 | 3300009098 | Bacteria | 3178 |
| 122 | Ga0114129_10055625 | 3300009147 | Bacteria | 5545 |
| 123 | Ga0114129_10101957 | 3300009147 | Bacteria | 3970 |
| 124 | Ga0105243_10513834 | 3300009148 | Bacteria | 1138 |
| 125 | Ga0105241_10046592 | 3300009174 | Bacteria | 3293 |
| 126 | Ga0105241_10232848 | 3300009174 | Bacteria | 1553 |
| 127 | Ga0105248_10909424 | 3300009177 | Bacteria | 994 |
| 128 | Ga0105237_10036560 | 3300009545 | Bacteria | 4970 |
| 129 | Ga0105237_10071402 | 3300009545 | Bacteria | 3466 |
| 130 | Ga0105237_10337386 | 3300009545 | Bacteria | 1512 |
| 131 | Ga0105238_10197412 | 3300009551 | Bacteria | 1988 |
| 132 | Ga0105238_10378160 | 3300009551 | Bacteria | 1407 |
| 133 | Ga0105249_10461645 | 3300009553 | Bacteria | 1310 |
| 134 | Ga0099796_10012847 | 3300010159 | Bacteria | 2377 |
| 135 | Ga0099796_10191672 | 3300010159 | Bacteria | 825 |
| 136 | Ga0105239_10063317 | 3300010375 | Bacteria | 4060 |
| 137 | Ga0105239_10079841 | 3300010375 | Bacteria | 3600 |
| 138 | Ga0105239_10181918 | 3300010375 | Bacteria | 2352 |
| 139 | Ga0105239_10334669 | 3300010375 | Bacteria | 1708 |
| 140 | Ga0105239_10603116 | 3300010375 | Bacteria | 1252 |
| 141 | Ga0157370_10352394 | 3300013104 | Bacteria | 1357 |
| 142 | Ga0163162_11030991 | 3300013306 | Bacteria | 931 |
| 143 | Ga0157375_10284616 | 3300013308 | Bacteria | 1816 |
| 144 | Ga0157375_10633899 | 3300013308 | Bacteria | 1226 |
| 145 | Ga0163163_10309141 | 3300014325 | Bacteria | 1633 |
| 146 | Ga0163163_10423188 | 3300014325 | Bacteria | 1391 |
| 147 | Ga0157377_10352769 | 3300014745 | Bacteria | 987 |
| 148 | Ga0157379_10206937 | 3300014968 | Bacteria | 1775 |
| 149 | Ga0157379_10437434 | 3300014968 | Bacteria | 1206 |
| 150 | Ga0182007_10097440 | 3300015262 | Bacteria | 971 |
| 151 | Ga0213876_10004604 | 3300021384 | Bacteria | 7688 |
| 152 | Ga0207425_1032449 | 3300025245 | Bacteria | 1034 |
| 153 | Ga0209677_104344 | 3300025253 | Bacteria | 4130 |
| 154 | Ga0209148_1000334 | 3300025254 | Bacteria | 64148 |
| 155 | Ga0209455_1000787 | 3300025272 | Bacteria | 17683 |
| 156 | Ga0209673_1041175 | 3300025273 | Bacteria | 1314 |
| 157 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 158 | Ga0209758_1000224 | 3300025297 | Bacteria | 121530 |
| 159 | Ga0209758_1000692 | 3300025297 | Bacteria | 49946 |
| 160 | Ga0209758_1007793 | 3300025297 | Bacteria | 7152 |
| 161 | Ga0209758_1016910 | 3300025297 | Bacteria | 3671 |
| 162 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 163 | Ga0207426_1004020 | 3300025302 | Bacteria | 7460 |
| 164 | Ga0207426_1004845 | 3300025302 | Bacteria | 6378 |
| 165 | Ga0207426_1088282 | 3300025302 | Bacteria | 826 |
| 166 | Ga0209051_1022112 | 3300025303 | Bacteria | 2686 |
| 167 | Ga0209257_1006922 | 3300025304 | Bacteria | 7088 |
| 168 | Ga0209257_1010082 | 3300025304 | Bacteria | 4883 |
| 169 | Ga0209257_1043698 | 3300025304 | Bacteria | 1312 |
| 170 | Ga0207692_10003125 | 3300025898 | Bacteria | 6425 |
| 171 | Ga0207692_10016330 | 3300025898 | Bacteria | 3285 |
| 172 | Ga0207688_10142213 | 3300025901 | Bacteria | 1413 |
| 173 | Ga0207680_10170252 | 3300025903 | Bacteria | 1466 |
| 174 | Ga0207647_10023266 | 3300025904 | Bacteria | 4100 |
| 175 | Ga0207685_10227400 | 3300025905 | Bacteria | 891 |
| 176 | Ga0207699_10004953 | 3300025906 | Bacteria | 6368 |
| 177 | Ga0207699_10011179 | 3300025906 | Bacteria | 4524 |
| 178 | Ga0207705_10063380 | 3300025909 | Bacteria | 2671 |
| 179 | Ga0207705_10148279 | 3300025909 | Bacteria | 1756 |
| 180 | Ga0207705_10174065 | 3300025909 | Bacteria | 1622 |
| 181 | Ga0207654_10044831 | 3300025911 | Bacteria | 2514 |
| 182 | Ga0207654_10306431 | 3300025911 | Bacteria | 1082 |
| 183 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 184 | Ga0207671_10010281 | 3300025914 | Bacteria | 7736 |
| 185 | Ga0207671_10247853 | 3300025914 | Bacteria | 1400 |
| 186 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 187 | Ga0207693_10008082 | 3300025915 | Bacteria | 8629 |
| 188 | Ga0207693_10048842 | 3300025915 | Bacteria | 3323 |
| 189 | Ga0207663_10000222 | 3300025916 | Bacteria | 25394 |
| 190 | Ga0207663_10050152 | 3300025916 | Bacteria | 2593 |
| 191 | Ga0207657_10006481 | 3300025919 | Bacteria | 12130 |
| 192 | Ga0207681_10218006 | 3300025923 | Bacteria | 1475 |
| 193 | Ga0207694_10079439 | 3300025924 | Bacteria | 2573 |
| 194 | Ga0207687_10083446 | 3300025927 | Bacteria | 2313 |
| 195 | Ga0207687_10197408 | 3300025927 | Bacteria | 1570 |
| 196 | Ga0207700_10243506 | 3300025928 | Bacteria | 1534 |
| 197 | Ga0207664_10026828 | 3300025929 | Bacteria | 4359 |
| 198 | Ga0207664_10930994 | 3300025929 | Bacteria | 780 |
| 199 | Ga0207644_10420317 | 3300025931 | Bacteria | 1095 |
| 200 | Ga0207690_10245023 | 3300025932 | Bacteria | 1382 |
| 201 | Ga0207665_10000316 | 3300025939 | Bacteria | 33366 |
| 202 | Ga0207665_10069246 | 3300025939 | Bacteria | 2406 |
| 203 | Ga0207689_10356269 | 3300025942 | Bacteria | 1217 |
| 204 | Ga0207679_10206995 | 3300025945 | Bacteria | 1643 |
| 205 | Ga0207667_10331186 | 3300025949 | Bacteria | 1554 |
| 206 | Ga0207668_10197826 | 3300025972 | Bacteria | 1598 |
| 207 | Ga0207640_10622721 | 3300025981 | Bacteria | 916 |
| 208 | Ga0207658_10108908 | 3300025986 | Bacteria | 2186 |
| 209 | Ga0207677_10154418 | 3300026023 | Bacteria | 1775 |
| 210 | Ga0207677_10359139 | 3300026023 | Bacteria | 1223 |
| 211 | Ga0207678_10048854 | 3300026067 | Bacteria | 3656 |
| 212 | Ga0207678_10073742 | 3300026067 | Bacteria | 2925 |
| 213 | Ga0207678_10139094 | 3300026067 | Bacteria | 2072 |
| 214 | Ga0207678_10144836 | 3300026067 | Bacteria | 2028 |
| 215 | Ga0207641_10337148 | 3300026088 | Bacteria | 1434 |
| 216 | Ga0207676_10856197 | 3300026095 | Bacteria | 889 |
| 217 | Ga0207698_10065694 | 3300026142 | Bacteria | 2851 |
| 218 | Ga0207698_10180967 | 3300026142 | Bacteria | 1867 |
| 219 | Ga0207698_10462370 | 3300026142 | Bacteria | 1227 |
| 220 | Ga0207698_10782059 | 3300026142 | Bacteria | 955 |
| 221 | Ga0209389_1000051 | 3300027296 | Bacteria | 110364 |
| 222 | Ga0209389_1000064 | 3300027296 | Bacteria | 102177 |
| 223 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 224 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 225 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 226 | Ga0209489_102226 | 3300027361 | Bacteria | 39655 |
| 227 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 228 | Ga0209179_1004497 | 3300027512 | Bacteria | 2109 |
| 229 | Ga0209813_10033212 | 3300027866 | Bacteria | 1533 |
| 230 | Ga0209813_10162563 | 3300027866 | Bacteria | 806 |
| 231 | Ga0268266_10361233 | 3300028379 | Bacteria | 1366 |
| 232 | Ga0268265_10526921 | 3300028380 | Bacteria | 1118 |
| 233 | Ga0307517_10250461 | 3300028786 | Bacteria | 1040 |
| 234 | Ga0307515_10156561 | 3300028794 | Bacteria | 2348 |
| 235 | Ga0265332_10016245 | 3300031238 | Bacteria | 3284 |
| 236 | Ga0307408_100020929 | 3300031548 | Bacteria | 4421 |
| 237 | Ga0307408_100578190 | 3300031548 | Bacteria | 995 |
| 238 | Ga0265342_10105013 | 3300031712 | Bacteria | 1605 |
| 239 | Ga0307405_10450849 | 3300031731 | Bacteria | 1020 |
| 240 | Ga0307510_10023425 | 3300033180 | Bacteria | 7158 |
| 241 | Ga0307510_10033862 | 3300033180 | Bacteria | 5730 |
| 242 | Ga0307510_10408005 | 3300033180 | Bacteria | 801 |
| 243 | Ga0373950_0008539 | 3300034818 | Bacteria | 1615 |
| 244 | Ga0373934_0002860 | 3300035086 | Bacteria | 6318 |
| 245 | Ga0373944_0043490 | 3300035089 | Bacteria | 1396 |
| 246 | Ga0373953_0102426 | 3300035117 | Bacteria | 1206 |
| 247 | Ga0373954_0067381 | 3300035118 | Bacteria | 1696 |
| 248 | Ga0373962_0077044 | 3300035242 | Bacteria | 1006 |
| 249 | Ga0373933_0000173 | 3300035724 | Bacteria | 42306 |
| 250 | Ga0373933_0270831 | 3300035724 | Bacteria | 1096 |
| 251 | Ga0373937_0059216 | 3300036401 | Bacteria | 3520 |
| 252 | Ga0310109_024188 | 3300036534 | Bacteria | 815 |
| 253 | Ga0373925_0027030 | 3300037068 | Bacteria | 4201 |
| 254 | Ga0373925_0463033 | 3300037068 | Bacteria | 1039 |
| 255 | Ga0395899_0045464 | 3300037312 | Bacteria | 3272 |
| 256 | Ga0395899_0060576 | 3300037312 | Bacteria | 2789 |
| 257 | Ga0395899_0077138 | 3300037312 | Bacteria | 2431 |
| 258 | Ga0395899_0098584 | 3300037312 | Bacteria | 2111 |
| 259 | Ga0395900_0000696 | 3300037418 | Bacteria | 44867 |
| 260 | Ga0395900_0061239 | 3300037418 | Bacteria | 3870 |
| 261 | Ga0395900_0312439 | 3300037418 | Bacteria | 1554 |
| 262 | Ga0395900_0473814 | 3300037418 | Bacteria | 1205 |
| 263 | Ga0395898_0008381 | 3300037466 | Bacteria | 10932 |
| 264 | Ga0395898_0009029 | 3300037466 | Bacteria | 10496 |
| 265 | Ga0395898_0212991 | 3300037466 | Bacteria | 1843 |
| 266 | Ga0395898_0317064 | 3300037466 | Bacteria | 1487 |
| 267 | Ga0395905_0002558 | 3300037471 | Bacteria | 20049 |
| 268 | Ga0395905_0077822 | 3300037471 | Bacteria | 3107 |
| 269 | Ga0395901_0000688 | 3300038443 | Bacteria | 38764 |
| 270 | Ga0395901_0007034 | 3300038443 | Bacteria | 11371 |
| 271 | Ga0395901_0027392 | 3300038443 | Bacteria | 5856 |
| 272 | Ga0395901_0331349 | 3300038443 | Bacteria | 1574 |
| 273 | Ga0436365_0217850 | 3300039437 | Bacteria | 2058 |
| 274 | Ga0436365_1912827 | 3300039437 | Bacteria | 2944 |
| 275 | Ga0436360_0696150 | 3300039438 | Bacteria | 2027 |
| 276 | Ga0436361_1126767 | 3300039447 | Bacteria | 4228 |
| 277 | Ga0436363_0224061 | 3300039450 | Bacteria | 1662 |
| 278 | Ga0451795_0339562 | 3300041456 | Bacteria | 870 |
| 279 | Ga0451833_0705105 | 3300041491 | Bacteria | 1149 |
| 280 | Ga0451837_1393955 | 3300041494 | Bacteria | 820 |
| 281 | Ga0451853_2342626 | 3300041512 | Bacteria | 924 |
| 282 | Ga0466969_0035718 | 3300044656 | Bacteria | 2513 |
| 283 | Ga0466969_0103404 | 3300044656 | Bacteria | 1339 |
| 284 | Ga0466972_0000059 | 3300044658 | Bacteria | 110350 |
| 285 | Ga0466972_0128821 | 3300044658 | Bacteria | 1192 |
| 286 | Ga0466965_0009320 | 3300044683 | Bacteria | 4563 |
| 287 | Ga0466965_0013307 | 3300044683 | Bacteria | 3881 |
| 288 | Ga0466966_0000307 | 3300044684 | Bacteria | 31630 |
| 289 | Ga0466961_0000019 | 3300044693 | Bacteria | 107624 |
| 290 | Ga0466963_0048239 | 3300044694 | Bacteria | 2813 |
| 291 | Ga0466964_0124325 | 3300044706 | Bacteria | 1167 |
| 292 | Ga0466968_0121861 | 3300044735 | Bacteria | 1180 |
| 293 | Ga0466960_0115953 | 3300044901 | Bacteria | 1397 |
| 294 | Ga0466959_0179332 | 3300045049 | Bacteria | 1482 |
| 295 | Ga0466959_0593337 | 3300045049 | Bacteria | 745 |
| 296 | Ga0466958_0404400 | 3300045836 | Bacteria | 881 |
| 297 | Ga0466967_0041692 | 3300045976 | Bacteria | 3960 |
| 298 | Ga0466967_0412536 | 3300045976 | Bacteria | 1315 |
| 299 | Ga0495592_0020048 | 3300046454 | Bacteria | 5084 |
| 300 | Ga0495592_0349585 | 3300046454 | Bacteria | 948 |
| 301 | Ga0495603_0022781 | 3300046455 | Bacteria | 3790 |
| 302 | Ga0495603_0299061 | 3300046455 | Bacteria | 924 |
| 303 | Ga0495629_0028818 | 3300046459 | Bacteria | 3941 |
| 304 | Ga0495638_0053712 | 3300046460 | Bacteria | 2507 |
| 305 | Ga0495638_0074116 | 3300046460 | Bacteria | 2076 |
| 306 | Ga0495638_0083181 | 3300046460 | Bacteria | 1939 |
| 307 | Ga0495651_0005167 | 3300046462 | Bacteria | 9956 |
| 308 | Ga0495651_0181099 | 3300046462 | Bacteria | 1491 |
