F481712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 808 | 365 | 805 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300006880|Ga0075429_100037897|Ga0075429_1000378972 |
| Length | 318 |
| Sequence | MKLPRNFFQPLAIGAPAPLRELPVRLERMIHFDVVLGNLEDAIPADAKTAARAGFIAMAKASEFGSTGLWTRINALNSPWALDDAAEIVAAVGQKLDVIMLPKVEGPWDIHYLDQLLAQLEARHAVKKPILIHAILETAQGVNNVEAIATASPRMHGMSLGPADLAASRAMKTTRVGGGHPDYKVLADPSPAGGARAAFQQDLWHYTLAKMVDACAAAGIKPFYGPFGDFADPDACEAQFRNAFLMGCVGAWTLHPSQVPIAKRVFSPDIAAMPDGSGAVMIDGKMQDDATWKQAKVLIDLARLVAAKDPDLAARYAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 3 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 4 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 259 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.37 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.72 |
| Nodule | 0 |
| Rhizoplane | 10.77 |
| Rhizosphere | 85.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_100456 | 3300001430 | Bacteria | 2136 |
| 2 | JGI24741J21665_1009374 | 3300001915 | Bacteria | 1800 |
| 3 | JGI24746J21847_1007086 | 3300001977 | Bacteria | 1722 |
| 4 | JGI24739J22299_10005177 | 3300001989 | Bacteria | 4969 |
| 5 | JGI24737J22298_10007210 | 3300001990 | Bacteria | 3761 |
| 6 | JGI24737J22298_10021923 | 3300001990 | Bacteria | 2031 |
| 7 | JGI24743J22301_10004958 | 3300001991 | Bacteria | 2196 |
| 8 | JGI24750J21931_1000172 | 3300002070 | Bacteria | 10780 |
| 9 | JGI24748J21848_1000609 | 3300002074 | Bacteria | 3845 |
| 10 | JGI24738J21930_10000223 | 3300002075 | Bacteria | 15332 |
| 11 | JGI24749J21850_1001214 | 3300002076 | Bacteria | 3661 |
| 12 | JGI24744J21845_10000129 | 3300002077 | Bacteria | 10529 |
| 13 | JGI24034J26672_10003265 | 3300002239 | Bacteria | 2261 |
| 14 | JGI24742J22300_10001901 | 3300002244 | Bacteria | 3324 |
| 15 | JGI24751J29686_10002778 | 3300002459 | Bacteria | 3520 |
| 16 | JGI25153J46596_10008419 | 3300003215 | Bacteria | 4930 |
| 17 | Ga0065712_10095195 | 3300005290 | Bacteria | 2227 |
| 18 | Ga0065715_10091352 | 3300005293 | Bacteria | 5838 |
| 19 | Ga0070676_10000012 | 3300005328 | Bacteria | 58061 |
| 20 | Ga0070676_10031623 | 3300005328 | Bacteria | 3026 |
| 21 | Ga0070683_100000139 | 3300005329 | Bacteria | 46987 |
| 22 | Ga0070683_100079414 | 3300005329 | Bacteria | 3071 |
| 23 | Ga0070690_100032762 | 3300005330 | Bacteria | 3248 |
| 24 | Ga0070670_100006320 | 3300005331 | Bacteria | 10026 |
| 25 | Ga0070670_100006855 | 3300005331 | Bacteria | 9652 |
| 26 | Ga0070677_10000125 | 3300005333 | Bacteria | 25491 |
| 27 | Ga0068869_100000605 | 3300005334 | Bacteria | 20215 |
| 28 | Ga0068869_100101609 | 3300005334 | Bacteria | 2175 |
| 29 | Ga0070666_10020349 | 3300005335 | Bacteria | 4289 |
| 30 | Ga0070666_10124051 | 3300005335 | Bacteria | 1792 |
| 31 | Ga0070680_100000179 | 3300005336 | Bacteria | 40975 |
| 32 | Ga0070682_100000565 | 3300005337 | Bacteria | 22802 |
| 33 | Ga0068868_100001158 | 3300005338 | Bacteria | 18075 |
| 34 | Ga0070660_100001605 | 3300005339 | Bacteria | 15534 |
| 35 | Ga0070689_100000190 | 3300005340 | Bacteria | 37316 |
| 36 | Ga0070691_10000706 | 3300005341 | Bacteria | 13041 |
| 37 | Ga0070691_10094402 | 3300005341 | Bacteria | 1479 |
| 38 | Ga0070687_100003795 | 3300005343 | Bacteria | 5928 |
| 39 | Ga0070661_100001455 | 3300005344 | Bacteria | 16432 |
| 40 | Ga0070692_10000434 | 3300005345 | Bacteria | 12695 |
| 41 | Ga0070692_10019972 | 3300005345 | Bacteria | 3241 |
| 42 | Ga0070668_100000597 | 3300005347 | Bacteria | 24181 |
| 43 | Ga0070668_100080948 | 3300005347 | Bacteria | 2545 |
| 44 | Ga0070668_100195394 | 3300005347 | Bacteria | 1659 |
| 45 | Ga0070669_100000409 | 3300005353 | Bacteria | 32911 |
| 46 | Ga0070669_100083771 | 3300005353 | Bacteria | 2378 |
| 47 | Ga0070675_100000166 | 3300005354 | Bacteria | 40573 |
| 48 | Ga0070675_100032912 | 3300005354 | Bacteria | 4199 |
| 49 | Ga0070671_100009212 | 3300005355 | Bacteria | 7929 |
| 50 | Ga0070671_100042470 | 3300005355 | Bacteria | 3779 |
| 51 | Ga0070671_100125673 | 3300005355 | Bacteria | 2159 |
| 52 | Ga0070671_100213033 | 3300005355 | Bacteria | 1639 |
| 53 | Ga0070674_100000084 | 3300005356 | Bacteria | 43585 |
| 54 | Ga0070673_100000041 | 3300005364 | Bacteria | 54096 |
| 55 | Ga0070688_100000180 | 3300005365 | Bacteria | 33887 |
| 56 | Ga0070688_100009381 | 3300005365 | Bacteria | 5348 |
| 57 | Ga0070659_100000752 | 3300005366 | Bacteria | 23551 |
| 58 | Ga0070659_100035031 | 3300005366 | Bacteria | 3906 |
| 59 | Ga0070667_100000365 | 3300005367 | Bacteria | 49335 |
| 60 | Ga0070667_100102800 | 3300005367 | Bacteria | 2469 |
| 61 | Ga0070703_10000903 | 3300005406 | Bacteria | 9460 |
| 62 | Ga0070709_10133446 | 3300005434 | Bacteria | 1698 |
| 63 | Ga0070714_100048797 | 3300005435 | Bacteria | 3601 |
| 64 | Ga0070710_10076323 | 3300005437 | Bacteria | 1945 |
| 65 | Ga0070710_10121752 | 3300005437 | Bacteria | 1580 |
| 66 | Ga0070701_10000493 | 3300005438 | Bacteria | 13517 |
| 67 | Ga0070701_10021044 | 3300005438 | Bacteria | 3106 |
| 68 | Ga0070711_100009896 | 3300005439 | Bacteria | 5879 |
| 69 | Ga0070711_100082736 | 3300005439 | Bacteria | 2291 |
| 70 | Ga0070711_100248195 | 3300005439 | Bacteria | 1395 |
| 71 | Ga0070705_100001328 | 3300005440 | Bacteria | 13230 |
| 72 | Ga0070705_100005755 | 3300005440 | Bacteria | 6057 |
| 73 | Ga0070700_100000467 | 3300005441 | Bacteria | 20231 |
| 74 | Ga0070700_100022512 | 3300005441 | Bacteria | 3675 |
| 75 | Ga0070700_100023506 | 3300005441 | Bacteria | 3605 |
| 76 | Ga0070694_100000065 | 3300005444 | Bacteria | 49515 |
| 77 | Ga0070708_100023359 | 3300005445 | Bacteria | 5259 |
| 78 | Ga0070663_100000473 | 3300005455 | Bacteria | 21137 |
| 79 | Ga0070663_100040620 | 3300005455 | Bacteria | 3258 |
| 80 | Ga0070678_100000091 | 3300005456 | Bacteria | 34559 |
| 81 | Ga0070678_100264345 | 3300005456 | Bacteria | 1448 |
| 82 | Ga0070662_100000629 | 3300005457 | Bacteria | 21333 |
| 83 | Ga0070662_100007924 | 3300005457 | Bacteria | 6908 |
| 84 | Ga0070681_10025730 | 3300005458 | Bacteria | 5917 |
| 85 | Ga0070681_10068737 | 3300005458 | Bacteria | 3509 |
| 86 | Ga0070681_10161798 | 3300005458 | Bacteria | 2162 |
| 87 | Ga0070681_10291287 | 3300005458 | Bacteria | 1542 |
| 88 | Ga0070681_10328512 | 3300005458 | Bacteria | 1439 |
| 89 | Ga0068867_100001090 | 3300005459 | Bacteria | 18551 |
| 90 | Ga0070685_10002067 | 3300005466 | Bacteria | 10381 |
| 91 | Ga0070685_10009274 | 3300005466 | Bacteria | 5080 |
| 92 | Ga0070699_100135624 | 3300005518 | Bacteria | 2171 |
| 93 | Ga0070699_100276328 | 3300005518 | Bacteria | 1504 |
| 94 | Ga0070679_100015891 | 3300005530 | Bacteria | 7244 |
| 95 | Ga0070679_100055203 | 3300005530 | Bacteria | 3956 |
| 96 | Ga0070679_100138981 | 3300005530 | Bacteria | 2410 |
| 97 | Ga0070679_100244606 | 3300005530 | Bacteria | 1751 |
| 98 | Ga0070684_100000219 | 3300005535 | Bacteria | 39995 |
| 99 | Ga0070684_100055171 | 3300005535 | Bacteria | 3463 |
| 100 | Ga0068853_100000600 | 3300005539 | Bacteria | 24713 |
| 101 | Ga0070672_100000019 | 3300005543 | Bacteria | 69855 |
| 102 | Ga0070672_100028026 | 3300005543 | Bacteria | 4209 |
| 103 | Ga0070686_100000318 | 3300005544 | Bacteria | 31671 |
| 104 | Ga0070686_100004396 | 3300005544 | Bacteria | 7773 |
| 105 | Ga0070686_100166544 | 3300005544 | Bacteria | 1555 |
| 106 | Ga0070695_100000474 | 3300005545 | Bacteria | 20848 |
| 107 | Ga0070695_100004709 | 3300005545 | Bacteria | 8023 |
| 108 | Ga0070696_100009125 | 3300005546 | Bacteria | 6642 |
| 109 | Ga0070693_100000036 | 3300005547 | Bacteria | 50540 |
| 110 | Ga0070665_100485364 | 3300005548 | Bacteria | 1246 |
| 111 | Ga0070704_100000252 | 3300005549 | Bacteria | 23218 |
| 112 | Ga0068855_100019218 | 3300005563 | Bacteria | 8212 |
| 113 | Ga0068855_100062526 | 3300005563 | Bacteria | 4346 |
| 114 | Ga0070664_100000819 | 3300005564 | Bacteria | 23927 |
| 115 | Ga0070664_100016265 | 3300005564 | Bacteria | 6098 |
| 116 | Ga0068857_100000768 | 3300005577 | Bacteria | 23872 |
| 117 | Ga0068854_100000179 | 3300005578 | Bacteria | 43176 |
| 118 | Ga0068856_100003866 | 3300005614 | Bacteria | 15030 |
| 119 | Ga0068856_100018775 | 3300005614 | Bacteria | 6706 |
| 120 | Ga0070702_100000071 | 3300005615 | Bacteria | 28864 |
| 121 | Ga0070702_100007222 | 3300005615 | Bacteria | 5308 |
| 122 | Ga0068852_100002121 | 3300005616 | Bacteria | 13586 |
| 123 | Ga0068852_100026665 | 3300005616 | Bacteria | 4701 |
| 124 | Ga0068852_100095205 | 3300005616 | Bacteria | 2673 |
| 125 | Ga0068859_100001870 | 3300005617 | Bacteria | 21434 |
| 126 | Ga0068859_100007104 | 3300005617 | Bacteria | 11364 |
| 127 | Ga0068864_100000429 | 3300005618 | Bacteria | 36391 |
| 128 | Ga0068864_100004309 | 3300005618 | Bacteria | 11700 |
| 129 | Ga0068866_10000461 | 3300005718 | Bacteria | 18602 |
| 130 | Ga0068866_10013137 | 3300005718 | Bacteria | 3624 |
| 131 | Ga0068861_100000169 | 3300005719 | Bacteria | 34559 |
| 132 | Ga0068861_100462030 | 3300005719 | Bacteria | 1140 |
| 133 | Ga0068851_10019416 | 3300005834 | Bacteria | 3284 |
| 134 | Ga0068870_10000586 | 3300005840 | Bacteria | 13817 |
| 135 | Ga0068870_10008422 | 3300005840 | Bacteria | 4638 |
| 136 | Ga0068863_100000381 | 3300005841 | Bacteria | 45003 |
| 137 | Ga0068858_100030479 | 3300005842 | Bacteria | 5008 |
| 138 | Ga0068858_100272187 | 3300005842 | Bacteria | 1612 |
| 139 | Ga0068860_100001472 | 3300005843 | Bacteria | 25432 |
| 140 | Ga0068860_100026330 | 3300005843 | Bacteria | 5607 |
| 141 | Ga0068860_100108763 | 3300005843 | Bacteria | 2650 |
| 142 | Ga0068860_100207999 | 3300005843 | Bacteria | 1898 |
| 143 | Ga0068862_100001886 | 3300005844 | Bacteria | 19006 |
| 144 | Ga0068862_100027295 | 3300005844 | Bacteria | 4805 |
| 145 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 146 | Ga0081455_10011279 | 3300005937 | Bacteria | 8992 |
| 147 | Ga0081455_10035188 | 3300005937 | Bacteria | 4478 |
| 148 | Ga0081455_10062655 | 3300005937 | Bacteria | 3125 |
| 149 | Ga0081538_10120736 | 3300005981 | Bacteria | 1260 |
| 150 | Ga0081540_1000257 | 3300005983 | Bacteria | 55989 |
| 151 | Ga0081540_1000642 | 3300005983 | Bacteria | 33163 |
| 152 | Ga0081540_1015934 | 3300005983 | Bacteria | 4736 |
| 153 | Ga0081540_1029094 | 3300005983 | Bacteria | 3086 |
| 154 | Ga0070717_10120012 | 3300006028 | Bacteria | 2251 |
| 155 | Ga0070717_10177703 | 3300006028 | Bacteria | 1854 |
| 156 | Ga0075365_10039649 | 3300006038 | Bacteria | 3068 |
| 157 | Ga0075365_10074111 | 3300006038 | Bacteria | 2295 |
| 158 | Ga0075368_10020103 | 3300006042 | Bacteria | 2525 |
| 159 | Ga0075364_10061544 | 3300006051 | Bacteria | 2463 |
| 160 | Ga0070715_10011354 | 3300006163 | Bacteria | 3206 |
| 161 | Ga0075362_10018081 | 3300006177 | Bacteria | 2912 |
| 162 | Ga0075362_10019138 | 3300006177 | Bacteria | 2843 |
| 163 | Ga0075367_10073241 | 3300006178 | Bacteria | 2063 |
| 164 | Ga0075367_10109742 | 3300006178 | Bacteria | 1692 |
| 165 | Ga0075367_10208496 | 3300006178 | Bacteria | 1222 |
| 166 | Ga0075367_10232869 | 3300006178 | Bacteria | 1153 |
| 167 | Ga0075369_10008059 | 3300006186 | Bacteria | 4039 |
| 168 | Ga0075366_10018043 | 3300006195 | Bacteria | 4073 |
| 169 | Ga0097621_100001234 | 3300006237 | Bacteria | 17707 |
| 170 | Ga0097621_100032849 | 3300006237 | Bacteria | 4128 |
| 171 | Ga0068871_100000068 | 3300006358 | Bacteria | 57531 |
| 172 | Ga0075428_100014319 | 3300006844 | Bacteria | 8817 |
| 173 | Ga0075428_100122273 | 3300006844 | Bacteria | 2834 |
| 174 | Ga0075428_100123190 | 3300006844 | Bacteria | 2822 |
| 175 | Ga0075428_100231818 | 3300006844 | Bacteria | 1992 |
| 176 | Ga0075431_100027830 | 3300006847 | Bacteria | 5801 |
| 177 | Ga0075431_100197790 | 3300006847 | Bacteria | 2058 |
| 178 | Ga0075433_10002775 | 3300006852 | Bacteria | 13399 |
| 179 | Ga0075434_100002138 | 3300006871 | Bacteria | 17193 |
| 180 | Ga0075434_100023001 | 3300006871 | Bacteria | 6067 |
| 181 | Ga0075429_100037897 | 3300006880 | Bacteria | 4196 |
| 182 | Ga0068865_100000294 | 3300006881 | Bacteria | 27523 |
| 183 | Ga0068865_100028940 | 3300006881 | Bacteria | 3671 |
| 184 | Ga0075436_100022391 | 3300006914 | Bacteria | 4340 |
| 185 | Ga0097620_100001870 | 3300006931 | Bacteria | 21434 |
| 186 | Ga0097620_100007104 | 3300006931 | Bacteria | 11364 |
| 187 | Ga0075435_100063250 | 3300007076 | Bacteria | 3005 |
| 188 | Ga0099794_10040005 | 3300007265 | Bacteria | 2227 |
| 189 | Ga0099795_10006498 | 3300007788 | Bacteria | 3194 |
| 190 | Ga0099795_10021476 | 3300007788 | Bacteria | 2118 |
| 191 | Ga0099795_10044521 | 3300007788 | Bacteria | 1592 |
| 192 | Ga0105240_10023458 | 3300009093 | Bacteria | 8157 |
| 193 | Ga0105245_10000780 | 3300009098 | Bacteria | 28901 |
| 194 | Ga0105247_10005194 | 3300009101 | Bacteria | 8233 |
| 195 | Ga0105247_10008421 | 3300009101 | Bacteria | 6283 |
| 196 | Ga0105247_10038435 | 3300009101 | Bacteria | 2922 |
| 197 | Ga0105247_10038934 | 3300009101 | Bacteria | 2903 |
| 198 | Ga0114129_10010082 | 3300009147 | Bacteria | 13469 |
| 199 | Ga0114129_10134226 | 3300009147 | Bacteria | 3397 |
| 200 | Ga0105243_10001083 | 3300009148 | Bacteria | 24917 |
| 201 | Ga0105243_10198668 | 3300009148 | Bacteria | 1757 |
| 202 | Ga0105241_10000760 | 3300009174 | Bacteria | 24503 |
| 203 | Ga0105241_10043566 | 3300009174 | Bacteria | 3399 |
| 204 | Ga0105242_10006332 | 3300009176 | Bacteria | 9118 |
| 205 | Ga0105242_10022852 | 3300009176 | Bacteria | 4924 |
| 206 | Ga0105242_10030536 | 3300009176 | Bacteria | 4303 |
| 207 | Ga0105242_10229678 | 3300009176 | Bacteria | 1662 |
| 208 | Ga0105248_10080587 | 3300009177 | Bacteria | 3659 |
| 209 | Ga0105248_10160902 | 3300009177 | Bacteria | 2532 |
| 210 | Ga0105248_10197706 | 3300009177 | Bacteria | 2265 |
| 211 | Ga0105237_10007890 | 3300009545 | Bacteria | 11599 |
| 212 | Ga0105237_10064505 | 3300009545 | Bacteria | 3659 |
| 213 | Ga0105238_10024019 | 3300009551 | Bacteria | 6216 |
| 214 | Ga0105249_10000755 | 3300009553 | Bacteria | 29091 |
| 215 | Ga0105249_10137256 | 3300009553 | Bacteria | 2342 |
| 216 | Ga0105249_10403723 | 3300009553 | Bacteria | 1397 |
| 217 | Ga0105239_10002791 | 3300010375 | Bacteria | 21868 |
| 218 | Ga0105239_10094126 | 3300010375 | Bacteria | 3309 |
| 219 | Ga0105239_10507914 | 3300010375 | Bacteria | 1371 |
| 220 | Ga0105246_10000061 | 3300011119 | Bacteria | 44338 |
| 221 | Ga0105246_10014686 | 3300011119 | Bacteria | 4929 |
| 222 | Ga0105246_10124088 | 3300011119 | Bacteria | 1918 |
| 223 | Ga0157373_10030638 | 3300013100 | Bacteria | 3870 |
| 224 | Ga0157371_10015260 | 3300013102 | Bacteria | 5768 |
| 225 | Ga0157374_10001691 | 3300013296 | Bacteria | 18474 |
| 226 | Ga0157374_10020476 | 3300013296 | Bacteria | 5868 |
| 227 | Ga0157374_10306851 | 3300013296 | Bacteria | 1571 |
| 228 | Ga0157378_10001445 | 3300013297 | Bacteria | 21386 |
| 229 | Ga0163162_10000790 | 3300013306 | Bacteria | 29412 |
| 230 | Ga0163162_10020256 | 3300013306 | Bacteria | 6531 |
| 231 | Ga0163162_10023125 | 3300013306 | Bacteria | 6131 |
| 232 | Ga0157372_10016229 | 3300013307 | Bacteria | 7991 |
| 233 | Ga0157372_10157323 | 3300013307 | Bacteria | 2625 |
| 234 | Ga0157372_10357216 | 3300013307 | Bacteria | 1702 |
| 235 | Ga0157375_10000468 | 3300013308 | Bacteria | 36848 |
| 236 | Ga0157375_10013783 | 3300013308 | Bacteria | 7205 |
| 237 | Ga0157375_10138136 | 3300013308 | Bacteria | 2562 |
| 238 | Ga0163163_10001508 | 3300014325 | Bacteria | 19688 |
| 239 | Ga0163163_10044077 | 3300014325 | Bacteria | 4375 |
| 240 | Ga0163163_10053814 | 3300014325 | Bacteria | 3975 |
| 241 | Ga0157380_10007877 | 3300014326 | Bacteria | 7582 |
| 242 | Ga0157380_10022504 | 3300014326 | Bacteria | 4748 |
| 243 | Ga0157377_10000276 | 3300014745 | Bacteria | 24762 |
| 244 | Ga0157379_10004514 | 3300014968 | Bacteria | 11940 |
| 245 | Ga0157379_10015057 | 3300014968 | Bacteria | 6784 |
| 246 | Ga0157379_10026464 | 3300014968 | Bacteria | 5164 |
| 247 | Ga0157376_10000692 | 3300014969 | Bacteria | 21811 |
| 248 | Ga0157376_10022279 | 3300014969 | Bacteria | 4935 |
| 249 | Ga0163161_10000384 | 3300017792 | Bacteria | 37040 |
| 250 | Ga0197907_10934374 | 3300020069 | Bacteria | 1207 |
| 251 | Ga0206356_10856229 | 3300020070 | Bacteria | 2526 |
| 252 | Ga0206353_10594769 | 3300020082 | Bacteria | 2370 |
| 253 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 254 | Ga0224572_1010103 | 3300024225 | Bacteria | 1771 |
| 255 | Ga0207666_1000097 | 3300025271 | Bacteria | 13853 |
| 256 | Ga0207673_1000054 | 3300025290 | Bacteria | 9582 |
| 257 | Ga0209758_1000638 | 3300025297 | Bacteria | 53416 |
| 258 | Ga0207697_10000550 | 3300025315 | Bacteria | 21243 |
| 259 | Ga0207653_10008172 | 3300025885 | Bacteria | 3262 |
| 260 | Ga0207682_10000088 | 3300025893 | Bacteria | 41732 |
| 261 | Ga0207692_10060130 | 3300025898 | Bacteria | 1964 |
| 262 | Ga0207642_10000926 | 3300025899 | Bacteria | 9202 |
| 263 | Ga0207710_10011074 | 3300025900 | Bacteria | 3798 |
| 264 | Ga0207688_10000276 | 3300025901 | Bacteria | 23473 |
| 265 | Ga0207688_10001203 | 3300025901 | Bacteria | 13390 |
| 266 | Ga0207680_10025652 | 3300025903 | Bacteria | 3254 |
| 267 | Ga0207647_10002714 | 3300025904 | Bacteria | 13370 |
| 268 | Ga0207699_10026117 | 3300025906 | Bacteria | 3215 |
| 269 | Ga0207699_10283479 | 3300025906 | Bacteria | 1152 |
| 270 | Ga0207645_10000140 | 3300025907 | Bacteria | 55845 |
| 271 | Ga0207645_10020572 | 3300025907 | Bacteria | 4318 |
| 272 | Ga0207643_10000083 | 3300025908 | Bacteria | 62116 |
| 273 | Ga0207643_10001883 | 3300025908 | Bacteria | 11586 |
| 274 | Ga0207684_10025559 | 3300025910 | Bacteria | 5032 |
| 275 | Ga0207654_10005138 | 3300025911 | Bacteria | 6604 |
| 276 | Ga0207654_10053666 | 3300025911 | Bacteria | 2328 |
| 277 | Ga0207707_10004967 | 3300025912 | Bacteria | 11688 |
| 278 | Ga0207707_10013826 | 3300025912 | Bacteria | 7038 |
| 279 | Ga0207707_10056844 | 3300025912 | Bacteria | 3405 |
| 280 | Ga0207695_10131832 | 3300025913 | Bacteria | 2456 |
| 281 | Ga0207695_10310300 | 3300025913 | Bacteria | 1468 |
| 282 | Ga0207693_10007583 | 3300025915 | Bacteria | 8914 |
| 283 | Ga0207693_10062777 | 3300025915 | Bacteria | 2910 |
| 284 | Ga0207663_10218121 | 3300025916 | Bacteria | 1386 |
| 285 | Ga0207663_10228813 | 3300025916 | Bacteria | 1357 |
| 286 | Ga0207660_10000073 | 3300025917 | Bacteria | 51871 |
| 287 | Ga0207660_10019543 | 3300025917 | Bacteria | 4529 |
| 288 | Ga0207660_10059995 | 3300025917 | Bacteria | 2733 |
| 289 | Ga0207660_10116369 | 3300025917 | Bacteria | 2019 |
| 290 | Ga0207662_10000964 | 3300025918 | Bacteria | 13368 |
| 291 | Ga0207657_10005395 | 3300025919 | Bacteria | 13362 |
| 292 | Ga0207657_10021847 | 3300025919 | Bacteria | 6010 |
| 293 | Ga0207657_10036881 | 3300025919 | Bacteria | 4373 |
| 294 | Ga0207657_10169967 | 3300025919 | Bacteria | 1767 |
| 295 | Ga0207649_10000450 | 3300025920 | Bacteria | 29604 |
| 296 | Ga0207652_10007770 | 3300025921 | Bacteria | 8617 |
| 297 | Ga0207652_10025311 | 3300025921 | Bacteria | 4932 |
| 298 | Ga0207652_10038151 | 3300025921 | Bacteria | 4070 |
| 299 | Ga0207681_10000097 | 3300025923 | Bacteria | 73836 |
| 300 | Ga0207681_10050182 | 3300025923 | Bacteria | 2823 |
| 301 | Ga0207681_10057429 | 3300025923 | Bacteria | 2660 |
| 302 | Ga0207650_10015682 | 3300025925 | Bacteria | 5282 |
| 303 | Ga0207659_10000092 | 3300025926 | Bacteria | 52642 |
| 304 | Ga0207659_10006748 | 3300025926 | Bacteria | 7053 |
| 305 | Ga0207687_10000129 | 3300025927 | Bacteria | 50592 |
| 306 | Ga0207700_10023166 | 3300025928 | Bacteria | 4276 |
| 307 | Ga0207700_10025257 | 3300025928 | Bacteria | 4124 |
| 308 | Ga0207700_10025742 | 3300025928 | Bacteria | 4091 |
| 309 | Ga0207700_10113366 | 3300025928 | Bacteria | 2186 |
| 310 | Ga0207644_10021324 | 3300025931 | Bacteria | 4412 |
| 311 | Ga0207644_10038782 | 3300025931 | Bacteria | 3358 |
| 312 | Ga0207644_10054061 | 3300025931 | Bacteria | 2891 |
| 313 | Ga0207644_10121848 | 3300025931 | Bacteria | 1986 |
| 314 | Ga0207690_10002606 | 3300025932 | Bacteria | 10873 |
| 315 | Ga0207690_10016846 | 3300025932 | Bacteria | 4453 |
| 316 | Ga0207690_10119775 | 3300025932 | Bacteria | 1910 |
| 317 | Ga0207706_10004310 | 3300025933 | Bacteria | 13370 |
| 318 | Ga0207706_10005901 | 3300025933 | Bacteria | 11393 |
| 319 | Ga0207706_10073834 | 3300025933 | Bacteria | 2999 |
| 320 | Ga0207686_10000796 | 3300025934 | Bacteria | 19364 |
| 321 | Ga0207686_10031352 | 3300025934 | Bacteria | 3155 |
| 322 | Ga0207709_10000362 | 3300025935 | Bacteria | 45886 |
| 323 | Ga0207709_10034793 | 3300025935 | Bacteria | 2973 |
| 324 | Ga0207670_10004868 | 3300025936 | Bacteria | 7299 |
| 325 | Ga0207669_10000350 | 3300025937 | Bacteria | 20966 |
| 326 | Ga0207669_10081479 | 3300025937 | Bacteria | 2074 |
| 327 | Ga0207704_10000757 | 3300025938 | Bacteria | 14243 |
| 328 | Ga0207704_10018553 | 3300025938 | Bacteria | 3634 |
| 329 | Ga0207665_10047129 | 3300025939 | Bacteria | 2888 |
| 330 | Ga0207665_10076338 | 3300025939 | Bacteria | 2297 |
| 331 | Ga0207691_10000283 | 3300025940 | Bacteria | 50040 |
| 332 | Ga0207691_10021969 | 3300025940 | Bacteria | 6021 |
| 333 | Ga0207711_10023405 | 3300025941 | Bacteria | 5172 |
| 334 | Ga0207711_10176024 | 3300025941 | Bacteria | 1944 |
| 335 | Ga0207711_10269776 | 3300025941 | Bacteria | 1565 |
| 336 | Ga0207689_10000085 | 3300025942 | Bacteria | 75467 |
| 337 | Ga0207689_10002370 | 3300025942 | Bacteria | 17597 |
| 338 | Ga0207689_10293660 | 3300025942 | Bacteria | 1347 |
| 339 | Ga0207661_10000464 | 3300025944 | Bacteria | 26194 |
| 340 | Ga0207661_10009753 | 3300025944 | Bacteria | 6897 |
| 341 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 342 | Ga0207679_10061285 | 3300025945 | Bacteria | 2800 |
| 343 | Ga0207679_10081256 | 3300025945 | Bacteria | 2478 |
| 344 | Ga0207667_10018715 | 3300025949 | Bacteria | 7758 |
| 345 | Ga0207667_10041317 | 3300025949 | Bacteria | 4905 |
| 346 | Ga0207667_10197114 | 3300025949 | Bacteria | 2066 |
| 347 | Ga0207651_10000088 | 3300025960 | Bacteria | 40879 |
| 348 | Ga0207651_10035283 | 3300025960 | Bacteria | 3250 |
| 349 | Ga0207712_10024539 | 3300025961 | Bacteria | 3995 |
| 350 | Ga0207712_10096114 | 3300025961 | Bacteria | 2192 |
| 351 | Ga0207668_10000114 | 3300025972 | Bacteria | 57323 |
| 352 | Ga0207668_10020821 | 3300025972 | Bacteria | 4174 |
| 353 | Ga0207668_10180924 | 3300025972 | Bacteria | 1663 |
| 354 | Ga0207640_10000616 | 3300025981 | Bacteria | 20961 |
| 355 | Ga0207640_10025371 | 3300025981 | Bacteria | 3587 |
| 356 | Ga0207658_10002853 | 3300025986 | Bacteria | 12371 |
| 357 | Ga0207677_10001731 | 3300026023 | Bacteria | 11572 |
| 358 | Ga0207677_10014241 | 3300026023 | Bacteria | 4637 |
| 359 | Ga0207703_10000983 | 3300026035 | Bacteria | 27443 |
| 360 | Ga0207703_10010855 | 3300026035 | Bacteria | 7102 |
| 361 | Ga0207639_10000305 | 3300026041 | Bacteria | 34869 |
| 362 | Ga0207639_10032877 | 3300026041 | Bacteria | 3822 |
| 363 | Ga0207678_10000125 | 3300026067 | Bacteria | 63817 |
| 364 | Ga0207708_10000187 | 3300026075 | Bacteria | 48792 |
| 365 | Ga0207708_10000256 | 3300026075 | Bacteria | 41918 |
| 366 | Ga0207702_10008418 | 3300026078 | Bacteria | 8702 |
| 367 | Ga0207702_10053363 | 3300026078 | Bacteria | 3422 |
| 368 | Ga0207702_10121445 | 3300026078 | Bacteria | 2339 |
| 369 | Ga0207641_10002129 | 3300026088 | Bacteria | 18722 |
| 370 | Ga0207641_10038449 | 3300026088 | Bacteria | 4000 |
| 371 | Ga0207648_10002168 | 3300026089 | Bacteria | 21342 |
| 372 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 373 | Ga0207674_10002501 | 3300026116 | Bacteria | 23186 |
| 374 | Ga0207674_10118492 | 3300026116 | Bacteria | 2617 |
| 375 | Ga0207675_100002373 | 3300026118 | Bacteria | 18649 |
| 376 | Ga0207675_100004556 | 3300026118 | Bacteria | 13370 |
| 377 | Ga0207683_10000014 | 3300026121 | Bacteria | 128817 |
| 378 | Ga0207683_10031114 | 3300026121 | Bacteria | 4630 |
| 379 | Ga0207683_10055140 | 3300026121 | Bacteria | 3486 |
| 380 | Ga0207698_10079743 | 3300026142 | Bacteria | 2634 |
| 381 | Ga0209981_1009723 | 3300027378 | Bacteria | 1318 |
| 382 | Ga0210002_1000767 | 3300027617 | Bacteria | 4352 |
| 383 | Ga0209588_1040657 | 3300027671 | Bacteria | 1500 |
| 384 | Ga0209998_10003457 | 3300027717 | Bacteria | 3451 |
| 385 | Ga0207428_10000467 | 3300027907 | Bacteria | 48756 |
| 386 | Ga0207428_10175555 | 3300027907 | Bacteria | 1621 |
| 387 | Ga0268266_10094562 | 3300028379 | Bacteria | 2623 |
| 388 | Ga0268265_10001371 | 3300028380 | Bacteria | 20700 |
| 389 | Ga0268264_10000469 | 3300028381 | Bacteria | 54801 |
| 390 | Ga0268264_10008918 | 3300028381 | Bacteria | 8321 |
| 391 | Ga0265332_10001014 | 3300031238 | Bacteria | 16568 |
| 392 | Ga0265328_10006061 | 3300031239 | Bacteria | 5146 |
| 393 | Ga0265328_10006537 | 3300031239 | Bacteria | 4918 |
| 394 | Ga0265325_10000423 | 3300031241 | Bacteria | 30296 |
| 395 | Ga0265325_10033971 | 3300031241 | Bacteria | 2717 |
| 396 | Ga0265325_10046647 | 3300031241 | Bacteria | 2246 |
| 397 | Ga0265325_10127955 | 3300031241 | Bacteria | 1219 |
| 398 | Ga0265340_10033530 | 3300031247 | Bacteria | 2556 |
| 399 | Ga0265340_10127742 | 3300031247 | Bacteria | 1167 |
| 400 | Ga0265339_10014704 | 3300031249 | Bacteria | 4712 |
| 401 | Ga0307513_10039588 | 3300031456 | Bacteria | 5224 |
| 402 | Ga0265313_10012760 | 3300031595 | Bacteria | 5101 |
| 403 | Ga0265314_10026124 | 3300031711 | Bacteria | 4393 |
| 404 | Ga0265314_10040963 | 3300031711 | Bacteria | 3320 |
| 405 | Ga0265314_10061077 | 3300031711 | Bacteria | 2569 |
| 406 | Ga0265342_10000035 | 3300031712 | Bacteria | 142886 |
| 407 | Ga0265342_10004840 | 3300031712 | Bacteria | 10435 |
| 408 | Ga0373940_0003532 | 3300035088 | Bacteria | 3201 |
| 409 | Ga0373949_0005195 | 3300035090 | Bacteria | 2918 |
| 410 | Ga0373923_0000216 | 3300035111 | Bacteria | 11993 |
| 411 | Ga0373923_0006009 | 3300035111 | Bacteria | 4164 |
| 412 | Ga0373923_0034979 | 3300035111 | Bacteria | 2042 |
| 413 | Ga0373932_0004024 | 3300035112 | Bacteria | 3499 |
| 414 | Ga0373936_0000683 | 3300035113 | Bacteria | 11820 |
| 415 | Ga0373939_0001020 | 3300035114 | Bacteria | 6907 |
| 416 | Ga0373945_0001832 | 3300035116 | Bacteria | 6566 |
| 417 | Ga0373945_0013214 | 3300035116 | Bacteria | 2752 |
| 418 | Ga0373945_0030285 | 3300035116 | Bacteria | 1907 |
| 419 | Ga0373954_0002030 | 3300035118 | Bacteria | 8412 |
| 420 | Ga0373954_0004093 | 3300035118 | Bacteria | 6250 |
| 421 | Ga0373954_0006107 | 3300035118 | Bacteria | 5244 |
| 422 | Ga0373954_0034900 | 3300035118 | Bacteria | 2331 |
| 423 | Ga0373956_0001485 | 3300035119 | Bacteria | 9695 |
| 424 | Ga0373956_0004320 | 3300035119 | Bacteria | 5703 |
| 425 | Ga0373957_0007742 | 3300035120 | Bacteria | 3450 |
| 426 | Ga0373957_0064588 | 3300035120 | Bacteria | 1423 |
| 427 | Ga0373960_0000611 | 3300035121 | Bacteria | 7314 |
| 428 | Ga0373943_0000943 | 3300035170 | Bacteria | 12849 |
| 429 | Ga0373943_0019066 | 3300035170 | Bacteria | 3155 |
| 430 | Ga0373943_0031766 | 3300035170 | Bacteria | 2506 |
| 431 | Ga0373946_0001331 | 3300035171 | Bacteria | 8527 |
| 432 | Ga0373946_0020116 | 3300035171 | Bacteria | 2577 |
| 433 | Ga0373946_0031607 | 3300035171 | Bacteria | 2122 |
| 434 | Ga0373955_0000426 | 3300035172 | Bacteria | 17789 |
| 435 | Ga0373955_0001269 | 3300035172 | Bacteria | 10731 |
| 436 | Ga0373955_0010198 | 3300035172 | Bacteria | 4428 |
| 437 | Ga0373955_0011222 | 3300035172 | Bacteria | 4260 |
| 438 | Ga0373955_0024586 | 3300035172 | Bacteria | 3082 |
| 439 | Ga0373961_0001648 | 3300035241 | Bacteria | 6258 |
| 440 | Ga0373924_0016450 | 3300035410 | Bacteria | 2823 |
| 441 | Ga0373924_0031851 | 3300035410 | Bacteria | 2122 |
| 442 | Ga0373931_0000169 | 3300035691 | Bacteria | 28308 |
| 443 | Ga0373931_0028283 | 3300035691 | Bacteria | 2868 |
| 444 | Ga0373931_0049715 | 3300035691 | Bacteria | 2229 |
| 445 | Ga0373935_0000088 | 3300035692 | Bacteria | 40092 |
| 446 | Ga0373935_0002327 | 3300035692 | Bacteria | 10846 |
| 447 | Ga0373935_0024986 | 3300035692 | Bacteria | 3681 |
| 448 | Ga0373935_0114153 | 3300035692 | Bacteria | 1797 |
| 449 | Ga0373927_0003463 | 3300035695 | Bacteria | 11305 |
| 450 | Ga0373927_0008005 | 3300035695 | Bacteria | 7137 |
| 451 | Ga0373927_0032604 | 3300035695 | Bacteria | 3393 |
| 452 | Ga0373927_0038796 | 3300035695 | Bacteria | 3092 |
| 453 | Ga0373927_0106824 | 3300035695 | Bacteria | 1823 |
| 454 | Ga0373933_0001124 | 3300035724 | Bacteria | 15927 |
| 455 | Ga0373933_0002510 | 3300035724 | Bacteria | 10312 |
| 456 | Ga0373933_0006652 | 3300035724 | Bacteria | 6296 |
| 457 | Ga0373933_0011724 | 3300035724 | Bacteria | 4838 |
| 458 | Ga0373947_0000574 | 3300035725 | Bacteria | 21474 |
| 459 | Ga0373947_0002738 | 3300035725 | Bacteria | 10562 |
| 460 | Ga0373947_0024321 | 3300035725 | Bacteria | 3530 |
| 461 | Ga0373947_0202426 | 3300035725 | Bacteria | 1299 |
| 462 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 463 | Ga0373937_0001052 | 3300036401 | Bacteria | 23314 |
| 464 | Ga0373937_0004918 | 3300036401 | Bacteria | 11357 |
| 465 | Ga0373937_0075219 | 3300036401 | Bacteria | 3117 |
| 466 | Ga0373937_0076549 | 3300036401 | Bacteria | 3090 |
| 467 | Ga0373937_0264222 | 3300036401 | Bacteria | 1623 |
| 468 | Ga0373925_0000929 | 3300037068 | Bacteria | 26669 |
| 469 | Ga0373925_0001647 | 3300037068 | Bacteria | 18821 |
| 470 | Ga0373925_0005578 | 3300037068 | Bacteria | 9368 |
| 471 | Ga0373925_0014171 | 3300037068 | Bacteria | 5770 |
| 472 | Ga0373925_0021901 | 3300037068 | Bacteria | 4659 |
| 473 | Ga0373925_0028494 | 3300037068 | Bacteria | 4092 |
| 474 | Ga0373925_0100869 | 3300037068 | Bacteria | 2219 |
| 475 | Ga0373925_0212415 | 3300037068 | Bacteria | 1541 |
| 476 | Ga0395899_0002468 | 3300037312 | Bacteria | 15011 |
| 477 | Ga0395900_0001885 | 3300037418 | Bacteria | 23846 |
| 478 | Ga0395900_0359703 | 3300037418 | Bacteria | 1427 |
| 479 | Ga0395898_0041853 | 3300037466 | Bacteria | 4522 |
| 480 | Ga0395898_0092678 | 3300037466 | Bacteria | 2905 |
| 481 | Ga0395898_0126688 | 3300037466 | Bacteria | 2446 |
| 482 | Ga0395898_0200115 | 3300037466 | Bacteria | 1907 |
| 483 | Ga0436364_0309649 | 3300037853 | Bacteria | 36034 |
| 484 | Ga0395901_0043395 | 3300038443 | Bacteria | 4664 |
| 485 | Ga0395901_0098693 | 3300038443 | Bacteria | 3062 |
| 486 | Ga0395901_0177698 | 3300038443 | Bacteria | 2232 |
| 487 | Ga0436365_0498663 | 3300039437 | Bacteria | 5727 |
| 488 | Ga0436365_0977831 | 3300039437 | Bacteria | 4422 |
| 489 | Ga0436365_1037616 | 3300039437 | Bacteria | 2732 |
| 490 | Ga0436361_1176104 | 3300039447 | Bacteria | 6391 |
| 491 | Ga0436363_0718092 | 3300039450 | Bacteria | 3258 |
| 492 | Ga0439453_0003508 | 3300041408 | Bacteria | 2263 |
| 493 | Ga0439464_0004335 | 3300042439 | Bacteria | 3627 |
| 494 | Ga0466966_0114059 | 3300044684 | Bacteria | 1664 |
| 495 | Ga0466971_0047546 | 3300044719 | Bacteria | 1929 |
| 496 | Ga0466971_0121890 | 3300044719 | Bacteria | 1207 |
| 497 | Ga0466959_0085581 | 3300045049 | Bacteria | 2268 |
| 498 | Ga0451576_0034716 | 3300045051 | Bacteria | 5356 |
| 499 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 500 | Ga0495592_0003638 | 3300046454 | Bacteria | 11092 |
| 501 | Ga0495592_0020065 | 3300046454 | Bacteria | 5081 |
| 502 | Ga0495592_0024541 | 3300046454 | Bacteria | 4582 |
| 503 | Ga0495603_0059418 | 3300046455 | Bacteria | 2260 |
| 504 | Ga0495603_0101255 | 3300046455 | Bacteria | 1682 |
| 505 | Ga0495590_0021990 | 3300046457 | Bacteria | 2258 |
| 506 | Ga0495629_0045295 | 3300046459 | Bacteria | 3086 |
| 507 | Ga0495629_0045577 | 3300046459 | Bacteria | 3076 |
| 508 | Ga0495629_0087940 | 3300046459 | Bacteria | 2167 |
| 509 | Ga0495629_0105668 | 3300046459 | Bacteria | 1964 |
| 510 | Ga0495629_0139610 | 3300046459 | Bacteria | 1686 |
| 511 | Ga0495638_0002961 | 3300046460 | Bacteria | 13550 |
| 512 | Ga0495638_0182569 | 3300046460 | Bacteria | 1196 |
| 513 | Ga0495641_0025043 | 3300046461 | Bacteria | 2932 |
| 514 | Ga0495641_0075739 | 3300046461 | Bacteria | 1508 |
| 515 | Ga0495651_0000606 | 3300046462 | Bacteria | 27884 |
| 516 | Ga0495651_0001798 | 3300046462 | Bacteria | 16533 |
| 517 | Ga0495651_0009868 | 3300046462 | Bacteria | 7341 |
| 518 | Ga0495651_0126565 | 3300046462 | Bacteria | 1870 |
| 519 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 520 | Ga0495653_0002673 | 3300046463 | Bacteria | 14197 |
| 521 | Ga0495653_0008326 | 3300046463 | Bacteria | 8500 |
| 522 | Ga0495653_0038924 | 3300046463 | Bacteria | 3729 |
| 523 | Ga0495582_0035855 | 3300046473 | Bacteria | 2729 |
| 524 | Ga0495582_0037877 | 3300046473 | Bacteria | 2652 |
| 525 | Ga0495582_0141304 | 3300046473 | Bacteria | 1364 |
| 526 | Ga0495582_0169085 | 3300046473 | Bacteria | 1244 |
| 527 | Ga0495639_0124449 | 3300046475 | Bacteria | 1231 |
| 528 | Ga0495662_0001688 | 3300046476 | Bacteria | 11019 |
| 529 | Ga0495662_0012231 | 3300046476 | Bacteria | 4191 |
| 530 | Ga0495662_0033933 | 3300046476 | Bacteria | 2465 |
| 531 | Ga0495662_0081789 | 3300046476 | Bacteria | 1571 |
| 532 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 533 | Ga0495664_0003537 | 3300046477 | Bacteria | 8521 |
| 534 | Ga0495664_0016826 | 3300046477 | Bacteria | 4174 |
| 535 | Ga0495664_0060982 | 3300046477 | Bacteria | 2246 |
| 536 | Ga0495664_0146951 | 3300046477 | Bacteria | 1430 |
| 537 | Ga0495584_0086032 | 3300046491 | Bacteria | 1584 |
| 538 | Ga0495594_0024673 | 3300046499 | Bacteria | 3231 |
| 539 | Ga0495594_0057062 | 3300046499 | Bacteria | 2156 |
| 540 | Ga0495608_0000560 | 3300046511 | Bacteria | 25606 |
| 541 | Ga0495608_0000591 | 3300046511 | Bacteria | 24964 |
| 542 | Ga0495608_0001474 | 3300046511 | Bacteria | 16724 |
| 543 | Ga0495608_0088372 | 3300046511 | Bacteria | 2006 |
| 544 | Ga0495608_0179617 | 3300046511 | Bacteria | 1339 |
| 545 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 546 | Ga0495618_0001466 | 3300046514 | Bacteria | 15809 |
| 547 | Ga0495618_0027234 | 3300046514 | Bacteria | 3558 |
| 548 | Ga0495618_0130395 | 3300046514 | Bacteria | 1608 |
| 549 | Ga0495628_0000530 | 3300046516 | Bacteria | 34897 |
| 550 | Ga0495628_0001927 | 3300046516 | Bacteria | 18830 |
| 551 | Ga0495628_0044982 | 3300046516 | Bacteria | 3510 |
| 552 | Ga0495630_0003509 | 3300046517 | Bacteria | 10907 |
| 553 | Ga0495630_0146463 | 3300046517 | Bacteria | 1796 |
| 554 | Ga0495630_0198539 | 3300046517 | Bacteria | 1531 |
| 555 | Ga0495663_0021375 | 3300046525 | Bacteria | 1864 |
| 556 | Ga0495666_0049682 | 3300046526 | Bacteria | 2017 |
| 557 | Ga0495652_0001393 | 3300046529 | Bacteria | 26853 |
| 558 | Ga0495652_0003497 | 3300046529 | Bacteria | 15467 |
| 559 | Ga0495652_0015699 | 3300046529 | Bacteria | 6778 |
| 560 | Ga0495652_0039947 | 3300046529 | Bacteria | 4055 |
| 561 | Ga0495652_0202002 | 3300046529 | Bacteria | 1507 |
| 562 | Ga0495652_0246691 | 3300046529 | Bacteria | 1325 |
| 563 | Ga0495665_0099672 | 3300046531 | Bacteria | 1525 |
| 564 | Ga0495665_0216472 | 3300046531 | Bacteria | 991 |
| 565 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 566 | Ga0495640_0002454 | 3300046533 | Bacteria | 14898 |
| 567 | Ga0495640_0012195 | 3300046533 | Bacteria | 6579 |
| 568 | Ga0495640_0019507 | 3300046533 | Bacteria | 5004 |
| 569 | Ga0495640_0062664 | 3300046533 | Bacteria | 2521 |
| 570 | Ga0495640_0066208 | 3300046533 | Bacteria | 2437 |
| 571 | Ga0495640_0111630 | 3300046533 | Bacteria | 1786 |
| 572 | Ga0495640_0219704 | 3300046533 | Bacteria | 1199 |
| 573 | Ga0495586_0008177 | 3300046535 | Bacteria | 5575 |
| 574 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 575 | Ga0495587_0002240 | 3300046536 | Bacteria | 12923 |
| 576 | Ga0495598_0001163 | 3300046537 | Bacteria | 5082 |
| 577 | Ga0495598_0021826 | 3300046537 | Bacteria | 1707 |
| 578 | Ga0495621_0088633 | 3300046539 | Bacteria | 1164 |
| 579 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 580 | Ga0495645_0002539 | 3300046543 | Bacteria | 12383 |
| 581 | Ga0495645_0013129 | 3300046543 | Bacteria | 5854 |
| 582 | Ga0495645_0023203 | 3300046543 | Bacteria | 4492 |
| 583 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 584 | Ga0495667_0001150 | 3300046559 | Bacteria | 17257 |
| 585 | Ga0495667_0021829 | 3300046559 | Bacteria | 4317 |
| 586 | Ga0495634_0000345 | 3300046642 | Bacteria | 44890 |
| 587 | Ga0495634_0003468 | 3300046642 | Bacteria | 12632 |
| 588 | Ga0495634_0071521 | 3300046642 | Bacteria | 2283 |
| 589 | Ga0495634_0101196 | 3300046642 | Bacteria | 1862 |
| 590 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 591 | Ga0495635_0003881 | 3300046663 | Bacteria | 10388 |
| 592 | Ga0495635_0008488 | 3300046663 | Bacteria | 7176 |
| 593 | Ga0495635_0065489 | 3300046663 | Bacteria | 2493 |
| 594 | Ga0495635_0082945 | 3300046663 | Bacteria | 2194 |
| 595 | Ga0495588_0013595 | 3300046674 | Bacteria | 3881 |
| 596 | Ga0495657_0002787 | 3300046675 | Bacteria | 14535 |
| 597 | Ga0495657_0003270 | 3300046675 | Bacteria | 13307 |
| 598 | Ga0495657_0014478 | 3300046675 | Bacteria | 5790 |
| 599 | Ga0495599_0000066 | 3300046678 | Bacteria | 72412 |
| 600 | Ga0495599_0000564 | 3300046678 | Bacteria | 21162 |
| 601 | Ga0495599_0009859 | 3300046678 | Bacteria | 5848 |
| 602 | Ga0495599_0043601 | 3300046678 | Bacteria | 2815 |
| 603 | Ga0495599_0070189 | 3300046678 | Bacteria | 2186 |
| 604 | Ga0495623_0000420 | 3300046679 | Bacteria | 27960 |
| 605 | Ga0495623_0000428 | 3300046679 | Bacteria | 27653 |
| 606 | Ga0495623_0124704 | 3300046679 | Bacteria | 1547 |
| 607 | Ga0495646_0000108 | 3300046680 | Bacteria | 40754 |
| 608 | Ga0495646_0003113 | 3300046680 | Bacteria | 10292 |
| 609 | Ga0495646_0051463 | 3300046680 | Bacteria | 2492 |
| 610 | Ga0495646_0111475 | 3300046680 | Bacteria | 1557 |
| 611 | Ga0495658_0016513 | 3300046683 | Bacteria | 3800 |
| 612 | Ga0495658_0030249 | 3300046683 | Bacteria | 2939 |
| 613 | Ga0495613_0075636 | 3300046689 | Bacteria | 2451 |
| 614 | Ga0495613_0126784 | 3300046689 | Bacteria | 1830 |
| 615 | Ga0495624_0009460 | 3300046690 | Bacteria | 6751 |
| 616 | Ga0495624_0039009 | 3300046690 | Bacteria | 3047 |
| 617 | Ga0495624_0191906 | 3300046690 | Bacteria | 1242 |
| 618 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 619 | Ga0495600_0001326 | 3300046809 | Bacteria | 13661 |
| 620 | Ga0495600_0019703 | 3300046809 | Bacteria | 4311 |
| 621 | Ga0495600_0060643 | 3300046809 | Bacteria | 2470 |
| 622 | Ga0495600_0062772 | 3300046809 | Bacteria | 2427 |
| 623 | Ga0495660_0132045 | 3300046810 | Bacteria | 1252 |
| 624 | Ga0495581_0006750 | 3300047315 | Bacteria | 6655 |
| 625 | Ga0495581_0015790 | 3300047315 | Bacteria | 4385 |
| 626 | Ga0495581_0068578 | 3300047315 | Bacteria | 2050 |
| 627 | Ga0495581_0099987 | 3300047315 | Bacteria | 1685 |
| 628 | Ga0495604_0000501 | 3300047317 | Bacteria | 34507 |
| 629 | Ga0495604_0002131 | 3300047317 | Bacteria | 15916 |
| 630 | Ga0495604_0003891 | 3300047317 | Bacteria | 11887 |
| 631 | Ga0495604_0020818 | 3300047317 | Bacteria | 5236 |
| 632 | Ga0495604_0045926 | 3300047317 | Bacteria | 3407 |
| 633 | Ga0495674_0001027 | 3300047319 | Bacteria | 26811 |
| 634 | Ga0495674_0009434 | 3300047319 | Bacteria | 9272 |
| 635 | Ga0495674_0042562 | 3300047319 | Bacteria | 4049 |
| 636 | Ga0495674_0047567 | 3300047319 | Bacteria | 3802 |
| 637 | Ga0495674_0072707 | 3300047319 | Bacteria | 2965 |
| 638 | Ga0495672_0039766 | 3300047320 | Bacteria | 2858 |
| 639 | Ga0495676_0006491 | 3300047321 | Bacteria | 10781 |
| 640 | Ga0495676_0053487 | 3300047321 | Bacteria | 3217 |
| 641 | Ga0495680_0001686 | 3300047322 | Bacteria | 23465 |
| 642 | Ga0495680_0002301 | 3300047322 | Bacteria | 19625 |
| 643 | Ga0495680_0021430 | 3300047322 | Bacteria | 5410 |
| 644 | Ga0495675_0001544 | 3300047444 | Bacteria | 13904 |
| 645 | Ga0495675_0002669 | 3300047444 | Bacteria | 10688 |
| 646 | Ga0495675_0036104 | 3300047444 | Bacteria | 3154 |
| 647 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 648 | Ga0495684_0002087 | 3300047471 | Bacteria | 16070 |
| 649 | Ga0495684_0003625 | 3300047471 | Bacteria | 12034 |
| 650 | Ga0495684_0004889 | 3300047471 | Bacteria | 10451 |
| 651 | Ga0495593_0022923 | 3300047673 | Bacteria | 3474 |
| 652 | Ga0495593_0046746 | 3300047673 | Bacteria | 2305 |
| 653 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 654 | Ga0495602_0005526 | 3300048088 | Bacteria | 13262 |
| 655 | Ga0495602_0018930 | 3300048088 | Bacteria | 6854 |
| 656 | Ga0495602_0024466 | 3300048088 | Bacteria | 5858 |
| 657 | Ga0495602_0057446 | 3300048088 | Bacteria | 3413 |
| 658 | Ga0495614_0055075 | 3300048089 | Bacteria | 1706 |
| 659 | Ga0496100_0000106 | 3300048903 | Bacteria | 48123 |
| 660 | Ga0496100_0000499 | 3300048903 | Bacteria | 18860 |
| 661 | Ga0496100_0029143 | 3300048903 | Bacteria | 3412 |
| 662 | Ga0496100_0031123 | 3300048903 | Bacteria | 3314 |
| 663 | Ga0496100_0075751 | 3300048903 | Bacteria | 2257 |
| 664 | Ga0496100_0106338 | 3300048903 | Bacteria | 1942 |
| 665 | Ga0496101_0000136 | 3300048904 | Bacteria | 65392 |
| 666 | Ga0496101_0000604 | 3300048904 | Bacteria | 21914 |
| 667 | Ga0496101_0008407 | 3300048904 | Bacteria | 6744 |
| 668 | Ga0496102_0005128 | 3300048905 | Bacteria | 11106 |
| 669 | Ga0496102_0015419 | 3300048905 | Bacteria | 6656 |
| 670 | Ga0496102_0029938 | 3300048905 | Bacteria | 4871 |
| 671 | Ga0496102_0030697 | 3300048905 | Bacteria | 4811 |
| 672 | Ga0496102_0041646 | 3300048905 | Bacteria | 4160 |
| 673 | Ga0496102_0459782 | 3300048905 | Bacteria | 1194 |
| 674 | Ga0496103_0005104 | 3300048906 | Bacteria | 7905 |
| 675 | Ga0496103_0029900 | 3300048906 | Bacteria | 3312 |
| 676 | Ga0496103_0033703 | 3300048906 | Bacteria | 3129 |
| 677 | Ga0496103_0081812 | 3300048906 | Bacteria | 2032 |
| 678 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 679 | Ga0496104_0000506 | 3300048907 | Bacteria | 33454 |
| 680 | Ga0496104_0002062 | 3300048907 | Bacteria | 17450 |
| 681 | Ga0496104_0006735 | 3300048907 | Bacteria | 10119 |
| 682 | Ga0496104_0007428 | 3300048907 | Bacteria | 9685 |
| 683 | Ga0496104_0031476 | 3300048907 | Bacteria | 4934 |
| 684 | Ga0496104_0032114 | 3300048907 | Bacteria | 4886 |
| 685 | Ga0496104_0035256 | 3300048907 | Bacteria | 4672 |
| 686 | Ga0496104_0064478 | 3300048907 | Bacteria | 3475 |
| 687 | Ga0496104_0082159 | 3300048907 | Bacteria | 3072 |
| 688 | Ga0496105_0004357 | 3300048908 | Bacteria | 10657 |
| 689 | Ga0496105_0013985 | 3300048908 | Bacteria | 6383 |
| 690 | Ga0496105_0018996 | 3300048908 | Bacteria | 5538 |
| 691 | Ga0496105_0034775 | 3300048908 | Bacteria | 4146 |
| 692 | Ga0496105_0069997 | 3300048908 | Bacteria | 2900 |
| 693 | Ga0496105_0147348 | 3300048908 | Bacteria | 1935 |
| 694 | Ga0496106_0002270 | 3300048909 | Bacteria | 14338 |
| 695 | Ga0496106_0002626 | 3300048909 | Bacteria | 13365 |
| 696 | Ga0496106_0045224 | 3300048909 | Bacteria | 3307 |
| 697 | Ga0496106_0094569 | 3300048909 | Bacteria | 2311 |
| 698 | Ga0496106_0164611 | 3300048909 | Bacteria | 1755 |
| 699 | Ga0496106_0330303 | 3300048909 | Bacteria | 1224 |
| 700 | Ga0496107_0000129 | 3300048910 | Bacteria | 36728 |
| 701 | Ga0496107_0005132 | 3300048910 | Bacteria | 8934 |
| 702 | Ga0496107_0007357 | 3300048910 | Bacteria | 7593 |
| 703 | Ga0496107_0007909 | 3300048910 | Bacteria | 7339 |
| 704 | Ga0496108_0000595 | 3300048911 | Bacteria | 28321 |
| 705 | Ga0496108_0003914 | 3300048911 | Bacteria | 11960 |
| 706 | Ga0496108_0007392 | 3300048911 | Bacteria | 8908 |
| 707 | Ga0496108_0037385 | 3300048911 | Bacteria | 4043 |
| 708 | Ga0496108_0205192 | 3300048911 | Bacteria | 1710 |
| 709 | Ga0496108_0279657 | 3300048911 | Bacteria | 1453 |
| 710 | Ga0496109_0002975 | 3300048912 | Bacteria | 14165 |
| 711 | Ga0496109_0009902 | 3300048912 | Bacteria | 8137 |
| 712 | Ga0496109_0015516 | 3300048912 | Bacteria | 6641 |
| 713 | Ga0496109_0029346 | 3300048912 | Bacteria | 4926 |
| 714 | Ga0496109_0092710 | 3300048912 | Bacteria | 2794 |
| 715 | Ga0496109_0318351 | 3300048912 | Bacteria | 1468 |
| 716 | Ga0496109_0570041 | 3300048912 | Bacteria | 1067 |
| 717 | Ga0496110_0000579 | 3300048913 | Bacteria | 25125 |
| 718 | Ga0496110_0011041 | 3300048913 | Bacteria | 7373 |
| 719 | Ga0496110_0048224 | 3300048913 | Bacteria | 3733 |
| 720 | Ga0496110_0279886 | 3300048913 | Bacteria | 1519 |
| 721 | Ga0496111_0000122 | 3300048914 | Bacteria | 33866 |
| 722 | Ga0496111_0000845 | 3300048914 | Bacteria | 16533 |
| 723 | Ga0496111_0032359 | 3300048914 | Bacteria | 3728 |
| 724 | Ga0496111_0035537 | 3300048914 | Bacteria | 3562 |
| 725 | Ga0496112_0005655 | 3300048915 | Bacteria | 10853 |
| 726 | Ga0496112_0045602 | 3300048915 | Bacteria | 4297 |
| 727 | Ga0496112_0110192 | 3300048915 | Bacteria | 2723 |
| 728 | Ga0496112_0206822 | 3300048915 | Bacteria | 1920 |
| 729 | Ga0496112_0260843 | 3300048915 | Bacteria | 1682 |
| 730 | Ga0496112_0509706 | 3300048915 | Bacteria | 1138 |
| 731 | Ga0496113_0000068 | 3300048916 | Bacteria | 45065 |
| 732 | Ga0496113_0002918 | 3300048916 | Bacteria | 10091 |
| 733 | Ga0496113_0009362 | 3300048916 | Bacteria | 6421 |
| 734 | Ga0496113_0044770 | 3300048916 | Bacteria | 3280 |
| 735 | Ga0496114_0010925 | 3300048917 | Bacteria | 7237 |
| 736 | Ga0496114_0035030 | 3300048917 | Bacteria | 4144 |
| 737 | Ga0496114_0095817 | 3300048917 | Bacteria | 2525 |
| 738 | Ga0496115_0001121 | 3300048918 | Bacteria | 19330 |
| 739 | Ga0496115_0010308 | 3300048918 | Bacteria | 6977 |
| 740 | Ga0496115_0027950 | 3300048918 | Bacteria | 4416 |
| 741 | Ga0496115_0049351 | 3300048918 | Bacteria | 3368 |
| 742 | Ga0496115_0053290 | 3300048918 | Bacteria | 3246 |
| 743 | Ga0496115_0056075 | 3300048918 | Bacteria | 3166 |
| 744 | Ga0496115_0081992 | 3300048918 | Bacteria | 2627 |
| 745 | Ga0496115_0365049 | 3300048918 | Bacteria | 1176 |
| 746 | Ga0501034_0174911 | 3300049571 | Bacteria | 2113 |
| 747 | Ga0501036_0294024 | 3300049572 | Bacteria | 1359 |
| 748 | Ga0501039_0175034 | 3300049575 | Bacteria | 1688 |
| 749 | Ga0501041_0145101 | 3300049577 | Bacteria | 1481 |
| 750 | Ga0501042_0177013 | 3300049578 | Bacteria | 1539 |
| 751 | Ga0501046_0170924 | 3300049580 | Bacteria | 1631 |
| 752 | Ga0501047_0009616 | 3300049581 | Bacteria | 9142 |
| 753 | Ga0501047_0199646 | 3300049581 | Bacteria | 1861 |
| 754 | Ga0501048_0150758 | 3300049582 | Bacteria | 1645 |
| 755 | Ga0501074_0065156 | 3300049590 | Bacteria | 2623 |
| 756 | Ga0501079_0117171 | 3300049741 | Bacteria | 2071 |
| 757 | Ga0501080_0371480 | 3300049742 | Bacteria | 1289 |
| 758 | Ga0501081_0144666 | 3300049743 | Bacteria | 1705 |
| 759 | Ga0501035_0297722 | 3300049822 | Bacteria | 1360 |
| 760 | Ga0501045_0093568 | 3300049824 | Bacteria | 2223 |
| 761 | nmdc:mga00v17_81243_c1 | 3300050491 | Bacteria | 2024 |
| 762 | nmdc:mga0yw44_47060_c1 | 3300050492 | Bacteria | 2594 |
| 763 | nmdc:mga0k408_15093_c1 | 3300050493 | Bacteria | 4269 |
| 764 | nmdc:mga07m45_141716_c1 | 3300050496 | Bacteria | 1392 |
| 765 | nmdc:mga05p37_231454_c1 | 3300050507 | Bacteria | 2226 |
| 766 | nmdc:mga05p37_275845_c1 | 3300050507 | Bacteria | 2007 |
| 767 | nmdc:mga05p37_4379_c1 | 3300050507 | Bacteria | 10579 |
| 768 | nmdc:mga0qj67_15663_c1 | 3300050509 | Bacteria | 5743 |
| 769 | nmdc:mga06r32_186730_c1 | 3300050510 | Bacteria | 2060 |
| 770 | nmdc:mga06r32_27472_c1 | 3300050510 | Bacteria | 5316 |
| 771 | nmdc:mga06r32_9884_c1 | 3300050510 | Bacteria | 8610 |
| 772 | nmdc:mga08y16_359919_c1 | 3300050511 | Bacteria | 1494 |
| 773 | nmdc:mga08y16_460915_c1 | 3300050511 | Bacteria | 1295 |
| 774 | nmdc:mga0n895_68953_c1 | 3300050512 | Bacteria | 3503 |
| 775 | nmdc:mga0rr50_376811_c1 | 3300050513 | Bacteria | 1196 |
| 776 | nmdc:mga08x19_4942_c1 | 3300050514 | Bacteria | 7874 |
| 777 | nmdc:mga0a205_380_c1 | 3300050515 | Bacteria | 33747 |
| 778 | nmdc:mga0a205_7888_c1 | 3300050515 | Bacteria | 9666 |
| 779 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 780 | Ga0495601_0000360 | 3300053077 | Bacteria | 23959 |
| 781 | Ga0495601_0001260 | 3300053077 | Bacteria | 13862 |
| 782 | Ga0495601_0016653 | 3300053077 | Bacteria | 4456 |
| 783 | Ga0495601_0032598 | 3300053077 | Bacteria | 3244 |
| 784 | Ga0495601_0117275 | 3300053077 | Bacteria | 1727 |
| 785 | Ga0495601_0128248 | 3300053077 | Bacteria | 1651 |
| 786 | Ga0495612_0000108 | 3300053078 | Bacteria | 34924 |
| 787 | Ga0495612_0000964 | 3300053078 | Bacteria | 11832 |
| 788 | Ga0495612_0001388 | 3300053078 | Bacteria | 9988 |
| 789 | Ga0495612_0001978 | 3300053078 | Bacteria | 8443 |
| 790 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 791 | Ga0495595_0000969 | 3300053084 | Bacteria | 11036 |
| 792 | Ga0495595_0009321 | 3300053084 | Bacteria | 4056 |
| 793 | Ga0495595_0030564 | 3300053084 | Bacteria | 2417 |
| 794 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 795 | Ga0495619_0000581 | 3300053085 | Bacteria | 24290 |
| 796 | Ga0495619_0001851 | 3300053085 | Bacteria | 14080 |
| 797 | Ga0495619_0002169 | 3300053085 | Bacteria | 13003 |
| 798 | Ga0495619_0008848 | 3300053085 | Bacteria | 6365 |
| 799 | Ga0495619_0024789 | 3300053085 | Bacteria | 3848 |
| 800 | Ga0495619_0053214 | 3300053085 | Bacteria | 2677 |
| 801 | Ga0500641_0005257 | 3300053096 | Bacteria | 4587 |
| 802 | Ga0500595_007827 | 3300053119 | Bacteria | 4402 |
| 803 | Ga0500616_0042962 | 3300053153 | Bacteria | 2418 |
| 804 | Ga0500616_0059585 | 3300053153 | Bacteria | 1982 |
| 805 | Ga0501082_0092413 | 3300060353 | Bacteria | 2614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100248195 | Ga0070711_1002481952 | 307 |
| 2 | 3300025916 | Ga0207663_10218121 | Ga0207663_102181211 | 307 |
| 3 | 3300048907 | Ga0496104_0064478 | Ga0496104_0064478_1119_2159 | 307 |
| 4 | 3300048908 | Ga0496105_0034775 | Ga0496105_0034775_2476_3516 | 307 |
| 5 | 3300048909 | Ga0496106_0094569 | Ga0496106_0094569_897_1937 | 307 |
| 6 | 3300049742 | Ga0501080_0371480 | Ga0501080_0371480_39_1025 | 307 |
| 7 | 3300039437 | Ga0436365_1037616 | Ga0436365_1037616_1190_2230 | 308 |
| 8 | 3300046459 | Ga0495629_0045577 | Ga0495629_0045577_2057_3043 | 309 |
| 9 | 3300046531 | Ga0495665_0216472 | Ga0495665_0216472_18_974 | 312 |
| 10 | 3300046525 | Ga0495663_0021375 | Ga0495663_0021375_778_1764 | 314 |
| 11 | 3300049571 | Ga0501034_0174911 | Ga0501034_0174911_1158_2102 | 314 |
| 12 | 3300005530 | Ga0070679_100138981 | Ga0070679_1001389812 | 315 |
| 13 | 3300035725 | Ga0373947_0202426 | Ga0373947_0202426_27_980 | 315 |
| 14 | 3300048918 | Ga0496115_0365049 | Ga0496115_0365049_206_1159 | 315 |
| 15 | 3300006880 | Ga0075429_100037897 | Ga0075429_1000378972 | 317 |
| 16 | 3300039437 | Ga0436365_0498663 | Ga0436365_0498663_2069_3109 | 317 |
| 17 | 3300048909 | Ga0496106_0330303 | Ga0496106_0330303_250_1212 | 317 |
| 18 | 3300046680 | Ga0495646_0111475 | Ga0495646_0111475_17_985 | 318 |
| 19 | 3300048915 | Ga0496112_0260843 | Ga0496112_0260843_13_972 | 318 |
| 20 | 3300037466 | Ga0395898_0092678 | Ga0395898_0092678_17_1003 | 319 |
| 21 | 3300007788 | Ga0099795_10021476 | Ga0099795_100214762 | 320 |
| 22 | 3300005983 | Ga0081540_1000642 | Ga0081540_100064229 | 322 |
| 23 | 3300005341 | Ga0070691_10094402 | Ga0070691_100944021 | 324 |
| 24 | 3300005441 | Ga0070700_100023506 | Ga0070700_1000235063 | 324 |
| 25 | 3300005545 | Ga0070695_100004709 | Ga0070695_1000047096 | 324 |
| 26 | 3300005983 | Ga0081540_1015934 | Ga0081540_10159343 | 324 |
| 27 | 3300048909 | Ga0496106_0164611 | Ga0496106_0164611_125_1165 | 324 |
| 28 | 3300050511 | nmdc:mga08y16_460915_c1 | nmdc:mga08y16_460915_c1_107_1156 | 324 |
| 29 | 3300035170 | Ga0373943_0031766 | Ga0373943_0031766_165_1217 | 325 |
| 30 | 3300046455 | Ga0495603_0101255 | Ga0495603_0101255_455_1507 | 325 |
| 31 | 3300049590 | Ga0501074_0065156 | Ga0501074_0065156_641_1681 | 325 |
| 32 | 3300053153 | Ga0500616_0042962 | Ga0500616_0042962_837_1880 | 325 |
| 33 | 3300006844 | Ga0075428_100014319 | Ga0075428_1000143193 | 326 |
| 34 | 3300006847 | Ga0075431_100027830 | Ga0075431_1000278303 | 326 |
| 35 | 3300035241 | Ga0373961_0001648 | Ga0373961_0001648_3216_4253 | 326 |
| 36 | 3300050510 | nmdc:mga06r32_27472_c1 | nmdc:mga06r32_27472_c1_1372_2424 | 326 |
| 37 | 3300005458 | Ga0070681_10291287 | Ga0070681_102912871 | 327 |
| 38 | 3300005535 | Ga0070684_100055171 | Ga0070684_1000551712 | 327 |
| 39 | 3300009551 | Ga0105238_10024019 | Ga0105238_100240196 | 327 |
| 40 | 3300025915 | Ga0207693_10007583 | Ga0207693_100075834 | 327 |
| 41 | 3300025917 | Ga0207660_10019543 | Ga0207660_100195433 | 327 |
| 42 | 3300026078 | Ga0207702_10121445 | Ga0207702_101214452 | 327 |
| 43 | 3300031239 | Ga0265328_10006537 | Ga0265328_100065373 | 327 |
| 44 | 3300031711 | Ga0265314_10026124 | Ga0265314_100261243 | 327 |
| 45 | 3300035114 | Ga0373939_0001020 | Ga0373939_0001020_4953_6029 | 327 |
| 46 | 3300035695 | Ga0373927_0038796 | Ga0373927_0038796_1998_3038 | 327 |
| 47 | 3300046462 | Ga0495651_0126565 | Ga0495651_0126565_35_1087 | 327 |
| 48 | 3300046511 | Ga0495608_0088372 | Ga0495608_0088372_174_1226 | 327 |
| 49 | 3300046514 | Ga0495618_0130395 | Ga0495618_0130395_12_1064 | 327 |
| 50 | 3300046529 | Ga0495652_0202002 | Ga0495652_0202002_215_1267 | 327 |
| 51 | 3300046559 | Ga0495667_0021829 | Ga0495667_0021829_95_1147 | 327 |
| 52 | 3300047315 | Ga0495581_0068578 | Ga0495581_0068578_554_1606 | 327 |
| 53 | 3300047317 | Ga0495604_0045926 | Ga0495604_0045926_1144_2196 | 327 |
| 54 | 3300047319 | Ga0495674_0042562 | Ga0495674_0042562_538_1590 | 327 |
| 55 | 3300047471 | Ga0495684_0002087 | Ga0495684_0002087_2078_3130 | 327 |
| 56 | 3300048912 | Ga0496109_0318351 | Ga0496109_0318351_402_1448 | 327 |
| 57 | 3300053085 | Ga0495619_0008848 | Ga0495619_0008848_4581_5633 | 327 |
| 58 | 3300005937 | Ga0081455_10062655 | Ga0081455_100626552 | 328 |
| 59 | 3300035111 | Ga0373923_0000216 | Ga0373923_0000216_6502_7542 | 328 |
| 60 | 3300035113 | Ga0373936_0000683 | Ga0373936_0000683_3669_4709 | 328 |
| 61 | 3300035116 | Ga0373945_0001832 | Ga0373945_0001832_3623_4663 | 328 |
| 62 | 3300035118 | Ga0373954_0004093 | Ga0373954_0004093_3119_4159 | 328 |
| 63 | 3300035172 | Ga0373955_0000426 | Ga0373955_0000426_15415_16455 | 328 |
| 64 | 3300035692 | Ga0373935_0000088 | Ga0373935_0000088_17584_18624 | 328 |
| 65 | 3300035724 | Ga0373933_0006652 | Ga0373933_0006652_2151_3191 | 328 |
| 66 | 3300035725 | Ga0373947_0002738 | Ga0373947_0002738_9509_10549 | 328 |
| 67 | 3300036401 | Ga0373937_0000124 | Ga0373937_0000124_55223_56263 | 328 |
| 68 | 3300037068 | Ga0373925_0000929 | Ga0373925_0000929_16510_17550 | 328 |
| 69 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_121900_122940 | 328 |
| 70 | 3300046459 | Ga0495629_0045295 | Ga0495629_0045295_1958_2998 | 328 |
| 71 | 3300046462 | Ga0495651_0001798 | Ga0495651_0001798_1926_2966 | 328 |
| 72 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_17858_18898 | 328 |
| 73 | 3300046473 | Ga0495582_0169085 | Ga0495582_0169085_138_1178 | 328 |
| 74 | 3300046476 | Ga0495662_0001688 | Ga0495662_0001688_4832_5872 | 328 |
| 75 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_17799_18839 | 328 |
| 76 | 3300046511 | Ga0495608_0000560 | Ga0495608_0000560_17799_18839 | 328 |
| 77 | 3300046514 | Ga0495618_0000059 | Ga0495618_0000059_17780_18820 | 328 |
| 78 | 3300046516 | Ga0495628_0000530 | Ga0495628_0000530_8143_9183 | 328 |
| 79 | 3300046529 | Ga0495652_0001393 | Ga0495652_0001393_8143_9183 | 328 |
| 80 | 3300046533 | Ga0495640_0000029 | Ga0495640_0000029_60875_61915 | 328 |
| 81 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_143296_144336 | 328 |
| 82 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_62687_63727 | 328 |
| 83 | 3300046559 | Ga0495667_0000061 | Ga0495667_0000061_75994_77034 | 328 |
| 84 | 3300046642 | Ga0495634_0000345 | Ga0495634_0000345_35932_36972 | 328 |
| 85 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_143528_144568 | 328 |
| 86 | 3300046675 | Ga0495657_0002787 | Ga0495657_0002787_8015_9055 | 328 |
| 87 | 3300046678 | Ga0495599_0000066 | Ga0495599_0000066_25643_26683 | 328 |
| 88 | 3300046679 | Ga0495623_0000428 | Ga0495623_0000428_17529_18569 | 328 |
| 89 | 3300046680 | Ga0495646_0000108 | Ga0495646_0000108_17618_18658 | 328 |
| 90 | 3300046689 | Ga0495613_0075636 | Ga0495613_0075636_550_1590 | 328 |
| 91 | 3300046690 | Ga0495624_0039009 | Ga0495624_0039009_1918_2958 | 328 |
| 92 | 3300046809 | Ga0495600_0000030 | Ga0495600_0000030_70837_71877 | 328 |
| 93 | 3300047315 | Ga0495581_0015790 | Ga0495581_0015790_2870_3910 | 328 |
| 94 | 3300047317 | Ga0495604_0000501 | Ga0495604_0000501_8015_9055 | 328 |
| 95 | 3300047319 | Ga0495674_0001027 | Ga0495674_0001027_17757_18797 | 328 |
| 96 | 3300047322 | Ga0495680_0002301 | Ga0495680_0002301_794_1834 | 328 |
| 97 | 3300047471 | Ga0495684_0000056 | Ga0495684_0000056_60904_61944 | 328 |
| 98 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_17749_18789 | 328 |
| 99 | 3300048915 | Ga0496112_0206822 | Ga0496112_0206822_564_1604 | 328 |
| 100 | 3300049572 | Ga0501036_0294024 | Ga0501036_0294024_56_1102 | 328 |
| 101 | 3300049580 | Ga0501046_0170924 | Ga0501046_0170924_404_1450 | 328 |
| 102 | 3300049743 | Ga0501081_0144666 | Ga0501081_0144666_41_1087 | 328 |
| 103 | 3300049824 | Ga0501045_0093568 | Ga0501045_0093568_1030_2076 | 328 |
| 104 | 3300050509 | nmdc:mga0qj67_15663_c1 | nmdc:mga0qj67_15663_c1_2992_4038 | 328 |
| 105 | 3300050510 | nmdc:mga06r32_9884_c1 | nmdc:mga06r32_9884_c1_7189_8235 | 328 |
| 106 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_347269_348309 | 328 |
| 107 | 3300053078 | Ga0495612_0000108 | Ga0495612_0000108_25742_26782 | 328 |
| 108 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_5430_6470 | 328 |
| 109 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_147398_148438 | 328 |
| 110 | 3300053119 | Ga0500595_007827 | Ga0500595_007827_2327_3367 | 328 |
| 111 | 3300005437 | Ga0070710_10076323 | Ga0070710_100763232 | 329 |
| 112 | 3300005983 | Ga0081540_1000257 | Ga0081540_10002576 | 329 |
| 113 | 3300006028 | Ga0070717_10120012 | Ga0070717_101200123 | 329 |
| 114 | 3300006163 | Ga0070715_10011354 | Ga0070715_100113543 | 329 |
| 115 | 3300025939 | Ga0207665_10076338 | Ga0207665_100763382 | 329 |
| 116 | 3300031241 | Ga0265325_10127955 | Ga0265325_101279551 | 329 |
| 117 | 3300035691 | Ga0373931_0049715 | Ga0373931_0049715_1132_2205 | 329 |
| 118 | 3300035692 | Ga0373935_0024986 | Ga0373935_0024986_672_1745 | 329 |
| 119 | 3300035725 | Ga0373947_0024321 | Ga0373947_0024321_1423_2496 | 329 |
| 120 | 3300037068 | Ga0373925_0100869 | Ga0373925_0100869_443_1516 | 329 |
| 121 | 3300005458 | Ga0070681_10328512 | Ga0070681_103285122 | 330 |
| 122 | 3300005518 | Ga0070699_100276328 | Ga0070699_1002763282 | 330 |
| 123 | 3300005981 | Ga0081538_10120736 | Ga0081538_101207361 | 330 |
| 124 | 3300006195 | Ga0075366_10018043 | Ga0075366_100180433 | 330 |
| 125 | 3300046477 | Ga0495664_0146951 | Ga0495664_0146951_335_1375 | 330 |
| 126 | 3300050493 | nmdc:mga0k408_15093_c1 | nmdc:mga0k408_15093_c1_809_1849 | 330 |
| 127 | 3300050496 | nmdc:mga07m45_141716_c1 | nmdc:mga07m45_141716_c1_274_1314 | 330 |
| 128 | 3300050507 | nmdc:mga05p37_275845_c1 | nmdc:mga05p37_275845_c1_669_1718 | 330 |
| 129 | 3300049577 | Ga0501041_0145101 | Ga0501041_0145101_129_1175 | 331 |
| 130 | 3300053153 | Ga0500616_0059585 | Ga0500616_0059585_758_1813 | 331 |
| 131 | 3300003215 | JGI25153J46596_10008419 | JGI25153J46596_100084196 | 332 |
| 132 | 3300005435 | Ga0070714_100048797 | Ga0070714_1000487971 | 332 |
| 133 | 3300005563 | Ga0068855_100062526 | Ga0068855_1000625264 | 332 |
| 134 | 3300005616 | Ga0068852_100095205 | Ga0068852_1000952052 | 332 |
| 135 | 3300025297 | Ga0209758_1000638 | Ga0209758_100063839 | 332 |
| 136 | 3300025949 | Ga0207667_10197114 | Ga0207667_101971142 | 332 |
| 137 | 3300031239 | Ga0265328_10006061 | Ga0265328_100060612 | 332 |
| 138 | 3300035172 | Ga0373955_0011222 | Ga0373955_0011222_936_1979 | 332 |
| 139 | 3300036401 | Ga0373937_0076549 | Ga0373937_0076549_1029_2072 | 332 |
| 140 | 3300039437 | Ga0436365_0977831 | Ga0436365_0977831_2552_3598 | 332 |
| 141 | 3300045049 | Ga0466959_0085581 | Ga0466959_0085581_1035_2078 | 332 |
| 142 | 3300046457 | Ga0495590_0021990 | Ga0495590_0021990_141_1199 | 332 |
| 143 | 3300046463 | Ga0495653_0038924 | Ga0495653_0038924_2148_3200 | 332 |
| 144 | 3300046533 | Ga0495640_0066208 | Ga0495640_0066208_879_1922 | 332 |
| 145 | 3300046674 | Ga0495588_0013595 | Ga0495588_0013595_576_1628 | 332 |
| 146 | 3300046809 | Ga0495600_0060643 | Ga0495600_0060643_1300_2352 | 332 |
| 147 | 3300050513 | nmdc:mga0rr50_376811_c1 | nmdc:mga0rr50_376811_c1_62_1099 | 332 |
| 148 | 3300053077 | Ga0495601_0128248 | Ga0495601_0128248_412_1464 | 332 |
| 149 | 3300005355 | Ga0070671_100213033 | Ga0070671_1002130332 | 333 |
| 150 | 3300005719 | Ga0068861_100462030 | Ga0068861_1004620301 | 333 |
| 151 | 3300006028 | Ga0070717_10177703 | Ga0070717_101777032 | 333 |
| 152 | 3300006042 | Ga0075368_10020103 | Ga0075368_100201033 | 333 |
| 153 | 3300006177 | Ga0075362_10018081 | Ga0075362_100180811 | 333 |
| 154 | 3300006178 | Ga0075367_10232869 | Ga0075367_102328691 | 333 |
| 155 | 3300006186 | Ga0075369_10008059 | Ga0075369_100080591 | 333 |
| 156 | 3300007788 | Ga0099795_10044521 | Ga0099795_100445211 | 333 |
| 157 | 3300009553 | Ga0105249_10403723 | Ga0105249_104037231 | 333 |
| 158 | 3300011119 | Ga0105246_10124088 | Ga0105246_101240882 | 333 |
| 159 | 3300025923 | Ga0207681_10057429 | Ga0207681_100574292 | 333 |
| 160 | 3300025931 | Ga0207644_10121848 | Ga0207644_101218481 | 333 |
| 161 | 3300025941 | Ga0207711_10176024 | Ga0207711_101760243 | 333 |
| 162 | 3300026121 | Ga0207683_10031114 | Ga0207683_100311145 | 333 |
| 163 | 3300035111 | Ga0373923_0034979 | Ga0373923_0034979_452_1504 | 333 |
| 164 | 3300035171 | Ga0373946_0020116 | Ga0373946_0020116_253_1305 | 333 |
| 165 | 3300035172 | Ga0373955_0001269 | Ga0373955_0001269_500_1552 | 333 |
| 166 | 3300035410 | Ga0373924_0031851 | Ga0373924_0031851_291_1343 | 333 |
| 167 | 3300035691 | Ga0373931_0028283 | Ga0373931_0028283_615_1655 | 333 |
| 168 | 3300046461 | Ga0495641_0025043 | Ga0495641_0025043_424_1476 | 333 |
| 169 | 3300046473 | Ga0495582_0037877 | Ga0495582_0037877_1116_2168 | 333 |
| 170 | 3300046499 | Ga0495594_0024673 | Ga0495594_0024673_843_1895 | 333 |
| 171 | 3300046526 | Ga0495666_0049682 | Ga0495666_0049682_623_1675 | 333 |
| 172 | 3300046535 | Ga0495586_0008177 | Ga0495586_0008177_190_1242 | 333 |
| 173 | 3300046678 | Ga0495599_0070189 | Ga0495599_0070189_330_1382 | 333 |
| 174 | 3300046680 | Ga0495646_0051463 | Ga0495646_0051463_121_1173 | 333 |
| 175 | 3300048088 | Ga0495602_0057446 | Ga0495602_0057446_2281_3333 | 333 |
| 176 | 3300048903 | Ga0496100_0000499 | Ga0496100_0000499_4270_5310 | 333 |
| 177 | 3300048904 | Ga0496101_0008407 | Ga0496101_0008407_2750_3790 | 333 |
| 178 | 3300048906 | Ga0496103_0081812 | Ga0496103_0081812_715_1755 | 333 |
| 179 | 3300048907 | Ga0496104_0006735 | Ga0496104_0006735_1739_2779 | 333 |
| 180 | 3300048909 | Ga0496106_0045224 | Ga0496106_0045224_1758_2798 | 333 |
| 181 | 3300048911 | Ga0496108_0205192 | Ga0496108_0205192_322_1362 | 333 |
| 182 | 3300048918 | Ga0496115_0056075 | Ga0496115_0056075_973_2013 | 333 |
| 183 | 3300053077 | Ga0495601_0032598 | Ga0495601_0032598_37_1077 | 333 |
| 184 | 3300053084 | Ga0495595_0030564 | Ga0495595_0030564_156_1196 | 333 |
| 185 | 3300053096 | Ga0500641_0005257 | Ga0500641_0005257_3154_4194 | 333 |
| 186 | 3300005354 | Ga0070675_100032912 | Ga0070675_1000329123 | 334 |
| 187 | 3300005530 | Ga0070679_100244606 | Ga0070679_1002446062 | 334 |
| 188 | 3300009148 | Ga0105243_10198668 | Ga0105243_101986681 | 334 |
| 189 | 3300009553 | Ga0105249_10137256 | Ga0105249_101372562 | 334 |
| 190 | 3300031238 | Ga0265332_10001014 | Ga0265332_100010144 | 334 |
| 191 | 3300031247 | Ga0265340_10033530 | Ga0265340_100335303 | 334 |
| 192 | 3300031249 | Ga0265339_10014704 | Ga0265339_100147044 | 334 |
| 193 | 3300031711 | Ga0265314_10040963 | Ga0265314_100409633 | 334 |
| 194 | 3300031712 | Ga0265342_10000035 | Ga0265342_1000003581 | 334 |
| 195 | 3300039450 | Ga0436363_0718092 | Ga0436363_0718092_879_1922 | 334 |
| 196 | 3300046539 | Ga0495621_0088633 | Ga0495621_0088633_97_1137 | 334 |
| 197 | 3300007265 | Ga0099794_10040005 | Ga0099794_100400053 | 335 |
| 198 | 3300025928 | Ga0207700_10113366 | Ga0207700_101133662 | 335 |
| 199 | 3300027671 | Ga0209588_1040657 | Ga0209588_10406571 | 335 |
| 200 | 3300031241 | Ga0265325_10033971 | Ga0265325_100339712 | 335 |
| 201 | 3300035170 | Ga0373943_0019066 | Ga0373943_0019066_2041_3096 | 335 |
| 202 | 3300060353 | Ga0501082_0092413 | Ga0501082_0092413_1042_2082 | 335 |
| 203 | 3300006178 | Ga0075367_10109742 | Ga0075367_101097423 | 336 |
| 204 | 3300044719 | Ga0466971_0121890 | Ga0466971_0121890_82_1122 | 336 |
| 205 | 3300049578 | Ga0501042_0177013 | Ga0501042_0177013_428_1471 | 336 |
| 206 | 3300006038 | Ga0075365_10039649 | Ga0075365_100396491 | 337 |
| 207 | 3300006178 | Ga0075367_10208496 | Ga0075367_102084962 | 337 |
| 208 | 3300037312 | Ga0395899_0002468 | Ga0395899_0002468_1218_2276 | 337 |
| 209 | 3300037418 | Ga0395900_0001885 | Ga0395900_0001885_1726_2784 | 337 |
| 210 | 3300037466 | Ga0395898_0041853 | Ga0395898_0041853_1623_2681 | 337 |
| 211 | 3300038443 | Ga0395901_0043395 | Ga0395901_0043395_273_1331 | 337 |
| 212 | 3300050492 | nmdc:mga0yw44_47060_c1 | nmdc:mga0yw44_47060_c1_1353_2393 | 337 |
| 213 | 3300049741 | Ga0501079_0117171 | Ga0501079_0117171_70_1089 | 339 |
| 214 | 3300001977 | JGI24746J21847_1007086 | JGI24746J21847_10070862 | 340 |
| 215 | 3300001990 | JGI24737J22298_10021923 | JGI24737J22298_100219233 | 340 |
| 216 | 3300002077 | JGI24744J21845_10000129 | JGI24744J21845_100001293 | 340 |
| 217 | 3300002239 | JGI24034J26672_10003265 | JGI24034J26672_100032652 | 340 |
| 218 | 3300005328 | Ga0070676_10031623 | Ga0070676_100316233 | 340 |
| 219 | 3300005329 | Ga0070683_100079414 | Ga0070683_1000794143 | 340 |
| 220 | 3300005330 | Ga0070690_100032762 | Ga0070690_1000327623 | 340 |
| 221 | 3300005331 | Ga0070670_100006320 | Ga0070670_1000063207 | 340 |
| 222 | 3300005334 | Ga0068869_100101609 | Ga0068869_1001016091 | 340 |
| 223 | 3300005335 | Ga0070666_10020349 | Ga0070666_100203492 | 340 |
| 224 | 3300005345 | Ga0070692_10019972 | Ga0070692_100199722 | 340 |
| 225 | 3300005347 | Ga0070668_100080948 | Ga0070668_1000809482 | 340 |
| 226 | 3300005347 | Ga0070668_100195394 | Ga0070668_1001953942 | 340 |
| 227 | 3300005353 | Ga0070669_100083771 | Ga0070669_1000837713 | 340 |
| 228 | 3300005355 | Ga0070671_100042470 | Ga0070671_1000424703 | 340 |
| 229 | 3300005365 | Ga0070688_100009381 | Ga0070688_1000093813 | 340 |
| 230 | 3300005366 | Ga0070659_100035031 | Ga0070659_1000350314 | 340 |
| 231 | 3300005438 | Ga0070701_10021044 | Ga0070701_100210442 | 340 |
| 232 | 3300005439 | Ga0070711_100009896 | Ga0070711_1000098966 | 340 |
| 233 | 3300005440 | Ga0070705_100005755 | Ga0070705_1000057553 | 340 |
| 234 | 3300005441 | Ga0070700_100022512 | Ga0070700_1000225122 | 340 |
| 235 | 3300005457 | Ga0070662_100007924 | Ga0070662_1000079243 | 340 |
| 236 | 3300005466 | Ga0070685_10009274 | Ga0070685_100092742 | 340 |
| 237 | 3300005543 | Ga0070672_100028026 | Ga0070672_1000280263 | 340 |
| 238 | 3300005544 | Ga0070686_100004396 | Ga0070686_1000043965 | 340 |
| 239 | 3300005548 | Ga0070665_100485364 | Ga0070665_1004853641 | 340 |
| 240 | 3300005564 | Ga0070664_100016265 | Ga0070664_1000162656 | 340 |
| 241 | 3300005614 | Ga0068856_100018775 | Ga0068856_1000187754 | 340 |
| 242 | 3300005615 | Ga0070702_100007222 | Ga0070702_1000072223 | 340 |
| 243 | 3300005616 | Ga0068852_100026665 | Ga0068852_1000266655 | 340 |
| 244 | 3300005617 | Ga0068859_100007104 | Ga0068859_1000071047 | 340 |
| 245 | 3300005618 | Ga0068864_100004309 | Ga0068864_1000043099 | 340 |
| 246 | 3300005718 | Ga0068866_10013137 | Ga0068866_100131374 | 340 |
| 247 | 3300005834 | Ga0068851_10019416 | Ga0068851_100194163 | 340 |
| 248 | 3300005840 | Ga0068870_10008422 | Ga0068870_100084223 | 340 |
| 249 | 3300005843 | Ga0068860_100026330 | Ga0068860_1000263303 | 340 |
| 250 | 3300005844 | Ga0068862_100027295 | Ga0068862_1000272953 | 340 |
| 251 | 3300006177 | Ga0075362_10019138 | Ga0075362_100191381 | 340 |
| 252 | 3300006178 | Ga0075367_10073241 | Ga0075367_100732413 | 340 |
| 253 | 3300006844 | Ga0075428_100123190 | Ga0075428_1001231902 | 340 |
| 254 | 3300006871 | Ga0075434_100002138 | Ga0075434_1000021386 | 340 |
| 255 | 3300006881 | Ga0068865_100028940 | Ga0068865_1000289404 | 340 |
| 256 | 3300006931 | Ga0097620_100007104 | Ga0097620_1000071047 | 340 |
| 257 | 3300009101 | Ga0105247_10008421 | Ga0105247_100084214 | 340 |
| 258 | 3300009101 | Ga0105247_10038934 | Ga0105247_100389342 | 340 |
| 259 | 3300009147 | Ga0114129_10010082 | Ga0114129_100100823 | 340 |
| 260 | 3300009174 | Ga0105241_10043566 | Ga0105241_100435663 | 340 |
| 261 | 3300009176 | Ga0105242_10022852 | Ga0105242_100228524 | 340 |
| 262 | 3300009177 | Ga0105248_10080587 | Ga0105248_100805872 | 340 |
| 263 | 3300010375 | Ga0105239_10094126 | Ga0105239_100941262 | 340 |
| 264 | 3300011119 | Ga0105246_10014686 | Ga0105246_100146864 | 340 |
| 265 | 3300013296 | Ga0157374_10020476 | Ga0157374_100204761 | 340 |
| 266 | 3300013306 | Ga0163162_10023125 | Ga0163162_100231252 | 340 |
| 267 | 3300013307 | Ga0157372_10157323 | Ga0157372_101573232 | 340 |
| 268 | 3300013308 | Ga0157375_10013783 | Ga0157375_100137835 | 340 |
| 269 | 3300014325 | Ga0163163_10044077 | Ga0163163_100440775 | 340 |
| 270 | 3300014325 | Ga0163163_10053814 | Ga0163163_100538143 | 340 |
| 271 | 3300014326 | Ga0157380_10022504 | Ga0157380_100225042 | 340 |
| 272 | 3300014968 | Ga0157379_10015057 | Ga0157379_100150574 | 340 |
| 273 | 3300014969 | Ga0157376_10022279 | Ga0157376_100222793 | 340 |
| 274 | 3300025900 | Ga0207710_10011074 | Ga0207710_100110742 | 340 |
| 275 | 3300025901 | Ga0207688_10000276 | Ga0207688_1000027618 | 340 |
| 276 | 3300025903 | Ga0207680_10025652 | Ga0207680_100256522 | 340 |
| 277 | 3300025907 | Ga0207645_10020572 | Ga0207645_100205724 | 340 |
| 278 | 3300025908 | Ga0207643_10001883 | Ga0207643_100018833 | 340 |
| 279 | 3300025919 | Ga0207657_10021847 | Ga0207657_100218472 | 340 |
| 280 | 3300025923 | Ga0207681_10050182 | Ga0207681_100501822 | 340 |
| 281 | 3300025925 | Ga0207650_10015682 | Ga0207650_100156824 | 340 |
| 282 | 3300025926 | Ga0207659_10006748 | Ga0207659_100067482 | 340 |
| 283 | 3300025928 | Ga0207700_10025257 | Ga0207700_100252571 | 340 |
| 284 | 3300025931 | Ga0207644_10038782 | Ga0207644_100387823 | 340 |
| 285 | 3300025932 | Ga0207690_10016846 | Ga0207690_100168465 | 340 |
| 286 | 3300025934 | Ga0207686_10031352 | Ga0207686_100313523 | 340 |
| 287 | 3300025935 | Ga0207709_10034793 | Ga0207709_100347933 | 340 |
| 288 | 3300025938 | Ga0207704_10018553 | Ga0207704_100185533 | 340 |
| 289 | 3300025940 | Ga0207691_10021969 | Ga0207691_100219693 | 340 |
| 290 | 3300025941 | Ga0207711_10023405 | Ga0207711_100234053 | 340 |
| 291 | 3300025942 | Ga0207689_10002370 | Ga0207689_1000237012 | 340 |
| 292 | 3300025944 | Ga0207661_10009753 | Ga0207661_100097532 | 340 |
| 293 | 3300025945 | Ga0207679_10081256 | Ga0207679_100812562 | 340 |
| 294 | 3300025961 | Ga0207712_10024539 | Ga0207712_100245394 | 340 |
| 295 | 3300025972 | Ga0207668_10020821 | Ga0207668_100208215 | 340 |
| 296 | 3300025972 | Ga0207668_10180924 | Ga0207668_101809242 | 340 |
| 297 | 3300025981 | Ga0207640_10025371 | Ga0207640_100253713 | 340 |
| 298 | 3300026023 | Ga0207677_10014241 | Ga0207677_100142412 | 340 |
| 299 | 3300026035 | Ga0207703_10010855 | Ga0207703_100108555 | 340 |
| 300 | 3300026041 | Ga0207639_10032877 | Ga0207639_100328771 | 340 |
| 301 | 3300026075 | Ga0207708_10000256 | Ga0207708_1000025624 | 340 |
| 302 | 3300026078 | Ga0207702_10053363 | Ga0207702_100533631 | 340 |
| 303 | 3300026088 | Ga0207641_10038449 | Ga0207641_100384493 | 340 |
| 304 | 3300026116 | Ga0207674_10118492 | Ga0207674_101184922 | 340 |
| 305 | 3300026118 | Ga0207675_100002373 | Ga0207675_1000023736 | 340 |
| 306 | 3300026121 | Ga0207683_10055140 | Ga0207683_100551402 | 340 |
| 307 | 3300026142 | Ga0207698_10079743 | Ga0207698_100797432 | 340 |
| 308 | 3300028379 | Ga0268266_10094562 | Ga0268266_100945621 | 340 |
| 309 | 3300028381 | Ga0268264_10008918 | Ga0268264_100089185 | 340 |
| 310 | 3300035116 | Ga0373945_0013214 | Ga0373945_0013214_672_1712 | 340 |
| 311 | 3300035692 | Ga0373935_0114153 | Ga0373935_0114153_400_1440 | 340 |
| 312 | 3300037068 | Ga0373925_0005578 | Ga0373925_0005578_8304_9344 | 340 |
| 313 | 3300046455 | Ga0495603_0059418 | Ga0495603_0059418_624_1664 | 340 |
| 314 | 3300046459 | Ga0495629_0139610 | Ga0495629_0139610_311_1360 | 340 |
| 315 | 3300046461 | Ga0495641_0075739 | Ga0495641_0075739_215_1255 | 340 |
| 316 | 3300046473 | Ga0495582_0035855 | Ga0495582_0035855_458_1507 | 340 |
| 317 | 3300046473 | Ga0495582_0141304 | Ga0495582_0141304_173_1213 | 340 |
| 318 | 3300046475 | Ga0495639_0124449 | Ga0495639_0124449_86_1126 | 340 |
| 319 | 3300046491 | Ga0495584_0086032 | Ga0495584_0086032_132_1172 | 340 |
| 320 | 3300046499 | Ga0495594_0057062 | Ga0495594_0057062_692_1732 | 340 |
| 321 | 3300046517 | Ga0495630_0146463 | Ga0495630_0146463_727_1776 | 340 |
| 322 | 3300046517 | Ga0495630_0198539 | Ga0495630_0198539_278_1318 | 340 |
| 323 | 3300046537 | Ga0495598_0001163 | Ga0495598_0001163_1831_2871 | 340 |
| 324 | 3300046537 | Ga0495598_0021826 | Ga0495598_0021826_500_1540 | 340 |
| 325 | 3300046683 | Ga0495658_0030249 | Ga0495658_0030249_49_1089 | 340 |
| 326 | 3300046810 | Ga0495660_0132045 | Ga0495660_0132045_26_1066 | 340 |
| 327 | 3300047321 | Ga0495676_0053487 | Ga0495676_0053487_1505_2545 | 340 |
| 328 | 3300048903 | Ga0496100_0031123 | Ga0496100_0031123_405_1445 | 340 |
| 329 | 3300048904 | Ga0496101_0000604 | Ga0496101_0000604_3228_4268 | 340 |
| 330 | 3300048905 | Ga0496102_0005128 | Ga0496102_0005128_5402_6442 | 340 |
| 331 | 3300048905 | Ga0496102_0015419 | Ga0496102_0015419_3399_4439 | 340 |
| 332 | 3300048906 | Ga0496103_0005104 | Ga0496103_0005104_5538_6578 | 340 |
| 333 | 3300048907 | Ga0496104_0031476 | Ga0496104_0031476_511_1551 | 340 |
| 334 | 3300048907 | Ga0496104_0032114 | Ga0496104_0032114_1200_2240 | 340 |
| 335 | 3300048908 | Ga0496105_0004357 | Ga0496105_0004357_4322_5362 | 340 |
| 336 | 3300048909 | Ga0496106_0002626 | Ga0496106_0002626_3684_4724 | 340 |
| 337 | 3300048910 | Ga0496107_0000129 | Ga0496107_0000129_31671_32711 | 340 |
| 338 | 3300048910 | Ga0496107_0005132 | Ga0496107_0005132_2555_3595 | 340 |
| 339 | 3300048911 | Ga0496108_0000595 | Ga0496108_0000595_1860_2900 | 340 |
| 340 | 3300048911 | Ga0496108_0007392 | Ga0496108_0007392_2519_3559 | 340 |
| 341 | 3300048912 | Ga0496109_0015516 | Ga0496109_0015516_2218_3258 | 340 |
| 342 | 3300048912 | Ga0496109_0029346 | Ga0496109_0029346_3781_4821 | 340 |
| 343 | 3300048912 | Ga0496109_0570041 | Ga0496109_0570041_16_1056 | 340 |
| 344 | 3300048913 | Ga0496110_0000579 | Ga0496110_0000579_4010_5050 | 340 |
| 345 | 3300048914 | Ga0496111_0000122 | Ga0496111_0000122_29997_31037 | 340 |
| 346 | 3300048914 | Ga0496111_0000845 | Ga0496111_0000845_11990_13030 | 340 |
| 347 | 3300048915 | Ga0496112_0005655 | Ga0496112_0005655_3922_4962 | 340 |
| 348 | 3300048915 | Ga0496112_0045602 | Ga0496112_0045602_3152_4192 | 340 |
| 349 | 3300048916 | Ga0496113_0000068 | Ga0496113_0000068_19193_20233 | 340 |
| 350 | 3300048916 | Ga0496113_0002918 | Ga0496113_0002918_4002_5042 | 340 |
| 351 | 3300048917 | Ga0496114_0010925 | Ga0496114_0010925_1945_2985 | 340 |
| 352 | 3300048918 | Ga0496115_0049351 | Ga0496115_0049351_1396_2436 | 340 |
| 353 | 3300050507 | nmdc:mga05p37_4379_c1 | nmdc:mga05p37_4379_c1_4012_5052 | 340 |
| 354 | 3300053077 | Ga0495601_0117275 | Ga0495601_0117275_174_1214 | 340 |
| 355 | 3300025933 | Ga0207706_10005901 | Ga0207706_100059018 | 341 |
| 356 | iso_pu_bacteria | 2643221547 | 2643756399 | 342 |
| 357 | iso_pu_bacteria | 2842694124 | 2842697653 | 342 |
| 358 | iso_pu_bacteria | 2891088606 | 2891089995 | 342 |
| 359 | 3300005983 | Ga0081540_1029094 | Ga0081540_10290943 | 343 |
| 360 | 3300006237 | Ga0097621_100032849 | Ga0097621_1000328495 | 343 |
| 361 | 3300006852 | Ga0075433_10002775 | Ga0075433_100027752 | 343 |
| 362 | 3300006871 | Ga0075434_100023001 | Ga0075434_1000230011 | 343 |
| 363 | 3300007788 | Ga0099795_10006498 | Ga0099795_100064984 | 343 |
| 364 | 3300035088 | Ga0373940_0003532 | Ga0373940_0003532_1753_2790 | 343 |
| 365 | 3300035695 | Ga0373927_0008005 | Ga0373927_0008005_559_1596 | 343 |
| 366 | 3300035695 | Ga0373927_0106824 | Ga0373927_0106824_146_1195 | 343 |
| 367 | 3300046531 | Ga0495665_0099672 | Ga0495665_0099672_111_1148 | 343 |
| 368 | 3300047315 | Ga0495581_0099987 | Ga0495581_0099987_195_1232 | 343 |
| 369 | 3300048913 | Ga0496110_0279886 | Ga0496110_0279886_240_1277 | 343 |
| 370 | 3300050512 | nmdc:mga0n895_68953_c1 | nmdc:mga0n895_68953_c1_152_1189 | 343 |
| 371 | 3300050515 | nmdc:mga0a205_7888_c1 | nmdc:mga0a205_7888_c1_2213_3250 | 343 |
| 372 | 3300031456 | Ga0307513_10039588 | Ga0307513_100395884 | 344 |
| 373 | 3300035116 | Ga0373945_0030285 | Ga0373945_0030285_183_1220 | 344 |
| 374 | 3300035171 | Ga0373946_0031607 | Ga0373946_0031607_1037_2074 | 344 |
| 375 | 3300036401 | Ga0373937_0264222 | Ga0373937_0264222_435_1472 | 344 |
| 376 | 3300037068 | Ga0373925_0014171 | Ga0373925_0014171_1133_2170 | 344 |
| 377 | 3300046460 | Ga0495638_0182569 | Ga0495638_0182569_135_1181 | 344 |
| 378 | 3300046476 | Ga0495662_0081789 | Ga0495662_0081789_463_1500 | 344 |
| 379 | 3300046533 | Ga0495640_0111630 | Ga0495640_0111630_704_1741 | 344 |
| 380 | 3300046642 | Ga0495634_0101196 | Ga0495634_0101196_198_1235 | 344 |
| 381 | 3300035170 | Ga0373943_0000943 | Ga0373943_0000943_504_1544 | 345 |
| 382 | 3300035171 | Ga0373946_0001331 | Ga0373946_0001331_706_1746 | 345 |
| 383 | 3300035692 | Ga0373935_0002327 | Ga0373935_0002327_3603_4643 | 345 |
| 384 | 3300035695 | Ga0373927_0003463 | Ga0373927_0003463_1263_2303 | 345 |
| 385 | 3300035725 | Ga0373947_0000574 | Ga0373947_0000574_14245_15285 | 345 |
| 386 | 3300037068 | Ga0373925_0001647 | Ga0373925_0001647_3687_4727 | 345 |
| 387 | 3300046459 | Ga0495629_0105668 | Ga0495629_0105668_192_1232 | 345 |
| 388 | 3300046460 | Ga0495638_0002961 | Ga0495638_0002961_1016_2095 | 345 |
| 389 | 3300046476 | Ga0495662_0012231 | Ga0495662_0012231_1549_2589 | 345 |
| 390 | 3300046517 | Ga0495630_0003509 | Ga0495630_0003509_8449_9489 | 345 |
| 391 | 3300046533 | Ga0495640_0019507 | Ga0495640_0019507_392_1432 | 345 |
| 392 | 3300046642 | Ga0495634_0071521 | Ga0495634_0071521_1217_2257 | 345 |
| 393 | 3300046663 | Ga0495635_0082945 | Ga0495635_0082945_756_1796 | 345 |
| 394 | 3300046683 | Ga0495658_0016513 | Ga0495658_0016513_951_1991 | 345 |
| 395 | 3300046690 | Ga0495624_0009460 | Ga0495624_0009460_1532_2572 | 345 |
| 396 | 3300047315 | Ga0495581_0006750 | Ga0495581_0006750_2273_3313 | 345 |
| 397 | 3300047321 | Ga0495676_0006491 | Ga0495676_0006491_727_1767 | 345 |
| 398 | 3300047471 | Ga0495684_0004889 | Ga0495684_0004889_3112_4152 | 345 |
| 399 | 3300047673 | Ga0495593_0022923 | Ga0495593_0022923_1305_2345 | 345 |
| 400 | 3300048903 | Ga0496100_0029143 | Ga0496100_0029143_2016_3071 | 345 |
| 401 | 3300048905 | Ga0496102_0030697 | Ga0496102_0030697_3187_4242 | 345 |
| 402 | 3300048907 | Ga0496104_0002062 | Ga0496104_0002062_2572_3627 | 345 |
| 403 | 3300048908 | Ga0496105_0147348 | Ga0496105_0147348_67_1122 | 345 |
| 404 | 3300048910 | Ga0496107_0007357 | Ga0496107_0007357_2466_3521 | 345 |
| 405 | 3300048911 | Ga0496108_0037385 | Ga0496108_0037385_1555_2610 | 345 |
| 406 | 3300048912 | Ga0496109_0009902 | Ga0496109_0009902_5082_6137 | 345 |
| 407 | 3300048913 | Ga0496110_0011041 | Ga0496110_0011041_3651_4706 | 345 |
| 408 | 3300048916 | Ga0496113_0009362 | Ga0496113_0009362_2292_3347 | 345 |
| 409 | 3300053085 | Ga0495619_0053214 | Ga0495619_0053214_312_1352 | 345 |
| 410 | 3300001430 | JGI24032J14994_100456 | JGI24032J14994_1004563 | 346 |
| 411 | 3300001915 | JGI24741J21665_1009374 | JGI24741J21665_10093742 | 346 |
| 412 | 3300001989 | JGI24739J22299_10005177 | JGI24739J22299_100051774 | 346 |
| 413 | 3300001990 | JGI24737J22298_10007210 | JGI24737J22298_100072102 | 346 |
| 414 | 3300001991 | JGI24743J22301_10004958 | JGI24743J22301_100049582 | 346 |
| 415 | 3300002070 | JGI24750J21931_1000172 | JGI24750J21931_10001724 | 346 |
| 416 | 3300002074 | JGI24748J21848_1000609 | JGI24748J21848_10006093 | 346 |
| 417 | 3300002075 | JGI24738J21930_10000223 | JGI24738J21930_1000022315 | 346 |
| 418 | 3300002076 | JGI24749J21850_1001214 | JGI24749J21850_10012142 | 346 |
| 419 | 3300002244 | JGI24742J22300_10001901 | JGI24742J22300_100019012 | 346 |
| 420 | 3300002459 | JGI24751J29686_10002778 | JGI24751J29686_100027784 | 346 |
| 421 | 3300005290 | Ga0065712_10095195 | Ga0065712_100951952 | 346 |
| 422 | 3300005293 | Ga0065715_10091352 | Ga0065715_100913523 | 346 |
| 423 | 3300005328 | Ga0070676_10000012 | Ga0070676_1000001242 | 346 |
| 424 | 3300005329 | Ga0070683_100000139 | Ga0070683_10000013923 | 346 |
| 425 | 3300005331 | Ga0070670_100006855 | Ga0070670_1000068555 | 346 |
| 426 | 3300005333 | Ga0070677_10000125 | Ga0070677_1000012515 | 346 |
| 427 | 3300005334 | Ga0068869_100000605 | Ga0068869_1000006053 | 346 |
| 428 | 3300005335 | Ga0070666_10124051 | Ga0070666_101240511 | 346 |
| 429 | 3300005336 | Ga0070680_100000179 | Ga0070680_10000017920 | 346 |
| 430 | 3300005337 | Ga0070682_100000565 | Ga0070682_10000056517 | 346 |
| 431 | 3300005338 | Ga0068868_100001158 | Ga0068868_1000011589 | 346 |
| 432 | 3300005339 | Ga0070660_100001605 | Ga0070660_10000160514 | 346 |
| 433 | 3300005340 | Ga0070689_100000190 | Ga0070689_10000019032 | 346 |
| 434 | 3300005341 | Ga0070691_10000706 | Ga0070691_100007063 | 346 |
| 435 | 3300005343 | Ga0070687_100003795 | Ga0070687_1000037953 | 346 |
| 436 | 3300005344 | Ga0070661_100001455 | Ga0070661_1000014554 | 346 |
| 437 | 3300005345 | Ga0070692_10000434 | Ga0070692_1000043412 | 346 |
| 438 | 3300005347 | Ga0070668_100000597 | Ga0070668_1000005973 | 346 |
| 439 | 3300005353 | Ga0070669_100000409 | Ga0070669_10000040914 | 346 |
| 440 | 3300005354 | Ga0070675_100000166 | Ga0070675_10000016642 | 346 |
| 441 | 3300005355 | Ga0070671_100009212 | Ga0070671_1000092122 | 346 |
| 442 | 3300005355 | Ga0070671_100125673 | Ga0070671_1001256732 | 346 |
| 443 | 3300005356 | Ga0070674_100000084 | Ga0070674_10000008441 | 346 |
| 444 | 3300005364 | Ga0070673_100000041 | Ga0070673_10000004123 | 346 |
| 445 | 3300005365 | Ga0070688_100000180 | Ga0070688_10000018026 | 346 |
| 446 | 3300005366 | Ga0070659_100000752 | Ga0070659_1000007525 | 346 |
| 447 | 3300005367 | Ga0070667_100000365 | Ga0070667_10000036513 | 346 |
| 448 | 3300005367 | Ga0070667_100102800 | Ga0070667_1001028003 | 346 |
| 449 | 3300005406 | Ga0070703_10000903 | Ga0070703_100009033 | 346 |
| 450 | 3300005434 | Ga0070709_10133446 | Ga0070709_101334462 | 346 |
| 451 | 3300005437 | Ga0070710_10121752 | Ga0070710_101217522 | 346 |
| 452 | 3300005438 | Ga0070701_10000493 | Ga0070701_100004934 | 346 |
| 453 | 3300005439 | Ga0070711_100082736 | Ga0070711_1000827361 | 346 |
| 454 | 3300005440 | Ga0070705_100001328 | Ga0070705_1000013283 | 346 |
| 455 | 3300005441 | Ga0070700_100000467 | Ga0070700_1000004676 | 346 |
| 456 | 3300005444 | Ga0070694_100000065 | Ga0070694_10000006538 | 346 |
| 457 | 3300005445 | Ga0070708_100023359 | Ga0070708_1000233594 | 346 |
| 458 | 3300005455 | Ga0070663_100000473 | Ga0070663_1000004734 | 346 |
| 459 | 3300005455 | Ga0070663_100040620 | Ga0070663_1000406202 | 346 |
| 460 | 3300005456 | Ga0070678_100000091 | Ga0070678_10000009114 | 346 |
| 461 | 3300005456 | Ga0070678_100264345 | Ga0070678_1002643452 | 346 |
| 462 | 3300005457 | Ga0070662_100000629 | Ga0070662_10000062915 | 346 |
| 463 | 3300005458 | Ga0070681_10025730 | Ga0070681_100257303 | 346 |
| 464 | 3300005458 | Ga0070681_10068737 | Ga0070681_100687374 | 346 |
| 465 | 3300005458 | Ga0070681_10161798 | Ga0070681_101617981 | 346 |
| 466 | 3300005459 | Ga0068867_100001090 | Ga0068867_1000010909 | 346 |
| 467 | 3300005466 | Ga0070685_10002067 | Ga0070685_100020672 | 346 |
| 468 | 3300005518 | Ga0070699_100135624 | Ga0070699_1001356241 | 346 |
| 469 | 3300005530 | Ga0070679_100015891 | Ga0070679_1000158913 | 346 |
| 470 | 3300005530 | Ga0070679_100055203 | Ga0070679_1000552033 | 346 |
| 471 | 3300005535 | Ga0070684_100000219 | Ga0070684_10000021914 | 346 |
| 472 | 3300005539 | Ga0068853_100000600 | Ga0068853_10000060011 | 346 |
| 473 | 3300005543 | Ga0070672_100000019 | Ga0070672_10000001923 | 346 |
| 474 | 3300005544 | Ga0070686_100000318 | Ga0070686_10000031820 | 346 |
| 475 | 3300005544 | Ga0070686_100166544 | Ga0070686_1001665442 | 346 |
| 476 | 3300005545 | Ga0070695_100000474 | Ga0070695_1000004746 | 346 |
| 477 | 3300005546 | Ga0070696_100009125 | Ga0070696_1000091252 | 346 |
| 478 | 3300005547 | Ga0070693_100000036 | Ga0070693_1000000364 | 346 |
| 479 | 3300005549 | Ga0070704_100000252 | Ga0070704_10000025210 | 346 |
| 480 | 3300005563 | Ga0068855_100019218 | Ga0068855_1000192185 | 346 |
| 481 | 3300005564 | Ga0070664_100000819 | Ga0070664_10000081921 | 346 |
| 482 | 3300005577 | Ga0068857_100000768 | Ga0068857_10000076815 | 346 |
| 483 | 3300005578 | Ga0068854_100000179 | Ga0068854_1000001795 | 346 |
| 484 | 3300005614 | Ga0068856_100003866 | Ga0068856_10000386611 | 346 |
| 485 | 3300005615 | Ga0070702_100000071 | Ga0070702_1000000712 | 346 |
| 486 | 3300005616 | Ga0068852_100002121 | Ga0068852_10000212110 | 346 |
| 487 | 3300005617 | Ga0068859_100001870 | Ga0068859_1000018709 | 346 |
| 488 | 3300005618 | Ga0068864_100000429 | Ga0068864_10000042923 | 346 |
| 489 | 3300005718 | Ga0068866_10000461 | Ga0068866_100004615 | 346 |
| 490 | 3300005719 | Ga0068861_100000169 | Ga0068861_10000016915 | 346 |
| 491 | 3300005840 | Ga0068870_10000586 | Ga0068870_1000058614 | 346 |
| 492 | 3300005841 | Ga0068863_100000381 | Ga0068863_10000038120 | 346 |
| 493 | 3300005842 | Ga0068858_100030479 | Ga0068858_1000304794 | 346 |
| 494 | 3300005842 | Ga0068858_100272187 | Ga0068858_1002721872 | 346 |
| 495 | 3300005843 | Ga0068860_100001472 | Ga0068860_10000147210 | 346 |
| 496 | 3300005843 | Ga0068860_100108763 | Ga0068860_1001087633 | 346 |
| 497 | 3300005843 | Ga0068860_100207999 | Ga0068860_1002079991 | 346 |
| 498 | 3300005844 | Ga0068862_100001886 | Ga0068862_10000188615 | 346 |
| 499 | 3300005937 | Ga0081455_10000036 | Ga0081455_10000036118 | 346 |
| 500 | 3300005937 | Ga0081455_10011279 | Ga0081455_100112795 | 346 |
| 501 | 3300005937 | Ga0081455_10035188 | Ga0081455_100351882 | 346 |
| 502 | 3300006038 | Ga0075365_10074111 | Ga0075365_100741111 | 346 |
| 503 | 3300006051 | Ga0075364_10061544 | Ga0075364_100615444 | 346 |
| 504 | 3300006237 | Ga0097621_100001234 | Ga0097621_10000123415 | 346 |
| 505 | 3300006358 | Ga0068871_100000068 | Ga0068871_10000006843 | 346 |
| 506 | 3300006844 | Ga0075428_100122273 | Ga0075428_1001222732 | 346 |
| 507 | 3300006844 | Ga0075428_100231818 | Ga0075428_1002318181 | 346 |
| 508 | 3300006847 | Ga0075431_100197790 | Ga0075431_1001977902 | 346 |
| 509 | 3300006881 | Ga0068865_100000294 | Ga0068865_1000002942 | 346 |
| 510 | 3300006914 | Ga0075436_100022391 | Ga0075436_1000223913 | 346 |
| 511 | 3300006931 | Ga0097620_100001870 | Ga0097620_1000018709 | 346 |
| 512 | 3300007076 | Ga0075435_100063250 | Ga0075435_1000632502 | 346 |
| 513 | 3300009093 | Ga0105240_10023458 | Ga0105240_100234587 | 346 |
| 514 | 3300009098 | Ga0105245_10000780 | Ga0105245_1000078023 | 346 |
| 515 | 3300009101 | Ga0105247_10005194 | Ga0105247_100051943 | 346 |
| 516 | 3300009101 | Ga0105247_10038435 | Ga0105247_100384353 | 346 |
| 517 | 3300009147 | Ga0114129_10134226 | Ga0114129_101342262 | 346 |
| 518 | 3300009148 | Ga0105243_10001083 | Ga0105243_1000108324 | 346 |
| 519 | 3300009174 | Ga0105241_10000760 | Ga0105241_1000076023 | 346 |
| 520 | 3300009176 | Ga0105242_10006332 | Ga0105242_100063325 | 346 |
| 521 | 3300009176 | Ga0105242_10030536 | Ga0105242_100305363 | 346 |
| 522 | 3300009176 | Ga0105242_10229678 | Ga0105242_102296782 | 346 |
| 523 | 3300009177 | Ga0105248_10160902 | Ga0105248_101609023 | 346 |
| 524 | 3300009177 | Ga0105248_10197706 | Ga0105248_101977062 | 346 |
| 525 | 3300009545 | Ga0105237_10007890 | Ga0105237_100078905 | 346 |
| 526 | 3300009545 | Ga0105237_10064505 | Ga0105237_100645053 | 346 |
| 527 | 3300009553 | Ga0105249_10000755 | Ga0105249_100007552 | 346 |
| 528 | 3300010375 | Ga0105239_10002791 | Ga0105239_1000279122 | 346 |
| 529 | 3300010375 | Ga0105239_10507914 | Ga0105239_105079142 | 346 |
| 530 | 3300011119 | Ga0105246_10000061 | Ga0105246_1000006135 | 346 |
| 531 | 3300013100 | Ga0157373_10030638 | Ga0157373_100306382 | 346 |
| 532 | 3300013102 | Ga0157371_10015260 | Ga0157371_100152603 | 346 |
| 533 | 3300013296 | Ga0157374_10001691 | Ga0157374_100016914 | 346 |
| 534 | 3300013296 | Ga0157374_10306851 | Ga0157374_103068512 | 346 |
| 535 | 3300013297 | Ga0157378_10001445 | Ga0157378_100014453 | 346 |
| 536 | 3300013306 | Ga0163162_10000790 | Ga0163162_100007904 | 346 |
| 537 | 3300013306 | Ga0163162_10020256 | Ga0163162_100202563 | 346 |
| 538 | 3300013307 | Ga0157372_10016229 | Ga0157372_100162296 | 346 |
| 539 | 3300013307 | Ga0157372_10357216 | Ga0157372_103572162 | 346 |
| 540 | 3300013308 | Ga0157375_10000468 | Ga0157375_1000046814 | 346 |
| 541 | 3300013308 | Ga0157375_10138136 | Ga0157375_101381363 | 346 |
| 542 | 3300014325 | Ga0163163_10001508 | Ga0163163_100015086 | 346 |
| 543 | 3300014326 | Ga0157380_10007877 | Ga0157380_100078772 | 346 |
| 544 | 3300014745 | Ga0157377_10000276 | Ga0157377_1000027624 | 346 |
| 545 | 3300014968 | Ga0157379_10004514 | Ga0157379_100045149 | 346 |
| 546 | 3300014968 | Ga0157379_10026464 | Ga0157379_100264644 | 346 |
| 547 | 3300014969 | Ga0157376_10000692 | Ga0157376_1000069213 | 346 |
| 548 | 3300017792 | Ga0163161_10000384 | Ga0163161_1000038423 | 346 |
| 549 | 3300020069 | Ga0197907_10934374 | Ga0197907_109343741 | 346 |
| 550 | 3300020070 | Ga0206356_10856229 | Ga0206356_108562292 | 346 |
| 551 | 3300020082 | Ga0206353_10594769 | Ga0206353_105947692 | 346 |
| 552 | 3300021388 | Ga0213875_10000007 | Ga0213875_10000007151 | 346 |
| 553 | 3300024225 | Ga0224572_1010103 | Ga0224572_10101032 | 346 |
| 554 | 3300025271 | Ga0207666_1000097 | Ga0207666_10000973 | 346 |
| 555 | 3300025290 | Ga0207673_1000054 | Ga0207673_10000544 | 346 |
| 556 | 3300025315 | Ga0207697_10000550 | Ga0207697_100005503 | 346 |
| 557 | 3300025885 | Ga0207653_10008172 | Ga0207653_100081723 | 346 |
| 558 | 3300025893 | Ga0207682_10000088 | Ga0207682_1000008824 | 346 |
| 559 | 3300025898 | Ga0207692_10060130 | Ga0207692_100601302 | 346 |
| 560 | 3300025899 | Ga0207642_10000926 | Ga0207642_100009264 | 346 |
| 561 | 3300025901 | Ga0207688_10001203 | Ga0207688_1000120314 | 346 |
| 562 | 3300025904 | Ga0207647_10002714 | Ga0207647_1000271414 | 346 |
| 563 | 3300025906 | Ga0207699_10026117 | Ga0207699_100261174 | 346 |
| 564 | 3300025906 | Ga0207699_10283479 | Ga0207699_102834791 | 346 |
| 565 | 3300025907 | Ga0207645_10000140 | Ga0207645_1000014014 | 346 |
| 566 | 3300025908 | Ga0207643_10000083 | Ga0207643_1000008314 | 346 |
| 567 | 3300025910 | Ga0207684_10025559 | Ga0207684_100255594 | 346 |
| 568 | 3300025911 | Ga0207654_10005138 | Ga0207654_100051385 | 346 |
| 569 | 3300025911 | Ga0207654_10053666 | Ga0207654_100536663 | 346 |
| 570 | 3300025912 | Ga0207707_10004967 | Ga0207707_100049675 | 346 |
| 571 | 3300025912 | Ga0207707_10013826 | Ga0207707_100138264 | 346 |
| 572 | 3300025912 | Ga0207707_10056844 | Ga0207707_100568442 | 346 |
| 573 | 3300025913 | Ga0207695_10131832 | Ga0207695_101318323 | 346 |
| 574 | 3300025913 | Ga0207695_10310300 | Ga0207695_103103002 | 346 |
| 575 | 3300025915 | Ga0207693_10062777 | Ga0207693_100627772 | 346 |
| 576 | 3300025916 | Ga0207663_10228813 | Ga0207663_102288133 | 346 |
| 577 | 3300025917 | Ga0207660_10000073 | Ga0207660_1000007310 | 346 |
| 578 | 3300025917 | Ga0207660_10059995 | Ga0207660_100599953 | 346 |
| 579 | 3300025917 | Ga0207660_10116369 | Ga0207660_101163692 | 346 |
| 580 | 3300025918 | Ga0207662_10000964 | Ga0207662_100009643 | 346 |
| 581 | 3300025919 | Ga0207657_10005395 | Ga0207657_100053953 | 346 |
| 582 | 3300025919 | Ga0207657_10036881 | Ga0207657_100368814 | 346 |
| 583 | 3300025919 | Ga0207657_10169967 | Ga0207657_101699673 | 346 |
| 584 | 3300025920 | Ga0207649_10000450 | Ga0207649_100004509 | 346 |
| 585 | 3300025921 | Ga0207652_10007770 | Ga0207652_100077705 | 346 |
| 586 | 3300025921 | Ga0207652_10025311 | Ga0207652_100253115 | 346 |
| 587 | 3300025921 | Ga0207652_10038151 | Ga0207652_100381514 | 346 |
| 588 | 3300025923 | Ga0207681_10000097 | Ga0207681_1000009742 | 346 |
| 589 | 3300025926 | Ga0207659_10000092 | Ga0207659_1000009236 | 346 |
| 590 | 3300025927 | Ga0207687_10000129 | Ga0207687_100001296 | 346 |
| 591 | 3300025928 | Ga0207700_10023166 | Ga0207700_100231665 | 346 |
| 592 | 3300025928 | Ga0207700_10025742 | Ga0207700_100257424 | 346 |
| 593 | 3300025931 | Ga0207644_10021324 | Ga0207644_100213242 | 346 |
| 594 | 3300025931 | Ga0207644_10054061 | Ga0207644_100540612 | 346 |
| 595 | 3300025932 | Ga0207690_10002606 | Ga0207690_100026065 | 346 |
| 596 | 3300025932 | Ga0207690_10119775 | Ga0207690_101197752 | 346 |
| 597 | 3300025933 | Ga0207706_10004310 | Ga0207706_1000431014 | 346 |
| 598 | 3300025933 | Ga0207706_10073834 | Ga0207706_100738344 | 346 |
| 599 | 3300025934 | Ga0207686_10000796 | Ga0207686_1000079615 | 346 |
| 600 | 3300025935 | Ga0207709_10000362 | Ga0207709_1000036220 | 346 |
| 601 | 3300025936 | Ga0207670_10004868 | Ga0207670_100048685 | 346 |
| 602 | 3300025937 | Ga0207669_10000350 | Ga0207669_100003502 | 346 |
| 603 | 3300025937 | Ga0207669_10081479 | Ga0207669_100814792 | 346 |
| 604 | 3300025938 | Ga0207704_10000757 | Ga0207704_100007572 | 346 |
| 605 | 3300025939 | Ga0207665_10047129 | Ga0207665_100471294 | 346 |
| 606 | 3300025940 | Ga0207691_10000283 | Ga0207691_1000028336 | 346 |
| 607 | 3300025941 | Ga0207711_10269776 | Ga0207711_102697762 | 346 |
| 608 | 3300025942 | Ga0207689_10000085 | Ga0207689_1000008573 | 346 |
| 609 | 3300025942 | Ga0207689_10293660 | Ga0207689_102936602 | 346 |
| 610 | 3300025944 | Ga0207661_10000464 | Ga0207661_1000046424 | 346 |
| 611 | 3300025945 | Ga0207679_10000030 | Ga0207679_10000030143 | 346 |
| 612 | 3300025945 | Ga0207679_10061285 | Ga0207679_100612854 | 346 |
| 613 | 3300025949 | Ga0207667_10018715 | Ga0207667_100187155 | 346 |
| 614 | 3300025949 | Ga0207667_10041317 | Ga0207667_100413174 | 346 |
| 615 | 3300025960 | Ga0207651_10000088 | Ga0207651_100000885 | 346 |
| 616 | 3300025960 | Ga0207651_10035283 | Ga0207651_100352833 | 346 |
| 617 | 3300025961 | Ga0207712_10096114 | Ga0207712_100961143 | 346 |
| 618 | 3300025972 | Ga0207668_10000114 | Ga0207668_1000011436 | 346 |
| 619 | 3300025981 | Ga0207640_10000616 | Ga0207640_1000061616 | 346 |
| 620 | 3300025986 | Ga0207658_10002853 | Ga0207658_100028534 | 346 |
| 621 | 3300026023 | Ga0207677_10001731 | Ga0207677_100017319 | 346 |
| 622 | 3300026035 | Ga0207703_10000983 | Ga0207703_1000098317 | 346 |
| 623 | 3300026041 | Ga0207639_10000305 | Ga0207639_100003059 | 346 |
| 624 | 3300026067 | Ga0207678_10000125 | Ga0207678_1000012543 | 346 |
| 625 | 3300026075 | Ga0207708_10000187 | Ga0207708_100001873 | 346 |
| 626 | 3300026078 | Ga0207702_10008418 | Ga0207702_100084187 | 346 |
| 627 | 3300026088 | Ga0207641_10002129 | Ga0207641_1000212910 | 346 |
| 628 | 3300026089 | Ga0207648_10002168 | Ga0207648_1000216824 | 346 |
| 629 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007423 | 346 |
| 630 | 3300026116 | Ga0207674_10002501 | Ga0207674_100025013 | 346 |
| 631 | 3300026118 | Ga0207675_100004556 | Ga0207675_1000045563 | 346 |
| 632 | 3300026121 | Ga0207683_10000014 | Ga0207683_1000001437 | 346 |
| 633 | 3300027378 | Ga0209981_1009723 | Ga0209981_10097231 | 346 |
| 634 | 3300027617 | Ga0210002_1000767 | Ga0210002_10007674 | 346 |
| 635 | 3300027717 | Ga0209998_10003457 | Ga0209998_100034572 | 346 |
| 636 | 3300027907 | Ga0207428_10000467 | Ga0207428_1000046725 | 346 |
| 637 | 3300027907 | Ga0207428_10175555 | Ga0207428_101755551 | 346 |
| 638 | 3300028380 | Ga0268265_10001371 | Ga0268265_1000137111 | 346 |
| 639 | 3300028381 | Ga0268264_10000469 | Ga0268264_1000046922 | 346 |
| 640 | 3300031241 | Ga0265325_10000423 | Ga0265325_1000042317 | 346 |
| 641 | 3300031241 | Ga0265325_10046647 | Ga0265325_100466472 | 346 |
| 642 | 3300031247 | Ga0265340_10127742 | Ga0265340_101277421 | 346 |
| 643 | 3300031595 | Ga0265313_10012760 | Ga0265313_100127603 | 346 |
| 644 | 3300031711 | Ga0265314_10061077 | Ga0265314_100610771 | 346 |
| 645 | 3300031712 | Ga0265342_10004840 | Ga0265342_100048406 | 346 |
| 646 | 3300035090 | Ga0373949_0005195 | Ga0373949_0005195_779_1825 | 346 |
| 647 | 3300035111 | Ga0373923_0006009 | Ga0373923_0006009_2062_3114 | 346 |
| 648 | 3300035112 | Ga0373932_0004024 | Ga0373932_0004024_1260_2306 | 346 |
| 649 | 3300035118 | Ga0373954_0002030 | Ga0373954_0002030_5477_6523 | 346 |
| 650 | 3300035118 | Ga0373954_0006107 | Ga0373954_0006107_2797_3849 | 346 |
| 651 | 3300035118 | Ga0373954_0034900 | Ga0373954_0034900_443_1483 | 346 |
| 652 | 3300035119 | Ga0373956_0001485 | Ga0373956_0001485_942_1988 | 346 |
| 653 | 3300035119 | Ga0373956_0004320 | Ga0373956_0004320_3407_4447 | 346 |
| 654 | 3300035120 | Ga0373957_0007742 | Ga0373957_0007742_214_1266 | 346 |
| 655 | 3300035120 | Ga0373957_0064588 | Ga0373957_0064588_266_1312 | 346 |
| 656 | 3300035121 | Ga0373960_0000611 | Ga0373960_0000611_318_1364 | 346 |
| 657 | 3300035172 | Ga0373955_0010198 | Ga0373955_0010198_3085_4137 | 346 |
| 658 | 3300035172 | Ga0373955_0024586 | Ga0373955_0024586_192_1232 | 346 |
| 659 | 3300035410 | Ga0373924_0016450 | Ga0373924_0016450_836_1882 | 346 |
| 660 | 3300035691 | Ga0373931_0000169 | Ga0373931_0000169_8957_10003 | 346 |
| 661 | 3300035695 | Ga0373927_0032604 | Ga0373927_0032604_1395_2447 | 346 |
| 662 | 3300035724 | Ga0373933_0001124 | Ga0373933_0001124_7529_8575 | 346 |
| 663 | 3300035724 | Ga0373933_0002510 | Ga0373933_0002510_7978_9030 | 346 |
| 664 | 3300035724 | Ga0373933_0011724 | Ga0373933_0011724_2982_4022 | 346 |
| 665 | 3300036401 | Ga0373937_0001052 | Ga0373937_0001052_8164_9216 | 346 |
| 666 | 3300036401 | Ga0373937_0004918 | Ga0373937_0004918_7148_8194 | 346 |
| 667 | 3300036401 | Ga0373937_0075219 | Ga0373937_0075219_1445_2485 | 346 |
| 668 | 3300037068 | Ga0373925_0021901 | Ga0373925_0021901_802_1842 | 346 |
| 669 | 3300037068 | Ga0373925_0028494 | Ga0373925_0028494_1598_2650 | 346 |
| 670 | 3300037068 | Ga0373925_0212415 | Ga0373925_0212415_368_1447 | 346 |
| 671 | 3300037418 | Ga0395900_0359703 | Ga0395900_0359703_73_1116 | 346 |
| 672 | 3300037466 | Ga0395898_0126688 | Ga0395898_0126688_460_1518 | 346 |
| 673 | 3300037466 | Ga0395898_0200115 | Ga0395898_0200115_311_1354 | 346 |
| 674 | 3300037853 | Ga0436364_0309649 | Ga0436364_0309649_7601_8644 | 346 |
| 675 | 3300038443 | Ga0395901_0098693 | Ga0395901_0098693_1015_2073 | 346 |
| 676 | 3300038443 | Ga0395901_0177698 | Ga0395901_0177698_991_2034 | 346 |
| 677 | 3300039447 | Ga0436361_1176104 | Ga0436361_1176104_644_1687 | 346 |
| 678 | 3300041408 | Ga0439453_0003508 | Ga0439453_0003508_1038_2120 | 346 |
| 679 | 3300042439 | Ga0439464_0004335 | Ga0439464_0004335_715_1755 | 346 |
| 680 | 3300044684 | Ga0466966_0114059 | Ga0466966_0114059_416_1459 | 346 |
| 681 | 3300044719 | Ga0466971_0047546 | Ga0466971_0047546_289_1329 | 346 |
| 682 | 3300045051 | Ga0451576_0034716 | Ga0451576_0034716_1548_2588 | 346 |
| 683 | 3300046454 | Ga0495592_0003638 | Ga0495592_0003638_570_1622 | 346 |
| 684 | 3300046454 | Ga0495592_0020065 | Ga0495592_0020065_296_1342 | 346 |
| 685 | 3300046454 | Ga0495592_0024541 | Ga0495592_0024541_3403_4443 | 346 |
| 686 | 3300046459 | Ga0495629_0087940 | Ga0495629_0087940_272_1351 | 346 |
| 687 | 3300046462 | Ga0495651_0000606 | Ga0495651_0000606_9182_10234 | 346 |
| 688 | 3300046462 | Ga0495651_0009868 | Ga0495651_0009868_4814_5860 | 346 |
| 689 | 3300046463 | Ga0495653_0002673 | Ga0495653_0002673_5310_6362 | 346 |
| 690 | 3300046463 | Ga0495653_0008326 | Ga0495653_0008326_310_1356 | 346 |
| 691 | 3300046476 | Ga0495662_0033933 | Ga0495662_0033933_1141_2193 | 346 |
| 692 | 3300046477 | Ga0495664_0003537 | Ga0495664_0003537_431_1477 | 346 |
| 693 | 3300046477 | Ga0495664_0016826 | Ga0495664_0016826_1792_2871 | 346 |
| 694 | 3300046477 | Ga0495664_0060982 | Ga0495664_0060982_1036_2088 | 346 |
| 695 | 3300046511 | Ga0495608_0000591 | Ga0495608_0000591_17359_18411 | 346 |
| 696 | 3300046511 | Ga0495608_0001474 | Ga0495608_0001474_7663_8709 | 346 |
| 697 | 3300046511 | Ga0495608_0179617 | Ga0495608_0179617_30_1070 | 346 |
| 698 | 3300046514 | Ga0495618_0001466 | Ga0495618_0001466_11181_12233 | 346 |
| 699 | 3300046514 | Ga0495618_0027234 | Ga0495618_0027234_339_1385 | 346 |
| 700 | 3300046516 | Ga0495628_0001927 | Ga0495628_0001927_14462_15502 | 346 |
| 701 | 3300046516 | Ga0495628_0044982 | Ga0495628_0044982_1837_2883 | 346 |
| 702 | 3300046529 | Ga0495652_0003497 | Ga0495652_0003497_5747_6799 | 346 |
| 703 | 3300046529 | Ga0495652_0015699 | Ga0495652_0015699_577_1617 | 346 |
| 704 | 3300046529 | Ga0495652_0039947 | Ga0495652_0039947_1127_2173 | 346 |
| 705 | 3300046529 | Ga0495652_0246691 | Ga0495652_0246691_61_1140 | 346 |
| 706 | 3300046533 | Ga0495640_0002454 | Ga0495640_0002454_4179_5231 | 346 |
| 707 | 3300046533 | Ga0495640_0012195 | Ga0495640_0012195_5366_6412 | 346 |
| 708 | 3300046533 | Ga0495640_0062664 | Ga0495640_0062664_409_1488 | 346 |
| 709 | 3300046533 | Ga0495640_0219704 | Ga0495640_0219704_38_1078 | 346 |
| 710 | 3300046536 | Ga0495587_0002240 | Ga0495587_0002240_2715_3761 | 346 |
| 711 | 3300046543 | Ga0495645_0002539 | Ga0495645_0002539_2343_3389 | 346 |
| 712 | 3300046543 | Ga0495645_0013129 | Ga0495645_0013129_1307_2359 | 346 |
| 713 | 3300046543 | Ga0495645_0023203 | Ga0495645_0023203_2663_3703 | 346 |
| 714 | 3300046559 | Ga0495667_0001150 | Ga0495667_0001150_10078_11124 | 346 |
| 715 | 3300046642 | Ga0495634_0003468 | Ga0495634_0003468_2130_3182 | 346 |
| 716 | 3300046663 | Ga0495635_0003881 | Ga0495635_0003881_8216_9262 | 346 |
| 717 | 3300046663 | Ga0495635_0008488 | Ga0495635_0008488_4343_5395 | 346 |
| 718 | 3300046663 | Ga0495635_0065489 | Ga0495635_0065489_1400_2440 | 346 |
| 719 | 3300046675 | Ga0495657_0003270 | Ga0495657_0003270_3468_4520 | 346 |
| 720 | 3300046675 | Ga0495657_0014478 | Ga0495657_0014478_1601_2647 | 346 |
| 721 | 3300046678 | Ga0495599_0000564 | Ga0495599_0000564_5170_6222 | 346 |
| 722 | 3300046678 | Ga0495599_0009859 | Ga0495599_0009859_3902_4942 | 346 |
| 723 | 3300046678 | Ga0495599_0043601 | Ga0495599_0043601_296_1342 | 346 |
| 724 | 3300046679 | Ga0495623_0000420 | Ga0495623_0000420_19942_20988 | 346 |
| 725 | 3300046679 | Ga0495623_0124704 | Ga0495623_0124704_132_1172 | 346 |
| 726 | 3300046680 | Ga0495646_0003113 | Ga0495646_0003113_3740_4786 | 346 |
| 727 | 3300046689 | Ga0495613_0126784 | Ga0495613_0126784_493_1545 | 346 |
| 728 | 3300046690 | Ga0495624_0191906 | Ga0495624_0191906_130_1170 | 346 |
| 729 | 3300046809 | Ga0495600_0001326 | Ga0495600_0001326_8153_9193 | 346 |
| 730 | 3300046809 | Ga0495600_0019703 | Ga0495600_0019703_68_1114 | 346 |
| 731 | 3300046809 | Ga0495600_0062772 | Ga0495600_0062772_1195_2247 | 346 |
| 732 | 3300047317 | Ga0495604_0002131 | Ga0495604_0002131_14158_15210 | 346 |
| 733 | 3300047317 | Ga0495604_0003891 | Ga0495604_0003891_1093_2139 | 346 |
| 734 | 3300047317 | Ga0495604_0020818 | Ga0495604_0020818_4036_5076 | 346 |
| 735 | 3300047319 | Ga0495674_0009434 | Ga0495674_0009434_5167_6219 | 346 |
| 736 | 3300047319 | Ga0495674_0047567 | Ga0495674_0047567_201_1280 | 346 |
| 737 | 3300047319 | Ga0495674_0072707 | Ga0495674_0072707_636_1682 | 346 |
| 738 | 3300047320 | Ga0495672_0039766 | Ga0495672_0039766_940_1980 | 346 |
| 739 | 3300047322 | Ga0495680_0001686 | Ga0495680_0001686_8063_9115 | 346 |
| 740 | 3300047322 | Ga0495680_0021430 | Ga0495680_0021430_3127_4173 | 346 |
| 741 | 3300047444 | Ga0495675_0001544 | Ga0495675_0001544_3255_4301 | 346 |
| 742 | 3300047444 | Ga0495675_0002669 | Ga0495675_0002669_4276_5328 | 346 |
| 743 | 3300047444 | Ga0495675_0036104 | Ga0495675_0036104_255_1295 | 346 |
| 744 | 3300047471 | Ga0495684_0003625 | Ga0495684_0003625_4450_5502 | 346 |
| 745 | 3300047673 | Ga0495593_0046746 | Ga0495593_0046746_775_1821 | 346 |
| 746 | 3300048088 | Ga0495602_0005526 | Ga0495602_0005526_3350_4396 | 346 |
| 747 | 3300048088 | Ga0495602_0018930 | Ga0495602_0018930_5703_6755 | 346 |
| 748 | 3300048088 | Ga0495602_0024466 | Ga0495602_0024466_3535_4575 | 346 |
| 749 | 3300048089 | Ga0495614_0055075 | Ga0495614_0055075_219_1298 | 346 |
| 750 | 3300048903 | Ga0496100_0000106 | Ga0496100_0000106_44835_45881 | 346 |
| 751 | 3300048903 | Ga0496100_0075751 | Ga0496100_0075751_387_1433 | 346 |
| 752 | 3300048903 | Ga0496100_0106338 | Ga0496100_0106338_779_1822 | 346 |
| 753 | 3300048904 | Ga0496101_0000136 | Ga0496101_0000136_63776_64822 | 346 |
| 754 | 3300048905 | Ga0496102_0029938 | Ga0496102_0029938_343_1389 | 346 |
| 755 | 3300048905 | Ga0496102_0041646 | Ga0496102_0041646_715_1794 | 346 |
| 756 | 3300048905 | Ga0496102_0459782 | Ga0496102_0459782_71_1123 | 346 |
| 757 | 3300048906 | Ga0496103_0029900 | Ga0496103_0029900_1778_2824 | 346 |
| 758 | 3300048906 | Ga0496103_0033703 | Ga0496103_0033703_1385_2431 | 346 |
| 759 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_68086_69126 | 346 |
| 760 | 3300048907 | Ga0496104_0000506 | Ga0496104_0000506_21932_22975 | 346 |
| 761 | 3300048907 | Ga0496104_0007428 | Ga0496104_0007428_4609_5652 | 346 |
| 762 | 3300048907 | Ga0496104_0035256 | Ga0496104_0035256_3044_4090 | 346 |
| 763 | 3300048907 | Ga0496104_0082159 | Ga0496104_0082159_1858_2904 | 346 |
| 764 | 3300048908 | Ga0496105_0013985 | Ga0496105_0013985_151_1194 | 346 |
| 765 | 3300048908 | Ga0496105_0018996 | Ga0496105_0018996_1228_2274 | 346 |
| 766 | 3300048908 | Ga0496105_0069997 | Ga0496105_0069997_339_1379 | 346 |
| 767 | 3300048909 | Ga0496106_0002270 | Ga0496106_0002270_12594_13640 | 346 |
| 768 | 3300048910 | Ga0496107_0007909 | Ga0496107_0007909_699_1745 | 346 |
| 769 | 3300048911 | Ga0496108_0003914 | Ga0496108_0003914_10819_11865 | 346 |
| 770 | 3300048911 | Ga0496108_0279657 | Ga0496108_0279657_374_1417 | 346 |
| 771 | 3300048912 | Ga0496109_0002975 | Ga0496109_0002975_12421_13467 | 346 |
| 772 | 3300048912 | Ga0496109_0092710 | Ga0496109_0092710_587_1630 | 346 |
| 773 | 3300048913 | Ga0496110_0048224 | Ga0496110_0048224_1113_2156 | 346 |
| 774 | 3300048914 | Ga0496111_0032359 | Ga0496111_0032359_1299_2342 | 346 |
| 775 | 3300048914 | Ga0496111_0035537 | Ga0496111_0035537_411_1457 | 346 |
| 776 | 3300048915 | Ga0496112_0110192 | Ga0496112_0110192_406_1452 | 346 |
| 777 | 3300048915 | Ga0496112_0509706 | Ga0496112_0509706_75_1121 | 346 |
| 778 | 3300048916 | Ga0496113_0044770 | Ga0496113_0044770_1928_2974 | 346 |
| 779 | 3300048917 | Ga0496114_0035030 | Ga0496114_0035030_1834_2880 | 346 |
| 780 | 3300048917 | Ga0496114_0095817 | Ga0496114_0095817_1418_2464 | 346 |
| 781 | 3300048918 | Ga0496115_0001121 | Ga0496115_0001121_3957_5003 | 346 |
| 782 | 3300048918 | Ga0496115_0010308 | Ga0496115_0010308_2883_3923 | 346 |
| 783 | 3300048918 | Ga0496115_0027950 | Ga0496115_0027950_815_1858 | 346 |
| 784 | 3300048918 | Ga0496115_0053290 | Ga0496115_0053290_1392_2471 | 346 |
| 785 | 3300048918 | Ga0496115_0081992 | Ga0496115_0081992_1178_2224 | 346 |
| 786 | 3300049575 | Ga0501039_0175034 | Ga0501039_0175034_256_1296 | 346 |
| 787 | 3300049581 | Ga0501047_0009616 | Ga0501047_0009616_385_1425 | 346 |
| 788 | 3300049581 | Ga0501047_0199646 | Ga0501047_0199646_677_1717 | 346 |
| 789 | 3300049582 | Ga0501048_0150758 | Ga0501048_0150758_578_1618 | 346 |
| 790 | 3300049822 | Ga0501035_0297722 | Ga0501035_0297722_136_1176 | 346 |
| 791 | 3300050491 | nmdc:mga00v17_81243_c1 | nmdc:mga00v17_81243_c1_31_1107 | 346 |
| 792 | 3300050507 | nmdc:mga05p37_231454_c1 | nmdc:mga05p37_231454_c1_987_2030 | 346 |
| 793 | 3300050510 | nmdc:mga06r32_186730_c1 | nmdc:mga06r32_186730_c1_295_1335 | 346 |
| 794 | 3300050511 | nmdc:mga08y16_359919_c1 | nmdc:mga08y16_359919_c1_158_1204 | 346 |
| 795 | 3300050514 | nmdc:mga08x19_4942_c1 | nmdc:mga08x19_4942_c1_1512_2552 | 346 |
| 796 | 3300050515 | nmdc:mga0a205_380_c1 | nmdc:mga0a205_380_c1_6362_7408 | 346 |
| 797 | 3300053077 | Ga0495601_0000360 | Ga0495601_0000360_8546_9586 | 346 |
| 798 | 3300053077 | Ga0495601_0001260 | Ga0495601_0001260_8152_9198 | 346 |
| 799 | 3300053077 | Ga0495601_0016653 | Ga0495601_0016653_30_1109 | 346 |
| 800 | 3300053078 | Ga0495612_0000964 | Ga0495612_0000964_7971_9017 | 346 |
| 801 | 3300053078 | Ga0495612_0001388 | Ga0495612_0001388_7794_8846 | 346 |
| 802 | 3300053078 | Ga0495612_0001978 | Ga0495612_0001978_2878_3918 | 346 |
| 803 | 3300053084 | Ga0495595_0000969 | Ga0495595_0000969_3452_4492 | 346 |
| 804 | 3300053084 | Ga0495595_0009321 | Ga0495595_0009321_484_1530 | 346 |
| 805 | 3300053085 | Ga0495619_0000581 | Ga0495619_0000581_2698_3738 | 346 |
| 806 | 3300053085 | Ga0495619_0001851 | Ga0495619_0001851_3943_5022 | 346 |
| 807 | 3300053085 | Ga0495619_0002169 | Ga0495619_0002169_2048_3100 | 346 |
| 808 | 3300053085 | Ga0495619_0024789 | Ga0495619_0024789_460_1506 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kkh-assembly1.cif.gz_A | crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii | 0.9064 | 23 | 339 |
| 4l9y-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa | 0.8967 | 23 | 286 |
| 3qll-assembly1.cif.gz_A | crystal structure of ripc from yersinia pestis | 0.8951 | 27 | 291 |
| 6cj3-assembly1.cif.gz_A | crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium and pyruvate | 0.8795 | 26 | 287 |
| 1z6k-assembly1.cif.gz_A | citrate lyase beta subunit complexed with oxaloacetate and magnesium from m. tuberculosis | 0.8769 | 26 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l9yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8967 | 23 | 286 | 3.20.20.60 |
| 3qllC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8874 | 28 | 291 | 3.20.20.60 |
| af_P0A9I1_3_299_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8717 | 24 | 332 | 3.20.20.60 |
| 1z6kA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8684 | 26 | 286 | 3.20.20.60 |
| 4l9yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8675 | 23 | 286 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529JPZ5-F1-model_v4 | CoA ester lyase | 0.9792 | 87 | 174 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A529KY44-F1-model_v4 | CoA ester lyase | 0.9725 | 58 | 177 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A7J4V9E9-F1-model_v4 | CoA ester lyase | 0.9642 | 52 | 156 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A354CBR2-F1-model_v4 | deleted | 0.9575 | 257 | 346 |
|
| AF-A0A537QEJ3-F1-model_v4 | CoA ester lyase | 0.9511 | 24 | 180 |
GO:0000287
GO:0006107 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar