F481712

General Info

Members Datasets Scaffolds Average Seq Length
808 365 805 342

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100037897|Ga0075429_1000378972
Length 318
Sequence MKLPRNFFQPLAIGAPAPLRELPVRLERMIHFDVVLGNLEDAIPADAKTAARAGFIAMAKASEFGSTGLWTRINALNSPWALDDAAEIVAAVGQKLDVIMLPKVEGPWDIHYLDQLLAQLEARHAVKKPILIHAILETAQGVNNVEAIATASPRMHGMSLGPADLAASRAMKTTRVGGGHPDYKVLADPSPAGGARAAFQQDLWHYTLAKMVDACAAAGIKPFYGPFGDFADPDACEAQFRNAFLMGCVGAWTLHPSQVPIAKRVFSPDIAAMPDGSGAVMIDGKMQDDATWKQAKVLIDLARLVAAKDPDLAARYAL

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
4 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.37
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 10.77
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100456 3300001430 Bacteria 2136
2 JGI24741J21665_1009374 3300001915 Bacteria 1800
3 JGI24746J21847_1007086 3300001977 Bacteria 1722
4 JGI24739J22299_10005177 3300001989 Bacteria 4969
5 JGI24737J22298_10007210 3300001990 Bacteria 3761
6 JGI24737J22298_10021923 3300001990 Bacteria 2031
7 JGI24743J22301_10004958 3300001991 Bacteria 2196
8 JGI24750J21931_1000172 3300002070 Bacteria 10780
9 JGI24748J21848_1000609 3300002074 Bacteria 3845
10 JGI24738J21930_10000223 3300002075 Bacteria 15332
11 JGI24749J21850_1001214 3300002076 Bacteria 3661
12 JGI24744J21845_10000129 3300002077 Bacteria 10529
13 JGI24034J26672_10003265 3300002239 Bacteria 2261
14 JGI24742J22300_10001901 3300002244 Bacteria 3324
15 JGI24751J29686_10002778 3300002459 Bacteria 3520
16 JGI25153J46596_10008419 3300003215 Bacteria 4930
17 Ga0065712_10095195 3300005290 Bacteria 2227
18 Ga0065715_10091352 3300005293 Bacteria 5838
19 Ga0070676_10000012 3300005328 Bacteria 58061
20 Ga0070676_10031623 3300005328 Bacteria 3026
21 Ga0070683_100000139 3300005329 Bacteria 46987
22 Ga0070683_100079414 3300005329 Bacteria 3071
23 Ga0070690_100032762 3300005330 Bacteria 3248
24 Ga0070670_100006320 3300005331 Bacteria 10026
25 Ga0070670_100006855 3300005331 Bacteria 9652
26 Ga0070677_10000125 3300005333 Bacteria 25491
27 Ga0068869_100000605 3300005334 Bacteria 20215
28 Ga0068869_100101609 3300005334 Bacteria 2175
29 Ga0070666_10020349 3300005335 Bacteria 4289
30 Ga0070666_10124051 3300005335 Bacteria 1792
31 Ga0070680_100000179 3300005336 Bacteria 40975
32 Ga0070682_100000565 3300005337 Bacteria 22802
33 Ga0068868_100001158 3300005338 Bacteria 18075
34 Ga0070660_100001605 3300005339 Bacteria 15534
35 Ga0070689_100000190 3300005340 Bacteria 37316
36 Ga0070691_10000706 3300005341 Bacteria 13041
37 Ga0070691_10094402 3300005341 Bacteria 1479
38 Ga0070687_100003795 3300005343 Bacteria 5928
39 Ga0070661_100001455 3300005344 Bacteria 16432
40 Ga0070692_10000434 3300005345 Bacteria 12695
41 Ga0070692_10019972 3300005345 Bacteria 3241
42 Ga0070668_100000597 3300005347 Bacteria 24181
43 Ga0070668_100080948 3300005347 Bacteria 2545
44 Ga0070668_100195394 3300005347 Bacteria 1659
45 Ga0070669_100000409 3300005353 Bacteria 32911
46 Ga0070669_100083771 3300005353 Bacteria 2378
47 Ga0070675_100000166 3300005354 Bacteria 40573
48 Ga0070675_100032912 3300005354 Bacteria 4199
49 Ga0070671_100009212 3300005355 Bacteria 7929
50 Ga0070671_100042470 3300005355 Bacteria 3779
51 Ga0070671_100125673 3300005355 Bacteria 2159
52 Ga0070671_100213033 3300005355 Bacteria 1639
53 Ga0070674_100000084 3300005356 Bacteria 43585
54 Ga0070673_100000041 3300005364 Bacteria 54096
55 Ga0070688_100000180 3300005365 Bacteria 33887
56 Ga0070688_100009381 3300005365 Bacteria 5348
57 Ga0070659_100000752 3300005366 Bacteria 23551
58 Ga0070659_100035031 3300005366 Bacteria 3906
59 Ga0070667_100000365 3300005367 Bacteria 49335
60 Ga0070667_100102800 3300005367 Bacteria 2469
61 Ga0070703_10000903 3300005406 Bacteria 9460
62 Ga0070709_10133446 3300005434 Bacteria 1698
63 Ga0070714_100048797 3300005435 Bacteria 3601
64 Ga0070710_10076323 3300005437 Bacteria 1945
65 Ga0070710_10121752 3300005437 Bacteria 1580
66 Ga0070701_10000493 3300005438 Bacteria 13517
67 Ga0070701_10021044 3300005438 Bacteria 3106
68 Ga0070711_100009896 3300005439 Bacteria 5879
69 Ga0070711_100082736 3300005439 Bacteria 2291
70 Ga0070711_100248195 3300005439 Bacteria 1395
71 Ga0070705_100001328 3300005440 Bacteria 13230
72 Ga0070705_100005755 3300005440 Bacteria 6057
73 Ga0070700_100000467 3300005441 Bacteria 20231
74 Ga0070700_100022512 3300005441 Bacteria 3675
75 Ga0070700_100023506 3300005441 Bacteria 3605
76 Ga0070694_100000065 3300005444 Bacteria 49515
77 Ga0070708_100023359 3300005445 Bacteria 5259
78 Ga0070663_100000473 3300005455 Bacteria 21137
79 Ga0070663_100040620 3300005455 Bacteria 3258
80 Ga0070678_100000091 3300005456 Bacteria 34559
81 Ga0070678_100264345 3300005456 Bacteria 1448
82 Ga0070662_100000629 3300005457 Bacteria 21333
83 Ga0070662_100007924 3300005457 Bacteria 6908
84 Ga0070681_10025730 3300005458 Bacteria 5917
85 Ga0070681_10068737 3300005458 Bacteria 3509
86 Ga0070681_10161798 3300005458 Bacteria 2162
87 Ga0070681_10291287 3300005458 Bacteria 1542
88 Ga0070681_10328512 3300005458 Bacteria 1439
89 Ga0068867_100001090 3300005459 Bacteria 18551
90 Ga0070685_10002067 3300005466 Bacteria 10381
91 Ga0070685_10009274 3300005466 Bacteria 5080
92 Ga0070699_100135624 3300005518 Bacteria 2171
93 Ga0070699_100276328 3300005518 Bacteria 1504
94 Ga0070679_100015891 3300005530 Bacteria 7244
95 Ga0070679_100055203 3300005530 Bacteria 3956
96 Ga0070679_100138981 3300005530 Bacteria 2410
97 Ga0070679_100244606 3300005530 Bacteria 1751
98 Ga0070684_100000219 3300005535 Bacteria 39995
99 Ga0070684_100055171 3300005535 Bacteria 3463
100 Ga0068853_100000600 3300005539 Bacteria 24713
101 Ga0070672_100000019 3300005543 Bacteria 69855
102 Ga0070672_100028026 3300005543 Bacteria 4209
103 Ga0070686_100000318 3300005544 Bacteria 31671
104 Ga0070686_100004396 3300005544 Bacteria 7773
105 Ga0070686_100166544 3300005544 Bacteria 1555
106 Ga0070695_100000474 3300005545 Bacteria 20848
107 Ga0070695_100004709 3300005545 Bacteria 8023
108 Ga0070696_100009125 3300005546 Bacteria 6642
109 Ga0070693_100000036 3300005547 Bacteria 50540
110 Ga0070665_100485364 3300005548 Bacteria 1246
111 Ga0070704_100000252 3300005549 Bacteria 23218
112 Ga0068855_100019218 3300005563 Bacteria 8212
113 Ga0068855_100062526 3300005563 Bacteria 4346
114 Ga0070664_100000819 3300005564 Bacteria 23927
115 Ga0070664_100016265 3300005564 Bacteria 6098
116 Ga0068857_100000768 3300005577 Bacteria 23872
117 Ga0068854_100000179 3300005578 Bacteria 43176
118 Ga0068856_100003866 3300005614 Bacteria 15030
119 Ga0068856_100018775 3300005614 Bacteria 6706
120 Ga0070702_100000071 3300005615 Bacteria 28864
121 Ga0070702_100007222 3300005615 Bacteria 5308
122 Ga0068852_100002121 3300005616 Bacteria 13586
123 Ga0068852_100026665 3300005616 Bacteria 4701
124 Ga0068852_100095205 3300005616 Bacteria 2673
125 Ga0068859_100001870 3300005617 Bacteria 21434
126 Ga0068859_100007104 3300005617 Bacteria 11364
127 Ga0068864_100000429 3300005618 Bacteria 36391
128 Ga0068864_100004309 3300005618 Bacteria 11700
129 Ga0068866_10000461 3300005718 Bacteria 18602
130 Ga0068866_10013137 3300005718 Bacteria 3624
131 Ga0068861_100000169 3300005719 Bacteria 34559
132 Ga0068861_100462030 3300005719 Bacteria 1140
133 Ga0068851_10019416 3300005834 Bacteria 3284
134 Ga0068870_10000586 3300005840 Bacteria 13817
135 Ga0068870_10008422 3300005840 Bacteria 4638
136 Ga0068863_100000381 3300005841 Bacteria 45003
137 Ga0068858_100030479 3300005842 Bacteria 5008
138 Ga0068858_100272187 3300005842 Bacteria 1612
139 Ga0068860_100001472 3300005843 Bacteria 25432
140 Ga0068860_100026330 3300005843 Bacteria 5607
141 Ga0068860_100108763 3300005843 Bacteria 2650
142 Ga0068860_100207999 3300005843 Bacteria 1898
143 Ga0068862_100001886 3300005844 Bacteria 19006
144 Ga0068862_100027295 3300005844 Bacteria 4805
145 Ga0081455_10000036 3300005937 Bacteria 136303
146 Ga0081455_10011279 3300005937 Bacteria 8992
147 Ga0081455_10035188 3300005937 Bacteria 4478
148 Ga0081455_10062655 3300005937 Bacteria 3125
149 Ga0081538_10120736 3300005981 Bacteria 1260
150 Ga0081540_1000257 3300005983 Bacteria 55989
151 Ga0081540_1000642 3300005983 Bacteria 33163
152 Ga0081540_1015934 3300005983 Bacteria 4736
153 Ga0081540_1029094 3300005983 Bacteria 3086
154 Ga0070717_10120012 3300006028 Bacteria 2251
155 Ga0070717_10177703 3300006028 Bacteria 1854
156 Ga0075365_10039649 3300006038 Bacteria 3068
157 Ga0075365_10074111 3300006038 Bacteria 2295
158 Ga0075368_10020103 3300006042 Bacteria 2525
159 Ga0075364_10061544 3300006051 Bacteria 2463
160 Ga0070715_10011354 3300006163 Bacteria 3206
161 Ga0075362_10018081 3300006177 Bacteria 2912
162 Ga0075362_10019138 3300006177 Bacteria 2843
163 Ga0075367_10073241 3300006178 Bacteria 2063
164 Ga0075367_10109742 3300006178 Bacteria 1692
165 Ga0075367_10208496 3300006178 Bacteria 1222
166 Ga0075367_10232869 3300006178 Bacteria 1153
167 Ga0075369_10008059 3300006186 Bacteria 4039
168 Ga0075366_10018043 3300006195 Bacteria 4073
169 Ga0097621_100001234 3300006237 Bacteria 17707
170 Ga0097621_100032849 3300006237 Bacteria 4128
171 Ga0068871_100000068 3300006358 Bacteria 57531
172 Ga0075428_100014319 3300006844 Bacteria 8817
173 Ga0075428_100122273 3300006844 Bacteria 2834
174 Ga0075428_100123190 3300006844 Bacteria 2822
175 Ga0075428_100231818 3300006844 Bacteria 1992
176 Ga0075431_100027830 3300006847 Bacteria 5801
177 Ga0075431_100197790 3300006847 Bacteria 2058
178 Ga0075433_10002775 3300006852 Bacteria 13399
179 Ga0075434_100002138 3300006871 Bacteria 17193
180 Ga0075434_100023001 3300006871 Bacteria 6067
181 Ga0075429_100037897 3300006880 Bacteria 4196
182 Ga0068865_100000294 3300006881 Bacteria 27523
183 Ga0068865_100028940 3300006881 Bacteria 3671
184 Ga0075436_100022391 3300006914 Bacteria 4340
185 Ga0097620_100001870 3300006931 Bacteria 21434
186 Ga0097620_100007104 3300006931 Bacteria 11364
187 Ga0075435_100063250 3300007076 Bacteria 3005
188 Ga0099794_10040005 3300007265 Bacteria 2227
189 Ga0099795_10006498 3300007788 Bacteria 3194
190 Ga0099795_10021476 3300007788 Bacteria 2118
191 Ga0099795_10044521 3300007788 Bacteria 1592
192 Ga0105240_10023458 3300009093 Bacteria 8157
193 Ga0105245_10000780 3300009098 Bacteria 28901
194 Ga0105247_10005194 3300009101 Bacteria 8233
195 Ga0105247_10008421 3300009101 Bacteria 6283
196 Ga0105247_10038435 3300009101 Bacteria 2922
197 Ga0105247_10038934 3300009101 Bacteria 2903
198 Ga0114129_10010082 3300009147 Bacteria 13469
199 Ga0114129_10134226 3300009147 Bacteria 3397
200 Ga0105243_10001083 3300009148 Bacteria 24917
201 Ga0105243_10198668 3300009148 Bacteria 1757
202 Ga0105241_10000760 3300009174 Bacteria 24503
203 Ga0105241_10043566 3300009174 Bacteria 3399
204 Ga0105242_10006332 3300009176 Bacteria 9118
205 Ga0105242_10022852 3300009176 Bacteria 4924
206 Ga0105242_10030536 3300009176 Bacteria 4303
207 Ga0105242_10229678 3300009176 Bacteria 1662
208 Ga0105248_10080587 3300009177 Bacteria 3659
209 Ga0105248_10160902 3300009177 Bacteria 2532
210 Ga0105248_10197706 3300009177 Bacteria 2265
211 Ga0105237_10007890 3300009545 Bacteria 11599
212 Ga0105237_10064505 3300009545 Bacteria 3659
213 Ga0105238_10024019 3300009551 Bacteria 6216
214 Ga0105249_10000755 3300009553 Bacteria 29091
215 Ga0105249_10137256 3300009553 Bacteria 2342
216 Ga0105249_10403723 3300009553 Bacteria 1397
217 Ga0105239_10002791 3300010375 Bacteria 21868
218 Ga0105239_10094126 3300010375 Bacteria 3309
219 Ga0105239_10507914 3300010375 Bacteria 1371
220 Ga0105246_10000061 3300011119 Bacteria 44338
221 Ga0105246_10014686 3300011119 Bacteria 4929
222 Ga0105246_10124088 3300011119 Bacteria 1918
223 Ga0157373_10030638 3300013100 Bacteria 3870
224 Ga0157371_10015260 3300013102 Bacteria 5768
225 Ga0157374_10001691 3300013296 Bacteria 18474
226 Ga0157374_10020476 3300013296 Bacteria 5868
227 Ga0157374_10306851 3300013296 Bacteria 1571
228 Ga0157378_10001445 3300013297 Bacteria 21386
229 Ga0163162_10000790 3300013306 Bacteria 29412
230 Ga0163162_10020256 3300013306 Bacteria 6531
231 Ga0163162_10023125 3300013306 Bacteria 6131
232 Ga0157372_10016229 3300013307 Bacteria 7991
233 Ga0157372_10157323 3300013307 Bacteria 2625
234 Ga0157372_10357216 3300013307 Bacteria 1702
235 Ga0157375_10000468 3300013308 Bacteria 36848
236 Ga0157375_10013783 3300013308 Bacteria 7205
237 Ga0157375_10138136 3300013308 Bacteria 2562
238 Ga0163163_10001508 3300014325 Bacteria 19688
239 Ga0163163_10044077 3300014325 Bacteria 4375
240 Ga0163163_10053814 3300014325 Bacteria 3975
241 Ga0157380_10007877 3300014326 Bacteria 7582
242 Ga0157380_10022504 3300014326 Bacteria 4748
243 Ga0157377_10000276 3300014745 Bacteria 24762
244 Ga0157379_10004514 3300014968 Bacteria 11940
245 Ga0157379_10015057 3300014968 Bacteria 6784
246 Ga0157379_10026464 3300014968 Bacteria 5164
247 Ga0157376_10000692 3300014969 Bacteria 21811
248 Ga0157376_10022279 3300014969 Bacteria 4935
249 Ga0163161_10000384 3300017792 Bacteria 37040
250 Ga0197907_10934374 3300020069 Bacteria 1207
251 Ga0206356_10856229 3300020070 Bacteria 2526
252 Ga0206353_10594769 3300020082 Bacteria 2370
253 Ga0213875_10000007 3300021388 Bacteria 562717
254 Ga0224572_1010103 3300024225 Bacteria 1771
255 Ga0207666_1000097 3300025271 Bacteria 13853
256 Ga0207673_1000054 3300025290 Bacteria 9582
257 Ga0209758_1000638 3300025297 Bacteria 53416
258 Ga0207697_10000550 3300025315 Bacteria 21243
259 Ga0207653_10008172 3300025885 Bacteria 3262
260 Ga0207682_10000088 3300025893 Bacteria 41732
261 Ga0207692_10060130 3300025898 Bacteria 1964
262 Ga0207642_10000926 3300025899 Bacteria 9202
263 Ga0207710_10011074 3300025900 Bacteria 3798
264 Ga0207688_10000276 3300025901 Bacteria 23473
265 Ga0207688_10001203 3300025901 Bacteria 13390
266 Ga0207680_10025652 3300025903 Bacteria 3254
267 Ga0207647_10002714 3300025904 Bacteria 13370
268 Ga0207699_10026117 3300025906 Bacteria 3215
269 Ga0207699_10283479 3300025906 Bacteria 1152
270 Ga0207645_10000140 3300025907 Bacteria 55845
271 Ga0207645_10020572 3300025907 Bacteria 4318
272 Ga0207643_10000083 3300025908 Bacteria 62116
273 Ga0207643_10001883 3300025908 Bacteria 11586
274 Ga0207684_10025559 3300025910 Bacteria 5032
275 Ga0207654_10005138 3300025911 Bacteria 6604
276 Ga0207654_10053666 3300025911 Bacteria 2328
277 Ga0207707_10004967 3300025912 Bacteria 11688
278 Ga0207707_10013826 3300025912 Bacteria 7038
279 Ga0207707_10056844 3300025912 Bacteria 3405
280 Ga0207695_10131832 3300025913 Bacteria 2456
281 Ga0207695_10310300 3300025913 Bacteria 1468
282 Ga0207693_10007583 3300025915 Bacteria 8914
283 Ga0207693_10062777 3300025915 Bacteria 2910
284 Ga0207663_10218121 3300025916 Bacteria 1386
285 Ga0207663_10228813 3300025916 Bacteria 1357
286 Ga0207660_10000073 3300025917 Bacteria 51871
287 Ga0207660_10019543 3300025917 Bacteria 4529
288 Ga0207660_10059995 3300025917 Bacteria 2733
289 Ga0207660_10116369 3300025917 Bacteria 2019
290 Ga0207662_10000964 3300025918 Bacteria 13368
291 Ga0207657_10005395 3300025919 Bacteria 13362
292 Ga0207657_10021847 3300025919 Bacteria 6010
293 Ga0207657_10036881 3300025919 Bacteria 4373
294 Ga0207657_10169967 3300025919 Bacteria 1767
295 Ga0207649_10000450 3300025920 Bacteria 29604
296 Ga0207652_10007770 3300025921 Bacteria 8617
297 Ga0207652_10025311 3300025921 Bacteria 4932
298 Ga0207652_10038151 3300025921 Bacteria 4070
299 Ga0207681_10000097 3300025923 Bacteria 73836
300 Ga0207681_10050182 3300025923 Bacteria 2823
301 Ga0207681_10057429 3300025923 Bacteria 2660
302 Ga0207650_10015682 3300025925 Bacteria 5282
303 Ga0207659_10000092 3300025926 Bacteria 52642
304 Ga0207659_10006748 3300025926 Bacteria 7053
305 Ga0207687_10000129 3300025927 Bacteria 50592
306 Ga0207700_10023166 3300025928 Bacteria 4276
307 Ga0207700_10025257 3300025928 Bacteria 4124
308 Ga0207700_10025742 3300025928 Bacteria 4091
309 Ga0207700_10113366 3300025928 Bacteria 2186
310 Ga0207644_10021324 3300025931 Bacteria 4412
311 Ga0207644_10038782 3300025931 Bacteria 3358
312 Ga0207644_10054061 3300025931 Bacteria 2891
313 Ga0207644_10121848 3300025931 Bacteria 1986
314 Ga0207690_10002606 3300025932 Bacteria 10873
315 Ga0207690_10016846 3300025932 Bacteria 4453
316 Ga0207690_10119775 3300025932 Bacteria 1910
317 Ga0207706_10004310 3300025933 Bacteria 13370
318 Ga0207706_10005901 3300025933 Bacteria 11393
319 Ga0207706_10073834 3300025933 Bacteria 2999
320 Ga0207686_10000796 3300025934 Bacteria 19364
321 Ga0207686_10031352 3300025934 Bacteria 3155
322 Ga0207709_10000362 3300025935 Bacteria 45886
323 Ga0207709_10034793 3300025935 Bacteria 2973
324 Ga0207670_10004868 3300025936 Bacteria 7299
325 Ga0207669_10000350 3300025937 Bacteria 20966
326 Ga0207669_10081479 3300025937 Bacteria 2074
327 Ga0207704_10000757 3300025938 Bacteria 14243
328 Ga0207704_10018553 3300025938 Bacteria 3634
329 Ga0207665_10047129 3300025939 Bacteria 2888
330 Ga0207665_10076338 3300025939 Bacteria 2297
331 Ga0207691_10000283 3300025940 Bacteria 50040
332 Ga0207691_10021969 3300025940 Bacteria 6021
333 Ga0207711_10023405 3300025941 Bacteria 5172
334 Ga0207711_10176024 3300025941 Bacteria 1944
335 Ga0207711_10269776 3300025941 Bacteria 1565
336 Ga0207689_10000085 3300025942 Bacteria 75467
337 Ga0207689_10002370 3300025942 Bacteria 17597
338 Ga0207689_10293660 3300025942 Bacteria 1347
339 Ga0207661_10000464 3300025944 Bacteria 26194
340 Ga0207661_10009753 3300025944 Bacteria 6897
341 Ga0207679_10000030 3300025945 Bacteria 169351
342 Ga0207679_10061285 3300025945 Bacteria 2800
343 Ga0207679_10081256 3300025945 Bacteria 2478
344 Ga0207667_10018715 3300025949 Bacteria 7758
345 Ga0207667_10041317 3300025949 Bacteria 4905
346 Ga0207667_10197114 3300025949 Bacteria 2066
347 Ga0207651_10000088 3300025960 Bacteria 40879
348 Ga0207651_10035283 3300025960 Bacteria 3250
349 Ga0207712_10024539 3300025961 Bacteria 3995
350 Ga0207712_10096114 3300025961 Bacteria 2192
351 Ga0207668_10000114 3300025972 Bacteria 57323
352 Ga0207668_10020821 3300025972 Bacteria 4174
353 Ga0207668_10180924 3300025972 Bacteria 1663
354 Ga0207640_10000616 3300025981 Bacteria 20961
355 Ga0207640_10025371 3300025981 Bacteria 3587
356 Ga0207658_10002853 3300025986 Bacteria 12371
357 Ga0207677_10001731 3300026023 Bacteria 11572
358 Ga0207677_10014241 3300026023 Bacteria 4637
359 Ga0207703_10000983 3300026035 Bacteria 27443
360 Ga0207703_10010855 3300026035 Bacteria 7102
361 Ga0207639_10000305 3300026041 Bacteria 34869
362 Ga0207639_10032877 3300026041 Bacteria 3822
363 Ga0207678_10000125 3300026067 Bacteria 63817
364 Ga0207708_10000187 3300026075 Bacteria 48792
365 Ga0207708_10000256 3300026075 Bacteria 41918
366 Ga0207702_10008418 3300026078 Bacteria 8702
367 Ga0207702_10053363 3300026078 Bacteria 3422
368 Ga0207702_10121445 3300026078 Bacteria 2339
369 Ga0207641_10002129 3300026088 Bacteria 18722
370 Ga0207641_10038449 3300026088 Bacteria 4000
371 Ga0207648_10002168 3300026089 Bacteria 21342
372 Ga0207676_10000074 3300026095 Bacteria 101208
373 Ga0207674_10002501 3300026116 Bacteria 23186
374 Ga0207674_10118492 3300026116 Bacteria 2617
375 Ga0207675_100002373 3300026118 Bacteria 18649
376 Ga0207675_100004556 3300026118 Bacteria 13370
377 Ga0207683_10000014 3300026121 Bacteria 128817
378 Ga0207683_10031114 3300026121 Bacteria 4630
379 Ga0207683_10055140 3300026121 Bacteria 3486
380 Ga0207698_10079743 3300026142 Bacteria 2634
381 Ga0209981_1009723 3300027378 Bacteria 1318
382 Ga0210002_1000767 3300027617 Bacteria 4352
383 Ga0209588_1040657 3300027671 Bacteria 1500
384 Ga0209998_10003457 3300027717 Bacteria 3451
385 Ga0207428_10000467 3300027907 Bacteria 48756
386 Ga0207428_10175555 3300027907 Bacteria 1621
387 Ga0268266_10094562 3300028379 Bacteria 2623
388 Ga0268265_10001371 3300028380 Bacteria 20700
389 Ga0268264_10000469 3300028381 Bacteria 54801
390 Ga0268264_10008918 3300028381 Bacteria 8321
391 Ga0265332_10001014 3300031238 Bacteria 16568
392 Ga0265328_10006061 3300031239 Bacteria 5146
393 Ga0265328_10006537 3300031239 Bacteria 4918
394 Ga0265325_10000423 3300031241 Bacteria 30296
395 Ga0265325_10033971 3300031241 Bacteria 2717
396 Ga0265325_10046647 3300031241 Bacteria 2246
397 Ga0265325_10127955 3300031241 Bacteria 1219
398 Ga0265340_10033530 3300031247 Bacteria 2556
399 Ga0265340_10127742 3300031247 Bacteria 1167
400 Ga0265339_10014704 3300031249 Bacteria 4712
401 Ga0307513_10039588 3300031456 Bacteria 5224
402 Ga0265313_10012760 3300031595 Bacteria 5101
403 Ga0265314_10026124 3300031711 Bacteria 4393
404 Ga0265314_10040963 3300031711 Bacteria 3320
405 Ga0265314_10061077 3300031711 Bacteria 2569
406 Ga0265342_10000035 3300031712 Bacteria 142886
407 Ga0265342_10004840 3300031712 Bacteria 10435
408 Ga0373940_0003532 3300035088 Bacteria 3201
409 Ga0373949_0005195 3300035090 Bacteria 2918
410 Ga0373923_0000216 3300035111 Bacteria 11993
411 Ga0373923_0006009 3300035111 Bacteria 4164
412 Ga0373923_0034979 3300035111 Bacteria 2042
413 Ga0373932_0004024 3300035112 Bacteria 3499
414 Ga0373936_0000683 3300035113 Bacteria 11820
415 Ga0373939_0001020 3300035114 Bacteria 6907
416 Ga0373945_0001832 3300035116 Bacteria 6566
417 Ga0373945_0013214 3300035116 Bacteria 2752
418 Ga0373945_0030285 3300035116 Bacteria 1907
419 Ga0373954_0002030 3300035118 Bacteria 8412
420 Ga0373954_0004093 3300035118 Bacteria 6250
421 Ga0373954_0006107 3300035118 Bacteria 5244
422 Ga0373954_0034900 3300035118 Bacteria 2331
423 Ga0373956_0001485 3300035119 Bacteria 9695
424 Ga0373956_0004320 3300035119 Bacteria 5703
425 Ga0373957_0007742 3300035120 Bacteria 3450
426 Ga0373957_0064588 3300035120 Bacteria 1423
427 Ga0373960_0000611 3300035121 Bacteria 7314
428 Ga0373943_0000943 3300035170 Bacteria 12849
429 Ga0373943_0019066 3300035170 Bacteria 3155
430 Ga0373943_0031766 3300035170 Bacteria 2506
431 Ga0373946_0001331 3300035171 Bacteria 8527
432 Ga0373946_0020116 3300035171 Bacteria 2577
433 Ga0373946_0031607 3300035171 Bacteria 2122
434 Ga0373955_0000426 3300035172 Bacteria 17789
435 Ga0373955_0001269 3300035172 Bacteria 10731
436 Ga0373955_0010198 3300035172 Bacteria 4428
437 Ga0373955_0011222 3300035172 Bacteria 4260
438 Ga0373955_0024586 3300035172 Bacteria 3082
439 Ga0373961_0001648 3300035241 Bacteria 6258
440 Ga0373924_0016450 3300035410 Bacteria 2823
441 Ga0373924_0031851 3300035410 Bacteria 2122
442 Ga0373931_0000169 3300035691 Bacteria 28308
443 Ga0373931_0028283 3300035691 Bacteria 2868
444 Ga0373931_0049715 3300035691 Bacteria 2229
445 Ga0373935_0000088 3300035692 Bacteria 40092
446 Ga0373935_0002327 3300035692 Bacteria 10846
447 Ga0373935_0024986 3300035692 Bacteria 3681
448 Ga0373935_0114153 3300035692 Bacteria 1797
449 Ga0373927_0003463 3300035695 Bacteria 11305
450 Ga0373927_0008005 3300035695 Bacteria 7137
451 Ga0373927_0032604 3300035695 Bacteria 3393
452 Ga0373927_0038796 3300035695 Bacteria 3092
453 Ga0373927_0106824 3300035695 Bacteria 1823
454 Ga0373933_0001124 3300035724 Bacteria 15927
455 Ga0373933_0002510 3300035724 Bacteria 10312
456 Ga0373933_0006652 3300035724 Bacteria 6296
457 Ga0373933_0011724 3300035724 Bacteria 4838
458 Ga0373947_0000574 3300035725 Bacteria 21474
459 Ga0373947_0002738 3300035725 Bacteria 10562
460 Ga0373947_0024321 3300035725 Bacteria 3530
461 Ga0373947_0202426 3300035725 Bacteria 1299
462 Ga0373937_0000124 3300036401 Bacteria 73933
463 Ga0373937_0001052 3300036401 Bacteria 23314
464 Ga0373937_0004918 3300036401 Bacteria 11357
465 Ga0373937_0075219 3300036401 Bacteria 3117
466 Ga0373937_0076549 3300036401 Bacteria 3090
467 Ga0373937_0264222 3300036401 Bacteria 1623
468 Ga0373925_0000929 3300037068 Bacteria 26669
469 Ga0373925_0001647 3300037068 Bacteria 18821
470 Ga0373925_0005578 3300037068 Bacteria 9368
471 Ga0373925_0014171 3300037068 Bacteria 5770
472 Ga0373925_0021901 3300037068 Bacteria 4659
473 Ga0373925_0028494 3300037068 Bacteria 4092
474 Ga0373925_0100869 3300037068 Bacteria 2219
475 Ga0373925_0212415 3300037068 Bacteria 1541
476 Ga0395899_0002468 3300037312 Bacteria 15011
477 Ga0395900_0001885 3300037418 Bacteria 23846
478 Ga0395900_0359703 3300037418 Bacteria 1427
479 Ga0395898_0041853 3300037466 Bacteria 4522
480 Ga0395898_0092678 3300037466 Bacteria 2905
481 Ga0395898_0126688 3300037466 Bacteria 2446
482 Ga0395898_0200115 3300037466 Bacteria 1907
483 Ga0436364_0309649 3300037853 Bacteria 36034
484 Ga0395901_0043395 3300038443 Bacteria 4664
485 Ga0395901_0098693 3300038443 Bacteria 3062
486 Ga0395901_0177698 3300038443 Bacteria 2232
487 Ga0436365_0498663 3300039437 Bacteria 5727
488 Ga0436365_0977831 3300039437 Bacteria 4422
489 Ga0436365_1037616 3300039437 Bacteria 2732
490 Ga0436361_1176104 3300039447 Bacteria 6391
491 Ga0436363_0718092 3300039450 Bacteria 3258
492 Ga0439453_0003508 3300041408 Bacteria 2263
493 Ga0439464_0004335 3300042439 Bacteria 3627
494 Ga0466966_0114059 3300044684 Bacteria 1664
495 Ga0466971_0047546 3300044719 Bacteria 1929
496 Ga0466971_0121890 3300044719 Bacteria 1207
497 Ga0466959_0085581 3300045049 Bacteria 2268
498 Ga0451576_0034716 3300045051 Bacteria 5356
499 Ga0495592_0000020 3300046454 Bacteria 140576
500 Ga0495592_0003638 3300046454 Bacteria 11092
501 Ga0495592_0020065 3300046454 Bacteria 5081
502 Ga0495592_0024541 3300046454 Bacteria 4582
503 Ga0495603_0059418 3300046455 Bacteria 2260
504 Ga0495603_0101255 3300046455 Bacteria 1682
505 Ga0495590_0021990 3300046457 Bacteria 2258
506 Ga0495629_0045295 3300046459 Bacteria 3086
507 Ga0495629_0045577 3300046459 Bacteria 3076
508 Ga0495629_0087940 3300046459 Bacteria 2167
509 Ga0495629_0105668 3300046459 Bacteria 1964
510 Ga0495629_0139610 3300046459 Bacteria 1686
511 Ga0495638_0002961 3300046460 Bacteria 13550
512 Ga0495638_0182569 3300046460 Bacteria 1196
513 Ga0495641_0025043 3300046461 Bacteria 2932
514 Ga0495641_0075739 3300046461 Bacteria 1508
515 Ga0495651_0000606 3300046462 Bacteria 27884
516 Ga0495651_0001798 3300046462 Bacteria 16533
517 Ga0495651_0009868 3300046462 Bacteria 7341
518 Ga0495651_0126565 3300046462 Bacteria 1870
519 Ga0495653_0000046 3300046463 Bacteria 113893
520 Ga0495653_0002673 3300046463 Bacteria 14197
521 Ga0495653_0008326 3300046463 Bacteria 8500
522 Ga0495653_0038924 3300046463 Bacteria 3729
523 Ga0495582_0035855 3300046473 Bacteria 2729
524 Ga0495582_0037877 3300046473 Bacteria 2652
525 Ga0495582_0141304 3300046473 Bacteria 1364
526 Ga0495582_0169085 3300046473 Bacteria 1244
527 Ga0495639_0124449 3300046475 Bacteria 1231
528 Ga0495662_0001688 3300046476 Bacteria 11019
529 Ga0495662_0012231 3300046476 Bacteria 4191
530 Ga0495662_0033933 3300046476 Bacteria 2465
531 Ga0495662_0081789 3300046476 Bacteria 1571
532 Ga0495664_0000017 3300046477 Bacteria 172210
533 Ga0495664_0003537 3300046477 Bacteria 8521
534 Ga0495664_0016826 3300046477 Bacteria 4174
535 Ga0495664_0060982 3300046477 Bacteria 2246
536 Ga0495664_0146951 3300046477 Bacteria 1430
537 Ga0495584_0086032 3300046491 Bacteria 1584
538 Ga0495594_0024673 3300046499 Bacteria 3231
539 Ga0495594_0057062 3300046499 Bacteria 2156
540 Ga0495608_0000560 3300046511 Bacteria 25606
541 Ga0495608_0000591 3300046511 Bacteria 24964
542 Ga0495608_0001474 3300046511 Bacteria 16724
543 Ga0495608_0088372 3300046511 Bacteria 2006
544 Ga0495608_0179617 3300046511 Bacteria 1339
545 Ga0495618_0000059 3300046514 Bacteria 79623
546 Ga0495618_0001466 3300046514 Bacteria 15809
547 Ga0495618_0027234 3300046514 Bacteria 3558
548 Ga0495618_0130395 3300046514 Bacteria 1608
549 Ga0495628_0000530 3300046516 Bacteria 34897
550 Ga0495628_0001927 3300046516 Bacteria 18830
551 Ga0495628_0044982 3300046516 Bacteria 3510
552 Ga0495630_0003509 3300046517 Bacteria 10907
553 Ga0495630_0146463 3300046517 Bacteria 1796
554 Ga0495630_0198539 3300046517 Bacteria 1531
555 Ga0495663_0021375 3300046525 Bacteria 1864
556 Ga0495666_0049682 3300046526 Bacteria 2017
557 Ga0495652_0001393 3300046529 Bacteria 26853
558 Ga0495652_0003497 3300046529 Bacteria 15467
559 Ga0495652_0015699 3300046529 Bacteria 6778
560 Ga0495652_0039947 3300046529 Bacteria 4055
561 Ga0495652_0202002 3300046529 Bacteria 1507
562 Ga0495652_0246691 3300046529 Bacteria 1325
563 Ga0495665_0099672 3300046531 Bacteria 1525
564 Ga0495665_0216472 3300046531 Bacteria 991
565 Ga0495640_0000029 3300046533 Bacteria 79567
566 Ga0495640_0002454 3300046533 Bacteria 14898
567 Ga0495640_0012195 3300046533 Bacteria 6579
568 Ga0495640_0019507 3300046533 Bacteria 5004
569 Ga0495640_0062664 3300046533 Bacteria 2521
570 Ga0495640_0066208 3300046533 Bacteria 2437
571 Ga0495640_0111630 3300046533 Bacteria 1786
572 Ga0495640_0219704 3300046533 Bacteria 1199
573 Ga0495586_0008177 3300046535 Bacteria 5575
574 Ga0495587_0000019 3300046536 Bacteria 161972
575 Ga0495587_0002240 3300046536 Bacteria 12923
576 Ga0495598_0001163 3300046537 Bacteria 5082
577 Ga0495598_0021826 3300046537 Bacteria 1707
578 Ga0495621_0088633 3300046539 Bacteria 1164
579 Ga0495645_0000006 3300046543 Bacteria 382503
580 Ga0495645_0002539 3300046543 Bacteria 12383
581 Ga0495645_0013129 3300046543 Bacteria 5854
582 Ga0495645_0023203 3300046543 Bacteria 4492
583 Ga0495667_0000061 3300046559 Bacteria 94650
584 Ga0495667_0001150 3300046559 Bacteria 17257
585 Ga0495667_0021829 3300046559 Bacteria 4317
586 Ga0495634_0000345 3300046642 Bacteria 44890
587 Ga0495634_0003468 3300046642 Bacteria 12632
588 Ga0495634_0071521 3300046642 Bacteria 2283
589 Ga0495634_0101196 3300046642 Bacteria 1862
590 Ga0495635_0000023 3300046663 Bacteria 153429
591 Ga0495635_0003881 3300046663 Bacteria 10388
592 Ga0495635_0008488 3300046663 Bacteria 7176
593 Ga0495635_0065489 3300046663 Bacteria 2493
594 Ga0495635_0082945 3300046663 Bacteria 2194
595 Ga0495588_0013595 3300046674 Bacteria 3881
596 Ga0495657_0002787 3300046675 Bacteria 14535
597 Ga0495657_0003270 3300046675 Bacteria 13307
598 Ga0495657_0014478 3300046675 Bacteria 5790
599 Ga0495599_0000066 3300046678 Bacteria 72412
600 Ga0495599_0000564 3300046678 Bacteria 21162
601 Ga0495599_0009859 3300046678 Bacteria 5848
602 Ga0495599_0043601 3300046678 Bacteria 2815
603 Ga0495599_0070189 3300046678 Bacteria 2186
604 Ga0495623_0000420 3300046679 Bacteria 27960
605 Ga0495623_0000428 3300046679 Bacteria 27653
606 Ga0495623_0124704 3300046679 Bacteria 1547
607 Ga0495646_0000108 3300046680 Bacteria 40754
608 Ga0495646_0003113 3300046680 Bacteria 10292
609 Ga0495646_0051463 3300046680 Bacteria 2492
610 Ga0495646_0111475 3300046680 Bacteria 1557
611 Ga0495658_0016513 3300046683 Bacteria 3800
612 Ga0495658_0030249 3300046683 Bacteria 2939
613 Ga0495613_0075636 3300046689 Bacteria 2451
614 Ga0495613_0126784 3300046689 Bacteria 1830
615 Ga0495624_0009460 3300046690 Bacteria 6751
616 Ga0495624_0039009 3300046690 Bacteria 3047
617 Ga0495624_0191906 3300046690 Bacteria 1242
618 Ga0495600_0000030 3300046809 Bacteria 89424
619 Ga0495600_0001326 3300046809 Bacteria 13661
620 Ga0495600_0019703 3300046809 Bacteria 4311
621 Ga0495600_0060643 3300046809 Bacteria 2470
622 Ga0495600_0062772 3300046809 Bacteria 2427
623 Ga0495660_0132045 3300046810 Bacteria 1252
624 Ga0495581_0006750 3300047315 Bacteria 6655
625 Ga0495581_0015790 3300047315 Bacteria 4385
626 Ga0495581_0068578 3300047315 Bacteria 2050
627 Ga0495581_0099987 3300047315 Bacteria 1685
628 Ga0495604_0000501 3300047317 Bacteria 34507
629 Ga0495604_0002131 3300047317 Bacteria 15916
630 Ga0495604_0003891 3300047317 Bacteria 11887
631 Ga0495604_0020818 3300047317 Bacteria 5236
632 Ga0495604_0045926 3300047317 Bacteria 3407
633 Ga0495674_0001027 3300047319 Bacteria 26811
634 Ga0495674_0009434 3300047319 Bacteria 9272
635 Ga0495674_0042562 3300047319 Bacteria 4049
636 Ga0495674_0047567 3300047319 Bacteria 3802
637 Ga0495674_0072707 3300047319 Bacteria 2965
638 Ga0495672_0039766 3300047320 Bacteria 2858
639 Ga0495676_0006491 3300047321 Bacteria 10781
640 Ga0495676_0053487 3300047321 Bacteria 3217
641 Ga0495680_0001686 3300047322 Bacteria 23465
642 Ga0495680_0002301 3300047322 Bacteria 19625
643 Ga0495680_0021430 3300047322 Bacteria 5410
644 Ga0495675_0001544 3300047444 Bacteria 13904
645 Ga0495675_0002669 3300047444 Bacteria 10688
646 Ga0495675_0036104 3300047444 Bacteria 3154
647 Ga0495684_0000056 3300047471 Bacteria 79718
648 Ga0495684_0002087 3300047471 Bacteria 16070
649 Ga0495684_0003625 3300047471 Bacteria 12034
650 Ga0495684_0004889 3300047471 Bacteria 10451
651 Ga0495593_0022923 3300047673 Bacteria 3474
652 Ga0495593_0046746 3300047673 Bacteria 2305
653 Ga0495602_0000006 3300048088 Bacteria 322593
654 Ga0495602_0005526 3300048088 Bacteria 13262
655 Ga0495602_0018930 3300048088 Bacteria 6854
656 Ga0495602_0024466 3300048088 Bacteria 5858
657 Ga0495602_0057446 3300048088 Bacteria 3413
658 Ga0495614_0055075 3300048089 Bacteria 1706
659 Ga0496100_0000106 3300048903 Bacteria 48123
660 Ga0496100_0000499 3300048903 Bacteria 18860
661 Ga0496100_0029143 3300048903 Bacteria 3412
662 Ga0496100_0031123 3300048903 Bacteria 3314
663 Ga0496100_0075751 3300048903 Bacteria 2257
664 Ga0496100_0106338 3300048903 Bacteria 1942
665 Ga0496101_0000136 3300048904 Bacteria 65392
666 Ga0496101_0000604 3300048904 Bacteria 21914
667 Ga0496101_0008407 3300048904 Bacteria 6744
668 Ga0496102_0005128 3300048905 Bacteria 11106
669 Ga0496102_0015419 3300048905 Bacteria 6656
670 Ga0496102_0029938 3300048905 Bacteria 4871
671 Ga0496102_0030697 3300048905 Bacteria 4811
672 Ga0496102_0041646 3300048905 Bacteria 4160
673 Ga0496102_0459782 3300048905 Bacteria 1194
674 Ga0496103_0005104 3300048906 Bacteria 7905
675 Ga0496103_0029900 3300048906 Bacteria 3312
676 Ga0496103_0033703 3300048906 Bacteria 3129
677 Ga0496103_0081812 3300048906 Bacteria 2032
678 Ga0496104_0000090 3300048907 Bacteria 87877
679 Ga0496104_0000506 3300048907 Bacteria 33454
680 Ga0496104_0002062 3300048907 Bacteria 17450
681 Ga0496104_0006735 3300048907 Bacteria 10119
682 Ga0496104_0007428 3300048907 Bacteria 9685
683 Ga0496104_0031476 3300048907 Bacteria 4934
684 Ga0496104_0032114 3300048907 Bacteria 4886
685 Ga0496104_0035256 3300048907 Bacteria 4672
686 Ga0496104_0064478 3300048907 Bacteria 3475
687 Ga0496104_0082159 3300048907 Bacteria 3072
688 Ga0496105_0004357 3300048908 Bacteria 10657
689 Ga0496105_0013985 3300048908 Bacteria 6383
690 Ga0496105_0018996 3300048908 Bacteria 5538
691 Ga0496105_0034775 3300048908 Bacteria 4146
692 Ga0496105_0069997 3300048908 Bacteria 2900
693 Ga0496105_0147348 3300048908 Bacteria 1935
694 Ga0496106_0002270 3300048909 Bacteria 14338
695 Ga0496106_0002626 3300048909 Bacteria 13365
696 Ga0496106_0045224 3300048909 Bacteria 3307
697 Ga0496106_0094569 3300048909 Bacteria 2311
698 Ga0496106_0164611 3300048909 Bacteria 1755
699 Ga0496106_0330303 3300048909 Bacteria 1224
700 Ga0496107_0000129 3300048910 Bacteria 36728
701 Ga0496107_0005132 3300048910 Bacteria 8934
702 Ga0496107_0007357 3300048910 Bacteria 7593
703 Ga0496107_0007909 3300048910 Bacteria 7339
704 Ga0496108_0000595 3300048911 Bacteria 28321
705 Ga0496108_0003914 3300048911 Bacteria 11960
706 Ga0496108_0007392 3300048911 Bacteria 8908
707 Ga0496108_0037385 3300048911 Bacteria 4043
708 Ga0496108_0205192 3300048911 Bacteria 1710
709 Ga0496108_0279657 3300048911 Bacteria 1453
710 Ga0496109_0002975 3300048912 Bacteria 14165
711 Ga0496109_0009902 3300048912 Bacteria 8137
712 Ga0496109_0015516 3300048912 Bacteria 6641
713 Ga0496109_0029346 3300048912 Bacteria 4926
714 Ga0496109_0092710 3300048912 Bacteria 2794
715 Ga0496109_0318351 3300048912 Bacteria 1468
716 Ga0496109_0570041 3300048912 Bacteria 1067
717 Ga0496110_0000579 3300048913 Bacteria 25125
718 Ga0496110_0011041 3300048913 Bacteria 7373
719 Ga0496110_0048224 3300048913 Bacteria 3733
720 Ga0496110_0279886 3300048913 Bacteria 1519
721 Ga0496111_0000122 3300048914 Bacteria 33866
722 Ga0496111_0000845 3300048914 Bacteria 16533
723 Ga0496111_0032359 3300048914 Bacteria 3728
724 Ga0496111_0035537 3300048914 Bacteria 3562
725 Ga0496112_0005655 3300048915 Bacteria 10853
726 Ga0496112_0045602 3300048915 Bacteria 4297
727 Ga0496112_0110192 3300048915 Bacteria 2723
728 Ga0496112_0206822 3300048915 Bacteria 1920
729 Ga0496112_0260843 3300048915 Bacteria 1682
730 Ga0496112_0509706 3300048915 Bacteria 1138
731 Ga0496113_0000068 3300048916 Bacteria 45065
732 Ga0496113_0002918 3300048916 Bacteria 10091
733 Ga0496113_0009362 3300048916 Bacteria 6421
734 Ga0496113_0044770 3300048916 Bacteria 3280
735 Ga0496114_0010925 3300048917 Bacteria 7237
736 Ga0496114_0035030 3300048917 Bacteria 4144
737 Ga0496114_0095817 3300048917 Bacteria 2525
738 Ga0496115_0001121 3300048918 Bacteria 19330
739 Ga0496115_0010308 3300048918 Bacteria 6977
740 Ga0496115_0027950 3300048918 Bacteria 4416
741 Ga0496115_0049351 3300048918 Bacteria 3368
742 Ga0496115_0053290 3300048918 Bacteria 3246
743 Ga0496115_0056075 3300048918 Bacteria 3166
744 Ga0496115_0081992 3300048918 Bacteria 2627
745 Ga0496115_0365049 3300048918 Bacteria 1176
746 Ga0501034_0174911 3300049571 Bacteria 2113
747 Ga0501036_0294024 3300049572 Bacteria 1359
748 Ga0501039_0175034 3300049575 Bacteria 1688
749 Ga0501041_0145101 3300049577 Bacteria 1481
750 Ga0501042_0177013 3300049578 Bacteria 1539
751 Ga0501046_0170924 3300049580 Bacteria 1631
752 Ga0501047_0009616 3300049581 Bacteria 9142
753 Ga0501047_0199646 3300049581 Bacteria 1861
754 Ga0501048_0150758 3300049582 Bacteria 1645
755 Ga0501074_0065156 3300049590 Bacteria 2623
756 Ga0501079_0117171 3300049741 Bacteria 2071
757 Ga0501080_0371480 3300049742 Bacteria 1289
758 Ga0501081_0144666 3300049743 Bacteria 1705
759 Ga0501035_0297722 3300049822 Bacteria 1360
760 Ga0501045_0093568 3300049824 Bacteria 2223
761 nmdc:mga00v17_81243_c1 3300050491 Bacteria 2024
762 nmdc:mga0yw44_47060_c1 3300050492 Bacteria 2594
763 nmdc:mga0k408_15093_c1 3300050493 Bacteria 4269
764 nmdc:mga07m45_141716_c1 3300050496 Bacteria 1392
765 nmdc:mga05p37_231454_c1 3300050507 Bacteria 2226
766 nmdc:mga05p37_275845_c1 3300050507 Bacteria 2007
767 nmdc:mga05p37_4379_c1 3300050507 Bacteria 10579
768 nmdc:mga0qj67_15663_c1 3300050509 Bacteria 5743
769 nmdc:mga06r32_186730_c1 3300050510 Bacteria 2060
770 nmdc:mga06r32_27472_c1 3300050510 Bacteria 5316
771 nmdc:mga06r32_9884_c1 3300050510 Bacteria 8610
772 nmdc:mga08y16_359919_c1 3300050511 Bacteria 1494
773 nmdc:mga08y16_460915_c1 3300050511 Bacteria 1295
774 nmdc:mga0n895_68953_c1 3300050512 Bacteria 3503
775 nmdc:mga0rr50_376811_c1 3300050513 Bacteria 1196
776 nmdc:mga08x19_4942_c1 3300050514 Bacteria 7874
777 nmdc:mga0a205_380_c1 3300050515 Bacteria 33747
778 nmdc:mga0a205_7888_c1 3300050515 Bacteria 9666
779 Ga0495601_0000007 3300053077 Bacteria 365972
780 Ga0495601_0000360 3300053077 Bacteria 23959
781 Ga0495601_0001260 3300053077 Bacteria 13862
782 Ga0495601_0016653 3300053077 Bacteria 4456
783 Ga0495601_0032598 3300053077 Bacteria 3244
784 Ga0495601_0117275 3300053077 Bacteria 1727
785 Ga0495601_0128248 3300053077 Bacteria 1651
786 Ga0495612_0000108 3300053078 Bacteria 34924
787 Ga0495612_0000964 3300053078 Bacteria 11832
788 Ga0495612_0001388 3300053078 Bacteria 9988
789 Ga0495612_0001978 3300053078 Bacteria 8443
790 Ga0495595_0000031 3300053084 Bacteria 89199
791 Ga0495595_0000969 3300053084 Bacteria 11036
792 Ga0495595_0009321 3300053084 Bacteria 4056
793 Ga0495595_0030564 3300053084 Bacteria 2417
794 Ga0495619_0000023 3300053085 Bacteria 182266
795 Ga0495619_0000581 3300053085 Bacteria 24290
796 Ga0495619_0001851 3300053085 Bacteria 14080
797 Ga0495619_0002169 3300053085 Bacteria 13003
798 Ga0495619_0008848 3300053085 Bacteria 6365
799 Ga0495619_0024789 3300053085 Bacteria 3848
800 Ga0495619_0053214 3300053085 Bacteria 2677
801 Ga0500641_0005257 3300053096 Bacteria 4587
802 Ga0500595_007827 3300053119 Bacteria 4402
803 Ga0500616_0042962 3300053153 Bacteria 2418
804 Ga0500616_0059585 3300053153 Bacteria 1982
805 Ga0501082_0092413 3300060353 Bacteria 2614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100248195 Ga0070711_1002481952 307
2 3300025916 Ga0207663_10218121 Ga0207663_102181211 307
3 3300048907 Ga0496104_0064478 Ga0496104_0064478_1119_2159 307
4 3300048908 Ga0496105_0034775 Ga0496105_0034775_2476_3516 307
5 3300048909 Ga0496106_0094569 Ga0496106_0094569_897_1937 307
6 3300049742 Ga0501080_0371480 Ga0501080_0371480_39_1025 307
7 3300039437 Ga0436365_1037616 Ga0436365_1037616_1190_2230 308
8 3300046459 Ga0495629_0045577 Ga0495629_0045577_2057_3043 309
9 3300046531 Ga0495665_0216472 Ga0495665_0216472_18_974 312
10 3300046525 Ga0495663_0021375 Ga0495663_0021375_778_1764 314
11 3300049571 Ga0501034_0174911 Ga0501034_0174911_1158_2102 314
12 3300005530 Ga0070679_100138981 Ga0070679_1001389812 315
13 3300035725 Ga0373947_0202426 Ga0373947_0202426_27_980 315
14 3300048918 Ga0496115_0365049 Ga0496115_0365049_206_1159 315
15 3300006880 Ga0075429_100037897 Ga0075429_1000378972 317
16 3300039437 Ga0436365_0498663 Ga0436365_0498663_2069_3109 317
17 3300048909 Ga0496106_0330303 Ga0496106_0330303_250_1212 317
18 3300046680 Ga0495646_0111475 Ga0495646_0111475_17_985 318
19 3300048915 Ga0496112_0260843 Ga0496112_0260843_13_972 318
20 3300037466 Ga0395898_0092678 Ga0395898_0092678_17_1003 319
21 3300007788 Ga0099795_10021476 Ga0099795_100214762 320
22 3300005983 Ga0081540_1000642 Ga0081540_100064229 322
23 3300005341 Ga0070691_10094402 Ga0070691_100944021 324
24 3300005441 Ga0070700_100023506 Ga0070700_1000235063 324
25 3300005545 Ga0070695_100004709 Ga0070695_1000047096 324
26 3300005983 Ga0081540_1015934 Ga0081540_10159343 324
27 3300048909 Ga0496106_0164611 Ga0496106_0164611_125_1165 324
28 3300050511 nmdc:mga08y16_460915_c1 nmdc:mga08y16_460915_c1_107_1156 324
29 3300035170 Ga0373943_0031766 Ga0373943_0031766_165_1217 325
30 3300046455 Ga0495603_0101255 Ga0495603_0101255_455_1507 325
31 3300049590 Ga0501074_0065156 Ga0501074_0065156_641_1681 325
32 3300053153 Ga0500616_0042962 Ga0500616_0042962_837_1880 325
33 3300006844 Ga0075428_100014319 Ga0075428_1000143193 326
34 3300006847 Ga0075431_100027830 Ga0075431_1000278303 326
35 3300035241 Ga0373961_0001648 Ga0373961_0001648_3216_4253 326
36 3300050510 nmdc:mga06r32_27472_c1 nmdc:mga06r32_27472_c1_1372_2424 326
37 3300005458 Ga0070681_10291287 Ga0070681_102912871 327
38 3300005535 Ga0070684_100055171 Ga0070684_1000551712 327
39 3300009551 Ga0105238_10024019 Ga0105238_100240196 327
40 3300025915 Ga0207693_10007583 Ga0207693_100075834 327
41 3300025917 Ga0207660_10019543 Ga0207660_100195433 327
42 3300026078 Ga0207702_10121445 Ga0207702_101214452 327
43 3300031239 Ga0265328_10006537 Ga0265328_100065373 327
44 3300031711 Ga0265314_10026124 Ga0265314_100261243 327
45 3300035114 Ga0373939_0001020 Ga0373939_0001020_4953_6029 327
46 3300035695 Ga0373927_0038796 Ga0373927_0038796_1998_3038 327
47 3300046462 Ga0495651_0126565 Ga0495651_0126565_35_1087 327
48 3300046511 Ga0495608_0088372 Ga0495608_0088372_174_1226 327
49 3300046514 Ga0495618_0130395 Ga0495618_0130395_12_1064 327
50 3300046529 Ga0495652_0202002 Ga0495652_0202002_215_1267 327
51 3300046559 Ga0495667_0021829 Ga0495667_0021829_95_1147 327
52 3300047315 Ga0495581_0068578 Ga0495581_0068578_554_1606 327
53 3300047317 Ga0495604_0045926 Ga0495604_0045926_1144_2196 327
54 3300047319 Ga0495674_0042562 Ga0495674_0042562_538_1590 327
55 3300047471 Ga0495684_0002087 Ga0495684_0002087_2078_3130 327
56 3300048912 Ga0496109_0318351 Ga0496109_0318351_402_1448 327
57 3300053085 Ga0495619_0008848 Ga0495619_0008848_4581_5633 327
58 3300005937 Ga0081455_10062655 Ga0081455_100626552 328
59 3300035111 Ga0373923_0000216 Ga0373923_0000216_6502_7542 328
60 3300035113 Ga0373936_0000683 Ga0373936_0000683_3669_4709 328
61 3300035116 Ga0373945_0001832 Ga0373945_0001832_3623_4663 328
62 3300035118 Ga0373954_0004093 Ga0373954_0004093_3119_4159 328
63 3300035172 Ga0373955_0000426 Ga0373955_0000426_15415_16455 328
64 3300035692 Ga0373935_0000088 Ga0373935_0000088_17584_18624 328
65 3300035724 Ga0373933_0006652 Ga0373933_0006652_2151_3191 328
66 3300035725 Ga0373947_0002738 Ga0373947_0002738_9509_10549 328
67 3300036401 Ga0373937_0000124 Ga0373937_0000124_55223_56263 328
68 3300037068 Ga0373925_0000929 Ga0373925_0000929_16510_17550 328
69 3300046454 Ga0495592_0000020 Ga0495592_0000020_121900_122940 328
70 3300046459 Ga0495629_0045295 Ga0495629_0045295_1958_2998 328
71 3300046462 Ga0495651_0001798 Ga0495651_0001798_1926_2966 328
72 3300046463 Ga0495653_0000046 Ga0495653_0000046_17858_18898 328
73 3300046473 Ga0495582_0169085 Ga0495582_0169085_138_1178 328
74 3300046476 Ga0495662_0001688 Ga0495662_0001688_4832_5872 328
75 3300046477 Ga0495664_0000017 Ga0495664_0000017_17799_18839 328
76 3300046511 Ga0495608_0000560 Ga0495608_0000560_17799_18839 328
77 3300046514 Ga0495618_0000059 Ga0495618_0000059_17780_18820 328
78 3300046516 Ga0495628_0000530 Ga0495628_0000530_8143_9183 328
79 3300046529 Ga0495652_0001393 Ga0495652_0001393_8143_9183 328
80 3300046533 Ga0495640_0000029 Ga0495640_0000029_60875_61915 328
81 3300046536 Ga0495587_0000019 Ga0495587_0000019_143296_144336 328
82 3300046543 Ga0495645_0000006 Ga0495645_0000006_62687_63727 328
83 3300046559 Ga0495667_0000061 Ga0495667_0000061_75994_77034 328
84 3300046642 Ga0495634_0000345 Ga0495634_0000345_35932_36972 328
85 3300046663 Ga0495635_0000023 Ga0495635_0000023_143528_144568 328
86 3300046675 Ga0495657_0002787 Ga0495657_0002787_8015_9055 328
87 3300046678 Ga0495599_0000066 Ga0495599_0000066_25643_26683 328
88 3300046679 Ga0495623_0000428 Ga0495623_0000428_17529_18569 328
89 3300046680 Ga0495646_0000108 Ga0495646_0000108_17618_18658 328
90 3300046689 Ga0495613_0075636 Ga0495613_0075636_550_1590 328
91 3300046690 Ga0495624_0039009 Ga0495624_0039009_1918_2958 328
92 3300046809 Ga0495600_0000030 Ga0495600_0000030_70837_71877 328
93 3300047315 Ga0495581_0015790 Ga0495581_0015790_2870_3910 328
94 3300047317 Ga0495604_0000501 Ga0495604_0000501_8015_9055 328
95 3300047319 Ga0495674_0001027 Ga0495674_0001027_17757_18797 328
96 3300047322 Ga0495680_0002301 Ga0495680_0002301_794_1834 328
97 3300047471 Ga0495684_0000056 Ga0495684_0000056_60904_61944 328
98 3300048088 Ga0495602_0000006 Ga0495602_0000006_17749_18789 328
99 3300048915 Ga0496112_0206822 Ga0496112_0206822_564_1604 328
100 3300049572 Ga0501036_0294024 Ga0501036_0294024_56_1102 328
101 3300049580 Ga0501046_0170924 Ga0501046_0170924_404_1450 328
102 3300049743 Ga0501081_0144666 Ga0501081_0144666_41_1087 328
103 3300049824 Ga0501045_0093568 Ga0501045_0093568_1030_2076 328
104 3300050509 nmdc:mga0qj67_15663_c1 nmdc:mga0qj67_15663_c1_2992_4038 328
105 3300050510 nmdc:mga06r32_9884_c1 nmdc:mga06r32_9884_c1_7189_8235 328
106 3300053077 Ga0495601_0000007 Ga0495601_0000007_347269_348309 328
107 3300053078 Ga0495612_0000108 Ga0495612_0000108_25742_26782 328
108 3300053084 Ga0495595_0000031 Ga0495595_0000031_5430_6470 328
109 3300053085 Ga0495619_0000023 Ga0495619_0000023_147398_148438 328
110 3300053119 Ga0500595_007827 Ga0500595_007827_2327_3367 328
111 3300005437 Ga0070710_10076323 Ga0070710_100763232 329
112 3300005983 Ga0081540_1000257 Ga0081540_10002576 329
113 3300006028 Ga0070717_10120012 Ga0070717_101200123 329
114 3300006163 Ga0070715_10011354 Ga0070715_100113543 329
115 3300025939 Ga0207665_10076338 Ga0207665_100763382 329
116 3300031241 Ga0265325_10127955 Ga0265325_101279551 329
117 3300035691 Ga0373931_0049715 Ga0373931_0049715_1132_2205 329
118 3300035692 Ga0373935_0024986 Ga0373935_0024986_672_1745 329
119 3300035725 Ga0373947_0024321 Ga0373947_0024321_1423_2496 329
120 3300037068 Ga0373925_0100869 Ga0373925_0100869_443_1516 329
121 3300005458 Ga0070681_10328512 Ga0070681_103285122 330
122 3300005518 Ga0070699_100276328 Ga0070699_1002763282 330
123 3300005981 Ga0081538_10120736 Ga0081538_101207361 330
124 3300006195 Ga0075366_10018043 Ga0075366_100180433 330
125 3300046477 Ga0495664_0146951 Ga0495664_0146951_335_1375 330
126 3300050493 nmdc:mga0k408_15093_c1 nmdc:mga0k408_15093_c1_809_1849 330
127 3300050496 nmdc:mga07m45_141716_c1 nmdc:mga07m45_141716_c1_274_1314 330
128 3300050507 nmdc:mga05p37_275845_c1 nmdc:mga05p37_275845_c1_669_1718 330
129 3300049577 Ga0501041_0145101 Ga0501041_0145101_129_1175 331
130 3300053153 Ga0500616_0059585 Ga0500616_0059585_758_1813 331
131 3300003215 JGI25153J46596_10008419 JGI25153J46596_100084196 332
132 3300005435 Ga0070714_100048797 Ga0070714_1000487971 332
133 3300005563 Ga0068855_100062526 Ga0068855_1000625264 332
134 3300005616 Ga0068852_100095205 Ga0068852_1000952052 332
135 3300025297 Ga0209758_1000638 Ga0209758_100063839 332
136 3300025949 Ga0207667_10197114 Ga0207667_101971142 332
137 3300031239 Ga0265328_10006061 Ga0265328_100060612 332
138 3300035172 Ga0373955_0011222 Ga0373955_0011222_936_1979 332
139 3300036401 Ga0373937_0076549 Ga0373937_0076549_1029_2072 332
140 3300039437 Ga0436365_0977831 Ga0436365_0977831_2552_3598 332
141 3300045049 Ga0466959_0085581 Ga0466959_0085581_1035_2078 332
142 3300046457 Ga0495590_0021990 Ga0495590_0021990_141_1199 332
143 3300046463 Ga0495653_0038924 Ga0495653_0038924_2148_3200 332
144 3300046533 Ga0495640_0066208 Ga0495640_0066208_879_1922 332
145 3300046674 Ga0495588_0013595 Ga0495588_0013595_576_1628 332
146 3300046809 Ga0495600_0060643 Ga0495600_0060643_1300_2352 332
147 3300050513 nmdc:mga0rr50_376811_c1 nmdc:mga0rr50_376811_c1_62_1099 332
148 3300053077 Ga0495601_0128248 Ga0495601_0128248_412_1464 332
149 3300005355 Ga0070671_100213033 Ga0070671_1002130332 333
150 3300005719 Ga0068861_100462030 Ga0068861_1004620301 333
151 3300006028 Ga0070717_10177703 Ga0070717_101777032 333
152 3300006042 Ga0075368_10020103 Ga0075368_100201033 333
153 3300006177 Ga0075362_10018081 Ga0075362_100180811 333
154 3300006178 Ga0075367_10232869 Ga0075367_102328691 333
155 3300006186 Ga0075369_10008059 Ga0075369_100080591 333
156 3300007788 Ga0099795_10044521 Ga0099795_100445211 333
157 3300009553 Ga0105249_10403723 Ga0105249_104037231 333
158 3300011119 Ga0105246_10124088 Ga0105246_101240882 333
159 3300025923 Ga0207681_10057429 Ga0207681_100574292 333
160 3300025931 Ga0207644_10121848 Ga0207644_101218481 333
161 3300025941 Ga0207711_10176024 Ga0207711_101760243 333
162 3300026121 Ga0207683_10031114 Ga0207683_100311145 333
163 3300035111 Ga0373923_0034979 Ga0373923_0034979_452_1504 333
164 3300035171 Ga0373946_0020116 Ga0373946_0020116_253_1305 333
165 3300035172 Ga0373955_0001269 Ga0373955_0001269_500_1552 333
166 3300035410 Ga0373924_0031851 Ga0373924_0031851_291_1343 333
167 3300035691 Ga0373931_0028283 Ga0373931_0028283_615_1655 333
168 3300046461 Ga0495641_0025043 Ga0495641_0025043_424_1476 333
169 3300046473 Ga0495582_0037877 Ga0495582_0037877_1116_2168 333
170 3300046499 Ga0495594_0024673 Ga0495594_0024673_843_1895 333
171 3300046526 Ga0495666_0049682 Ga0495666_0049682_623_1675 333
172 3300046535 Ga0495586_0008177 Ga0495586_0008177_190_1242 333
173 3300046678 Ga0495599_0070189 Ga0495599_0070189_330_1382 333
174 3300046680 Ga0495646_0051463 Ga0495646_0051463_121_1173 333
175 3300048088 Ga0495602_0057446 Ga0495602_0057446_2281_3333 333
176 3300048903 Ga0496100_0000499 Ga0496100_0000499_4270_5310 333
177 3300048904 Ga0496101_0008407 Ga0496101_0008407_2750_3790 333
178 3300048906 Ga0496103_0081812 Ga0496103_0081812_715_1755 333
179 3300048907 Ga0496104_0006735 Ga0496104_0006735_1739_2779 333
180 3300048909 Ga0496106_0045224 Ga0496106_0045224_1758_2798 333
181 3300048911 Ga0496108_0205192 Ga0496108_0205192_322_1362 333
182 3300048918 Ga0496115_0056075 Ga0496115_0056075_973_2013 333
183 3300053077 Ga0495601_0032598 Ga0495601_0032598_37_1077 333
184 3300053084 Ga0495595_0030564 Ga0495595_0030564_156_1196 333
185 3300053096 Ga0500641_0005257 Ga0500641_0005257_3154_4194 333
186 3300005354 Ga0070675_100032912 Ga0070675_1000329123 334
187 3300005530 Ga0070679_100244606 Ga0070679_1002446062 334
188 3300009148 Ga0105243_10198668 Ga0105243_101986681 334
189 3300009553 Ga0105249_10137256 Ga0105249_101372562 334
190 3300031238 Ga0265332_10001014 Ga0265332_100010144 334
191 3300031247 Ga0265340_10033530 Ga0265340_100335303 334
192 3300031249 Ga0265339_10014704 Ga0265339_100147044 334
193 3300031711 Ga0265314_10040963 Ga0265314_100409633 334
194 3300031712 Ga0265342_10000035 Ga0265342_1000003581 334
195 3300039450 Ga0436363_0718092 Ga0436363_0718092_879_1922 334
196 3300046539 Ga0495621_0088633 Ga0495621_0088633_97_1137 334
197 3300007265 Ga0099794_10040005 Ga0099794_100400053 335
198 3300025928 Ga0207700_10113366 Ga0207700_101133662 335
199 3300027671 Ga0209588_1040657 Ga0209588_10406571 335
200 3300031241 Ga0265325_10033971 Ga0265325_100339712 335
201 3300035170 Ga0373943_0019066 Ga0373943_0019066_2041_3096 335
202 3300060353 Ga0501082_0092413 Ga0501082_0092413_1042_2082 335
203 3300006178 Ga0075367_10109742 Ga0075367_101097423 336
204 3300044719 Ga0466971_0121890 Ga0466971_0121890_82_1122 336
205 3300049578 Ga0501042_0177013 Ga0501042_0177013_428_1471 336
206 3300006038 Ga0075365_10039649 Ga0075365_100396491 337
207 3300006178 Ga0075367_10208496 Ga0075367_102084962 337
208 3300037312 Ga0395899_0002468 Ga0395899_0002468_1218_2276 337
209 3300037418 Ga0395900_0001885 Ga0395900_0001885_1726_2784 337
210 3300037466 Ga0395898_0041853 Ga0395898_0041853_1623_2681 337
211 3300038443 Ga0395901_0043395 Ga0395901_0043395_273_1331 337
212 3300050492 nmdc:mga0yw44_47060_c1 nmdc:mga0yw44_47060_c1_1353_2393 337
213 3300049741 Ga0501079_0117171 Ga0501079_0117171_70_1089 339
214 3300001977 JGI24746J21847_1007086 JGI24746J21847_10070862 340
215 3300001990 JGI24737J22298_10021923 JGI24737J22298_100219233 340
216 3300002077 JGI24744J21845_10000129 JGI24744J21845_100001293 340
217 3300002239 JGI24034J26672_10003265 JGI24034J26672_100032652 340
218 3300005328 Ga0070676_10031623 Ga0070676_100316233 340
219 3300005329 Ga0070683_100079414 Ga0070683_1000794143 340
220 3300005330 Ga0070690_100032762 Ga0070690_1000327623 340
221 3300005331 Ga0070670_100006320 Ga0070670_1000063207 340
222 3300005334 Ga0068869_100101609 Ga0068869_1001016091 340
223 3300005335 Ga0070666_10020349 Ga0070666_100203492 340
224 3300005345 Ga0070692_10019972 Ga0070692_100199722 340
225 3300005347 Ga0070668_100080948 Ga0070668_1000809482 340
226 3300005347 Ga0070668_100195394 Ga0070668_1001953942 340
227 3300005353 Ga0070669_100083771 Ga0070669_1000837713 340
228 3300005355 Ga0070671_100042470 Ga0070671_1000424703 340
229 3300005365 Ga0070688_100009381 Ga0070688_1000093813 340
230 3300005366 Ga0070659_100035031 Ga0070659_1000350314 340
231 3300005438 Ga0070701_10021044 Ga0070701_100210442 340
232 3300005439 Ga0070711_100009896 Ga0070711_1000098966 340
233 3300005440 Ga0070705_100005755 Ga0070705_1000057553 340
234 3300005441 Ga0070700_100022512 Ga0070700_1000225122 340
235 3300005457 Ga0070662_100007924 Ga0070662_1000079243 340
236 3300005466 Ga0070685_10009274 Ga0070685_100092742 340
237 3300005543 Ga0070672_100028026 Ga0070672_1000280263 340
238 3300005544 Ga0070686_100004396 Ga0070686_1000043965 340
239 3300005548 Ga0070665_100485364 Ga0070665_1004853641 340
240 3300005564 Ga0070664_100016265 Ga0070664_1000162656 340
241 3300005614 Ga0068856_100018775 Ga0068856_1000187754 340
242 3300005615 Ga0070702_100007222 Ga0070702_1000072223 340
243 3300005616 Ga0068852_100026665 Ga0068852_1000266655 340
244 3300005617 Ga0068859_100007104 Ga0068859_1000071047 340
245 3300005618 Ga0068864_100004309 Ga0068864_1000043099 340
246 3300005718 Ga0068866_10013137 Ga0068866_100131374 340
247 3300005834 Ga0068851_10019416 Ga0068851_100194163 340
248 3300005840 Ga0068870_10008422 Ga0068870_100084223 340
249 3300005843 Ga0068860_100026330 Ga0068860_1000263303 340
250 3300005844 Ga0068862_100027295 Ga0068862_1000272953 340
251 3300006177 Ga0075362_10019138 Ga0075362_100191381 340
252 3300006178 Ga0075367_10073241 Ga0075367_100732413 340
253 3300006844 Ga0075428_100123190 Ga0075428_1001231902 340
254 3300006871 Ga0075434_100002138 Ga0075434_1000021386 340
255 3300006881 Ga0068865_100028940 Ga0068865_1000289404 340
256 3300006931 Ga0097620_100007104 Ga0097620_1000071047 340
257 3300009101 Ga0105247_10008421 Ga0105247_100084214 340
258 3300009101 Ga0105247_10038934 Ga0105247_100389342 340
259 3300009147 Ga0114129_10010082 Ga0114129_100100823 340
260 3300009174 Ga0105241_10043566 Ga0105241_100435663 340
261 3300009176 Ga0105242_10022852 Ga0105242_100228524 340
262 3300009177 Ga0105248_10080587 Ga0105248_100805872 340
263 3300010375 Ga0105239_10094126 Ga0105239_100941262 340
264 3300011119 Ga0105246_10014686 Ga0105246_100146864 340
265 3300013296 Ga0157374_10020476 Ga0157374_100204761 340
266 3300013306 Ga0163162_10023125 Ga0163162_100231252 340
267 3300013307 Ga0157372_10157323 Ga0157372_101573232 340
268 3300013308 Ga0157375_10013783 Ga0157375_100137835 340
269 3300014325 Ga0163163_10044077 Ga0163163_100440775 340
270 3300014325 Ga0163163_10053814 Ga0163163_100538143 340
271 3300014326 Ga0157380_10022504 Ga0157380_100225042 340
272 3300014968 Ga0157379_10015057 Ga0157379_100150574 340
273 3300014969 Ga0157376_10022279 Ga0157376_100222793 340
274 3300025900 Ga0207710_10011074 Ga0207710_100110742 340
275 3300025901 Ga0207688_10000276 Ga0207688_1000027618 340
276 3300025903 Ga0207680_10025652 Ga0207680_100256522 340
277 3300025907 Ga0207645_10020572 Ga0207645_100205724 340
278 3300025908 Ga0207643_10001883 Ga0207643_100018833 340
279 3300025919 Ga0207657_10021847 Ga0207657_100218472 340
280 3300025923 Ga0207681_10050182 Ga0207681_100501822 340
281 3300025925 Ga0207650_10015682 Ga0207650_100156824 340
282 3300025926 Ga0207659_10006748 Ga0207659_100067482 340
283 3300025928 Ga0207700_10025257 Ga0207700_100252571 340
284 3300025931 Ga0207644_10038782 Ga0207644_100387823 340
285 3300025932 Ga0207690_10016846 Ga0207690_100168465 340
286 3300025934 Ga0207686_10031352 Ga0207686_100313523 340
287 3300025935 Ga0207709_10034793 Ga0207709_100347933 340
288 3300025938 Ga0207704_10018553 Ga0207704_100185533 340
289 3300025940 Ga0207691_10021969 Ga0207691_100219693 340
290 3300025941 Ga0207711_10023405 Ga0207711_100234053 340
291 3300025942 Ga0207689_10002370 Ga0207689_1000237012 340
292 3300025944 Ga0207661_10009753 Ga0207661_100097532 340
293 3300025945 Ga0207679_10081256 Ga0207679_100812562 340
294 3300025961 Ga0207712_10024539 Ga0207712_100245394 340
295 3300025972 Ga0207668_10020821 Ga0207668_100208215 340
296 3300025972 Ga0207668_10180924 Ga0207668_101809242 340
297 3300025981 Ga0207640_10025371 Ga0207640_100253713 340
298 3300026023 Ga0207677_10014241 Ga0207677_100142412 340
299 3300026035 Ga0207703_10010855 Ga0207703_100108555 340
300 3300026041 Ga0207639_10032877 Ga0207639_100328771 340
301 3300026075 Ga0207708_10000256 Ga0207708_1000025624 340
302 3300026078 Ga0207702_10053363 Ga0207702_100533631 340
303 3300026088 Ga0207641_10038449 Ga0207641_100384493 340
304 3300026116 Ga0207674_10118492 Ga0207674_101184922 340
305 3300026118 Ga0207675_100002373 Ga0207675_1000023736 340
306 3300026121 Ga0207683_10055140 Ga0207683_100551402 340
307 3300026142 Ga0207698_10079743 Ga0207698_100797432 340
308 3300028379 Ga0268266_10094562 Ga0268266_100945621 340
309 3300028381 Ga0268264_10008918 Ga0268264_100089185 340
310 3300035116 Ga0373945_0013214 Ga0373945_0013214_672_1712 340
311 3300035692 Ga0373935_0114153 Ga0373935_0114153_400_1440 340
312 3300037068 Ga0373925_0005578 Ga0373925_0005578_8304_9344 340
313 3300046455 Ga0495603_0059418 Ga0495603_0059418_624_1664 340
314 3300046459 Ga0495629_0139610 Ga0495629_0139610_311_1360 340
315 3300046461 Ga0495641_0075739 Ga0495641_0075739_215_1255 340
316 3300046473 Ga0495582_0035855 Ga0495582_0035855_458_1507 340
317 3300046473 Ga0495582_0141304 Ga0495582_0141304_173_1213 340
318 3300046475 Ga0495639_0124449 Ga0495639_0124449_86_1126 340
319 3300046491 Ga0495584_0086032 Ga0495584_0086032_132_1172 340
320 3300046499 Ga0495594_0057062 Ga0495594_0057062_692_1732 340
321 3300046517 Ga0495630_0146463 Ga0495630_0146463_727_1776 340
322 3300046517 Ga0495630_0198539 Ga0495630_0198539_278_1318 340
323 3300046537 Ga0495598_0001163 Ga0495598_0001163_1831_2871 340
324 3300046537 Ga0495598_0021826 Ga0495598_0021826_500_1540 340
325 3300046683 Ga0495658_0030249 Ga0495658_0030249_49_1089 340
326 3300046810 Ga0495660_0132045 Ga0495660_0132045_26_1066 340
327 3300047321 Ga0495676_0053487 Ga0495676_0053487_1505_2545 340
328 3300048903 Ga0496100_0031123 Ga0496100_0031123_405_1445 340
329 3300048904 Ga0496101_0000604 Ga0496101_0000604_3228_4268 340
330 3300048905 Ga0496102_0005128 Ga0496102_0005128_5402_6442 340
331 3300048905 Ga0496102_0015419 Ga0496102_0015419_3399_4439 340
332 3300048906 Ga0496103_0005104 Ga0496103_0005104_5538_6578 340
333 3300048907 Ga0496104_0031476 Ga0496104_0031476_511_1551 340
334 3300048907 Ga0496104_0032114 Ga0496104_0032114_1200_2240 340
335 3300048908 Ga0496105_0004357 Ga0496105_0004357_4322_5362 340
336 3300048909 Ga0496106_0002626 Ga0496106_0002626_3684_4724 340
337 3300048910 Ga0496107_0000129 Ga0496107_0000129_31671_32711 340
338 3300048910 Ga0496107_0005132 Ga0496107_0005132_2555_3595 340
339 3300048911 Ga0496108_0000595 Ga0496108_0000595_1860_2900 340
340 3300048911 Ga0496108_0007392 Ga0496108_0007392_2519_3559 340
341 3300048912 Ga0496109_0015516 Ga0496109_0015516_2218_3258 340
342 3300048912 Ga0496109_0029346 Ga0496109_0029346_3781_4821 340
343 3300048912 Ga0496109_0570041 Ga0496109_0570041_16_1056 340
344 3300048913 Ga0496110_0000579 Ga0496110_0000579_4010_5050 340
345 3300048914 Ga0496111_0000122 Ga0496111_0000122_29997_31037 340
346 3300048914 Ga0496111_0000845 Ga0496111_0000845_11990_13030 340
347 3300048915 Ga0496112_0005655 Ga0496112_0005655_3922_4962 340
348 3300048915 Ga0496112_0045602 Ga0496112_0045602_3152_4192 340
349 3300048916 Ga0496113_0000068 Ga0496113_0000068_19193_20233 340
350 3300048916 Ga0496113_0002918 Ga0496113_0002918_4002_5042 340
351 3300048917 Ga0496114_0010925 Ga0496114_0010925_1945_2985 340
352 3300048918 Ga0496115_0049351 Ga0496115_0049351_1396_2436 340
353 3300050507 nmdc:mga05p37_4379_c1 nmdc:mga05p37_4379_c1_4012_5052 340
354 3300053077 Ga0495601_0117275 Ga0495601_0117275_174_1214 340
355 3300025933 Ga0207706_10005901 Ga0207706_100059018 341
356 iso_pu_bacteria 2643221547 2643756399 342
357 iso_pu_bacteria 2842694124 2842697653 342
358 iso_pu_bacteria 2891088606 2891089995 342
359 3300005983 Ga0081540_1029094 Ga0081540_10290943 343
360 3300006237 Ga0097621_100032849 Ga0097621_1000328495 343
361 3300006852 Ga0075433_10002775 Ga0075433_100027752 343
362 3300006871 Ga0075434_100023001 Ga0075434_1000230011 343
363 3300007788 Ga0099795_10006498 Ga0099795_100064984 343
364 3300035088 Ga0373940_0003532 Ga0373940_0003532_1753_2790 343
365 3300035695 Ga0373927_0008005 Ga0373927_0008005_559_1596 343
366 3300035695 Ga0373927_0106824 Ga0373927_0106824_146_1195 343
367 3300046531 Ga0495665_0099672 Ga0495665_0099672_111_1148 343
368 3300047315 Ga0495581_0099987 Ga0495581_0099987_195_1232 343
369 3300048913 Ga0496110_0279886 Ga0496110_0279886_240_1277 343
370 3300050512 nmdc:mga0n895_68953_c1 nmdc:mga0n895_68953_c1_152_1189 343
371 3300050515 nmdc:mga0a205_7888_c1 nmdc:mga0a205_7888_c1_2213_3250 343
372 3300031456 Ga0307513_10039588 Ga0307513_100395884 344
373 3300035116 Ga0373945_0030285 Ga0373945_0030285_183_1220 344
374 3300035171 Ga0373946_0031607 Ga0373946_0031607_1037_2074 344
375 3300036401 Ga0373937_0264222 Ga0373937_0264222_435_1472 344
376 3300037068 Ga0373925_0014171 Ga0373925_0014171_1133_2170 344
377 3300046460 Ga0495638_0182569 Ga0495638_0182569_135_1181 344
378 3300046476 Ga0495662_0081789 Ga0495662_0081789_463_1500 344
379 3300046533 Ga0495640_0111630 Ga0495640_0111630_704_1741 344
380 3300046642 Ga0495634_0101196 Ga0495634_0101196_198_1235 344
381 3300035170 Ga0373943_0000943 Ga0373943_0000943_504_1544 345
382 3300035171 Ga0373946_0001331 Ga0373946_0001331_706_1746 345
383 3300035692 Ga0373935_0002327 Ga0373935_0002327_3603_4643 345
384 3300035695 Ga0373927_0003463 Ga0373927_0003463_1263_2303 345
385 3300035725 Ga0373947_0000574 Ga0373947_0000574_14245_15285 345
386 3300037068 Ga0373925_0001647 Ga0373925_0001647_3687_4727 345
387 3300046459 Ga0495629_0105668 Ga0495629_0105668_192_1232 345
388 3300046460 Ga0495638_0002961 Ga0495638_0002961_1016_2095 345
389 3300046476 Ga0495662_0012231 Ga0495662_0012231_1549_2589 345
390 3300046517 Ga0495630_0003509 Ga0495630_0003509_8449_9489 345
391 3300046533 Ga0495640_0019507 Ga0495640_0019507_392_1432 345
392 3300046642 Ga0495634_0071521 Ga0495634_0071521_1217_2257 345
393 3300046663 Ga0495635_0082945 Ga0495635_0082945_756_1796 345
394 3300046683 Ga0495658_0016513 Ga0495658_0016513_951_1991 345
395 3300046690 Ga0495624_0009460 Ga0495624_0009460_1532_2572 345
396 3300047315 Ga0495581_0006750 Ga0495581_0006750_2273_3313 345
397 3300047321 Ga0495676_0006491 Ga0495676_0006491_727_1767 345
398 3300047471 Ga0495684_0004889 Ga0495684_0004889_3112_4152 345
399 3300047673 Ga0495593_0022923 Ga0495593_0022923_1305_2345 345
400 3300048903 Ga0496100_0029143 Ga0496100_0029143_2016_3071 345
401 3300048905 Ga0496102_0030697 Ga0496102_0030697_3187_4242 345
402 3300048907 Ga0496104_0002062 Ga0496104_0002062_2572_3627 345
403 3300048908 Ga0496105_0147348 Ga0496105_0147348_67_1122 345
404 3300048910 Ga0496107_0007357 Ga0496107_0007357_2466_3521 345
405 3300048911 Ga0496108_0037385 Ga0496108_0037385_1555_2610 345
406 3300048912 Ga0496109_0009902 Ga0496109_0009902_5082_6137 345
407 3300048913 Ga0496110_0011041 Ga0496110_0011041_3651_4706 345
408 3300048916 Ga0496113_0009362 Ga0496113_0009362_2292_3347 345
409 3300053085 Ga0495619_0053214 Ga0495619_0053214_312_1352 345
410 3300001430 JGI24032J14994_100456 JGI24032J14994_1004563 346
411 3300001915 JGI24741J21665_1009374 JGI24741J21665_10093742 346
412 3300001989 JGI24739J22299_10005177 JGI24739J22299_100051774 346
413 3300001990 JGI24737J22298_10007210 JGI24737J22298_100072102 346
414 3300001991 JGI24743J22301_10004958 JGI24743J22301_100049582 346
415 3300002070 JGI24750J21931_1000172 JGI24750J21931_10001724 346
416 3300002074 JGI24748J21848_1000609 JGI24748J21848_10006093 346
417 3300002075 JGI24738J21930_10000223 JGI24738J21930_1000022315 346
418 3300002076 JGI24749J21850_1001214 JGI24749J21850_10012142 346
419 3300002244 JGI24742J22300_10001901 JGI24742J22300_100019012 346
420 3300002459 JGI24751J29686_10002778 JGI24751J29686_100027784 346
421 3300005290 Ga0065712_10095195 Ga0065712_100951952 346
422 3300005293 Ga0065715_10091352 Ga0065715_100913523 346
423 3300005328 Ga0070676_10000012 Ga0070676_1000001242 346
424 3300005329 Ga0070683_100000139 Ga0070683_10000013923 346
425 3300005331 Ga0070670_100006855 Ga0070670_1000068555 346
426 3300005333 Ga0070677_10000125 Ga0070677_1000012515 346
427 3300005334 Ga0068869_100000605 Ga0068869_1000006053 346
428 3300005335 Ga0070666_10124051 Ga0070666_101240511 346
429 3300005336 Ga0070680_100000179 Ga0070680_10000017920 346
430 3300005337 Ga0070682_100000565 Ga0070682_10000056517 346
431 3300005338 Ga0068868_100001158 Ga0068868_1000011589 346
432 3300005339 Ga0070660_100001605 Ga0070660_10000160514 346
433 3300005340 Ga0070689_100000190 Ga0070689_10000019032 346
434 3300005341 Ga0070691_10000706 Ga0070691_100007063 346
435 3300005343 Ga0070687_100003795 Ga0070687_1000037953 346
436 3300005344 Ga0070661_100001455 Ga0070661_1000014554 346
437 3300005345 Ga0070692_10000434 Ga0070692_1000043412 346
438 3300005347 Ga0070668_100000597 Ga0070668_1000005973 346
439 3300005353 Ga0070669_100000409 Ga0070669_10000040914 346
440 3300005354 Ga0070675_100000166 Ga0070675_10000016642 346
441 3300005355 Ga0070671_100009212 Ga0070671_1000092122 346
442 3300005355 Ga0070671_100125673 Ga0070671_1001256732 346
443 3300005356 Ga0070674_100000084 Ga0070674_10000008441 346
444 3300005364 Ga0070673_100000041 Ga0070673_10000004123 346
445 3300005365 Ga0070688_100000180 Ga0070688_10000018026 346
446 3300005366 Ga0070659_100000752 Ga0070659_1000007525 346
447 3300005367 Ga0070667_100000365 Ga0070667_10000036513 346
448 3300005367 Ga0070667_100102800 Ga0070667_1001028003 346
449 3300005406 Ga0070703_10000903 Ga0070703_100009033 346
450 3300005434 Ga0070709_10133446 Ga0070709_101334462 346
451 3300005437 Ga0070710_10121752 Ga0070710_101217522 346
452 3300005438 Ga0070701_10000493 Ga0070701_100004934 346
453 3300005439 Ga0070711_100082736 Ga0070711_1000827361 346
454 3300005440 Ga0070705_100001328 Ga0070705_1000013283 346
455 3300005441 Ga0070700_100000467 Ga0070700_1000004676 346
456 3300005444 Ga0070694_100000065 Ga0070694_10000006538 346
457 3300005445 Ga0070708_100023359 Ga0070708_1000233594 346
458 3300005455 Ga0070663_100000473 Ga0070663_1000004734 346
459 3300005455 Ga0070663_100040620 Ga0070663_1000406202 346
460 3300005456 Ga0070678_100000091 Ga0070678_10000009114 346
461 3300005456 Ga0070678_100264345 Ga0070678_1002643452 346
462 3300005457 Ga0070662_100000629 Ga0070662_10000062915 346
463 3300005458 Ga0070681_10025730 Ga0070681_100257303 346
464 3300005458 Ga0070681_10068737 Ga0070681_100687374 346
465 3300005458 Ga0070681_10161798 Ga0070681_101617981 346
466 3300005459 Ga0068867_100001090 Ga0068867_1000010909 346
467 3300005466 Ga0070685_10002067 Ga0070685_100020672 346
468 3300005518 Ga0070699_100135624 Ga0070699_1001356241 346
469 3300005530 Ga0070679_100015891 Ga0070679_1000158913 346
470 3300005530 Ga0070679_100055203 Ga0070679_1000552033 346
471 3300005535 Ga0070684_100000219 Ga0070684_10000021914 346
472 3300005539 Ga0068853_100000600 Ga0068853_10000060011 346
473 3300005543 Ga0070672_100000019 Ga0070672_10000001923 346
474 3300005544 Ga0070686_100000318 Ga0070686_10000031820 346
475 3300005544 Ga0070686_100166544 Ga0070686_1001665442 346
476 3300005545 Ga0070695_100000474 Ga0070695_1000004746 346
477 3300005546 Ga0070696_100009125 Ga0070696_1000091252 346
478 3300005547 Ga0070693_100000036 Ga0070693_1000000364 346
479 3300005549 Ga0070704_100000252 Ga0070704_10000025210 346
480 3300005563 Ga0068855_100019218 Ga0068855_1000192185 346
481 3300005564 Ga0070664_100000819 Ga0070664_10000081921 346
482 3300005577 Ga0068857_100000768 Ga0068857_10000076815 346
483 3300005578 Ga0068854_100000179 Ga0068854_1000001795 346
484 3300005614 Ga0068856_100003866 Ga0068856_10000386611 346
485 3300005615 Ga0070702_100000071 Ga0070702_1000000712 346
486 3300005616 Ga0068852_100002121 Ga0068852_10000212110 346
487 3300005617 Ga0068859_100001870 Ga0068859_1000018709 346
488 3300005618 Ga0068864_100000429 Ga0068864_10000042923 346
489 3300005718 Ga0068866_10000461 Ga0068866_100004615 346
490 3300005719 Ga0068861_100000169 Ga0068861_10000016915 346
491 3300005840 Ga0068870_10000586 Ga0068870_1000058614 346
492 3300005841 Ga0068863_100000381 Ga0068863_10000038120 346
493 3300005842 Ga0068858_100030479 Ga0068858_1000304794 346
494 3300005842 Ga0068858_100272187 Ga0068858_1002721872 346
495 3300005843 Ga0068860_100001472 Ga0068860_10000147210 346
496 3300005843 Ga0068860_100108763 Ga0068860_1001087633 346
497 3300005843 Ga0068860_100207999 Ga0068860_1002079991 346
498 3300005844 Ga0068862_100001886 Ga0068862_10000188615 346
499 3300005937 Ga0081455_10000036 Ga0081455_10000036118 346
500 3300005937 Ga0081455_10011279 Ga0081455_100112795 346
501 3300005937 Ga0081455_10035188 Ga0081455_100351882 346
502 3300006038 Ga0075365_10074111 Ga0075365_100741111 346
503 3300006051 Ga0075364_10061544 Ga0075364_100615444 346
504 3300006237 Ga0097621_100001234 Ga0097621_10000123415 346
505 3300006358 Ga0068871_100000068 Ga0068871_10000006843 346
506 3300006844 Ga0075428_100122273 Ga0075428_1001222732 346
507 3300006844 Ga0075428_100231818 Ga0075428_1002318181 346
508 3300006847 Ga0075431_100197790 Ga0075431_1001977902 346
509 3300006881 Ga0068865_100000294 Ga0068865_1000002942 346
510 3300006914 Ga0075436_100022391 Ga0075436_1000223913 346
511 3300006931 Ga0097620_100001870 Ga0097620_1000018709 346
512 3300007076 Ga0075435_100063250 Ga0075435_1000632502 346
513 3300009093 Ga0105240_10023458 Ga0105240_100234587 346
514 3300009098 Ga0105245_10000780 Ga0105245_1000078023 346
515 3300009101 Ga0105247_10005194 Ga0105247_100051943 346
516 3300009101 Ga0105247_10038435 Ga0105247_100384353 346
517 3300009147 Ga0114129_10134226 Ga0114129_101342262 346
518 3300009148 Ga0105243_10001083 Ga0105243_1000108324 346
519 3300009174 Ga0105241_10000760 Ga0105241_1000076023 346
520 3300009176 Ga0105242_10006332 Ga0105242_100063325 346
521 3300009176 Ga0105242_10030536 Ga0105242_100305363 346
522 3300009176 Ga0105242_10229678 Ga0105242_102296782 346
523 3300009177 Ga0105248_10160902 Ga0105248_101609023 346
524 3300009177 Ga0105248_10197706 Ga0105248_101977062 346
525 3300009545 Ga0105237_10007890 Ga0105237_100078905 346
526 3300009545 Ga0105237_10064505 Ga0105237_100645053 346
527 3300009553 Ga0105249_10000755 Ga0105249_100007552 346
528 3300010375 Ga0105239_10002791 Ga0105239_1000279122 346
529 3300010375 Ga0105239_10507914 Ga0105239_105079142 346
530 3300011119 Ga0105246_10000061 Ga0105246_1000006135 346
531 3300013100 Ga0157373_10030638 Ga0157373_100306382 346
532 3300013102 Ga0157371_10015260 Ga0157371_100152603 346
533 3300013296 Ga0157374_10001691 Ga0157374_100016914 346
534 3300013296 Ga0157374_10306851 Ga0157374_103068512 346
535 3300013297 Ga0157378_10001445 Ga0157378_100014453 346
536 3300013306 Ga0163162_10000790 Ga0163162_100007904 346
537 3300013306 Ga0163162_10020256 Ga0163162_100202563 346
538 3300013307 Ga0157372_10016229 Ga0157372_100162296 346
539 3300013307 Ga0157372_10357216 Ga0157372_103572162 346
540 3300013308 Ga0157375_10000468 Ga0157375_1000046814 346
541 3300013308 Ga0157375_10138136 Ga0157375_101381363 346
542 3300014325 Ga0163163_10001508 Ga0163163_100015086 346
543 3300014326 Ga0157380_10007877 Ga0157380_100078772 346
544 3300014745 Ga0157377_10000276 Ga0157377_1000027624 346
545 3300014968 Ga0157379_10004514 Ga0157379_100045149 346
546 3300014968 Ga0157379_10026464 Ga0157379_100264644 346
547 3300014969 Ga0157376_10000692 Ga0157376_1000069213 346
548 3300017792 Ga0163161_10000384 Ga0163161_1000038423 346
549 3300020069 Ga0197907_10934374 Ga0197907_109343741 346
550 3300020070 Ga0206356_10856229 Ga0206356_108562292 346
551 3300020082 Ga0206353_10594769 Ga0206353_105947692 346
552 3300021388 Ga0213875_10000007 Ga0213875_10000007151 346
553 3300024225 Ga0224572_1010103 Ga0224572_10101032 346
554 3300025271 Ga0207666_1000097 Ga0207666_10000973 346
555 3300025290 Ga0207673_1000054 Ga0207673_10000544 346
556 3300025315 Ga0207697_10000550 Ga0207697_100005503 346
557 3300025885 Ga0207653_10008172 Ga0207653_100081723 346
558 3300025893 Ga0207682_10000088 Ga0207682_1000008824 346
559 3300025898 Ga0207692_10060130 Ga0207692_100601302 346
560 3300025899 Ga0207642_10000926 Ga0207642_100009264 346
561 3300025901 Ga0207688_10001203 Ga0207688_1000120314 346
562 3300025904 Ga0207647_10002714 Ga0207647_1000271414 346
563 3300025906 Ga0207699_10026117 Ga0207699_100261174 346
564 3300025906 Ga0207699_10283479 Ga0207699_102834791 346
565 3300025907 Ga0207645_10000140 Ga0207645_1000014014 346
566 3300025908 Ga0207643_10000083 Ga0207643_1000008314 346
567 3300025910 Ga0207684_10025559 Ga0207684_100255594 346
568 3300025911 Ga0207654_10005138 Ga0207654_100051385 346
569 3300025911 Ga0207654_10053666 Ga0207654_100536663 346
570 3300025912 Ga0207707_10004967 Ga0207707_100049675 346
571 3300025912 Ga0207707_10013826 Ga0207707_100138264 346
572 3300025912 Ga0207707_10056844 Ga0207707_100568442 346
573 3300025913 Ga0207695_10131832 Ga0207695_101318323 346
574 3300025913 Ga0207695_10310300 Ga0207695_103103002 346
575 3300025915 Ga0207693_10062777 Ga0207693_100627772 346
576 3300025916 Ga0207663_10228813 Ga0207663_102288133 346
577 3300025917 Ga0207660_10000073 Ga0207660_1000007310 346
578 3300025917 Ga0207660_10059995 Ga0207660_100599953 346
579 3300025917 Ga0207660_10116369 Ga0207660_101163692 346
580 3300025918 Ga0207662_10000964 Ga0207662_100009643 346
581 3300025919 Ga0207657_10005395 Ga0207657_100053953 346
582 3300025919 Ga0207657_10036881 Ga0207657_100368814 346
583 3300025919 Ga0207657_10169967 Ga0207657_101699673 346
584 3300025920 Ga0207649_10000450 Ga0207649_100004509 346
585 3300025921 Ga0207652_10007770 Ga0207652_100077705 346
586 3300025921 Ga0207652_10025311 Ga0207652_100253115 346
587 3300025921 Ga0207652_10038151 Ga0207652_100381514 346
588 3300025923 Ga0207681_10000097 Ga0207681_1000009742 346
589 3300025926 Ga0207659_10000092 Ga0207659_1000009236 346
590 3300025927 Ga0207687_10000129 Ga0207687_100001296 346
591 3300025928 Ga0207700_10023166 Ga0207700_100231665 346
592 3300025928 Ga0207700_10025742 Ga0207700_100257424 346
593 3300025931 Ga0207644_10021324 Ga0207644_100213242 346
594 3300025931 Ga0207644_10054061 Ga0207644_100540612 346
595 3300025932 Ga0207690_10002606 Ga0207690_100026065 346
596 3300025932 Ga0207690_10119775 Ga0207690_101197752 346
597 3300025933 Ga0207706_10004310 Ga0207706_1000431014 346
598 3300025933 Ga0207706_10073834 Ga0207706_100738344 346
599 3300025934 Ga0207686_10000796 Ga0207686_1000079615 346
600 3300025935 Ga0207709_10000362 Ga0207709_1000036220 346
601 3300025936 Ga0207670_10004868 Ga0207670_100048685 346
602 3300025937 Ga0207669_10000350 Ga0207669_100003502 346
603 3300025937 Ga0207669_10081479 Ga0207669_100814792 346
604 3300025938 Ga0207704_10000757 Ga0207704_100007572 346
605 3300025939 Ga0207665_10047129 Ga0207665_100471294 346
606 3300025940 Ga0207691_10000283 Ga0207691_1000028336 346
607 3300025941 Ga0207711_10269776 Ga0207711_102697762 346
608 3300025942 Ga0207689_10000085 Ga0207689_1000008573 346
609 3300025942 Ga0207689_10293660 Ga0207689_102936602 346
610 3300025944 Ga0207661_10000464 Ga0207661_1000046424 346
611 3300025945 Ga0207679_10000030 Ga0207679_10000030143 346
612 3300025945 Ga0207679_10061285 Ga0207679_100612854 346
613 3300025949 Ga0207667_10018715 Ga0207667_100187155 346
614 3300025949 Ga0207667_10041317 Ga0207667_100413174 346
615 3300025960 Ga0207651_10000088 Ga0207651_100000885 346
616 3300025960 Ga0207651_10035283 Ga0207651_100352833 346
617 3300025961 Ga0207712_10096114 Ga0207712_100961143 346
618 3300025972 Ga0207668_10000114 Ga0207668_1000011436 346
619 3300025981 Ga0207640_10000616 Ga0207640_1000061616 346
620 3300025986 Ga0207658_10002853 Ga0207658_100028534 346
621 3300026023 Ga0207677_10001731 Ga0207677_100017319 346
622 3300026035 Ga0207703_10000983 Ga0207703_1000098317 346
623 3300026041 Ga0207639_10000305 Ga0207639_100003059 346
624 3300026067 Ga0207678_10000125 Ga0207678_1000012543 346
625 3300026075 Ga0207708_10000187 Ga0207708_100001873 346
626 3300026078 Ga0207702_10008418 Ga0207702_100084187 346
627 3300026088 Ga0207641_10002129 Ga0207641_1000212910 346
628 3300026089 Ga0207648_10002168 Ga0207648_1000216824 346
629 3300026095 Ga0207676_10000074 Ga0207676_1000007423 346
630 3300026116 Ga0207674_10002501 Ga0207674_100025013 346
631 3300026118 Ga0207675_100004556 Ga0207675_1000045563 346
632 3300026121 Ga0207683_10000014 Ga0207683_1000001437 346
633 3300027378 Ga0209981_1009723 Ga0209981_10097231 346
634 3300027617 Ga0210002_1000767 Ga0210002_10007674 346
635 3300027717 Ga0209998_10003457 Ga0209998_100034572 346
636 3300027907 Ga0207428_10000467 Ga0207428_1000046725 346
637 3300027907 Ga0207428_10175555 Ga0207428_101755551 346
638 3300028380 Ga0268265_10001371 Ga0268265_1000137111 346
639 3300028381 Ga0268264_10000469 Ga0268264_1000046922 346
640 3300031241 Ga0265325_10000423 Ga0265325_1000042317 346
641 3300031241 Ga0265325_10046647 Ga0265325_100466472 346
642 3300031247 Ga0265340_10127742 Ga0265340_101277421 346
643 3300031595 Ga0265313_10012760 Ga0265313_100127603 346
644 3300031711 Ga0265314_10061077 Ga0265314_100610771 346
645 3300031712 Ga0265342_10004840 Ga0265342_100048406 346
646 3300035090 Ga0373949_0005195 Ga0373949_0005195_779_1825 346
647 3300035111 Ga0373923_0006009 Ga0373923_0006009_2062_3114 346
648 3300035112 Ga0373932_0004024 Ga0373932_0004024_1260_2306 346
649 3300035118 Ga0373954_0002030 Ga0373954_0002030_5477_6523 346
650 3300035118 Ga0373954_0006107 Ga0373954_0006107_2797_3849 346
651 3300035118 Ga0373954_0034900 Ga0373954_0034900_443_1483 346
652 3300035119 Ga0373956_0001485 Ga0373956_0001485_942_1988 346
653 3300035119 Ga0373956_0004320 Ga0373956_0004320_3407_4447 346
654 3300035120 Ga0373957_0007742 Ga0373957_0007742_214_1266 346
655 3300035120 Ga0373957_0064588 Ga0373957_0064588_266_1312 346
656 3300035121 Ga0373960_0000611 Ga0373960_0000611_318_1364 346
657 3300035172 Ga0373955_0010198 Ga0373955_0010198_3085_4137 346
658 3300035172 Ga0373955_0024586 Ga0373955_0024586_192_1232 346
659 3300035410 Ga0373924_0016450 Ga0373924_0016450_836_1882 346
660 3300035691 Ga0373931_0000169 Ga0373931_0000169_8957_10003 346
661 3300035695 Ga0373927_0032604 Ga0373927_0032604_1395_2447 346
662 3300035724 Ga0373933_0001124 Ga0373933_0001124_7529_8575 346
663 3300035724 Ga0373933_0002510 Ga0373933_0002510_7978_9030 346
664 3300035724 Ga0373933_0011724 Ga0373933_0011724_2982_4022 346
665 3300036401 Ga0373937_0001052 Ga0373937_0001052_8164_9216 346
666 3300036401 Ga0373937_0004918 Ga0373937_0004918_7148_8194 346
667 3300036401 Ga0373937_0075219 Ga0373937_0075219_1445_2485 346
668 3300037068 Ga0373925_0021901 Ga0373925_0021901_802_1842 346
669 3300037068 Ga0373925_0028494 Ga0373925_0028494_1598_2650 346
670 3300037068 Ga0373925_0212415 Ga0373925_0212415_368_1447 346
671 3300037418 Ga0395900_0359703 Ga0395900_0359703_73_1116 346
672 3300037466 Ga0395898_0126688 Ga0395898_0126688_460_1518 346
673 3300037466 Ga0395898_0200115 Ga0395898_0200115_311_1354 346
674 3300037853 Ga0436364_0309649 Ga0436364_0309649_7601_8644 346
675 3300038443 Ga0395901_0098693 Ga0395901_0098693_1015_2073 346
676 3300038443 Ga0395901_0177698 Ga0395901_0177698_991_2034 346
677 3300039447 Ga0436361_1176104 Ga0436361_1176104_644_1687 346
678 3300041408 Ga0439453_0003508 Ga0439453_0003508_1038_2120 346
679 3300042439 Ga0439464_0004335 Ga0439464_0004335_715_1755 346
680 3300044684 Ga0466966_0114059 Ga0466966_0114059_416_1459 346
681 3300044719 Ga0466971_0047546 Ga0466971_0047546_289_1329 346
682 3300045051 Ga0451576_0034716 Ga0451576_0034716_1548_2588 346
683 3300046454 Ga0495592_0003638 Ga0495592_0003638_570_1622 346
684 3300046454 Ga0495592_0020065 Ga0495592_0020065_296_1342 346
685 3300046454 Ga0495592_0024541 Ga0495592_0024541_3403_4443 346
686 3300046459 Ga0495629_0087940 Ga0495629_0087940_272_1351 346
687 3300046462 Ga0495651_0000606 Ga0495651_0000606_9182_10234 346
688 3300046462 Ga0495651_0009868 Ga0495651_0009868_4814_5860 346
689 3300046463 Ga0495653_0002673 Ga0495653_0002673_5310_6362 346
690 3300046463 Ga0495653_0008326 Ga0495653_0008326_310_1356 346
691 3300046476 Ga0495662_0033933 Ga0495662_0033933_1141_2193 346
692 3300046477 Ga0495664_0003537 Ga0495664_0003537_431_1477 346
693 3300046477 Ga0495664_0016826 Ga0495664_0016826_1792_2871 346
694 3300046477 Ga0495664_0060982 Ga0495664_0060982_1036_2088 346
695 3300046511 Ga0495608_0000591 Ga0495608_0000591_17359_18411 346
696 3300046511 Ga0495608_0001474 Ga0495608_0001474_7663_8709 346
697 3300046511 Ga0495608_0179617 Ga0495608_0179617_30_1070 346
698 3300046514 Ga0495618_0001466 Ga0495618_0001466_11181_12233 346
699 3300046514 Ga0495618_0027234 Ga0495618_0027234_339_1385 346
700 3300046516 Ga0495628_0001927 Ga0495628_0001927_14462_15502 346
701 3300046516 Ga0495628_0044982 Ga0495628_0044982_1837_2883 346
702 3300046529 Ga0495652_0003497 Ga0495652_0003497_5747_6799 346
703 3300046529 Ga0495652_0015699 Ga0495652_0015699_577_1617 346
704 3300046529 Ga0495652_0039947 Ga0495652_0039947_1127_2173 346
705 3300046529 Ga0495652_0246691 Ga0495652_0246691_61_1140 346
706 3300046533 Ga0495640_0002454 Ga0495640_0002454_4179_5231 346
707 3300046533 Ga0495640_0012195 Ga0495640_0012195_5366_6412 346
708 3300046533 Ga0495640_0062664 Ga0495640_0062664_409_1488 346
709 3300046533 Ga0495640_0219704 Ga0495640_0219704_38_1078 346
710 3300046536 Ga0495587_0002240 Ga0495587_0002240_2715_3761 346
711 3300046543 Ga0495645_0002539 Ga0495645_0002539_2343_3389 346
712 3300046543 Ga0495645_0013129 Ga0495645_0013129_1307_2359 346
713 3300046543 Ga0495645_0023203 Ga0495645_0023203_2663_3703 346
714 3300046559 Ga0495667_0001150 Ga0495667_0001150_10078_11124 346
715 3300046642 Ga0495634_0003468 Ga0495634_0003468_2130_3182 346
716 3300046663 Ga0495635_0003881 Ga0495635_0003881_8216_9262 346
717 3300046663 Ga0495635_0008488 Ga0495635_0008488_4343_5395 346
718 3300046663 Ga0495635_0065489 Ga0495635_0065489_1400_2440 346
719 3300046675 Ga0495657_0003270 Ga0495657_0003270_3468_4520 346
720 3300046675 Ga0495657_0014478 Ga0495657_0014478_1601_2647 346
721 3300046678 Ga0495599_0000564 Ga0495599_0000564_5170_6222 346
722 3300046678 Ga0495599_0009859 Ga0495599_0009859_3902_4942 346
723 3300046678 Ga0495599_0043601 Ga0495599_0043601_296_1342 346
724 3300046679 Ga0495623_0000420 Ga0495623_0000420_19942_20988 346
725 3300046679 Ga0495623_0124704 Ga0495623_0124704_132_1172 346
726 3300046680 Ga0495646_0003113 Ga0495646_0003113_3740_4786 346
727 3300046689 Ga0495613_0126784 Ga0495613_0126784_493_1545 346
728 3300046690 Ga0495624_0191906 Ga0495624_0191906_130_1170 346
729 3300046809 Ga0495600_0001326 Ga0495600_0001326_8153_9193 346
730 3300046809 Ga0495600_0019703 Ga0495600_0019703_68_1114 346
731 3300046809 Ga0495600_0062772 Ga0495600_0062772_1195_2247 346
732 3300047317 Ga0495604_0002131 Ga0495604_0002131_14158_15210 346
733 3300047317 Ga0495604_0003891 Ga0495604_0003891_1093_2139 346
734 3300047317 Ga0495604_0020818 Ga0495604_0020818_4036_5076 346
735 3300047319 Ga0495674_0009434 Ga0495674_0009434_5167_6219 346
736 3300047319 Ga0495674_0047567 Ga0495674_0047567_201_1280 346
737 3300047319 Ga0495674_0072707 Ga0495674_0072707_636_1682 346
738 3300047320 Ga0495672_0039766 Ga0495672_0039766_940_1980 346
739 3300047322 Ga0495680_0001686 Ga0495680_0001686_8063_9115 346
740 3300047322 Ga0495680_0021430 Ga0495680_0021430_3127_4173 346
741 3300047444 Ga0495675_0001544 Ga0495675_0001544_3255_4301 346
742 3300047444 Ga0495675_0002669 Ga0495675_0002669_4276_5328 346
743 3300047444 Ga0495675_0036104 Ga0495675_0036104_255_1295 346
744 3300047471 Ga0495684_0003625 Ga0495684_0003625_4450_5502 346
745 3300047673 Ga0495593_0046746 Ga0495593_0046746_775_1821 346
746 3300048088 Ga0495602_0005526 Ga0495602_0005526_3350_4396 346
747 3300048088 Ga0495602_0018930 Ga0495602_0018930_5703_6755 346
748 3300048088 Ga0495602_0024466 Ga0495602_0024466_3535_4575 346
749 3300048089 Ga0495614_0055075 Ga0495614_0055075_219_1298 346
750 3300048903 Ga0496100_0000106 Ga0496100_0000106_44835_45881 346
751 3300048903 Ga0496100_0075751 Ga0496100_0075751_387_1433 346
752 3300048903 Ga0496100_0106338 Ga0496100_0106338_779_1822 346
753 3300048904 Ga0496101_0000136 Ga0496101_0000136_63776_64822 346
754 3300048905 Ga0496102_0029938 Ga0496102_0029938_343_1389 346
755 3300048905 Ga0496102_0041646 Ga0496102_0041646_715_1794 346
756 3300048905 Ga0496102_0459782 Ga0496102_0459782_71_1123 346
757 3300048906 Ga0496103_0029900 Ga0496103_0029900_1778_2824 346
758 3300048906 Ga0496103_0033703 Ga0496103_0033703_1385_2431 346
759 3300048907 Ga0496104_0000090 Ga0496104_0000090_68086_69126 346
760 3300048907 Ga0496104_0000506 Ga0496104_0000506_21932_22975 346
761 3300048907 Ga0496104_0007428 Ga0496104_0007428_4609_5652 346
762 3300048907 Ga0496104_0035256 Ga0496104_0035256_3044_4090 346
763 3300048907 Ga0496104_0082159 Ga0496104_0082159_1858_2904 346
764 3300048908 Ga0496105_0013985 Ga0496105_0013985_151_1194 346
765 3300048908 Ga0496105_0018996 Ga0496105_0018996_1228_2274 346
766 3300048908 Ga0496105_0069997 Ga0496105_0069997_339_1379 346
767 3300048909 Ga0496106_0002270 Ga0496106_0002270_12594_13640 346
768 3300048910 Ga0496107_0007909 Ga0496107_0007909_699_1745 346
769 3300048911 Ga0496108_0003914 Ga0496108_0003914_10819_11865 346
770 3300048911 Ga0496108_0279657 Ga0496108_0279657_374_1417 346
771 3300048912 Ga0496109_0002975 Ga0496109_0002975_12421_13467 346
772 3300048912 Ga0496109_0092710 Ga0496109_0092710_587_1630 346
773 3300048913 Ga0496110_0048224 Ga0496110_0048224_1113_2156 346
774 3300048914 Ga0496111_0032359 Ga0496111_0032359_1299_2342 346
775 3300048914 Ga0496111_0035537 Ga0496111_0035537_411_1457 346
776 3300048915 Ga0496112_0110192 Ga0496112_0110192_406_1452 346
777 3300048915 Ga0496112_0509706 Ga0496112_0509706_75_1121 346
778 3300048916 Ga0496113_0044770 Ga0496113_0044770_1928_2974 346
779 3300048917 Ga0496114_0035030 Ga0496114_0035030_1834_2880 346
780 3300048917 Ga0496114_0095817 Ga0496114_0095817_1418_2464 346
781 3300048918 Ga0496115_0001121 Ga0496115_0001121_3957_5003 346
782 3300048918 Ga0496115_0010308 Ga0496115_0010308_2883_3923 346
783 3300048918 Ga0496115_0027950 Ga0496115_0027950_815_1858 346
784 3300048918 Ga0496115_0053290 Ga0496115_0053290_1392_2471 346
785 3300048918 Ga0496115_0081992 Ga0496115_0081992_1178_2224 346
786 3300049575 Ga0501039_0175034 Ga0501039_0175034_256_1296 346
787 3300049581 Ga0501047_0009616 Ga0501047_0009616_385_1425 346
788 3300049581 Ga0501047_0199646 Ga0501047_0199646_677_1717 346
789 3300049582 Ga0501048_0150758 Ga0501048_0150758_578_1618 346
790 3300049822 Ga0501035_0297722 Ga0501035_0297722_136_1176 346
791 3300050491 nmdc:mga00v17_81243_c1 nmdc:mga00v17_81243_c1_31_1107 346
792 3300050507 nmdc:mga05p37_231454_c1 nmdc:mga05p37_231454_c1_987_2030 346
793 3300050510 nmdc:mga06r32_186730_c1 nmdc:mga06r32_186730_c1_295_1335 346
794 3300050511 nmdc:mga08y16_359919_c1 nmdc:mga08y16_359919_c1_158_1204 346
795 3300050514 nmdc:mga08x19_4942_c1 nmdc:mga08x19_4942_c1_1512_2552 346
796 3300050515 nmdc:mga0a205_380_c1 nmdc:mga0a205_380_c1_6362_7408 346
797 3300053077 Ga0495601_0000360 Ga0495601_0000360_8546_9586 346
798 3300053077 Ga0495601_0001260 Ga0495601_0001260_8152_9198 346
799 3300053077 Ga0495601_0016653 Ga0495601_0016653_30_1109 346
800 3300053078 Ga0495612_0000964 Ga0495612_0000964_7971_9017 346
801 3300053078 Ga0495612_0001388 Ga0495612_0001388_7794_8846 346
802 3300053078 Ga0495612_0001978 Ga0495612_0001978_2878_3918 346
803 3300053084 Ga0495595_0000969 Ga0495595_0000969_3452_4492 346
804 3300053084 Ga0495595_0009321 Ga0495595_0009321_484_1530 346
805 3300053085 Ga0495619_0000581 Ga0495619_0000581_2698_3738 346
806 3300053085 Ga0495619_0001851 Ga0495619_0001851_3943_5022 346
807 3300053085 Ga0495619_0002169 Ga0495619_0002169_2048_3100 346
808 3300053085 Ga0495619_0024789 Ga0495619_0024789_460_1506 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

24

256

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkh-assembly1.cif.gz_A crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii 0.9064 23 339
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.8967 23 286
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.8951 27 291
6cj3-assembly1.cif.gz_A crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium and pyruvate 0.8795 26 287
1z6k-assembly1.cif.gz_A citrate lyase beta subunit complexed with oxaloacetate and magnesium from m. tuberculosis 0.8769 26 286
ID Description Score Start End Superfamily
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8967 23 286 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8874 28 291 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8717 24 332 3.20.20.60
1z6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8684 26 286 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8675 23 286 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A529JPZ5-F1-model_v4 CoA ester lyase 0.9792 87 174 GO:0000287
GO:0006107
GO:0016829
AF-A0A529KY44-F1-model_v4 CoA ester lyase 0.9725 58 177 GO:0000287
GO:0006107
GO:0016829
AF-A0A7J4V9E9-F1-model_v4 CoA ester lyase 0.9642 52 156 GO:0000287
GO:0006107
GO:0016829
AF-A0A354CBR2-F1-model_v4 deleted 0.9575 257 346
AF-A0A537QEJ3-F1-model_v4 CoA ester lyase 0.9511 24 180 GO:0000287
GO:0006107
GO:0016829

Feature Viewer

pLDDT pTM Quality
74.61 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map