| 309 | Ga0495653_0029583 | 3300046463 | Bacteria | 4371 |
| 310 | Ga0495580_0246803 | 3300046472 | Bacteria | 1223 |
| 311 | Ga0495582_0093657 | 3300046473 | Bacteria | 1677 |
| 312 | Ga0495605_0118126 | 3300046474 | Bacteria | 1204 |
| 313 | Ga0495664_0045743 | 3300046477 | Bacteria | 2596 |
| 314 | Ga0495664_0073297 | 3300046477 | Bacteria | 2047 |
| 315 | Ga0495664_0152881 | 3300046477 | Bacteria | 1400 |
| 316 | Ga0495664_0331665 | 3300046477 | Bacteria | 917 |
| 317 | Ga0495594_0173227 | 3300046499 | Bacteria | 1228 |
| 318 | Ga0495596_0054926 | 3300046500 | Bacteria | 1557 |
| 319 | Ga0495607_0017436 | 3300046501 | Bacteria | 4609 |
| 320 | Ga0495583_0091173 | 3300046506 | Bacteria | 1312 |
| 321 | Ga0495606_0156206 | 3300046507 | Bacteria | 1334 |
| 322 | Ga0495608_0038509 | 3300046511 | Bacteria | 3210 |
| 323 | Ga0495616_0034692 | 3300046513 | Bacteria | 2617 |
| 324 | Ga0495616_0160150 | 3300046513 | Bacteria | 1013 |
| 325 | Ga0495620_0019743 | 3300046515 | Bacteria | 3307 |
| 326 | Ga0495620_0148935 | 3300046515 | Bacteria | 913 |
| 327 | Ga0495628_0025666 | 3300046516 | Bacteria | 4813 |
| 328 | Ga0495628_0247814 | 3300046516 | Bacteria | 1331 |
| 329 | Ga0495631_0181266 | 3300046518 | Bacteria | 902 |
| 330 | Ga0495643_0050132 | 3300046522 | Bacteria | 2249 |
| 331 | Ga0495648_0101195 | 3300046524 | Bacteria | 1590 |
| 332 | Ga0495648_0128999 | 3300046524 | Bacteria | 1347 |
| 333 | Ga0495648_0193983 | 3300046524 | Bacteria | 1022 |
| 334 | Ga0495652_0065462 | 3300046529 | Bacteria | 3053 |
| 335 | Ga0495652_0559335 | 3300046529 | Bacteria | 785 |
| 336 | Ga0495640_0035646 | 3300046533 | Bacteria | 3520 |
| 337 | Ga0495587_0008436 | 3300046536 | Bacteria | 6623 |
| 338 | Ga0495587_0129269 | 3300046536 | Bacteria | 1444 |
| 339 | Ga0495597_0025930 | 3300046542 | Bacteria | 2695 |
| 340 | Ga0495645_0016780 | 3300046543 | Bacteria | 5239 |
| 341 | Ga0495622_0048778 | 3300046557 | Bacteria | 1966 |
| 342 | Ga0495622_0081259 | 3300046557 | Bacteria | 1491 |
| 343 | Ga0495667_0011636 | 3300046559 | Bacteria | 5957 |
| 344 | Ga0495668_0134936 | 3300046616 | Bacteria | 1351 |
| 345 | Ga0495668_0366170 | 3300046616 | Bacteria | 791 |
| 346 | Ga0495634_0080297 | 3300046642 | Bacteria | 2135 |
| 347 | Ga0495611_0181533 | 3300046648 | Bacteria | 983 |
| 348 | Ga0495625_0038899 | 3300046660 | Bacteria | 3477 |
| 349 | Ga0495635_0204809 | 3300046663 | Bacteria | 1337 |
| 350 | Ga0495588_0015817 | 3300046674 | Bacteria | 3638 |
| 351 | Ga0495657_0008544 | 3300046675 | Bacteria | 7822 |
| 352 | Ga0495657_0028573 | 3300046675 | Bacteria | 3920 |
| 353 | Ga0495599_0016179 | 3300046678 | Bacteria | 4629 |
| 354 | Ga0495623_0020193 | 3300046679 | Bacteria | 4305 |
| 355 | Ga0495623_0220248 | 3300046679 | Bacteria | 1082 |
| 356 | Ga0495646_0027979 | 3300046680 | Bacteria | 3533 |
| 357 | Ga0495646_0101626 | 3300046680 | Bacteria | 1648 |
| 358 | Ga0495613_0023721 | 3300046689 | Bacteria | 4572 |
| 359 | Ga0495613_0058263 | 3300046689 | Bacteria | 2835 |
| 360 | Ga0495624_0014534 | 3300046690 | Bacteria | 5339 |
| 361 | Ga0495670_0048007 | 3300046691 | Bacteria | 2135 |
| 362 | Ga0495649_0056877 | 3300046694 | Bacteria | 2110 |
| 363 | Ga0495589_0236348 | 3300046794 | Bacteria | 856 |
| 364 | Ga0495600_0001422 | 3300046809 | Bacteria | 13229 |
| 365 | Ga0495600_0040341 | 3300046809 | Bacteria | 3040 |
| 366 | Ga0495660_0160016 | 3300046810 | Bacteria | 1105 |
| 367 | Ga0495581_0011351 | 3300047315 | Bacteria | 5155 |
| 368 | Ga0495581_0103423 | 3300047315 | Bacteria | 1655 |
| 369 | Ga0495604_0006103 | 3300047317 | Bacteria | 9562 |
| 370 | Ga0495604_0006283 | 3300047317 | Bacteria | 9428 |
| 371 | Ga0495674_0032580 | 3300047319 | Bacteria | 4727 |
| 372 | Ga0495676_0017179 | 3300047321 | Bacteria | 6403 |
| 373 | Ga0495676_0396742 | 3300047321 | Bacteria | 916 |
| 374 | Ga0495680_0010380 | 3300047322 | Bacteria | 8312 |
| 375 | Ga0495683_0076522 | 3300047323 | Bacteria | 1637 |
| 376 | Ga0495683_0103183 | 3300047323 | Bacteria | 1369 |
| 377 | Ga0495687_009999 | 3300047443 | Bacteria | 5243 |
| 378 | Ga0495687_020238 | 3300047443 | Bacteria | 3246 |
| 379 | Ga0495675_0072871 | 3300047444 | Bacteria | 2166 |
| 380 | Ga0495684_0014418 | 3300047471 | Bacteria | 6081 |
| 381 | Ga0495686_0028205 | 3300047472 | Bacteria | 3657 |
| 382 | Ga0495686_0038212 | 3300047472 | Bacteria | 3071 |
| 383 | Ga0495686_0060394 | 3300047472 | Bacteria | 2356 |
| 384 | Ga0495686_0096140 | 3300047472 | Bacteria | 1793 |
| 385 | Ga0495686_0269968 | 3300047472 | Bacteria | 949 |
| 386 | Ga0495686_0345848 | 3300047472 | Bacteria | 809 |
| 387 | Ga0495602_0016855 | 3300048088 | Bacteria | 7334 |
| 388 | Ga0495602_0632284 | 3300048088 | Bacteria | 733 |
| 389 | Ga0495626_0074453 | 3300048091 | Bacteria | 1519 |
| 390 | Ga0495626_0158636 | 3300048091 | Bacteria | 950 |
| 391 | Ga0496100_0092496 | 3300048903 | Bacteria | 2067 |
| 392 | Ga0496101_0148957 | 3300048904 | Bacteria | 1789 |
| 393 | Ga0496102_0489565 | 3300048905 | Bacteria | 1151 |
| 394 | Ga0496103_0002964 | 3300048906 | Bacteria | 10507 |
| 395 | Ga0496103_0138332 | 3300048906 | Bacteria | 1557 |
| 396 | Ga0496104_0011823 | 3300048907 | Bacteria | 7832 |
| 397 | Ga0496104_0186778 | 3300048907 | Bacteria | 1983 |
| 398 | Ga0496104_0328877 | 3300048907 | Bacteria | 1441 |
| 399 | Ga0496105_0019349 | 3300048908 | Bacteria | 5491 |
| 400 | Ga0496105_0090512 | 3300048908 | Bacteria | 2527 |
| 401 | Ga0496105_0341882 | 3300048908 | Bacteria | 1196 |
| 402 | Ga0496106_0099941 | 3300048909 | Bacteria | 2249 |
| 403 | Ga0496106_0866678 | 3300048909 | Bacteria | 714 |
| 404 | Ga0496108_0318125 | 3300048911 | Bacteria | 1357 |
| 405 | Ga0496110_0186371 | 3300048913 | Bacteria | 1884 |
| 406 | Ga0496111_0025336 | 3300048914 | Bacteria | 4186 |
| 407 | Ga0496112_0139058 | 3300048915 | Bacteria | 2398 |
| 408 | Ga0496112_0287165 | 3300048915 | Bacteria | 1591 |
| 409 | Ga0496113_0261166 | 3300048916 | Bacteria | 1383 |
| 410 | Ga0496113_0324375 | 3300048916 | Bacteria | 1234 |
| 411 | Ga0496113_0562603 | 3300048916 | Bacteria | 914 |
| 412 | Ga0496115_0025835 | 3300048918 | Bacteria | 4577 |
| 413 | Ga0496115_0242677 | 3300048918 | Bacteria | 1485 |
| 414 | Ga0496115_0386964 | 3300048918 | Bacteria | 1136 |
| 415 | Ga0496116_0005246 | 3300048919 | Bacteria | 12113 |
| 416 | Ga0496117_0027983 | 3300048920 | Bacteria | 4372 |
| 417 | Ga0496118_0030470 | 3300048921 | Bacteria | 4501 |
| 418 | Ga0496118_0038317 | 3300048921 | Bacteria | 3844 |
| 419 | Ga0496118_0046352 | 3300048921 | Bacteria | 3383 |
| 420 | Ga0496119_0012146 | 3300048922 | Bacteria | 7030 |
| 421 | Ga0496119_0056994 | 3300048922 | Bacteria | 2364 |
| 422 | Ga0496119_0094486 | 3300048922 | Bacteria | 1691 |
| 423 | Ga0496119_0142289 | 3300048922 | Bacteria | 1294 |
| 424 | Ga0496120_0024913 | 3300048923 | Bacteria | 3723 |
| 425 | Ga0496120_0075570 | 3300048923 | Bacteria | 1838 |
| 426 | Ga0496120_0129555 | 3300048923 | Bacteria | 1294 |
| 427 | Ga0496121_0002503 | 3300048924 | Bacteria | 27924 |
| 428 | Ga0496121_0009424 | 3300048924 | Bacteria | 11225 |
| 429 | Ga0496121_0044951 | 3300048924 | Bacteria | 3802 |
| 430 | Ga0496121_0082040 | 3300048924 | Bacteria | 2550 |
| 431 | Ga0496121_0364213 | 3300048924 | Bacteria | 959 |
| 432 | Ga0496122_0033320 | 3300048925 | Bacteria | 4240 |
| 433 | Ga0496122_0071910 | 3300048925 | Bacteria | 2462 |
| 434 | Ga0496122_0177122 | 3300048925 | Bacteria | 1277 |
| 435 | Ga0496123_0023676 | 3300048926 | Bacteria | 4693 |
| 436 | Ga0496123_0067667 | 3300048926 | Bacteria | 2254 |
| 437 | Ga0496123_0133297 | 3300048926 | Bacteria | 1372 |
| 438 | Ga0496124_0058566 | 3300048927 | Bacteria | 3239 |
| 439 | Ga0496124_0146701 | 3300048927 | Bacteria | 1856 |
| 440 | Ga0496124_0201280 | 3300048927 | Bacteria | 1514 |
| 441 | Ga0496124_0220903 | 3300048927 | Bacteria | 1425 |
| 442 | Ga0496125_0000398 | 3300048928 | Bacteria | 81112 |
| 443 | Ga0496125_0004399 | 3300048928 | Bacteria | 16305 |
| 444 | Ga0496125_0009727 | 3300048928 | Bacteria | 9817 |
| 445 | Ga0496125_0121204 | 3300048928 | Bacteria | 1865 |
| 446 | Ga0496125_0142854 | 3300048928 | Bacteria | 1661 |
| 447 | Ga0496126_0003241 | 3300048929 | Bacteria | 20805 |
| 448 | Ga0496126_0007757 | 3300048929 | Bacteria | 11698 |
| 449 | Ga0496126_0020992 | 3300048929 | Bacteria | 6391 |
| 450 | Ga0496126_0039870 | 3300048929 | Bacteria | 4355 |
| 451 | Ga0496126_0041384 | 3300048929 | Bacteria | 4264 |
| 452 | Ga0496126_0135121 | 3300048929 | Bacteria | 2128 |
| 453 | Ga0496126_0163053 | 3300048929 | Bacteria | 1904 |
| 454 | Ga0496126_0282974 | 3300048929 | Bacteria | 1373 |
| 455 | Ga0496126_0312080 | 3300048929 | Bacteria | 1294 |
| 456 | Ga0496126_0462381 | 3300048929 | Bacteria | 1019 |
| 457 | Ga0496126_0651959 | 3300048929 | Bacteria | 823 |
| 458 | Ga0501031_0045037 | 3300049568 | Bacteria | 2879 |
| 459 | Ga0501031_0132018 | 3300049568 | Bacteria | 1631 |
| 460 | Ga0501032_0295519 | 3300049569 | Bacteria | 1047 |
| 461 | Ga0501033_0025424 | 3300049570 | Bacteria | 4461 |
| 462 | Ga0501033_0029630 | 3300049570 | Bacteria | 4113 |
| 463 | Ga0501033_0054593 | 3300049570 | Bacteria | 2955 |
| 464 | Ga0501033_0055615 | 3300049570 | Bacteria | 2926 |
| 465 | Ga0501034_0220436 | 3300049571 | Bacteria | 1849 |
| 466 | Ga0501034_0231809 | 3300049571 | Bacteria | 1795 |
| 467 | Ga0501034_0352834 | 3300049571 | Bacteria | 1399 |
| 468 | Ga0501034_0477484 | 3300049571 | Bacteria | 1162 |
| 469 | Ga0501036_0040405 | 3300049572 | Bacteria | 3945 |
| 470 | Ga0501036_0063511 | 3300049572 | Bacteria | 3126 |
| 471 | Ga0501037_0064363 | 3300049573 | Bacteria | 2672 |
| 472 | Ga0501037_0072169 | 3300049573 | Bacteria | 2511 |
| 473 | Ga0501037_0127352 | 3300049573 | Bacteria | 1827 |
| 474 | Ga0501038_0004453 | 3300049574 | Bacteria | 13020 |
| 475 | Ga0501038_0069403 | 3300049574 | Bacteria | 2994 |
| 476 | Ga0501038_0256777 | 3300049574 | Bacteria | 1382 |
| 477 | Ga0501038_0740997 | 3300049574 | Bacteria | 733 |
| 478 | Ga0501039_0251179 | 3300049575 | Bacteria | 1390 |
| 479 | Ga0501039_0364939 | 3300049575 | Bacteria | 1134 |
| 480 | Ga0501043_0005382 | 3300049579 | Bacteria | 10337 |
| 481 | Ga0501043_0044939 | 3300049579 | Bacteria | 3474 |
| 482 | Ga0501043_0241646 | 3300049579 | Bacteria | 1392 |
| 483 | Ga0501043_0266432 | 3300049579 | Bacteria | 1316 |
| 484 | Ga0501046_0012839 | 3300049580 | Bacteria | 7124 |
| 485 | Ga0501046_0036217 | 3300049580 | Bacteria | 3973 |
| 486 | Ga0501047_0023211 | 3300049581 | Bacteria | 5956 |
| 487 | Ga0501047_0165409 | 3300049581 | Bacteria | 2082 |
| 488 | Ga0501047_0183872 | 3300049581 | Bacteria | 1956 |
| 489 | Ga0501047_0253123 | 3300049581 | Bacteria | 1609 |
| 490 | Ga0501047_0263994 | 3300049581 | Bacteria | 1569 |
| 491 | Ga0501047_0315296 | 3300049581 | Bacteria | 1404 |
| 492 | Ga0501048_0016045 | 3300049582 | Bacteria | 5524 |
| 493 | Ga0501070_0127813 | 3300049586 | Bacteria | 2100 |
| 494 | Ga0501070_0285000 | 3300049586 | Bacteria | 1347 |
| 495 | Ga0501073_0449453 | 3300049589 | Bacteria | 891 |
| 496 | Ga0501079_0456727 | 3300049741 | Bacteria | 1003 |
| 497 | Ga0501080_0051614 | 3300049742 | Bacteria | 3827 |
| 498 | Ga0501080_0079803 | 3300049742 | Bacteria | 3042 |
| 499 | Ga0501035_0050067 | 3300049822 | Bacteria | 3744 |
| 500 | Ga0501035_0061642 | 3300049822 | Bacteria | 3338 |
| 501 | Ga0501035_0077755 | 3300049822 | Bacteria | 2932 |
| 502 | Ga0501035_0122926 | 3300049822 | Bacteria | 2267 |
| 503 | Ga0501035_0183198 | 3300049822 | Bacteria | 1803 |
| 504 | Ga0501044_0002617 | 3300049823 | Bacteria | 20451 |
| 505 | Ga0501044_0007879 | 3300049823 | Bacteria | 11709 |
| 506 | Ga0501044_0009525 | 3300049823 | Bacteria | 10574 |
| 507 | Ga0501044_0034204 | 3300049823 | Bacteria | 5332 |
| 508 | Ga0501044_0052414 | 3300049823 | Bacteria | 4204 |
| 509 | Ga0501044_0075196 | 3300049823 | Bacteria | 3429 |
| 510 | Ga0501044_0118516 | 3300049823 | Bacteria | 2650 |
| 511 | Ga0501044_0238966 | 3300049823 | Bacteria | 1761 |
| 512 | Ga0501044_0272752 | 3300049823 | Bacteria | 1627 |
| 513 | Ga0501044_0404330 | 3300049823 | Bacteria | 1277 |
| 514 | nmdc:mga03683_74374_c1 | 3300050489 | Bacteria | 1457 |
| 515 | nmdc:mga03n38_111393_c1 | 3300050490 | Bacteria | 1333 |
| 516 | nmdc:mga03n38_204226_c1 | 3300050490 | Bacteria | 1024 |
| 517 | nmdc:mga03n38_3019_c1 | 3300050490 | Bacteria | 5331 |
| 518 | nmdc:mga00v17_29286_c1 | 3300050491 | Bacteria | 3231 |
| 519 | nmdc:mga00v17_424279_c1 | 3300050491 | Bacteria | 864 |
| 520 | nmdc:mga00v17_82252_c1 | 3300050491 | Bacteria | 2012 |
| 521 | nmdc:mga0yw44_100757_c1 | 3300050492 | Bacteria | 1840 |
| 522 | nmdc:mga0yw44_128862_c1 | 3300050492 | Bacteria | 1636 |
| 523 | nmdc:mga0yw44_218233_c2 | 3300050492 | Bacteria | 951 |
| 524 | nmdc:mga0yw44_292730_c1 | 3300050492 | Bacteria | 1090 |
| 525 | nmdc:mga0yw44_386378_c1 | 3300050492 | Bacteria | 945 |
| 526 | nmdc:mga0yw44_45427_c1 | 3300050492 | Bacteria | 2633 |
| 527 | nmdc:mga0yw44_70594_c1 | 3300050492 | Bacteria | 2166 |
| 528 | nmdc:mga0k408_219068_c1 | 3300050493 | Bacteria | 1136 |
| 529 | nmdc:mga0k408_6697_c1 | 3300050493 | Bacteria | 6141 |
| 530 | nmdc:mga06z11_160979_c1 | 3300050494 | Bacteria | 1283 |
| 531 | nmdc:mga06z11_22732_c1 | 3300050494 | Bacteria | 2934 |
| 532 | nmdc:mga06z11_291154_c1 | 3300050494 | Bacteria | 969 |
| 533 | nmdc:mga06z11_53578_c1 | 3300050494 | Bacteria | 2075 |
| 534 | nmdc:mga06z11_60407_c1 | 3300050494 | Bacteria | 1973 |
| 535 | nmdc:mga04h51_161773_c1 | 3300050495 | Bacteria | 862 |
| 536 | nmdc:mga07m45_124902_c1 | 3300050496 | Bacteria | 1488 |
| 537 | nmdc:mga07m45_19585_c1 | 3300050496 | Bacteria | 3668 |
| 538 | nmdc:mga07m45_218943_c1 | 3300050496 | Bacteria | 1107 |
| 539 | nmdc:mga07m45_27605_c1 | 3300050496 | Bacteria | 3128 |
| 540 | nmdc:mga07m45_34927_c1 | 3300050496 | Bacteria | 2795 |
| 541 | nmdc:mga05p37_174021_c1 | 3300050507 | Bacteria | 2624 |
| 542 | nmdc:mga05p37_240581_c1 | 3300050507 | Bacteria | 2177 |
| 543 | nmdc:mga09592_30553_c1 | 3300050508 | Bacteria | 4483 |
| 544 | nmdc:mga09592_4123_c1 | 3300050508 | Bacteria | 11741 |
| 545 | nmdc:mga0qj67_257_c1 | 3300050509 | Bacteria | 36250 |
| 546 | nmdc:mga06r32_9197_c1 | 3300050510 | Bacteria | 8907 |
| 547 | nmdc:mga0n895_150416_c1 | 3300050512 | Bacteria | 2358 |
| 548 | nmdc:mga0n895_195018_c1 | 3300050512 | Bacteria | 2056 |
| 549 | nmdc:mga0a205_86915_c1 | 3300050515 | Bacteria | 3020 |
| 550 | nmdc:mga0sz30_73294_c1 | 3300050516 | Bacteria | 1476 |
| 551 | Ga0495601_0033060 | 3300053077 | Bacteria | 3222 |
| 552 | Ga0495601_0506956 | 3300053077 | Bacteria | 778 |
| 553 | Ga0495612_0217938 | 3300053078 | Bacteria | 844 |
| 554 | Ga0500635_0027829 | 3300053080 | Bacteria | 1800 |
| 555 | Ga0500635_0106737 | 3300053080 | Bacteria | 1036 |
| 556 | Ga0495655_0086886 | 3300053083 | Bacteria | 904 |
| 557 | Ga0495619_0114415 | 3300053085 | Bacteria | 1846 |
| 558 | Ga0500578_0388521 | 3300053086 | Bacteria | 807 |
| 559 | Ga0500643_000163 | 3300053087 | Bacteria | 66676 |
| 560 | Ga0500644_0200910 | 3300053088 | Bacteria | 824 |
| 561 | Ga0500646_0016674 | 3300053090 | Bacteria | 1920 |
| 562 | Ga0500646_0019969 | 3300053090 | Bacteria | 1776 |
| 563 | Ga0500647_0041005 | 3300053091 | Bacteria | 2221 |
| 564 | Ga0500651_0013593 | 3300053093 | Bacteria | 4963 |
| 565 | Ga0500651_0372351 | 3300053093 | Bacteria | 807 |
| 566 | Ga0500566_0000224 | 3300053094 | Bacteria | 30350 |
| 567 | Ga0500566_0001842 | 3300053094 | Bacteria | 12474 |
| 568 | Ga0500566_0134777 | 3300053094 | Bacteria | 1317 |
| 569 | Ga0500640_022067 | 3300053095 | Bacteria | 2749 |
| 570 | Ga0500555_000884 | 3300053103 | Bacteria | 10656 |
| 571 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 572 | Ga0500556_0103283 | 3300053104 | Bacteria | 1099 |
| 573 | Ga0500556_0114936 | 3300053104 | Bacteria | 1046 |
| 574 | Ga0500557_000051 | 3300053105 | Bacteria | 51214 |
| 575 | Ga0500557_136894 | 3300053105 | Bacteria | 810 |
| 576 | Ga0500569_025542 | 3300053109 | Bacteria | 1609 |
| 577 | Ga0500572_147906 | 3300053111 | Bacteria | 766 |
| 578 | Ga0500592_010930 | 3300053116 | Bacteria | 1449 |
| 579 | Ga0500595_001454 | 3300053119 | Bacteria | 12621 |
| 580 | Ga0500595_002517 | 3300053119 | Bacteria | 9047 |
| 581 | Ga0500595_025410 | 3300053119 | Bacteria | 2053 |
| 582 | Ga0500607_094992 | 3300053121 | Bacteria | 1492 |
| 583 | Ga0500607_158935 | 3300053121 | Bacteria | 1035 |
| 584 | Ga0500608_046176 | 3300053122 | Bacteria | 2092 |
| 585 | Ga0500608_046742 | 3300053122 | Bacteria | 2079 |
| 586 | Ga0500618_017773 | 3300053125 | Bacteria | 1766 |
| 587 | Ga0500621_186776 | 3300053126 | Bacteria | 746 |
| 588 | Ga0500642_0000055 | 3300053130 | Bacteria | 68809 |
| 589 | Ga0500642_0000117 | 3300053130 | Bacteria | 36211 |
| 590 | Ga0500652_000373 | 3300053131 | Bacteria | 16097 |
| 591 | Ga0500655_026635 | 3300053133 | Bacteria | 1101 |
| 592 | Ga0500658_0070331 | 3300053134 | Bacteria | 1475 |
| 593 | Ga0500559_0000268 | 3300053136 | Bacteria | 40472 |
| 594 | Ga0500559_0011309 | 3300053136 | Bacteria | 3814 |
| 595 | Ga0500559_0028889 | 3300053136 | Bacteria | 2371 |
| 596 | Ga0500564_106525 | 3300053138 | Bacteria | 1234 |
| 597 | Ga0500568_0004979 | 3300053139 | Bacteria | 6968 |
| 598 | Ga0500568_0019783 | 3300053139 | Bacteria | 2919 |
| 599 | Ga0500568_0136082 | 3300053139 | Bacteria | 912 |
| 600 | Ga0500577_0073150 | 3300053142 | Bacteria | 1349 |
| 601 | Ga0500577_0075168 | 3300053142 | Bacteria | 1334 |
| 602 | Ga0500586_006324 | 3300053145 | Bacteria | 3069 |
| 603 | Ga0500588_0050955 | 3300053146 | Bacteria | 1290 |
| 604 | Ga0500589_106367 | 3300053147 | Bacteria | 1211 |
| 605 | Ga0500590_025050 | 3300053148 | Bacteria | 3097 |
| 606 | Ga0500603_000204 | 3300053150 | Bacteria | 15582 |
| 607 | Ga0500604_0017960 | 3300053151 | Bacteria | 1965 |
| 608 | Ga0500604_0028984 | 3300053151 | Bacteria | 1610 |
| 609 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 610 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 611 | Ga0500619_127736 | 3300053154 | Bacteria | 866 |
| 612 | Ga0500622_0016210 | 3300053156 | Bacteria | 3983 |
| 613 | Ga0500622_0068137 | 3300053156 | Bacteria | 1803 |
| 614 | Ga0500627_0054862 | 3300053158 | Bacteria | 1743 |
| 615 | Ga0500633_0010105 | 3300053160 | Bacteria | 2510 |
| 616 | Ga0500633_0039689 | 3300053160 | Bacteria | 1575 |
| 617 | Ga0500634_0022109 | 3300053161 | Bacteria | 3449 |
| 618 | Ga0500636_0001663 | 3300053177 | Bacteria | 12175 |
| 619 | Ga0500636_0008037 | 3300053177 | Bacteria | 6104 |
| 620 | Ga0500636_0135817 | 3300053177 | Bacteria | 1366 |
| 621 | Ga0500637_0000531 | 3300053178 | Bacteria | 14845 |
| 622 | Ga0500649_118707 | 3300053722 | Bacteria | 1012 |
| 623 | Ga0500625_015823 | 3300053729 | Bacteria | 3504 |
| 624 | Ga0500645_055614 | 3300053730 | Bacteria | 1149 |
| 625 | Ga0500645_056543 | 3300053730 | Bacteria | 1138 |
| 626 | Ga0500601_000760 | 3300053737 | Bacteria | 4166 |
| 627 | Ga0501082_0413245 | 3300060353 | Bacteria | 1178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016630954 | 8016636016 | 185 |
| 2 | 3300049573 | Ga0501037_0127352 | Ga0501037_0127352_1177_1740 | 186 |
| 3 | 3300037466 | Ga0395898_0008381 | Ga0395898_0008381_5585_6193 | 187 |
| 4 | 3300038443 | Ga0395901_0000688 | Ga0395901_0000688_23545_24153 | 187 |
| 5 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_196234_196932 | 193 |
| 6 | 3300053139 | Ga0500568_0136082 | Ga0500568_0136082_18_599 | 193 |
| 7 | iso_pu_bacteria | 8019638758 | 8019640131 | 193 |
| 8 | 3300048916 | Ga0496113_0562603 | Ga0496113_0562603_273_860 | 195 |
| 9 | 3300049574 | Ga0501038_0740997 | Ga0501038_0740997_31_705 | 196 |
| 10 | 3300049579 | Ga0501043_0044939 | Ga0501043_0044939_494_1168 | 196 |
| 11 | 3300049580 | Ga0501046_0012839 | Ga0501046_0012839_1375_2049 | 196 |
| 12 | 3300049589 | Ga0501073_0449453 | Ga0501073_0449453_33_707 | 196 |
| 13 | 3300049742 | Ga0501080_0079803 | Ga0501080_0079803_1262_1936 | 196 |
| 14 | 3300049822 | Ga0501035_0122926 | Ga0501035_0122926_868_1542 | 196 |
| 15 | 3300049823 | Ga0501044_0002617 | Ga0501044_0002617_15508_16182 | 196 |
| 16 | 3300003215 | JGI25153J46596_10003534 | JGI25153J46596_100035347 | 199 |
| 17 | 3300006844 | Ga0075428_100839863 | Ga0075428_1008398632 | 199 |
| 18 | 3300006846 | Ga0075430_100000343 | Ga0075430_10000034326 | 199 |
| 19 | 3300006847 | Ga0075431_100719081 | Ga0075431_1007190812 | 199 |
| 20 | 3300006880 | Ga0075429_100000014 | Ga0075429_10000001465 | 199 |
| 21 | 3300009147 | Ga0114129_10055625 | Ga0114129_100556253 | 199 |
| 22 | 3300025297 | Ga0209758_1000224 | Ga0209758_10002247 | 199 |
| 23 | 3300050507 | nmdc:mga05p37_174021_c1 | nmdc:mga05p37_174021_c1_1247_1879 | 199 |
| 24 | 3300050508 | nmdc:mga09592_4123_c1 | nmdc:mga09592_4123_c1_273_905 | 199 |
| 25 | 3300050509 | nmdc:mga0qj67_257_c1 | nmdc:mga0qj67_257_c1_2014_2646 | 199 |
| 26 | 3300050510 | nmdc:mga06r32_9197_c1 | nmdc:mga06r32_9197_c1_4886_5518 | 199 |
| 27 | 3300026067 | Ga0207678_10048854 | Ga0207678_100488543 | 202 |
| 28 | 3300046460 | Ga0495638_0083181 | Ga0495638_0083181_604_1302 | 202 |
| 29 | 3300046506 | Ga0495583_0091173 | Ga0495583_0091173_478_1176 | 202 |
| 30 | 3300046518 | Ga0495631_0181266 | Ga0495631_0181266_117_815 | 202 |
| 31 | 3300046524 | Ga0495648_0128999 | Ga0495648_0128999_327_1025 | 202 |
| 32 | 3300046616 | Ga0495668_0134936 | Ga0495668_0134936_127_825 | 202 |
| 33 | 3300046691 | Ga0495670_0048007 | Ga0495670_0048007_846_1544 | 202 |
| 34 | 3300047472 | Ga0495686_0028205 | Ga0495686_0028205_1170_1868 | 202 |
| 35 | 3300048923 | Ga0496120_0024913 | Ga0496120_0024913_1377_2075 | 202 |
| 36 | 3300048924 | Ga0496121_0082040 | Ga0496121_0082040_1473_2171 | 202 |
| 37 | 3300048925 | Ga0496122_0177122 | Ga0496122_0177122_30_728 | 202 |
| 38 | 3300048926 | Ga0496123_0067667 | Ga0496123_0067667_1138_1836 | 202 |
| 39 | 3300048928 | Ga0496125_0004399 | Ga0496125_0004399_11270_11968 | 202 |
| 40 | 3300048929 | Ga0496126_0312080 | Ga0496126_0312080_356_1054 | 202 |
| 41 | 3300053090 | Ga0500646_0016674 | Ga0500646_0016674_965_1663 | 202 |
| 42 | 3300053093 | Ga0500651_0013593 | Ga0500651_0013593_507_1205 | 202 |
| 43 | 3300053105 | Ga0500557_136894 | Ga0500557_136894_82_780 | 202 |
| 44 | 3300053116 | Ga0500592_010930 | Ga0500592_010930_667_1365 | 202 |
| 45 | 3300053130 | Ga0500642_0000055 | Ga0500642_0000055_41159_41857 | 202 |
| 46 | 3300053131 | Ga0500652_000373 | Ga0500652_000373_3236_3934 | 202 |
| 47 | 3300053142 | Ga0500577_0073150 | Ga0500577_0073150_123_821 | 202 |
| 48 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_187330_188028 | 202 |
| 49 | 3300053156 | Ga0500622_0068137 | Ga0500622_0068137_96_794 | 202 |
| 50 | 3300053160 | Ga0500633_0039689 | Ga0500633_0039689_519_1217 | 202 |
| 51 | 3300053161 | Ga0500634_0022109 | Ga0500634_0022109_1731_2429 | 202 |
| 52 | 3300053730 | Ga0500645_055614 | Ga0500645_055614_57_755 | 202 |
| 53 | 3300006844 | Ga0075428_100605634 | Ga0075428_1006056342 | 208 |
| 54 | 3300006880 | Ga0075429_100022049 | Ga0075429_1000220494 | 208 |
| 55 | 3300037312 | Ga0395899_0077138 | Ga0395899_0077138_1423_2094 | 208 |
| 56 | 3300037418 | Ga0395900_0473814 | Ga0395900_0473814_413_1084 | 208 |
| 57 | 3300050507 | nmdc:mga05p37_240581_c1 | nmdc:mga05p37_240581_c1_536_1207 | 208 |
| 58 | 3300050508 | nmdc:mga09592_30553_c1 | nmdc:mga09592_30553_c1_974_1645 | 208 |
| 59 | 3300050512 | nmdc:mga0n895_195018_c1 | nmdc:mga0n895_195018_c1_656_1327 | 208 |
| 60 | 3300050515 | nmdc:mga0a205_86915_c1 | nmdc:mga0a205_86915_c1_1759_2430 | 208 |
| 61 | iso_pu_bacteria | 2849076700 | 2849082742 | 208 |
| 62 | 3300009147 | Ga0114129_10101957 | Ga0114129_101019572 | 209 |
| 63 | 3300025931 | Ga0207644_10420317 | Ga0207644_104203171 | 209 |
| 64 | 3300049823 | Ga0501044_0118516 | Ga0501044_0118516_27_674 | 209 |
| 65 | 3300053088 | Ga0500644_0200910 | Ga0500644_0200910_17_646 | 209 |
| 66 | 3300006844 | Ga0075428_100641465 | Ga0075428_1006414652 | 211 |
| 67 | 3300046648 | Ga0495611_0181533 | Ga0495611_0181533_20_661 | 211 |
| 68 | 3300048929 | Ga0496126_0003241 | Ga0496126_0003241_43_678 | 211 |
| 69 | 3300048929 | Ga0496126_0651959 | Ga0496126_0651959_13_654 | 211 |
| 70 | 3300010159 | Ga0099796_10191672 | Ga0099796_101916721 | 212 |
| 71 | 3300025905 | Ga0207685_10227400 | Ga0207685_102274001 | 212 |
| 72 | 3300045049 | Ga0466959_0593337 | Ga0466959_0593337_17_661 | 212 |
| 73 | 3300048909 | Ga0496106_0866678 | Ga0496106_0866678_15_659 | 212 |
| 74 | 3300046616 | Ga0495668_0366170 | Ga0495668_0366170_40_723 | 214 |
| 75 | 3300009551 | Ga0105238_10197412 | Ga0105238_101974122 | 218 |
| 76 | 3300025924 | Ga0207694_10079439 | Ga0207694_100794392 | 218 |
| 77 | 3300026142 | Ga0207698_10782059 | Ga0207698_107820591 | 218 |
| 78 | 3300049570 | Ga0501033_0055615 | Ga0501033_0055615_863_1537 | 218 |
| 79 | iso_pu_bacteria | 2932794094 | 2932794622 | 219 |
| 80 | iso_pu_bacteria | 2932801729 | 2932806903 | 219 |
| 81 | iso_pu_bacteria | 2513237104 | 2513718778 | 220 |
| 82 | iso_pu_bacteria | 2508501128 | 2509150104 | 221 |
| 83 | iso_pu_bacteria | 2513237094 | 2513639618 | 221 |
| 84 | iso_pu_bacteria | 2513237141 | 2513890371 | 221 |
| 85 | iso_pu_bacteria | 2643221651 | 2644290743 | 221 |
| 86 | iso_pu_bacteria | 2847930680 | 2847931402 | 221 |
| 87 | iso_pu_bacteria | 2874612657 | 2874619043 | 221 |
| 88 | iso_pu_bacteria | 2879083081 | 2879087562 | 221 |
| 89 | iso_pu_bacteria | 2906643746 | 2906652346 | 221 |
| 90 | iso_pu_bacteria | 3005594810 | 3005602228 | 221 |
| 91 | iso_pu_bacteria | 8056967851 | 8056970983 | 221 |
| 92 | 3300006038 | Ga0075365_10058216 | Ga0075365_100582163 | 222 |
| 93 | 3300006048 | Ga0075363_100197091 | Ga0075363_1001970912 | 222 |
| 94 | 3300006048 | Ga0075363_100244103 | Ga0075363_1002441032 | 222 |
| 95 | 3300006051 | Ga0075364_10031981 | Ga0075364_100319812 | 222 |
| 96 | 3300006177 | Ga0075362_10049798 | Ga0075362_100497982 | 222 |
| 97 | 3300006178 | Ga0075367_10074167 | Ga0075367_100741673 | 222 |
| 98 | 3300006353 | Ga0075370_10120838 | Ga0075370_101208381 | 222 |
| 99 | 3300037068 | Ga0373925_0463033 | Ga0373925_0463033_330_998 | 222 |
| 100 | 3300050490 | nmdc:mga03n38_111393_c1 | nmdc:mga03n38_111393_c1_151_819 | 222 |
| 101 | 3300050490 | nmdc:mga03n38_204226_c1 | nmdc:mga03n38_204226_c1_252_920 | 222 |
| 102 | 3300050491 | nmdc:mga00v17_29286_c1 | nmdc:mga00v17_29286_c1_439_1107 | 222 |
| 103 | 3300050494 | nmdc:mga06z11_60407_c1 | nmdc:mga06z11_60407_c1_1087_1755 | 222 |
| 104 | 3300050496 | nmdc:mga07m45_218943_c1 | nmdc:mga07m45_218943_c1_14_682 | 222 |
| 105 | iso_pu_bacteria | 2513237095 | 2513647895 | 222 |
| 106 | iso_pu_bacteria | 2528768022 | 2528851660 | 222 |
| 107 | iso_pu_bacteria | 2791355196 | 2793063044 | 222 |
| 108 | iso_pu_bacteria | 2816332527 | 2818237348 | 222 |
| 109 | iso_pu_bacteria | 2824661429 | 2824664799 | 222 |
| 110 | iso_pu_bacteria | 2844315083 | 2844321890 | 222 |
| 111 | iso_pu_bacteria | 2874628541 | 2874629154 | 222 |
| 112 | iso_pu_bacteria | 2876761206 | 2876764008 | 222 |
| 113 | iso_pu_bacteria | 2879099564 | 2879107295 | 222 |
| 114 | iso_pu_bacteria | 2885366525 | 2885371333 | 222 |
| 115 | iso_pu_bacteria | 2888378607 | 2888379895 | 222 |
| 116 | iso_pu_bacteria | 2888388044 | 2888390969 | 222 |
| 117 | iso_pu_bacteria | 2903727486 | 2903727560 | 222 |
| 118 | iso_pu_bacteria | 2906602504 | 2906602950 | 222 |
| 119 | iso_pu_bacteria | 2922368715 | 2922378277 | 222 |
| 120 | iso_pu_bacteria | 2929615660 | 2929623826 | 222 |
| 121 | iso_pu_bacteria | 2929624759 | 2929629057 | 222 |
| 122 | iso_pu_bacteria | 2932784394 | 2932786416 | 222 |
| 123 | iso_pu_bacteria | 2932809354 | 2932812509 | 222 |
| 124 | iso_pu_bacteria | 2932818245 | 2932822871 | 222 |
| 125 | iso_pu_bacteria | 2932828146 | 2932829654 | 222 |
| 126 | iso_pu_bacteria | 2933577622 | 2933585653 | 222 |
| 127 | iso_pu_bacteria | 2935616580 | 2935618172 | 222 |
| 128 | iso_pu_bacteria | 2935638405 | 2935641430 | 222 |
| 129 | iso_pu_bacteria | 2935665750 | 2935669512 | 222 |
| 130 | iso_pu_bacteria | 2935675223 | 2935677890 | 222 |
| 131 | iso_pu_bacteria | 2935684952 | 2935689661 | 222 |
| 132 | iso_pu_bacteria | 2935694250 | 2935698198 | 222 |
| 133 | iso_pu_bacteria | 2935703347 | 2935707337 | 222 |
| 134 | iso_pu_bacteria | 2935713505 | 2935717181 | 222 |
| 135 | iso_pu_bacteria | 2935722832 | 2935729985 | 222 |
| 136 | iso_pu_bacteria | 2935732158 | 2935738596 | 222 |
| 137 | iso_pu_bacteria | 2935741537 | 2935749156 | 222 |
| 138 | iso_pu_bacteria | 2935750917 | 2935757015 | 222 |
| 139 | iso_pu_bacteria | 2935760218 | 2935764374 | 222 |
| 140 | iso_pu_bacteria | 2935801545 | 2935804284 | 222 |
| 141 | iso_pu_bacteria | 2935810662 | 2935815368 | 222 |
| 142 | iso_pu_bacteria | 2935827899 | 2935831161 | 222 |
| 143 | iso_pu_bacteria | 2935837841 | 2935841770 | 222 |
| 144 | iso_pu_bacteria | 2935855204 | 2935856329 | 222 |
| 145 | iso_pu_bacteria | 2935864058 | 2935866339 | 222 |
| 146 | iso_pu_bacteria | 2935873716 | 2935874645 | 222 |
| 147 | iso_pu_bacteria | 2935883170 | 2935890315 | 222 |
| 148 | iso_pu_bacteria | 2935959822 | 2935962346 | 222 |
| 149 | iso_pu_bacteria | 2935992306 | 2935994106 | 222 |
| 150 | iso_pu_bacteria | 2936002035 | 2936004883 | 222 |
| 151 | iso_pu_bacteria | 2936037263 | 2936045023 | 222 |
| 152 | iso_pu_bacteria | 2940556831 | 2940562929 | 222 |
| 153 | iso_pu_bacteria | 2941538514 | 2941543843 | 222 |
| 154 | iso_pu_bacteria | 3005718088 | 3005725015 | 222 |
| 155 | iso_pu_bacteria | 8016511872 | 8016518549 | 222 |
| 156 | iso_pu_bacteria | 8017057580 | 8017058116 | 222 |
| 157 | iso_pu_bacteria | 8019576017 | 8019577613 | 222 |
| 158 | iso_pu_bacteria | 8019586578 | 8019595710 | 222 |
| 159 | iso_pu_bacteria | 8019597564 | 8019606053 | 222 |
| 160 | iso_pu_bacteria | 8019608314 | 8019612477 | 222 |
| 161 | iso_pu_bacteria | 8055742211 | 8055751075 | 222 |
| 162 | 3300009551 | Ga0105238_10378160 | Ga0105238_103781602 | 223 |
| 163 | 3300025297 | Ga0209758_1007793 | Ga0209758_10077934 | 223 |
| 164 | 3300031731 | Ga0307405_10450849 | Ga0307405_104508492 | 223 |
| 165 | 3300046454 | Ga0495592_0349585 | Ga0495592_0349585_20_691 | 223 |
| 166 | 3300046459 | Ga0495629_0028818 | Ga0495629_0028818_3132_3809 | 223 |
| 167 | 3300046473 | Ga0495582_0093657 | Ga0495582_0093657_378_1055 | 223 |
| 168 | 3300046499 | Ga0495594_0173227 | Ga0495594_0173227_426_1103 | 223 |
| 169 | 3300046529 | Ga0495652_0559335 | Ga0495652_0559335_49_726 | 223 |
| 170 | 3300046536 | Ga0495587_0129269 | Ga0495587_0129269_755_1432 | 223 |
| 171 | 3300046642 | Ga0495634_0080297 | Ga0495634_0080297_561_1238 | 223 |
| 172 | 3300046675 | Ga0495657_0028573 | Ga0495657_0028573_41_718 | 223 |
| 173 | 3300046680 | Ga0495646_0101626 | Ga0495646_0101626_725_1402 | 223 |
| 174 | 3300046689 | Ga0495613_0023721 | Ga0495613_0023721_783_1460 | 223 |
| 175 | 3300046809 | Ga0495600_0001422 | Ga0495600_0001422_12270_12947 | 223 |
| 176 | 3300047315 | Ga0495581_0011351 | Ga0495581_0011351_3539_4216 | 223 |
| 177 | 3300047317 | Ga0495604_0006283 | Ga0495604_0006283_4389_5066 | 223 |
| 178 | 3300047321 | Ga0495676_0017179 | Ga0495676_0017179_1989_2666 | 223 |
| 179 | 3300048904 | Ga0496101_0148957 | Ga0496101_0148957_559_1236 | 223 |
| 180 | 3300048907 | Ga0496104_0011823 | Ga0496104_0011823_5482_6159 | 223 |
| 181 | 3300048908 | Ga0496105_0019349 | Ga0496105_0019349_133_810 | 223 |
| 182 | 3300048918 | Ga0496115_0025835 | Ga0496115_0025835_815_1492 | 223 |
| 183 | 3300048922 | Ga0496119_0012146 | Ga0496119_0012146_5097_5774 | 223 |
| 184 | 3300048923 | Ga0496120_0075570 | Ga0496120_0075570_132_809 | 223 |
| 185 | 3300048927 | Ga0496124_0058566 | Ga0496124_0058566_443_1120 | 223 |
| 186 | 3300048929 | Ga0496126_0041384 | Ga0496126_0041384_3093_3770 | 223 |
| 187 | 3300053077 | Ga0495601_0506956 | Ga0495601_0506956_25_702 | 223 |
| 188 | 3300053086 | Ga0500578_0388521 | Ga0500578_0388521_74_751 | 223 |
| 189 | 3300053136 | Ga0500559_0028889 | Ga0500559_0028889_1587_2264 | 223 |
| 190 | iso_pu_bacteria | 2507262055 | 2507504911 | 223 |
| 191 | iso_pu_bacteria | 2511231028 | 2511398329 | 223 |
| 192 | iso_pu_bacteria | 2513237139 | 2513873842 | 223 |
| 193 | iso_pu_bacteria | 2524023205 | 2524440024 | 223 |
| 194 | iso_pu_bacteria | 2744054633 | 2745077864 | 223 |
| 195 | iso_pu_bacteria | 2802429603 | 2805915925 | 223 |
| 196 | iso_pu_bacteria | 2881665667 | 2881665762 | 223 |
| 197 | iso_pu_bacteria | 2935608549 | 2935614891 | 223 |
| 198 | iso_pu_bacteria | 2935769743 | 2935772710 | 223 |
| 199 | iso_pu_bacteria | 2935777560 | 2935778154 | 223 |
| 200 | iso_pu_bacteria | 2935785616 | 2935787381 | 223 |
| 201 | iso_pu_bacteria | 2935793552 | 2935795831 | 223 |
| 202 | iso_pu_bacteria | 2935819856 | 2935826069 | 223 |
| 203 | iso_pu_bacteria | 2935847175 | 2935851688 | 223 |
| 204 | iso_pu_bacteria | 2935908558 | 2935910290 | 223 |
| 205 | iso_pu_bacteria | 2935916978 | 2935918424 | 223 |
| 206 | iso_pu_bacteria | 2935926038 | 2935927799 | 223 |
| 207 | iso_pu_bacteria | 2935934488 | 2935936329 | 223 |
| 208 | iso_pu_bacteria | 2935942939 | 2935944118 | 223 |
| 209 | iso_pu_bacteria | 2935951376 | 2935952555 | 223 |
| 210 | iso_pu_bacteria | 2935967501 | 2935969395 | 223 |
| 211 | iso_pu_bacteria | 8006926726 | 8006931133 | 223 |
| 212 | iso_pu_bacteria | 8016522445 | 8016526525 | 223 |
| 213 | iso_pu_bacteria | 8016530956 | 8016531605 | 223 |
| 214 | iso_pu_bacteria | 8016539877 | 8016544810 | 223 |
| 215 | iso_pu_bacteria | 8016548790 | 8016557269 | 223 |
| 216 | iso_pu_bacteria | 8016557553 | 8016565621 | 223 |
| 217 | iso_pu_bacteria | 8016566248 | 8016569868 | 223 |
| 218 | iso_pu_bacteria | 8016575299 | 8016582465 | 223 |
| 219 | iso_pu_bacteria | 8016595262 | 8016603231 | 223 |
| 220 | iso_pu_bacteria | 8016603502 | 8016606159 | 223 |
| 221 | iso_pu_bacteria | 8016613128 | 8016618035 | 223 |
| 222 | iso_pu_bacteria | 8016622563 | 8016623536 | 223 |
| 223 | iso_pu_bacteria | 8019530166 | 8019531434 | 223 |
| 224 | iso_pu_bacteria | 8019538911 | 8019540092 | 223 |
| 225 | iso_pu_bacteria | 8019547302 | 8019550557 | 223 |
| 226 | iso_pu_bacteria | 8019648815 | 8019652806 | 223 |
| 227 | iso_pu_bacteria | 8019687851 | 8019696627 | 223 |
| 228 | 3300038443 | Ga0395901_0331349 | Ga0395901_0331349_233_925 | 224 |
| 229 | 3300046516 | Ga0495628_0247814 | Ga0495628_0247814_72_752 | 224 |
| 230 | 3300046690 | Ga0495624_0014534 | Ga0495624_0014534_4204_4884 | 224 |
| 231 | iso_pu_bacteria | 2508501009 | 2508546261 | 224 |
| 232 | iso_pu_bacteria | 2508501042 | 2508695193 | 224 |
| 233 | iso_pu_bacteria | 2513237102 | 2513699661 | 224 |
| 234 | iso_pu_bacteria | 2513237161 | 2514012813 | 224 |
| 235 | iso_pu_bacteria | 2515154112 | 2515625794 | 224 |
| 236 | iso_pu_bacteria | 2617270735 | 2617351775 | 224 |
| 237 | iso_pu_bacteria | 2824600985 | 2824602643 | 224 |
| 238 | iso_pu_bacteria | 2824609381 | 2824617090 | 224 |
| 239 | iso_pu_bacteria | 2824617872 | 2824621040 | 224 |
| 240 | iso_pu_bacteria | 2824626560 | 2824630047 | 224 |
| 241 | iso_pu_bacteria | 2824635225 | 2824637937 | 224 |
| 242 | iso_pu_bacteria | 2824644064 | 2824652252 | 224 |
| 243 | iso_pu_bacteria | 2824653114 | 2824654392 | 224 |
| 244 | iso_pu_bacteria | 2824671348 | 2824679551 | 224 |
| 245 | iso_pu_bacteria | 2824679649 | 2824682106 | 224 |
| 246 | iso_pu_bacteria | 2824687955 | 2824692977 | 224 |
| 247 | iso_pu_bacteria | 2824696289 | 2824704491 | 224 |
| 248 | iso_pu_bacteria | 2824714736 | 2824719904 | 224 |
| 249 | iso_pu_bacteria | 2824723954 | 2824726326 | 224 |
| 250 | iso_pu_bacteria | 2824773399 | 2824774870 | 224 |
| 251 | iso_pu_bacteria | 2838122688 | 2838124187 | 224 |
| 252 | iso_pu_bacteria | 2841941048 | 2841944535 | 224 |
| 253 | iso_pu_bacteria | 2841949485 | 2841951673 | 224 |
| 254 | iso_pu_bacteria | 2841957949 | 2841964817 | 224 |
| 255 | iso_pu_bacteria | 2841966195 | 2841969311 | 224 |
| 256 | iso_pu_bacteria | 2841974524 | 2841980290 | 224 |
| 257 | iso_pu_bacteria | 2841983080 | 2841985542 | 224 |
| 258 | iso_pu_bacteria | 2842038055 | 2842043810 | 224 |
| 259 | iso_pu_bacteria | 2842045827 | 2842052200 | 224 |
| 260 | iso_pu_bacteria | 2847939898 | 2847941826 | 224 |
| 261 | iso_pu_bacteria | 2857509624 | 2857511637 | 224 |
| 262 | iso_pu_bacteria | 2874590934 | 2874596907 | 224 |
| 263 | iso_pu_bacteria | 2874620515 | 2874624484 | 224 |
| 264 | iso_pu_bacteria | 2874645413 | 2874648712 | 224 |
| 265 | iso_pu_bacteria | 2876771140 | 2876777371 | 224 |
| 266 | iso_pu_bacteria | 2876818435 | 2876825453 | 224 |
| 267 | iso_pu_bacteria | 2879074833 | 2879077702 | 224 |
| 268 | iso_pu_bacteria | 2879127579 | 2879131416 | 224 |
| 269 | iso_pu_bacteria | 2879142872 | 2879144376 | 224 |
| 270 | iso_pu_bacteria | 2881364244 | 2881370935 | 224 |
| 271 | iso_pu_bacteria | 2888419890 | 2888420703 | 224 |
| 272 | iso_pu_bacteria | 2904666416 | 2904672177 | 224 |
| 273 | iso_pu_bacteria | 2922393267 | 2922396642 | 224 |
| 274 | iso_pu_bacteria | 2935648319 | 2935652922 | 224 |
| 275 | iso_pu_bacteria | 2935656913 | 2935661505 | 224 |
| 276 | iso_pu_bacteria | 2935975950 | 2935977837 | 224 |
| 277 | iso_pu_bacteria | 2935984226 | 2935984854 | 224 |
| 278 | iso_pu_bacteria | 2936011229 | 2936015766 | 224 |
| 279 | iso_pu_bacteria | 2936019824 | 2936024400 | 224 |
| 280 | iso_pu_bacteria | 2936028420 | 2936031713 | 224 |
| 281 | iso_pu_bacteria | 2936046547 | 2936051535 | 224 |
| 282 | iso_pu_bacteria | 2936055302 | 2936056025 | 224 |
| 283 | iso_pu_bacteria | 3005506211 | 3005509476 | 224 |
| 284 | iso_pu_bacteria | 8019619141 | 8019622632 | 224 |
| 285 | iso_pu_bacteria | 8019629233 | 8019630476 | 224 |
| 286 | iso_pu_bacteria | 8019659431 | 8019667308 | 224 |
| 287 | iso_pu_bacteria | 8019668869 | 8019677077 | 224 |
| 288 | iso_pu_bacteria | 8019678201 | 8019678904 | 224 |
| 289 | 3300003762 | Ga0055542_1008654 | Ga0055542_10086542 | 225 |
| 290 | 3300005435 | Ga0070714_100147138 | Ga0070714_1001471382 | 225 |
| 291 | 3300005548 | Ga0070665_100366299 | Ga0070665_1003662992 | 225 |
| 292 | 3300005616 | Ga0068852_100031105 | Ga0068852_1000311054 | 225 |
| 293 | 3300009093 | Ga0105240_10077943 | Ga0105240_100779433 | 225 |
| 294 | 3300009098 | Ga0105245_10070218 | Ga0105245_100702182 | 225 |
| 295 | 3300009174 | Ga0105241_10046592 | Ga0105241_100465922 | 225 |
| 296 | 3300009545 | Ga0105237_10036560 | Ga0105237_100365606 | 225 |
| 297 | 3300009545 | Ga0105237_10337386 | Ga0105237_103373862 | 225 |
| 298 | 3300010375 | Ga0105239_10079841 | Ga0105239_100798412 | 225 |
| 299 | 3300014968 | Ga0157379_10437434 | Ga0157379_104374342 | 225 |
| 300 | 3300025254 | Ga0209148_1000334 | Ga0209148_100033418 | 225 |
| 301 | 3300025272 | Ga0209455_1000787 | Ga0209455_10007878 | 225 |
| 302 | 3300025911 | Ga0207654_10044831 | Ga0207654_100448312 | 225 |
| 303 | 3300025913 | Ga0207695_10000065 | Ga0207695_10000065239 | 225 |
| 304 | 3300025914 | Ga0207671_10010281 | Ga0207671_100102818 | 225 |
| 305 | 3300025923 | Ga0207681_10218006 | Ga0207681_102180061 | 225 |
| 306 | 3300025927 | Ga0207687_10083446 | Ga0207687_100834462 | 225 |
| 307 | 3300025929 | Ga0207664_10930994 | Ga0207664_109309941 | 225 |
| 308 | 3300026142 | Ga0207698_10065694 | Ga0207698_100656942 | 225 |
| 309 | 3300026142 | Ga0207698_10462370 | Ga0207698_104623702 | 225 |
| 310 | 3300028379 | Ga0268266_10361233 | Ga0268266_103612332 | 225 |
| 311 | 3300031548 | Ga0307408_100020929 | Ga0307408_1000209296 | 225 |
| 312 | 3300034818 | Ga0373950_0008539 | Ga0373950_0008539_134_841 | 225 |
| 313 | 3300037418 | Ga0395900_0061239 | Ga0395900_0061239_1516_2220 | 225 |
| 314 | 3300037466 | Ga0395898_0212991 | Ga0395898_0212991_14_718 | 225 |
| 315 | 3300038443 | Ga0395901_0007034 | Ga0395901_0007034_9151_9855 | 225 |
| 316 | 3300044656 | Ga0466969_0035718 | Ga0466969_0035718_546_1229 | 225 |
| 317 | 3300044684 | Ga0466966_0000307 | Ga0466966_0000307_20913_21596 | 225 |
| 318 | 3300044693 | Ga0466961_0000019 | Ga0466961_0000019_74670_75353 | 225 |
| 319 | 3300044694 | Ga0466963_0048239 | Ga0466963_0048239_1076_1759 | 225 |
| 320 | 3300045049 | Ga0466959_0179332 | Ga0466959_0179332_352_1035 | 225 |
| 321 | 3300045836 | Ga0466958_0404400 | Ga0466958_0404400_139_822 | 225 |
| 322 | 3300045976 | Ga0466967_0041692 | Ga0466967_0041692_3011_3694 | 225 |
| 323 | 3300046513 | Ga0495616_0160150 | Ga0495616_0160150_170_853 | 225 |
| 324 | 3300046524 | Ga0495648_0193983 | Ga0495648_0193983_209_892 | 225 |
| 325 | 3300046660 | Ga0495625_0038899 | Ga0495625_0038899_1693_2376 | 225 |
| 326 | 3300047472 | Ga0495686_0269968 | Ga0495686_0269968_151_828 | 225 |
| 327 | 3300048923 | Ga0496120_0129555 | Ga0496120_0129555_537_1220 | 225 |
| 328 | 3300048924 | Ga0496121_0044951 | Ga0496121_0044951_1928_2605 | 225 |
| 329 | 3300048929 | Ga0496126_0135121 | Ga0496126_0135121_29_712 | 225 |
| 330 | 3300049568 | Ga0501031_0045037 | Ga0501031_0045037_490_1194 | 225 |
| 331 | 3300049570 | Ga0501033_0054593 | Ga0501033_0054593_46_753 | 225 |
| 332 | 3300049571 | Ga0501034_0220436 | Ga0501034_0220436_949_1653 | 225 |
| 333 | 3300049571 | Ga0501034_0477484 | Ga0501034_0477484_184_891 | 225 |
| 334 | 3300049572 | Ga0501036_0040405 | Ga0501036_0040405_1985_2689 | 225 |
| 335 | 3300049574 | Ga0501038_0069403 | Ga0501038_0069403_1519_2226 | 225 |
| 336 | 3300049579 | Ga0501043_0266432 | Ga0501043_0266432_523_1302 | 225 |
| 337 | 3300049581 | Ga0501047_0023211 | Ga0501047_0023211_3436_4143 | 225 |
| 338 | 3300049582 | Ga0501048_0016045 | Ga0501048_0016045_633_1337 | 225 |
| 339 | 3300049822 | Ga0501035_0050067 | Ga0501035_0050067_1203_1907 | 225 |
| 340 | 3300049822 | Ga0501035_0183198 | Ga0501035_0183198_484_1191 | 225 |
| 341 | 3300049823 | Ga0501044_0052414 | Ga0501044_0052414_3021_3728 | 225 |
| 342 | 3300049823 | Ga0501044_0238966 | Ga0501044_0238966_283_1062 | 225 |
| 343 | 3300049823 | Ga0501044_0272752 | Ga0501044_0272752_825_1532 | 225 |
| 344 | 3300053093 | Ga0500651_0372351 | Ga0500651_0372351_53_736 | 225 |
| 345 | 3300053119 | Ga0500595_002517 | Ga0500595_002517_497_1183 | 225 |
| 346 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_125725_126432 | 225 |
| 347 | iso_pu_bacteria | 2602042107 | 2603857854 | 225 |
| 348 | iso_pu_bacteria | 2857524615 | 2857527229 | 225 |
| 349 | iso_pu_bacteria | 2893066018 | 2893067997 | 225 |
| 350 | iso_pu_bacteria | 2919073203 | 2919078344 | 225 |
| 351 | 3300003354 | JGI25160J50197_1008958 | JGI25160J50197_10089584 | 226 |
| 352 | 3300003354 | JGI25160J50197_1014145 | JGI25160J50197_10141453 | 226 |
| 353 | 3300004625 | Ga0055543_1001201 | Ga0055543_10012019 | 226 |
| 354 | 3300005262 | Ga0065165_1003230 | Ga0065165_10032302 | 226 |
| 355 | 3300005262 | Ga0065165_1068283 | Ga0065165_10682831 | 226 |
| 356 | 3300005327 | Ga0070658_10525823 | Ga0070658_105258232 | 226 |
| 357 | 3300005331 | Ga0070670_100025237 | Ga0070670_1000252373 | 226 |
| 358 | 3300005334 | Ga0068869_100352092 | Ga0068869_1003520922 | 226 |
| 359 | 3300005338 | Ga0068868_100102289 | Ga0068868_1001022892 | 226 |
| 360 | 3300005344 | Ga0070661_100250871 | Ga0070661_1002508712 | 226 |
| 361 | 3300005347 | Ga0070668_100035201 | Ga0070668_1000352012 | 226 |
| 362 | 3300005367 | Ga0070667_100347889 | Ga0070667_1003478892 | 226 |
| 363 | 3300005435 | Ga0070714_100092324 | Ga0070714_1000923242 | 226 |
| 364 | 3300005444 | Ga0070694_100170782 | Ga0070694_1001707822 | 226 |
| 365 | 3300005455 | Ga0070663_100111072 | Ga0070663_1001110722 | 226 |
| 366 | 3300005455 | Ga0070663_100269663 | Ga0070663_1002696631 | 226 |
| 367 | 3300005455 | Ga0070663_100353457 | Ga0070663_1003534572 | 226 |
| 368 | 3300005468 | Ga0070707_100096973 | Ga0070707_1000969732 | 226 |
| 369 | 3300005548 | Ga0070665_100447213 | Ga0070665_1004472132 | 226 |
| 370 | 3300005548 | Ga0070665_100478775 | Ga0070665_1004787752 | 226 |
| 371 | 3300005577 | Ga0068857_100133495 | Ga0068857_1001334952 | 226 |
| 372 | 3300005614 | Ga0068856_100448706 | Ga0068856_1004487062 | 226 |
| 373 | 3300005615 | Ga0070702_100614851 | Ga0070702_1006148511 | 226 |
| 374 | 3300005618 | Ga0068864_100327275 | Ga0068864_1003272752 | 226 |
| 375 | 3300005841 | Ga0068863_100436663 | Ga0068863_1004366631 | 226 |
| 376 | 3300006038 | Ga0075365_10003007 | Ga0075365_100030072 | 226 |
| 377 | 3300006048 | Ga0075363_100010642 | Ga0075363_1000106422 | 226 |
| 378 | 3300006051 | Ga0075364_10073707 | Ga0075364_100737073 | 226 |
| 379 | 3300006177 | Ga0075362_10013513 | Ga0075362_100135133 | 226 |
| 380 | 3300006195 | Ga0075366_10010771 | Ga0075366_100107712 | 226 |
| 381 | 3300009148 | Ga0105243_10513834 | Ga0105243_105138342 | 226 |
| 382 | 3300009174 | Ga0105241_10232848 | Ga0105241_102328482 | 226 |
| 383 | 3300009545 | Ga0105237_10071402 | Ga0105237_100714022 | 226 |
| 384 | 3300009553 | Ga0105249_10461645 | Ga0105249_104616451 | 226 |
| 385 | 3300010375 | Ga0105239_10063317 | Ga0105239_100633172 | 226 |
| 386 | 3300010375 | Ga0105239_10334669 | Ga0105239_103346692 | 226 |
| 387 | 3300010375 | Ga0105239_10603116 | Ga0105239_106031161 | 226 |
| 388 | 3300013306 | Ga0163162_11030991 | Ga0163162_110309911 | 226 |
| 389 | 3300013308 | Ga0157375_10284616 | Ga0157375_102846162 | 226 |
| 390 | 3300014325 | Ga0163163_10309141 | Ga0163163_103091412 | 226 |
| 391 | 3300014325 | Ga0163163_10423188 | Ga0163163_104231882 | 226 |
| 392 | 3300014745 | Ga0157377_10352769 | Ga0157377_103527692 | 226 |
| 393 | 3300014968 | Ga0157379_10206937 | Ga0157379_102069372 | 226 |
| 394 | 3300015262 | Ga0182007_10097440 | Ga0182007_100974401 | 226 |
| 395 | 3300025253 | Ga0209677_104344 | Ga0209677_1043442 | 226 |
| 396 | 3300025297 | Ga0209758_1016910 | Ga0209758_10169102 | 226 |
| 397 | 3300025302 | Ga0207426_1004845 | Ga0207426_10048454 | 226 |
| 398 | 3300025302 | Ga0207426_1088282 | Ga0207426_10882822 | 226 |
| 399 | 3300025304 | Ga0209257_1010082 | Ga0209257_10100822 | 226 |
| 400 | 3300025901 | Ga0207688_10142213 | Ga0207688_101422132 | 226 |
| 401 | 3300025903 | Ga0207680_10170252 | Ga0207680_101702522 | 226 |
| 402 | 3300025904 | Ga0207647_10023266 | Ga0207647_100232662 | 226 |
| 403 | 3300025911 | Ga0207654_10306431 | Ga0207654_103064311 | 226 |
| 404 | 3300025914 | Ga0207671_10247853 | Ga0207671_102478532 | 226 |
| 405 | 3300025929 | Ga0207664_10026828 | Ga0207664_100268282 | 226 |
| 406 | 3300025942 | Ga0207689_10356269 | Ga0207689_103562692 | 226 |
| 407 | 3300025945 | Ga0207679_10206995 | Ga0207679_102069952 | 226 |
| 408 | 3300025949 | Ga0207667_10331186 | Ga0207667_103311862 | 226 |
| 409 | 3300025972 | Ga0207668_10197826 | Ga0207668_101978262 | 226 |
| 410 | 3300025981 | Ga0207640_10622721 | Ga0207640_106227211 | 226 |
| 411 | 3300025986 | Ga0207658_10108908 | Ga0207658_101089083 | 226 |
| 412 | 3300026023 | Ga0207677_10359139 | Ga0207677_103591391 | 226 |
| 413 | 3300026067 | Ga0207678_10139094 | Ga0207678_101390942 | 226 |
| 414 | 3300026067 | Ga0207678_10144836 | Ga0207678_101448361 | 226 |
| 415 | 3300026088 | Ga0207641_10337148 | Ga0207641_103371482 | 226 |
| 416 | 3300026095 | Ga0207676_10856197 | Ga0207676_108561972 | 226 |
| 417 | 3300027866 | Ga0209813_10033212 | Ga0209813_100332122 | 226 |
| 418 | 3300028786 | Ga0307517_10250461 | Ga0307517_102504611 | 226 |
| 419 | 3300031548 | Ga0307408_100578190 | Ga0307408_1005781901 | 226 |
| 420 | 3300033180 | Ga0307510_10023425 | Ga0307510_100234252 | 226 |
| 421 | 3300033180 | Ga0307510_10408005 | Ga0307510_104080051 | 226 |
| 422 | 3300037312 | Ga0395899_0045464 | Ga0395899_0045464_2488_3174 | 226 |
| 423 | 3300037418 | Ga0395900_0000696 | Ga0395900_0000696_4934_5620 | 226 |
| 424 | 3300037466 | Ga0395898_0009029 | Ga0395898_0009029_2470_3156 | 226 |
| 425 | 3300038443 | Ga0395901_0027392 | Ga0395901_0027392_2511_3197 | 226 |
| 426 | 3300046454 | Ga0495592_0020048 | Ga0495592_0020048_1883_2569 | 226 |
| 427 | 3300046455 | Ga0495603_0022781 | Ga0495603_0022781_624_1304 | 226 |
| 428 | 3300046455 | Ga0495603_0299061 | Ga0495603_0299061_146_832 | 226 |
| 429 | 3300046460 | Ga0495638_0053712 | Ga0495638_0053712_233_919 | 226 |
| 430 | 3300046462 | Ga0495651_0005167 | Ga0495651_0005167_4176_4862 | 226 |
| 431 | 3300046463 | Ga0495653_0029583 | Ga0495653_0029583_1976_2662 | 226 |
| 432 | 3300046474 | Ga0495605_0118126 | Ga0495605_0118126_80_766 | 226 |
| 433 | 3300046477 | Ga0495664_0045743 | Ga0495664_0045743_1636_2322 | 226 |
| 434 | 3300046477 | Ga0495664_0152881 | Ga0495664_0152881_14_724 | 226 |
| 435 | 3300046500 | Ga0495596_0054926 | Ga0495596_0054926_20_706 | 226 |
| 436 | 3300046511 | Ga0495608_0038509 | Ga0495608_0038509_2425_3111 | 226 |
| 437 | 3300046513 | Ga0495616_0034692 | Ga0495616_0034692_110_796 | 226 |
| 438 | 3300046515 | Ga0495620_0019743 | Ga0495620_0019743_570_1256 | 226 |
| 439 | 3300046515 | Ga0495620_0148935 | Ga0495620_0148935_89_775 | 226 |
| 440 | 3300046516 | Ga0495628_0025666 | Ga0495628_0025666_2700_3386 | 226 |
| 441 | 3300046522 | Ga0495643_0050132 | Ga0495643_0050132_741_1427 | 226 |
| 442 | 3300046524 | Ga0495648_0101195 | Ga0495648_0101195_574_1260 | 226 |
| 443 | 3300046529 | Ga0495652_0065462 | Ga0495652_0065462_276_962 | 226 |
| 444 | 3300046533 | Ga0495640_0035646 | Ga0495640_0035646_1945_2631 | 226 |
| 445 | 3300046536 | Ga0495587_0008436 | Ga0495587_0008436_2787_3473 | 226 |
| 446 | 3300046542 | Ga0495597_0025930 | Ga0495597_0025930_1250_1936 | 226 |
| 447 | 3300046543 | Ga0495645_0016780 | Ga0495645_0016780_101_787 | 226 |
| 448 | 3300046557 | Ga0495622_0048778 | Ga0495622_0048778_771_1457 | 226 |
| 449 | 3300046559 | Ga0495667_0011636 | Ga0495667_0011636_119_805 | 226 |
| 450 | 3300046663 | Ga0495635_0204809 | Ga0495635_0204809_495_1181 | 226 |
| 451 | 3300046674 | Ga0495588_0015817 | Ga0495588_0015817_254_940 | 226 |
| 452 | 3300046675 | Ga0495657_0008544 | Ga0495657_0008544_1358_2044 | 226 |
| 453 | 3300046678 | Ga0495599_0016179 | Ga0495599_0016179_3225_3911 | 226 |
| 454 | 3300046679 | Ga0495623_0020193 | Ga0495623_0020193_1477_2163 | 226 |
| 455 | 3300046680 | Ga0495646_0027979 | Ga0495646_0027979_2636_3322 | 226 |
| 456 | 3300046689 | Ga0495613_0058263 | Ga0495613_0058263_1169_1855 | 226 |
| 457 | 3300046694 | Ga0495649_0056877 | Ga0495649_0056877_665_1351 | 226 |
| 458 | 3300046809 | Ga0495600_0040341 | Ga0495600_0040341_1487_2173 | 226 |
| 459 | 3300046810 | Ga0495660_0160016 | Ga0495660_0160016_242_928 | 226 |
| 460 | 3300047317 | Ga0495604_0006103 | Ga0495604_0006103_276_962 | 226 |
| 461 | 3300047319 | Ga0495674_0032580 | Ga0495674_0032580_914_1600 | 226 |
| 462 | 3300047321 | Ga0495676_0396742 | Ga0495676_0396742_82_768 | 226 |
| 463 | 3300047322 | Ga0495680_0010380 | Ga0495680_0010380_5116_5802 | 226 |
| 464 | 3300047323 | Ga0495683_0076522 | Ga0495683_0076522_784_1470 | 226 |
| 465 | 3300047323 | Ga0495683_0103183 | Ga0495683_0103183_124_810 | 226 |
| 466 | 3300047443 | Ga0495687_009999 | Ga0495687_009999_285_971 | 226 |
| 467 | 3300047444 | Ga0495675_0072871 | Ga0495675_0072871_1144_1830 | 226 |
| 468 | 3300047471 | Ga0495684_0014418 | Ga0495684_0014418_2217_3020 | 226 |
| 469 | 3300047472 | Ga0495686_0096140 | Ga0495686_0096140_1019_1705 | 226 |
| 470 | 3300047472 | Ga0495686_0345848 | Ga0495686_0345848_97_783 | 226 |
| 471 | 3300048088 | Ga0495602_0016855 | Ga0495602_0016855_3077_3763 | 226 |
| 472 | 3300048088 | Ga0495602_0632284 | Ga0495602_0632284_18_698 | 226 |
| 473 | 3300048091 | Ga0495626_0158636 | Ga0495626_0158636_215_901 | 226 |
| 474 | 3300048903 | Ga0496100_0092496 | Ga0496100_0092496_681_1367 | 226 |
| 475 | 3300048905 | Ga0496102_0489565 | Ga0496102_0489565_364_1050 | 226 |
| 476 | 3300048906 | Ga0496103_0002964 | Ga0496103_0002964_1642_2328 | 226 |
| 477 | 3300048906 | Ga0496103_0138332 | Ga0496103_0138332_579_1265 | 226 |
| 478 | 3300048907 | Ga0496104_0186778 | Ga0496104_0186778_1093_1779 | 226 |
| 479 | 3300048907 | Ga0496104_0328877 | Ga0496104_0328877_270_956 | 226 |
| 480 | 3300048908 | Ga0496105_0341882 | Ga0496105_0341882_248_934 | 226 |
| 481 | 3300048909 | Ga0496106_0099941 | Ga0496106_0099941_1145_1831 | 226 |
| 482 | 3300048911 | Ga0496108_0318125 | Ga0496108_0318125_375_1061 | 226 |
| 483 | 3300048913 | Ga0496110_0186371 | Ga0496110_0186371_320_1006 | 226 |
| 484 | 3300048914 | Ga0496111_0025336 | Ga0496111_0025336_2979_3665 | 226 |
| 485 | 3300048915 | Ga0496112_0287165 | Ga0496112_0287165_520_1206 | 226 |
| 486 | 3300048916 | Ga0496113_0261166 | Ga0496113_0261166_107_793 | 226 |
| 487 | 3300048916 | Ga0496113_0324375 | Ga0496113_0324375_292_978 | 226 |
| 488 | 3300048918 | Ga0496115_0386964 | Ga0496115_0386964_132_818 | 226 |
| 489 | 3300048919 | Ga0496116_0005246 | Ga0496116_0005246_2255_2950 | 226 |
| 490 | 3300048921 | Ga0496118_0046352 | Ga0496118_0046352_1236_1922 | 226 |
| 491 | 3300048922 | Ga0496119_0056994 | Ga0496119_0056994_1202_1888 | 226 |
| 492 | 3300048922 | Ga0496119_0142289 | Ga0496119_0142289_187_873 | 226 |
| 493 | 3300048927 | Ga0496124_0146701 | Ga0496124_0146701_749_1435 | 226 |
| 494 | 3300048928 | Ga0496125_0121204 | Ga0496125_0121204_322_1008 | 226 |
| 495 | 3300048928 | Ga0496125_0142854 | Ga0496125_0142854_822_1508 | 226 |
| 496 | 3300048929 | Ga0496126_0282974 | Ga0496126_0282974_597_1283 | 226 |
| 497 | 3300048929 | Ga0496126_0462381 | Ga0496126_0462381_254_940 | 226 |
| 498 | 3300050489 | nmdc:mga03683_74374_c1 | nmdc:mga03683_74374_c1_640_1326 | 226 |
| 499 | 3300050490 | nmdc:mga03n38_3019_c1 | nmdc:mga03n38_3019_c1_2947_3633 | 226 |
| 500 | 3300050491 | nmdc:mga00v17_82252_c1 | nmdc:mga00v17_82252_c1_893_1579 | 226 |
| 501 | 3300050492 | nmdc:mga0yw44_100757_c1 | nmdc:mga0yw44_100757_c1_880_1566 | 226 |
| 502 | 3300050492 | nmdc:mga0yw44_70594_c1 | nmdc:mga0yw44_70594_c1_1059_1745 | 226 |
| 503 | 3300050493 | nmdc:mga0k408_6697_c1 | nmdc:mga0k408_6697_c1_4830_5516 | 226 |
| 504 | 3300050494 | nmdc:mga06z11_22732_c1 | nmdc:mga06z11_22732_c1_2198_2884 | 226 |
| 505 | 3300050494 | nmdc:mga06z11_53578_c1 | nmdc:mga06z11_53578_c1_1115_1801 | 226 |
| 506 | 3300050496 | nmdc:mga07m45_19585_c1 | nmdc:mga07m45_19585_c1_1854_2540 | 226 |
| 507 | 3300050516 | nmdc:mga0sz30_73294_c1 | nmdc:mga0sz30_73294_c1_240_926 | 226 |
| 508 | 3300053080 | Ga0500635_0106737 | Ga0500635_0106737_140_820 | 226 |
| 509 | 3300053083 | Ga0495655_0086886 | Ga0495655_0086886_49_735 | 226 |
| 510 | 3300053090 | Ga0500646_0019969 | Ga0500646_0019969_92_778 | 226 |
| 511 | 3300053094 | Ga0500566_0000224 | Ga0500566_0000224_27699_28385 | 226 |
| 512 | 3300053104 | Ga0500556_0103283 | Ga0500556_0103283_136_822 | 226 |
| 513 | 3300053119 | Ga0500595_025410 | Ga0500595_025410_1291_1977 | 226 |
| 514 | 3300053125 | Ga0500618_017773 | Ga0500618_017773_1043_1735 | 226 |
| 515 | 3300053126 | Ga0500621_186776 | Ga0500621_186776_13_699 | 226 |
| 516 | 3300053136 | Ga0500559_0011309 | Ga0500559_0011309_1014_1709 | 226 |
| 517 | 3300053146 | Ga0500588_0050955 | Ga0500588_0050955_13_699 | 226 |
| 518 | 3300053150 | Ga0500603_000204 | Ga0500603_000204_7324_8004 | 226 |
| 519 | 3300053156 | Ga0500622_0016210 | Ga0500622_0016210_602_1288 | 226 |
| 520 | 3300053160 | Ga0500633_0010105 | Ga0500633_0010105_1455_2141 | 226 |
| 521 | 3300053177 | Ga0500636_0135817 | Ga0500636_0135817_169_855 | 226 |
| 522 | 3300053178 | Ga0500637_0000531 | Ga0500637_0000531_771_1451 | 226 |
| 523 | 3300053730 | Ga0500645_056543 | Ga0500645_056543_79_765 | 226 |
| 524 | iso_pu_bacteria | 2941531003 | 2941532410 | 226 |
| 525 | 3300003215 | JGI25153J46596_10002236 | JGI25153J46596_100022363 | 227 |
| 526 | 3300003215 | JGI25153J46596_10051863 | JGI25153J46596_100518632 | 227 |
| 527 | 3300003320 | rootH2_10146027 | rootH2_101460272 | 227 |
| 528 | 3300003794 | Ga0055531_10006394 | Ga0055531_100063945 | 227 |
| 529 | 3300004625 | Ga0055543_1016667 | Ga0055543_10166672 | 227 |
| 530 | 3300005262 | Ga0065165_1003543 | Ga0065165_10035432 | 227 |
| 531 | 3300005327 | Ga0070658_10091470 | Ga0070658_100914702 | 227 |
| 532 | 3300005327 | Ga0070658_10104306 | Ga0070658_101043062 | 227 |
| 533 | 3300005327 | Ga0070658_10187977 | Ga0070658_101879772 | 227 |
| 534 | 3300005329 | Ga0070683_100104465 | Ga0070683_1001044653 | 227 |
| 535 | 3300005339 | Ga0070660_100467162 | Ga0070660_1004671622 | 227 |
| 536 | 3300005347 | Ga0070668_100542269 | Ga0070668_1005422691 | 227 |
| 537 | 3300005434 | Ga0070709_10004296 | Ga0070709_100042967 | 227 |
| 538 | 3300005435 | Ga0070714_100002380 | Ga0070714_10000238012 | 227 |
| 539 | 3300005435 | Ga0070714_100043477 | Ga0070714_1000434772 | 227 |
| 540 | 3300005436 | Ga0070713_100007138 | Ga0070713_1000071387 | 227 |
| 541 | 3300005437 | Ga0070710_10004062 | Ga0070710_100040624 | 227 |
| 542 | 3300005577 | Ga0068857_100177179 | Ga0068857_1001771792 | 227 |
| 543 | 3300006028 | Ga0070717_10003247 | Ga0070717_100032473 | 227 |
| 544 | 3300006028 | Ga0070717_10142680 | Ga0070717_101426801 | 227 |
| 545 | 3300006038 | Ga0075365_10028075 | Ga0075365_100280752 | 227 |
| 546 | 3300006038 | Ga0075365_10335823 | Ga0075365_103358232 | 227 |
| 547 | 3300006042 | Ga0075368_10135139 | Ga0075368_101351392 | 227 |
| 548 | 3300006163 | Ga0070715_10000109 | Ga0070715_100001094 | 227 |
| 549 | 3300006173 | Ga0070716_100043623 | Ga0070716_1000436232 | 227 |
| 550 | 3300006175 | Ga0070712_100011266 | Ga0070712_1000112666 | 227 |
| 551 | 3300006175 | Ga0070712_100117928 | Ga0070712_1001179282 | 227 |
| 552 | 3300006353 | Ga0075370_10331425 | Ga0075370_103314252 | 227 |
| 553 | 3300006942 | Ga0099824_1011459 | Ga0099824_10114593 | 227 |
| 554 | 3300007265 | Ga0099794_10004043 | Ga0099794_100040431 | 227 |
| 555 | 3300007265 | Ga0099794_10078326 | Ga0099794_100783262 | 227 |
| 556 | 3300009093 | Ga0105240_10013956 | Ga0105240_100139568 | 227 |
| 557 | 3300009177 | Ga0105248_10909424 | Ga0105248_109094242 | 227 |
| 558 | 3300010375 | Ga0105239_10181918 | Ga0105239_101819183 | 227 |
| 559 | 3300021384 | Ga0213876_10004604 | Ga0213876_100046046 | 227 |
| 560 | 3300025245 | Ga0207425_1032449 | Ga0207425_10324492 | 227 |
| 561 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015102 | 227 |
| 562 | 3300025302 | Ga0207426_1004020 | Ga0207426_10040206 | 227 |
| 563 | 3300025303 | Ga0209051_1022112 | Ga0209051_10221122 | 227 |
| 564 | 3300025304 | Ga0209257_1006922 | Ga0209257_10069225 | 227 |
| 565 | 3300025898 | Ga0207692_10016330 | Ga0207692_100163304 | 227 |
| 566 | 3300025906 | Ga0207699_10004953 | Ga0207699_100049534 | 227 |
| 567 | 3300025909 | Ga0207705_10063380 | Ga0207705_100633802 | 227 |
| 568 | 3300025915 | Ga0207693_10000073 | Ga0207693_1000007362 | 227 |
| 569 | 3300025915 | Ga0207693_10048842 | Ga0207693_100488421 | 227 |
| 570 | 3300025916 | Ga0207663_10000222 | Ga0207663_1000022211 | 227 |
| 571 | 3300025927 | Ga0207687_10197408 | Ga0207687_101974082 | 227 |
| 572 | 3300025939 | Ga0207665_10000316 | Ga0207665_1000031612 | 227 |
| 573 | 3300026023 | Ga0207677_10154418 | Ga0207677_101544182 | 227 |
| 574 | 3300026067 | Ga0207678_10073742 | Ga0207678_100737422 | 227 |
| 575 | 3300026142 | Ga0207698_10180967 | Ga0207698_101809672 | 227 |
| 576 | 3300027296 | Ga0209389_1000051 | Ga0209389_100005186 | 227 |
| 577 | 3300027357 | Ga0209589_1000012 | Ga0209589_1000012121 | 227 |
| 578 | 3300027357 | Ga0209589_1000013 | Ga0209589_100001385 | 227 |
| 579 | 3300027361 | Ga0209489_100013 | Ga0209489_100013122 | 227 |
| 580 | 3300027866 | Ga0209813_10162563 | Ga0209813_101625631 | 227 |
| 581 | 3300028380 | Ga0268265_10526921 | Ga0268265_105269212 | 227 |
| 582 | 3300028794 | Ga0307515_10156561 | Ga0307515_101565613 | 227 |
| 583 | 3300033180 | Ga0307510_10033862 | Ga0307510_100338623 | 227 |
| 584 | 3300035089 | Ga0373944_0043490 | Ga0373944_0043490_643_1338 | 227 |
| 585 | 3300035117 | Ga0373953_0102426 | Ga0373953_0102426_224_907 | 227 |
| 586 | 3300035118 | Ga0373954_0067381 | Ga0373954_0067381_279_962 | 227 |
| 587 | 3300035724 | Ga0373933_0270831 | Ga0373933_0270831_160_852 | 227 |
| 588 | 3300036401 | Ga0373937_0059216 | Ga0373937_0059216_2164_2856 | 227 |
| 589 | 3300037312 | Ga0395899_0060576 | Ga0395899_0060576_1405_2094 | 227 |
| 590 | 3300037471 | Ga0395905_0002558 | Ga0395905_0002558_7500_8189 | 227 |
| 591 | 3300037471 | Ga0395905_0077822 | Ga0395905_0077822_1858_2547 | 227 |
| 592 | 3300039437 | Ga0436365_0217850 | Ga0436365_0217850_1343_2032 | 227 |
| 593 | 3300039437 | Ga0436365_1912827 | Ga0436365_1912827_1925_2614 | 227 |
| 594 | 3300039438 | Ga0436360_0696150 | Ga0436360_0696150_781_1473 | 227 |
| 595 | 3300039447 | Ga0436361_1126767 | Ga0436361_1126767_169_861 | 227 |
| 596 | 3300039450 | Ga0436363_0224061 | Ga0436363_0224061_950_1639 | 227 |
| 597 | 3300044656 | Ga0466969_0103404 | Ga0466969_0103404_358_1047 | 227 |
| 598 | 3300044658 | Ga0466972_0000059 | Ga0466972_0000059_2084_2773 | 227 |
| 599 | 3300044658 | Ga0466972_0128821 | Ga0466972_0128821_294_983 | 227 |
| 600 | 3300044683 | Ga0466965_0009320 | Ga0466965_0009320_173_862 | 227 |
| 601 | 3300044706 | Ga0466964_0124325 | Ga0466964_0124325_334_1023 | 227 |
| 602 | 3300044735 | Ga0466968_0121861 | Ga0466968_0121861_121_810 | 227 |
| 603 | 3300046460 | Ga0495638_0074116 | Ga0495638_0074116_1338_2036 | 227 |
| 604 | 3300046462 | Ga0495651_0181099 | Ga0495651_0181099_399_1091 | 227 |
| 605 | 3300046477 | Ga0495664_0073297 | Ga0495664_0073297_611_1294 | 227 |
| 606 | 3300046501 | Ga0495607_0017436 | Ga0495607_0017436_3512_4210 | 227 |
| 607 | 3300046507 | Ga0495606_0156206 | Ga0495606_0156206_612_1301 | 227 |
| 608 | 3300046557 | Ga0495622_0081259 | Ga0495622_0081259_95_793 | 227 |
| 609 | 3300047315 | Ga0495581_0103423 | Ga0495581_0103423_747_1436 | 227 |
| 610 | 3300047443 | Ga0495687_020238 | Ga0495687_020238_1692_2381 | 227 |
| 611 | 3300047472 | Ga0495686_0038212 | Ga0495686_0038212_1373_2062 | 227 |
| 612 | 3300047472 | Ga0495686_0060394 | Ga0495686_0060394_360_1097 | 227 |
| 613 | 3300048091 | Ga0495626_0074453 | Ga0495626_0074453_460_1158 | 227 |
| 614 | 3300048920 | Ga0496117_0027983 | Ga0496117_0027983_2990_3688 | 227 |
| 615 | 3300048921 | Ga0496118_0030470 | Ga0496118_0030470_3477_4175 | 227 |
| 616 | 3300048921 | Ga0496118_0038317 | Ga0496118_0038317_868_1566 | 227 |
| 617 | 3300048922 | Ga0496119_0094486 | Ga0496119_0094486_515_1213 | 227 |
| 618 | 3300048924 | Ga0496121_0002503 | Ga0496121_0002503_22457_23170 | 227 |
| 619 | 3300048924 | Ga0496121_0009424 | Ga0496121_0009424_2269_3006 | 227 |
| 620 | 3300048924 | Ga0496121_0364213 | Ga0496121_0364213_38_727 | 227 |
| 621 | 3300048925 | Ga0496122_0033320 | Ga0496122_0033320_1046_1741 | 227 |
| 622 | 3300048925 | Ga0496122_0071910 | Ga0496122_0071910_48_746 | 227 |
| 623 | 3300048926 | Ga0496123_0023676 | Ga0496123_0023676_55_753 | 227 |
| 624 | 3300048926 | Ga0496123_0133297 | Ga0496123_0133297_72_767 | 227 |
| 625 | 3300048927 | Ga0496124_0220903 | Ga0496124_0220903_270_968 | 227 |
| 626 | 3300048928 | Ga0496125_0000398 | Ga0496125_0000398_58558_59253 | 227 |
| 627 | 3300048928 | Ga0496125_0009727 | Ga0496125_0009727_8224_8919 | 227 |
| 628 | 3300048929 | Ga0496126_0163053 | Ga0496126_0163053_381_1064 | 227 |
| 629 | 3300050492 | nmdc:mga0yw44_218233_c2 | nmdc:mga0yw44_218233_c2_213_902 | 227 |
| 630 | 3300050492 | nmdc:mga0yw44_292730_c1 | nmdc:mga0yw44_292730_c1_212_910 | 227 |
| 631 | 3300050494 | nmdc:mga06z11_291154_c1 | nmdc:mga06z11_291154_c1_232_930 | 227 |
| 632 | 3300050495 | nmdc:mga04h51_161773_c1 | nmdc:mga04h51_161773_c1_126_824 | 227 |
| 633 | 3300050496 | nmdc:mga07m45_27605_c1 | nmdc:mga07m45_27605_c1_1672_2370 | 227 |
| 634 | 3300053077 | Ga0495601_0033060 | Ga0495601_0033060_769_1452 | 227 |
| 635 | 3300053078 | Ga0495612_0217938 | Ga0495612_0217938_16_699 | 227 |
| 636 | 3300053080 | Ga0500635_0027829 | Ga0500635_0027829_11_700 | 227 |
| 637 | 3300053087 | Ga0500643_000163 | Ga0500643_000163_64984_65673 | 227 |
| 638 | 3300053091 | Ga0500647_0041005 | Ga0500647_0041005_1050_1739 | 227 |
| 639 | 3300053094 | Ga0500566_0001842 | Ga0500566_0001842_11523_12221 | 227 |
| 640 | 3300053094 | Ga0500566_0134777 | Ga0500566_0134777_14_703 | 227 |
| 641 | 3300053095 | Ga0500640_022067 | Ga0500640_022067_1644_2333 | 227 |
| 642 | 3300053103 | Ga0500555_000884 | Ga0500555_000884_3124_3813 | 227 |
| 643 | 3300053104 | Ga0500556_0114936 | Ga0500556_0114936_183_872 | 227 |
| 644 | 3300053105 | Ga0500557_000051 | Ga0500557_000051_8162_8851 | 227 |
| 645 | 3300053109 | Ga0500569_025542 | Ga0500569_025542_686_1375 | 227 |
| 646 | 3300053111 | Ga0500572_147906 | Ga0500572_147906_54_743 | 227 |
| 647 | 3300053119 | Ga0500595_001454 | Ga0500595_001454_4791_5528 | 227 |
| 648 | 3300053121 | Ga0500607_094992 | Ga0500607_094992_755_1453 | 227 |
| 649 | 3300053121 | Ga0500607_158935 | Ga0500607_158935_171_860 | 227 |
| 650 | 3300053122 | Ga0500608_046176 | Ga0500608_046176_1053_1742 | 227 |
| 651 | 3300053122 | Ga0500608_046742 | Ga0500608_046742_699_1397 | 227 |
| 652 | 3300053133 | Ga0500655_026635 | Ga0500655_026635_57_746 | 227 |
| 653 | 3300053134 | Ga0500658_0070331 | Ga0500658_0070331_749_1438 | 227 |
| 654 | 3300053136 | Ga0500559_0000268 | Ga0500559_0000268_17259_17957 | 227 |
| 655 | 3300053138 | Ga0500564_106525 | Ga0500564_106525_381_1070 | 227 |
| 656 | 3300053139 | Ga0500568_0004979 | Ga0500568_0004979_2386_3084 | 227 |
| 657 | 3300053139 | Ga0500568_0019783 | Ga0500568_0019783_678_1367 | 227 |
| 658 | 3300053142 | Ga0500577_0075168 | Ga0500577_0075168_601_1296 | 227 |
| 659 | 3300053145 | Ga0500586_006324 | Ga0500586_006324_369_1067 | 227 |
| 660 | 3300053147 | Ga0500589_106367 | Ga0500589_106367_315_1004 | 227 |
| 661 | 3300053148 | Ga0500590_025050 | Ga0500590_025050_1614_2303 | 227 |
| 662 | 3300053151 | Ga0500604_0017960 | Ga0500604_0017960_972_1661 | 227 |
| 663 | 3300053151 | Ga0500604_0028984 | Ga0500604_0028984_40_738 | 227 |
| 664 | 3300053154 | Ga0500619_127736 | Ga0500619_127736_166_855 | 227 |
| 665 | 3300053158 | Ga0500627_0054862 | Ga0500627_0054862_999_1688 | 227 |
| 666 | 3300053177 | Ga0500636_0001663 | Ga0500636_0001663_7432_8121 | 227 |
| 667 | 3300053177 | Ga0500636_0008037 | Ga0500636_0008037_1237_1935 | 227 |
| 668 | 3300053722 | Ga0500649_118707 | Ga0500649_118707_249_938 | 227 |
| 669 | 3300053729 | Ga0500625_015823 | Ga0500625_015823_2637_3326 | 227 |
| 670 | 3300053737 | Ga0500601_000760 | Ga0500601_000760_2305_2994 | 227 |
| 671 | iso_pu_bacteria | 3005710791 | 3005717992 | 227 |
| 672 | iso_pu_bacteria | 8016583857 | 8016586709 | 227 |
| 673 | 3300003203 | JGI25406J46586_10002939 | JGI25406J46586_1000293912 | 228 |
| 674 | 3300003322 | rootL2_10014174 | rootL2_100141741 | 228 |
| 675 | 3300003354 | JGI25160J50197_1007311 | JGI25160J50197_10073112 | 228 |
| 676 | 3300003659 | JGI25404J52841_10009041 | JGI25404J52841_100090412 | 228 |
| 677 | 3300003659 | JGI25404J52841_10023969 | JGI25404J52841_100239692 | 228 |
| 678 | 3300005327 | Ga0070658_10082475 | Ga0070658_100824753 | 228 |
| 679 | 3300005327 | Ga0070658_10515471 | Ga0070658_105154711 | 228 |
| 680 | 3300005339 | Ga0070660_100302526 | Ga0070660_1003025261 | 228 |
| 681 | 3300005344 | Ga0070661_100572237 | Ga0070661_1005722371 | 228 |
| 682 | 3300005366 | Ga0070659_100019746 | Ga0070659_1000197465 | 228 |
| 683 | 3300005434 | Ga0070709_10006312 | Ga0070709_100063124 | 228 |
| 684 | 3300005435 | Ga0070714_101052084 | Ga0070714_1010520841 | 228 |
| 685 | 3300005436 | Ga0070713_100185916 | Ga0070713_1001859162 | 228 |
| 686 | 3300005437 | Ga0070710_10255693 | Ga0070710_102556932 | 228 |
| 687 | 3300005439 | Ga0070711_100154851 | Ga0070711_1001548512 | 228 |
| 688 | 3300005471 | Ga0070698_100205477 | Ga0070698_1002054772 | 228 |
| 689 | 3300005530 | Ga0070679_100401000 | Ga0070679_1004010002 | 228 |
| 690 | 3300005614 | Ga0068856_100276734 | Ga0068856_1002767342 | 228 |
| 691 | 3300005937 | Ga0081455_10003129 | Ga0081455_100031297 | 228 |
| 692 | 3300005937 | Ga0081455_10005099 | Ga0081455_1000509911 | 228 |
| 693 | 3300005937 | Ga0081455_10172765 | Ga0081455_101727652 | 228 |
| 694 | 3300005983 | Ga0081540_1008204 | Ga0081540_10082045 | 228 |
| 695 | 3300005983 | Ga0081540_1010671 | Ga0081540_10106711 | 228 |
| 696 | 3300005983 | Ga0081540_1049990 | Ga0081540_10499902 | 228 |
| 697 | 3300005983 | Ga0081540_1053693 | Ga0081540_10536931 | 228 |
| 698 | 3300005983 | Ga0081540_1071200 | Ga0081540_10712002 | 228 |
| 699 | 3300006038 | Ga0075365_10031542 | Ga0075365_100315422 | 228 |
| 700 | 3300006038 | Ga0075365_10349122 | Ga0075365_103491222 | 228 |
| 701 | 3300006051 | Ga0075364_10094530 | Ga0075364_100945302 | 228 |
| 702 | 3300006051 | Ga0075364_10171955 | Ga0075364_101719552 | 228 |
| 703 | 3300006051 | Ga0075364_10459824 | Ga0075364_104598242 | 228 |
| 704 | 3300006173 | Ga0070716_100173005 | Ga0070716_1001730052 | 228 |
| 705 | 3300006175 | Ga0070712_100008123 | Ga0070712_1000081232 | 228 |
| 706 | 3300006175 | Ga0070712_100167898 | Ga0070712_1001678982 | 228 |
| 707 | 3300006195 | Ga0075366_10233189 | Ga0075366_102331892 | 228 |
| 708 | 3300006353 | Ga0075370_10053233 | Ga0075370_100532332 | 228 |
| 709 | 3300006942 | Ga0099824_1038190 | Ga0099824_10381902 | 228 |
| 710 | 3300006944 | Ga0099823_1055347 | Ga0099823_10553472 | 228 |
| 711 | 3300010159 | Ga0099796_10012847 | Ga0099796_100128472 | 228 |
| 712 | 3300013104 | Ga0157370_10352394 | Ga0157370_103523942 | 228 |
| 713 | 3300013308 | Ga0157375_10633899 | Ga0157375_106338993 | 228 |
| 714 | 3300025273 | Ga0209673_1041175 | Ga0209673_10411752 | 228 |
| 715 | 3300025297 | Ga0209758_1000692 | Ga0209758_100069235 | 228 |
| 716 | 3300025302 | Ga0207426_1000201 | Ga0207426_100020167 | 228 |
| 717 | 3300025304 | Ga0209257_1043698 | Ga0209257_10436982 | 228 |
| 718 | 3300025898 | Ga0207692_10003125 | Ga0207692_100031253 | 228 |
| 719 | 3300025906 | Ga0207699_10011179 | Ga0207699_100111792 | 228 |
| 720 | 3300025909 | Ga0207705_10148279 | Ga0207705_101482792 | 228 |
| 721 | 3300025909 | Ga0207705_10174065 | Ga0207705_101740652 | 228 |
| 722 | 3300025915 | Ga0207693_10008082 | Ga0207693_100080827 | 228 |
| 723 | 3300025916 | Ga0207663_10050152 | Ga0207663_100501523 | 228 |
| 724 | 3300025919 | Ga0207657_10006481 | Ga0207657_1000648110 | 228 |
| 725 | 3300025928 | Ga0207700_10243506 | Ga0207700_102435062 | 228 |
| 726 | 3300025932 | Ga0207690_10245023 | Ga0207690_102450232 | 228 |
| 727 | 3300025939 | Ga0207665_10069246 | Ga0207665_100692462 | 228 |
| 728 | 3300027296 | Ga0209389_1000064 | Ga0209389_100006444 | 228 |
| 729 | 3300027361 | Ga0209489_102226 | Ga0209489_10222626 | 228 |
| 730 | 3300027363 | Ga0209700_100014 | Ga0209700_100014167 | 228 |
| 731 | 3300027512 | Ga0209179_1004497 | Ga0209179_10044971 | 228 |
| 732 | 3300031238 | Ga0265332_10016245 | Ga0265332_100162455 | 228 |
| 733 | 3300031712 | Ga0265342_10105013 | Ga0265342_101050132 | 228 |
| 734 | 3300035086 | Ga0373934_0002860 | Ga0373934_0002860_1086_1772 | 228 |
| 735 | 3300035242 | Ga0373962_0077044 | Ga0373962_0077044_109_795 | 228 |
| 736 | 3300035724 | Ga0373933_0000173 | Ga0373933_0000173_22226_22918 | 228 |
| 737 | 3300036534 | Ga0310109_024188 | Ga0310109_024188_97_789 | 228 |
| 738 | 3300037068 | Ga0373925_0027030 | Ga0373925_0027030_1728_2414 | 228 |
| 739 | 3300037312 | Ga0395899_0098584 | Ga0395899_0098584_14_703 | 228 |
| 740 | 3300037418 | Ga0395900_0312439 | Ga0395900_0312439_371_1060 | 228 |
| 741 | 3300037466 | Ga0395898_0317064 | Ga0395898_0317064_471_1160 | 228 |
| 742 | 3300041456 | Ga0451795_0339562 | Ga0451795_0339562_102_797 | 228 |
| 743 | 3300041491 | Ga0451833_0705105 | Ga0451833_0705105_433_1125 | 228 |
| 744 | 3300041494 | Ga0451837_1393955 | Ga0451837_1393955_54_746 | 228 |
| 745 | 3300041512 | Ga0451853_2342626 | Ga0451853_2342626_61_753 | 228 |
| 746 | 3300044683 | Ga0466965_0013307 | Ga0466965_0013307_2136_2828 | 228 |
| 747 | 3300044901 | Ga0466960_0115953 | Ga0466960_0115953_144_836 | 228 |
| 748 | 3300045976 | Ga0466967_0412536 | Ga0466967_0412536_258_950 | 228 |
| 749 | 3300046472 | Ga0495580_0246803 | Ga0495580_0246803_357_1043 | 228 |
| 750 | 3300046477 | Ga0495664_0331665 | Ga0495664_0331665_50_736 | 228 |
| 751 | 3300046679 | Ga0495623_0220248 | Ga0495623_0220248_331_1017 | 228 |
| 752 | 3300046794 | Ga0495589_0236348 | Ga0495589_0236348_76_765 | 228 |
| 753 | 3300048908 | Ga0496105_0090512 | Ga0496105_0090512_122_814 | 228 |
| 754 | 3300048915 | Ga0496112_0139058 | Ga0496112_0139058_236_922 | 228 |
| 755 | 3300048918 | Ga0496115_0242677 | Ga0496115_0242677_700_1386 | 228 |
| 756 | 3300048927 | Ga0496124_0201280 | Ga0496124_0201280_23_715 | 228 |
| 757 | 3300048929 | Ga0496126_0007757 | Ga0496126_0007757_410_1102 | 228 |
| 758 | 3300048929 | Ga0496126_0020992 | Ga0496126_0020992_3045_3755 | 228 |
| 759 | 3300048929 | Ga0496126_0039870 | Ga0496126_0039870_1043_1729 | 228 |
| 760 | 3300049568 | Ga0501031_0132018 | Ga0501031_0132018_505_1197 | 228 |
| 761 | 3300049569 | Ga0501032_0295519 | Ga0501032_0295519_161_850 | 228 |
| 762 | 3300049570 | Ga0501033_0025424 | Ga0501033_0025424_413_1102 | 228 |
| 763 | 3300049570 | Ga0501033_0029630 | Ga0501033_0029630_856_1548 | 228 |
| 764 | 3300049571 | Ga0501034_0231809 | Ga0501034_0231809_88_777 | 228 |
| 765 | 3300049571 | Ga0501034_0352834 | Ga0501034_0352834_36_725 | 228 |
| 766 | 3300049572 | Ga0501036_0063511 | Ga0501036_0063511_2162_2851 | 228 |
| 767 | 3300049573 | Ga0501037_0064363 | Ga0501037_0064363_1797_2489 | 228 |
| 768 | 3300049573 | Ga0501037_0072169 | Ga0501037_0072169_1161_1850 | 228 |
| 769 | 3300049574 | Ga0501038_0004453 | Ga0501038_0004453_8686_9378 | 228 |
| 770 | 3300049574 | Ga0501038_0256777 | Ga0501038_0256777_560_1252 | 228 |
| 771 | 3300049575 | Ga0501039_0251179 | Ga0501039_0251179_281_973 | 228 |
| 772 | 3300049575 | Ga0501039_0364939 | Ga0501039_0364939_329_1021 | 228 |
| 773 | 3300049579 | Ga0501043_0005382 | Ga0501043_0005382_8898_9590 | 228 |
| 774 | 3300049579 | Ga0501043_0241646 | Ga0501043_0241646_141_833 | 228 |
| 775 | 3300049580 | Ga0501046_0036217 | Ga0501046_0036217_1634_2323 | 228 |
| 776 | 3300049581 | Ga0501047_0165409 | Ga0501047_0165409_951_1640 | 228 |
| 777 | 3300049581 | Ga0501047_0183872 | Ga0501047_0183872_367_1059 | 228 |
| 778 | 3300049581 | Ga0501047_0253123 | Ga0501047_0253123_748_1440 | 228 |
| 779 | 3300049581 | Ga0501047_0263994 | Ga0501047_0263994_344_1036 | 228 |
| 780 | 3300049581 | Ga0501047_0315296 | Ga0501047_0315296_581_1270 | 228 |
| 781 | 3300049586 | Ga0501070_0127813 | Ga0501070_0127813_984_1676 | 228 |
| 782 | 3300049586 | Ga0501070_0285000 | Ga0501070_0285000_576_1265 | 228 |
| 783 | 3300049741 | Ga0501079_0456727 | Ga0501079_0456727_197_886 | 228 |
| 784 | 3300049742 | Ga0501080_0051614 | Ga0501080_0051614_555_1247 | 228 |
| 785 | 3300049822 | Ga0501035_0061642 | Ga0501035_0061642_1087_1779 | 228 |
| 786 | 3300049822 | Ga0501035_0077755 | Ga0501035_0077755_2118_2807 | 228 |
| 787 | 3300049823 | Ga0501044_0007879 | Ga0501044_0007879_2410_3102 | 228 |
| 788 | 3300049823 | Ga0501044_0009525 | Ga0501044_0009525_660_1352 | 228 |
| 789 | 3300049823 | Ga0501044_0034204 | Ga0501044_0034204_4472_5161 | 228 |
| 790 | 3300049823 | Ga0501044_0075196 | Ga0501044_0075196_730_1419 | 228 |
| 791 | 3300049823 | Ga0501044_0404330 | Ga0501044_0404330_445_1137 | 228 |
| 792 | 3300050491 | nmdc:mga00v17_424279_c1 | nmdc:mga00v17_424279_c1_51_743 | 228 |
| 793 | 3300050492 | nmdc:mga0yw44_128862_c1 | nmdc:mga0yw44_128862_c1_671_1363 | 228 |
| 794 | 3300050492 | nmdc:mga0yw44_386378_c1 | nmdc:mga0yw44_386378_c1_223_915 | 228 |
| 795 | 3300050492 | nmdc:mga0yw44_45427_c1 | nmdc:mga0yw44_45427_c1_893_1585 | 228 |
| 796 | 3300050493 | nmdc:mga0k408_219068_c1 | nmdc:mga0k408_219068_c1_249_941 | 228 |
| 797 | 3300050494 | nmdc:mga06z11_160979_c1 | nmdc:mga06z11_160979_c1_540_1232 | 228 |
| 798 | 3300050496 | nmdc:mga07m45_124902_c1 | nmdc:mga07m45_124902_c1_52_744 | 228 |
| 799 | 3300050496 | nmdc:mga07m45_34927_c1 | nmdc:mga07m45_34927_c1_848_1540 | 228 |
| 800 | 3300050512 | nmdc:mga0n895_150416_c1 | nmdc:mga0n895_150416_c1_1170_1856 | 228 |
| 801 | 3300053085 | Ga0495619_0114415 | Ga0495619_0114415_344_1030 | 228 |
| 802 | 3300053130 | Ga0500642_0000117 | Ga0500642_0000117_6659_7351 | 228 |
| 803 | 3300060353 | Ga0501082_0413245 | Ga0501082_0413245_35_727 | 228 |
| 804 | iso_pu_bacteria | 2513237092 | 2513626695 | 228 |
| 805 | iso_pu_bacteria | 2517093001 | 2517102316 | 228 |
| 806 | iso_pu_bacteria | 2824704595 | 2824713993 | 228 |
| 807 | iso_pu_bacteria | 2824753945 | 2824757051 | 228 |
| 808 | iso_pu_bacteria | 2824763712 | 2824768387 | 228 |
| 809 | iso_pu_bacteria | 2885409591 | 2885411237 | 228 |
| 810 | iso_pu_bacteria | 2904711408 | 2904716246 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lp8-assembly1.cif.gz_A | a novel open-state crystal structure of the prokaryotic inward rectifier kirbac3.1 | 0.8563 | 125 | 222 |
| 2wlj-assembly1.cif.gz_A-2 | potassium channel from magnetospirillum magnetotacticum | 0.8205 | 128 | 220 |
| 2wln-assembly1.cif.gz_A | potassium channel from magnetospirillum magnetotacticum | 0.8193 | 125 | 222 |
| 2wlk-assembly1.cif.gz_A | structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum | 0.8171 | 125 | 220 |
| 7cal-assembly1.cif.gz_A | cryo-em structure of the hyperpolarization-activated inwardly rectifying potassium channel kat1 from arabidopsis | 0.8149 | 123 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KPW5_139_236_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8456 | 131 | 227 | 1.10.287.70 |
| af_F1RB62_245_342_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8253 | 125 | 227 | 1.10.287.70 |
| af_F1Q5A8_239_336_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8248 | 125 | 227 | 1.10.287.70 |
| 2wlkA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7906 | 125 | 222 | 1.10.287.70 |
| 2wllA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7887 | 125 | 222 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1BG24-F1-model_v4 | DUF1345 domain-containing protein | 0.949 | 6 | 228 |
GO:0016020
|
| AF-A0A257QQL1-F1-model_v4 | DUF1345 domain-containing protein | 0.9442 | 18 | 151 |
GO:0016020
|
| AF-A0A3S0F7T0-F1-model_v4 | DUF1345 domain-containing protein | 0.9346 | 17 | 227 |
GO:0016020
|
| AF-A0A6P1BG24-F1-model_v4 | DUF1345 domain-containing protein | 0.9328 | 6 | 228 |
GO:0016020
|
| AF-A0A258EF71-F1-model_v4 | DUF1345 domain-containing protein | 0.9304 | 29 | 227 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar