F481702

General Info

Members Datasets Scaffolds Average Seq Length
808 425 747 127

Family's Representative Sequence

Representative Sequence 3300003162|Ga0006778J45830_1084963|Ga0006778J45830_10849632
Length 138
Sequence MSIQNDIRTSQNDLRSISTLLGDALSQFAKLFQNEVDLAKAELGEKVQKLGGALGLIAGGAILLIPAVVMALFALSATLIESGWSQPVSYLTAAIAAGVIAGVLFAIGINRLGARNLAPHETIRQLEKDKDTMKGLVR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
7 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
8 2791355199
9 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
10 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
11 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
12 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
13 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
14 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
15 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
16 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
17 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
18 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
19 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
20 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
21 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
22 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
23 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
24 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
25 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
26 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
27 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
28 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
29 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
30 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
31 2904699407
32 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
33 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
34 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
35 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
36 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
37 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
38 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
39 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
40 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
41 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
42 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
43 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
44 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
45 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
46 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
47 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
48 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
49 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
50 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
51 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
52 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
53 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
54 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
57 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
88 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
91 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
160 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
178 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
184 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
185 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
260 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
261 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
264 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
282 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
283 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
284 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
372 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
415 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
416 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
417 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
418 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
419 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
420 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
421 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
422 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
423 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
424 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
425 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.2
Metatranscriptomes 5.59
Isolates 7.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 5.57
Rhizoplane 7.67
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10115572 3300001991 Bacteria 585
2 Ga0006778J45830_1084963 3300003162 Bacteria 822
3 Ga0006777J48905_1054578 3300003308 Bacteria 1515
4 Ga0007410J51695_1064914 3300003574 Bacteria 1404
5 Ga0007416J51690_1044015 3300003577 Bacteria 1616
6 Ga0007429J51699_1071289 3300003579 Bacteria 1516
7 Ga0007429J51699_1154310 3300003579 Bacteria 562
8 JGI25404J52841_10064688 3300003659 Bacteria 765
9 Ga0006780_1023625 3300003735 Bacteria 1377
10 Ga0058862_11790466 3300004803 Bacteria 628
11 Ga0065704_10530148 3300005289 Bacteria 648
12 Ga0065707_10208440 3300005295 Bacteria 1277
13 Ga0070658_10126933 3300005327 Bacteria 2124
14 Ga0070658_10771235 3300005327 Bacteria 835
15 Ga0070676_10071887 3300005328 Bacteria 2079
16 Ga0070676_10382664 3300005328 Bacteria 975
17 Ga0070676_10495128 3300005328 Bacteria 867
18 Ga0070683_100007169 3300005329 Bacteria 9402
19 Ga0070683_100094392 3300005329 Bacteria 2811
20 Ga0070683_100416434 3300005329 Bacteria 1282
21 Ga0070690_100183123 3300005330 Bacteria 1448
22 Ga0070670_100286418 3300005331 Bacteria 1439
23 Ga0070677_10459481 3300005333 Bacteria 683
24 Ga0070677_10537169 3300005333 Bacteria 639
25 Ga0070677_10592441 3300005333 Bacteria 613
26 Ga0068869_100047794 3300005334 Bacteria 3091
27 Ga0068869_100098155 3300005334 Bacteria 2212
28 Ga0068869_100981260 3300005334 Bacteria 735
29 Ga0070666_10770488 3300005335 Bacteria 708
30 Ga0070680_100049518 3300005336 Plasmid 3426
31 Ga0070680_100133457 3300005336 Bacteria 2078
32 Ga0070682_100369915 3300005337 Bacteria 1075
33 Ga0070682_100579346 3300005337 Bacteria 883
34 Ga0068868_100599466 3300005338 Bacteria 976
35 Ga0068868_100704536 3300005338 Bacteria 904
36 Ga0068868_101315879 3300005338 Bacteria 672
37 Ga0070660_100734171 3300005339 Bacteria 829
38 Ga0070689_101395618 3300005340 Bacteria 633
39 Ga0070691_10053511 3300005341 Unclassified 1931
40 Ga0070661_100102861 3300005344 Unclassified 2127
41 Ga0070661_100172589 3300005344 Bacteria 1642
42 Ga0070668_100014877 3300005347 Bacteria 5816
43 Ga0070668_100060891 3300005347 Bacteria 2924
44 Ga0070668_100063506 3300005347 Bacteria 2862
45 Ga0070668_100101567 3300005347 Bacteria 2279
46 Ga0070668_100124416 3300005347 Bacteria 2065
47 Ga0070668_100248878 3300005347 Bacteria 1475
48 Ga0070669_100052622 3300005353 Bacteria 2979
49 Ga0070669_100067171 3300005353 Bacteria 2644
50 Ga0070669_100149651 3300005353 Bacteria 1806
51 Ga0070675_100190447 3300005354 Bacteria 1777
52 Ga0070675_100337356 3300005354 Bacteria 1335
53 Ga0070671_100221363 3300005355 Bacteria 1605
54 Ga0070674_100158638 3300005356 Bacteria 1714
55 Ga0070674_100222479 3300005356 Bacteria 1469
56 Ga0070674_100504987 3300005356 Bacteria 1008
57 Ga0070674_100580414 3300005356 Bacteria 944
58 Ga0070674_101657352 3300005356 Bacteria 578
59 Ga0070673_101192602 3300005364 Bacteria 713
60 Ga0070688_100285441 3300005365 Unclassified 1188
61 Ga0070659_100165221 3300005366 Bacteria 1811
62 Ga0070659_100289221 3300005366 Bacteria 1365
63 Ga0070659_100510271 3300005366 Bacteria 1026
64 Ga0070659_100808405 3300005366 Bacteria 816
65 Ga0070667_101465595 3300005367 Bacteria 641
66 Ga0070709_10982653 3300005434 Bacteria 671
67 Ga0070714_101213080 3300005435 Bacteria 736
68 Ga0070713_101313351 3300005436 Bacteria 701
69 Ga0070710_10381949 3300005437 Bacteria 940
70 Ga0070701_10069565 3300005438 Bacteria 1878
71 Ga0070701_10264400 3300005438 Bacteria 1044
72 Ga0070711_100142859 3300005439 Bacteria 1796
73 Ga0070711_101958290 3300005439 Bacteria 515
74 Ga0070705_100253471 3300005440 Bacteria 1237
75 Ga0070705_100275687 3300005440 Bacteria 1193
76 Ga0070700_100140108 3300005441 Bacteria 1643
77 Ga0070663_100113294 3300005455 Bacteria 2041
78 Ga0070663_101472487 3300005455 Bacteria 605
79 Ga0070678_100051415 3300005456 Bacteria 2987
80 Ga0070678_100244971 3300005456 Bacteria 1500
81 Ga0070662_100064271 3300005457 Bacteria 2687
82 Ga0070662_100077064 3300005457 Bacteria 2473
83 Ga0070662_100170400 3300005457 Bacteria 1709
84 Ga0070662_101216752 3300005457 Bacteria 648
85 Ga0070681_10013969 3300005458 Bacteria 7990
86 Ga0070681_10041816 3300005458 Bacteria 4594
87 Ga0070681_10095644 3300005458 Bacteria 2919
88 Ga0068867_100162436 3300005459 Bacteria 1762
89 Ga0068867_101060732 3300005459 Bacteria 738
90 Ga0070685_10252617 3300005466 Bacteria 1168
91 Ga0070685_11197068 3300005466 Unclassified 577
92 Ga0070679_100024443 3300005530 Bacteria 5919
93 Ga0070679_100065969 3300005530 Bacteria 3608
94 Ga0070679_100102625 3300005530 Plasmid 2846
95 Ga0070679_101096045 3300005530 Bacteria 741
96 Ga0070684_100002306 3300005535 Bacteria 14068
97 Ga0070684_100017991 3300005535 Bacteria 5810
98 Ga0070684_100084644 3300005535 Bacteria 2811
99 Ga0068853_100152615 3300005539 Bacteria 2080
100 Ga0068853_100170689 3300005539 Bacteria 1968
101 Ga0068853_100189483 3300005539 Bacteria 1868
102 Ga0068853_100501426 3300005539 Bacteria 1146
103 Ga0070672_100115623 3300005543 Bacteria 2191
104 Ga0070686_100060319 3300005544 Bacteria 2448
105 Ga0070686_100385788 3300005544 Bacteria 1062
106 Ga0070686_100922270 3300005544 Bacteria 712
107 Ga0070695_100068752 3300005545 Bacteria 2314
108 Ga0070696_101745263 3300005546 Bacteria 537
109 Ga0070693_100056201 3300005547 Bacteria 2270
110 Ga0070693_100070890 3300005547 Bacteria 2052
111 Ga0070665_100060837 3300005548 Bacteria 3786
112 Ga0070665_100177709 3300005548 Bacteria 2129
113 Ga0070665_100396663 3300005548 Bacteria 1387
114 Ga0070704_100876115 3300005549 Bacteria 806
115 Ga0070704_100948833 3300005549 Bacteria 776
116 Ga0068855_100068129 3300005563 Bacteria 4144
117 Ga0068855_100908361 3300005563 Bacteria 930
118 Ga0070664_100184609 3300005564 Bacteria 1855
119 Ga0068857_100346055 3300005577 Unclassified 1376
120 Ga0068857_100347177 3300005577 Bacteria 1374
121 Ga0068857_101723755 3300005577 Bacteria 613
122 Ga0068854_100024693 3300005578 Bacteria 4118
123 Ga0068854_100050437 3300005578 Bacteria 2978
124 Ga0068856_100986719 3300005614 Bacteria 861
125 Ga0070702_100212412 3300005615 Bacteria 1289
126 Ga0070702_100213092 3300005615 Bacteria 1287
127 Ga0068852_100109971 3300005616 Bacteria 2503
128 Ga0068852_100374412 3300005616 Bacteria 1396
129 Ga0068859_101034646 3300005617 Unclassified 902
130 Ga0068859_101767041 3300005617 Bacteria 683
131 Ga0068859_102927657 3300005617 Bacteria 522
132 Ga0068866_10063758 3300005718 Bacteria 1922
133 Ga0068866_10210981 3300005718 Bacteria 1166
134 Ga0068866_10366755 3300005718 Bacteria 920
135 Ga0068866_10885304 3300005718 Bacteria 627
136 Ga0068861_100011944 3300005719 Bacteria 6049
137 Ga0068861_100021157 3300005719 Bacteria 4674
138 Ga0068861_100103055 3300005719 Bacteria 2273
139 Ga0068861_100557694 3300005719 Unclassified 1045
140 Ga0068861_102330771 3300005719 Bacteria 537
141 Ga0068870_10046886 3300005840 Bacteria 2269
142 Ga0068870_10279628 3300005840 Bacteria 1046
143 Ga0068863_100276427 3300005841 Bacteria 1626
144 Ga0068863_100988446 3300005841 Bacteria 844
145 Ga0068858_100038892 3300005842 Bacteria 4412
146 Ga0068858_100338654 3300005842 Bacteria 1439
147 Ga0068858_100525503 3300005842 Bacteria 1144
148 Ga0068860_100053479 3300005843 Bacteria 3839
149 Ga0068860_100344514 3300005843 Bacteria 1466
150 Ga0068860_100519422 3300005843 Bacteria 1191
151 Ga0068862_100014309 3300005844 Bacteria 6581
152 Ga0068862_100132437 3300005844 Bacteria 2206
153 Ga0068862_100212162 3300005844 Bacteria 1750
154 Ga0068862_100402692 3300005844 Bacteria 1280
155 Ga0068862_100843693 3300005844 Bacteria 897
156 Ga0081538_10008705 3300005981 Bacteria 8568
157 Ga0081540_1005428 3300005983 Bacteria 9514
158 Ga0081540_1018111 3300005983 Bacteria 4334
159 Ga0081540_1072003 3300005983 Bacteria 1594
160 Ga0075365_10038504 3300006038 Bacteria 3108
161 Ga0075365_10096387 3300006038 Bacteria 2021
162 Ga0075365_10103731 3300006038 Bacteria 1949
163 Ga0075368_10047483 3300006042 Bacteria 1699
164 Ga0075368_10078281 3300006042 Bacteria 1343
165 Ga0075363_100078217 3300006048 Bacteria 1806
166 Ga0075364_10294320 3300006051 Bacteria 1105
167 Ga0075364_10343261 3300006051 Bacteria 1017
168 Ga0070715_10737294 3300006163 Bacteria 592
169 Ga0070712_100031631 3300006175 Bacteria 3567
170 Ga0070712_100151969 3300006175 Bacteria 1778
171 Ga0070712_101310831 3300006175 Bacteria 631
172 Ga0075362_10098133 3300006177 Bacteria 1367
173 Ga0075367_10028058 3300006178 Bacteria 3208
174 Ga0075367_10070318 3300006178 Bacteria 2103
175 Ga0075369_10091001 3300006186 Bacteria 1361
176 Ga0075366_10039539 3300006195 Bacteria 2788
177 Ga0075366_10331988 3300006195 Bacteria 932
178 Ga0097621_100304808 3300006237 Bacteria 1408
179 Ga0075370_10025596 3300006353 Bacteria 3265
180 Ga0075370_10046152 3300006353 Bacteria 2465
181 Ga0075370_10447060 3300006353 Bacteria 777
182 Ga0075370_10449919 3300006353 Bacteria 775
183 Ga0068871_100139398 3300006358 Bacteria 2062
184 Ga0068871_100665538 3300006358 Bacteria 951
185 Ga0075428_100478587 3300006844 Bacteria 1333
186 Ga0075434_100162551 3300006871 Bacteria 2252
187 Ga0075434_100416744 3300006871 Bacteria 1364
188 Ga0068865_100037882 3300006881 Bacteria 3260
189 Ga0068865_100109633 3300006881 Bacteria 2034
190 Ga0068865_101072028 3300006881 Bacteria 708
191 Ga0075436_100606798 3300006914 Bacteria 806
192 Ga0097620_101034440 3300006931 Unclassified 902
193 Ga0097620_101767572 3300006931 Bacteria 683
194 Ga0097620_102927523 3300006931 Bacteria 522
195 Ga0075435_100863691 3300007076 Bacteria 788
196 Ga0105250_10058132 3300009092 Bacteria 1552
197 Ga0105240_10003169 3300009093 Bacteria 25859
198 Ga0105240_10024045 3300009093 Bacteria 8045
199 Ga0105240_10025461 3300009093 Bacteria 7774
200 Ga0105240_10266866 3300009093 Bacteria 1972
201 Ga0111539_10215440 3300009094 Bacteria 2237
202 Ga0111539_10404413 3300009094 Bacteria 1590
203 Ga0111539_12053008 3300009094 Bacteria 663
204 Ga0105245_10133105 3300009098 Bacteria 2334
205 Ga0105245_10197636 3300009098 Bacteria 1930
206 Ga0105245_10474194 3300009098 Bacteria 1264
207 Ga0105245_12227248 3300009098 Bacteria 602
208 Ga0105247_10798518 3300009101 Bacteria 720
209 Ga0105247_11257300 3300009101 Unclassified 592
210 Ga0105247_11303288 3300009101 Bacteria 583
211 Ga0114129_12016198 3300009147 Bacteria 698
212 Ga0105243_10007742 3300009148 Bacteria 8260
213 Ga0105243_10040330 3300009148 Bacteria 3646
214 Ga0105243_10112543 3300009148 Bacteria 2280
215 Ga0105243_10277296 3300009148 Bacteria 1508
216 Ga0105243_10453688 3300009148 Bacteria 1204
217 Ga0105241_10274436 3300009174 Bacteria 1438
218 Ga0105241_10904846 3300009174 Bacteria 820
219 Ga0105241_10907795 3300009174 Bacteria 818
220 Ga0105241_11989143 3300009174 Bacteria 572
221 Ga0105242_10142356 3300009176 Bacteria 2082
222 Ga0105242_10193550 3300009176 Bacteria 1802
223 Ga0105242_10449779 3300009176 Bacteria 1214
224 Ga0105242_12226343 3300009176 Bacteria 594
225 Ga0105248_10851262 3300009177 Bacteria 1029
226 Ga0105248_10950483 3300009177 Bacteria 971
227 Ga0105237_10082945 3300009545 Bacteria 3197
228 Ga0105237_10123651 3300009545 Bacteria 2582
229 Ga0105237_10314684 3300009545 Bacteria 1569
230 Ga0105237_10315105 3300009545 Bacteria 1568
231 Ga0105237_10352991 3300009545 Bacteria 1475
232 Ga0105238_10074249 3300009551 Bacteria 3394
233 Ga0105238_10307127 3300009551 Bacteria 1571
234 Ga0105238_10800313 3300009551 Bacteria 958
235 Ga0105249_10021729 3300009553 Bacteria 5745
236 Ga0105249_10039959 3300009553 Bacteria 4260
237 Ga0105249_10047434 3300009553 Bacteria 3914
238 Ga0105249_10130420 3300009553 Bacteria 2399
239 Ga0105249_11776603 3300009553 Bacteria 689
240 Ga0105249_12150800 3300009553 Bacteria 631
241 Ga0105239_10030105 3300010375 Bacteria 5968
242 Ga0105239_10059304 3300010375 Bacteria 4200
243 Ga0105239_10076194 3300010375 Bacteria 3689
244 Ga0105239_10090370 3300010375 Bacteria 3378
245 Ga0105239_10281473 3300010375 Bacteria 1872
246 Ga0105239_10716384 3300010375 Bacteria 1144
247 Ga0105239_10820394 3300010375 Bacteria 1066
248 Ga0105239_12092110 3300010375 Bacteria 658
249 Ga0105239_12878628 3300010375 Bacteria 561
250 Ga0105246_10158699 3300011119 Bacteria 1721
251 Ga0105246_10362064 3300011119 Bacteria 1192
252 Ga0157342_1003257 3300012507 Bacteria 1381
253 Ga0157338_1051281 3300012515 Bacteria 593
254 Ga0157373_10105493 3300013100 Bacteria 1982
255 Ga0157370_10023735 3300013104 Bacteria 6086
256 Ga0157369_10006685 3300013105 Bacteria 13314
257 Ga0157369_10031427 3300013105 Bacteria 5846
258 Ga0157369_10105763 3300013105 Plasmid 2996
259 Ga0157369_10589208 3300013105 Bacteria 1148
260 Ga0157374_10411631 3300013296 Bacteria 1350
261 Ga0157378_10107381 3300013297 Bacteria 2554
262 Ga0157378_10307533 3300013297 Bacteria 1536
263 Ga0163162_10252217 3300013306 Bacteria 1896
264 Ga0163162_10874763 3300013306 Bacteria 1013
265 Ga0163162_11306753 3300013306 Unclassified 824
266 Ga0157372_10057686 3300013307 Bacteria 4340
267 Ga0157375_10149375 3300013308 Bacteria 2470
268 Ga0157375_10409710 3300013308 Bacteria 1522
269 Ga0157375_10464067 3300013308 Bacteria 1432
270 Ga0157375_10660585 3300013308 Bacteria 1201
271 Ga0163163_10148521 3300014325 Bacteria 2388
272 Ga0163163_11040602 3300014325 Bacteria 882
273 Ga0163163_12831396 3300014325 Unclassified 541
274 Ga0157380_10014810 3300014326 Bacteria 5712
275 Ga0157380_10265798 3300014326 Bacteria 1561
276 Ga0157380_10361200 3300014326 Bacteria 1363
277 Ga0157380_10407592 3300014326 Unclassified 1292
278 Ga0157377_10266568 3300014745 Bacteria 1117
279 Ga0157379_10200612 3300014968 Bacteria 1804
280 Ga0157379_10353917 3300014968 Bacteria 1345
281 Ga0157379_10502415 3300014968 Bacteria 1124
282 Ga0157379_10632943 3300014968 Bacteria 1000
283 Ga0157376_12440258 3300014969 Bacteria 562
284 Ga0163161_10058776 3300017792 Bacteria 2795
285 Ga0163161_10071679 3300017792 Bacteria 2536
286 Ga0163161_10168122 3300017792 Bacteria 1675
287 Ga0163161_11742194 3300017792 Unclassified 553
288 Ga0197907_10837939 3300020069 Bacteria 1882
289 Ga0206356_11014121 3300020070 Bacteria 731
290 Ga0206355_1718662 3300020076 Bacteria 1049
291 Ga0206351_10276483 3300020077 Bacteria 732
292 Ga0206351_11013810 3300020077 Bacteria 913
293 Ga0206352_10195892 3300020078 Bacteria 2104
294 Ga0206352_10797130 3300020078 Bacteria 2560
295 Ga0206352_11346378 3300020078 Bacteria 1323
296 Ga0206350_10023438 3300020080 Bacteria 1883
297 Ga0206354_10540424 3300020081 Bacteria 2787
298 Ga0206354_11074111 3300020081 Plasmid 3198
299 Ga0206354_11591773 3300020081 Bacteria 2049
300 Ga0206353_10165421 3300020082 Bacteria 982
301 Ga0206353_12004661 3300020082 Unclassified 796
302 Ga0213874_10017730 3300021377 Bacteria 1914
303 Ga0213874_10175755 3300021377 Bacteria 760
304 Ga0213876_10009595 3300021384 Bacteria 5206
305 Ga0224712_10005349 3300022467 Plasmid 3565
306 Ga0224712_10006650 3300022467 Bacteria 3314
307 Ga0224712_10009636 3300022467 Bacteria 2920
308 Ga0224712_10133350 3300022467 Bacteria 1086
309 Ga0207697_10021935 3300025315 Bacteria 2616
310 Ga0207697_10272868 3300025315 Bacteria 749
311 Ga0207656_10428218 3300025321 Bacteria 667
312 Ga0207682_10365169 3300025893 Bacteria 681
313 Ga0207692_11051946 3300025898 Bacteria 538
314 Ga0207642_10167924 3300025899 Bacteria 1184
315 Ga0207642_10495315 3300025899 Bacteria 747
316 Ga0207642_10513035 3300025899 Bacteria 735
317 Ga0207710_10199154 3300025900 Bacteria 989
318 Ga0207688_10011296 3300025901 Bacteria 4861
319 Ga0207688_10125739 3300025901 Bacteria 1499
320 Ga0207688_10241532 3300025901 Unclassified 1092
321 Ga0207680_10095065 3300025903 Bacteria 1904
322 Ga0207647_10104056 3300025904 Bacteria 1683
323 Ga0207647_10227190 3300025904 Bacteria 1075
324 Ga0207685_10228828 3300025905 Bacteria 888
325 Ga0207685_10577068 3300025905 Bacteria 601
326 Ga0207685_10666225 3300025905 Bacteria 564
327 Ga0207645_10077833 3300025907 Bacteria 2125
328 Ga0207645_10079147 3300025907 Bacteria 2107
329 Ga0207643_10016072 3300025908 Bacteria 4078
330 Ga0207705_10773693 3300025909 Bacteria 745
331 Ga0207705_11428221 3300025909 Bacteria 525
332 Ga0207654_10551346 3300025911 Bacteria 819
333 Ga0207654_10741329 3300025911 Bacteria 707
334 Ga0207707_10009028 3300025912 Bacteria 8662
335 Ga0207707_10025826 3300025912 Bacteria 5137
336 Ga0207707_10075107 3300025912 Bacteria 2949
337 Ga0207695_10004203 3300025913 Bacteria 19783
338 Ga0207695_10039142 3300025913 Bacteria 5098
339 Ga0207695_10517429 3300025913 Bacteria 1075
340 Ga0207671_10142722 3300025914 Bacteria 1846
341 Ga0207671_10193399 3300025914 Bacteria 1587
342 Ga0207671_10360254 3300025914 Bacteria 1154
343 Ga0207693_10078197 3300025915 Bacteria 2589
344 Ga0207693_10300822 3300025915 Bacteria 1257
345 Ga0207663_10143186 3300025916 Bacteria 1668
346 Ga0207660_10049242 3300025917 Plasmid 2985
347 Ga0207660_10397835 3300025917 Bacteria 1109
348 Ga0207657_10070158 3300025919 Bacteria 2971
349 Ga0207657_10247049 3300025919 Bacteria 1423
350 Ga0207649_10118707 3300025920 Bacteria 1780
351 Ga0207649_10190704 3300025920 Bacteria 1441
352 Ga0207652_10006487 3300025921 Bacteria 9433
353 Ga0207652_10056575 3300025921 Plasmid 3376
354 Ga0207652_10126815 3300025921 Bacteria 2274
355 Ga0207681_10048191 3300025923 Bacteria 2875
356 Ga0207681_10186340 3300025923 Bacteria 1584
357 Ga0207694_10263931 3300025924 Bacteria 1411
358 Ga0207694_10322203 3300025924 Bacteria 1276
359 Ga0207694_10745891 3300025924 Bacteria 826
360 Ga0207659_10329419 3300025926 Bacteria 1262
361 Ga0207687_10193040 3300025927 Bacteria 1586
362 Ga0207687_10239474 3300025927 Bacteria 1437
363 Ga0207687_10259478 3300025927 Bacteria 1385
364 Ga0207687_10865146 3300025927 Bacteria 773
365 Ga0207700_10456768 3300025928 Unclassified 1126
366 Ga0207700_11038960 3300025928 Bacteria 733
367 Ga0207644_10073473 3300025931 Bacteria 2508
368 Ga0207644_10943218 3300025931 Bacteria 724
369 Ga0207690_10768086 3300025932 Bacteria 795
370 Ga0207706_10033391 3300025933 Bacteria 4581
371 Ga0207706_10035111 3300025933 Bacteria 4460
372 Ga0207706_10039080 3300025933 Bacteria 4207
373 Ga0207706_10097952 3300025933 Bacteria 2580
374 Ga0207706_10360941 3300025933 Bacteria 1262
375 Ga0207709_10029973 3300025935 Bacteria 3161
376 Ga0207709_10705538 3300025935 Bacteria 808
377 Ga0207709_10756257 3300025935 Bacteria 782
378 Ga0207670_10333318 3300025936 Bacteria 1197
379 Ga0207670_11032893 3300025936 Bacteria 692
380 Ga0207669_10158364 3300025937 Bacteria 1596
381 Ga0207669_10967788 3300025937 Unclassified 714
382 Ga0207704_10016904 3300025938 Bacteria 3765
383 Ga0207704_10189435 3300025938 Bacteria 1495
384 Ga0207704_10321281 3300025938 Bacteria 1194
385 Ga0207704_10595683 3300025938 Bacteria 904
386 Ga0207704_10610122 3300025938 Bacteria 894
387 Ga0207704_10731453 3300025938 Bacteria 821
388 Ga0207665_10125470 3300025939 Bacteria 1817
389 Ga0207691_10134868 3300025940 Bacteria 2178
390 Ga0207691_10163139 3300025940 Bacteria 1954
391 Ga0207711_10105189 3300025941 Bacteria 2502
392 Ga0207689_10042986 3300025942 Bacteria 3736
393 Ga0207689_10066836 3300025942 Bacteria 2955
394 Ga0207689_10125553 3300025942 Bacteria 2111
395 Ga0207661_10000498 3300025944 Bacteria 25279
396 Ga0207661_10006552 3300025944 Bacteria 8232
397 Ga0207661_10014298 3300025944 Bacteria 5813
398 Ga0207661_10222758 3300025944 Bacteria 1668
399 Ga0207661_10628284 3300025944 Bacteria 987
400 Ga0207679_10411920 3300025945 Bacteria 1191
401 Ga0207667_10101367 3300025949 Bacteria 2970
402 Ga0207667_10323213 3300025949 Bacteria 1576
403 Ga0207667_10324442 3300025949 Bacteria 1572
404 Ga0207651_10125081 3300025960 Bacteria 1958
405 Ga0207651_10741001 3300025960 Bacteria 868
406 Ga0207651_11205443 3300025960 Bacteria 680
407 Ga0207668_10003022 3300025972 Bacteria 9857
408 Ga0207668_10031398 3300025972 Bacteria 3498
409 Ga0207668_10061136 3300025972 Bacteria 2647
410 Ga0207668_10065283 3300025972 Bacteria 2575
411 Ga0207668_10440055 3300025972 Bacteria 1110
412 Ga0207668_10647444 3300025972 Bacteria 925
413 Ga0207640_10035538 3300025981 Bacteria 3119
414 Ga0207658_10362026 3300025986 Bacteria 1266
415 Ga0207658_11076990 3300025986 Bacteria 734
416 Ga0207677_11407138 3300026023 Bacteria 642
417 Ga0207703_10070311 3300026035 Bacteria 2889
418 Ga0207703_10187689 3300026035 Bacteria 1828
419 Ga0207703_10524514 3300026035 Bacteria 1114
420 Ga0207703_10844690 3300026035 Bacteria 875
421 Ga0207639_10126927 3300026041 Bacteria 2105
422 Ga0207678_10015089 3300026067 Bacteria 6797
423 Ga0207678_10200287 3300026067 Bacteria 1707
424 Ga0207678_10228738 3300026067 Bacteria 1592
425 Ga0207708_10024124 3300026075 Bacteria 4599
426 Ga0207708_10042216 3300026075 Bacteria 3477
427 Ga0207708_10627813 3300026075 Bacteria 912
428 Ga0207702_10347599 3300026078 Bacteria 1418
429 Ga0207702_10526278 3300026078 Bacteria 1154
430 Ga0207641_12606043 3300026088 Bacteria 503
431 Ga0207648_10611248 3300026089 Bacteria 1005
432 Ga0207648_10954745 3300026089 Bacteria 802
433 Ga0207648_11120133 3300026089 Bacteria 738
434 Ga0207676_10216797 3300026095 Bacteria 1702
435 Ga0207676_10919796 3300026095 Bacteria 859
436 Ga0207674_10076505 3300026116 Bacteria 3354
437 Ga0207674_10182859 3300026116 Unclassified 2047
438 Ga0207674_10365266 3300026116 Bacteria 1395
439 Ga0207675_100011592 3300026118 Bacteria 8243
440 Ga0207675_100016273 3300026118 Bacteria 6944
441 Ga0207675_100051864 3300026118 Bacteria 3828
442 Ga0207675_100665628 3300026118 Bacteria 1048
443 Ga0207683_10072324 3300026121 Bacteria 3049
444 Ga0207683_10097453 3300026121 Bacteria 2623
445 Ga0207683_11202883 3300026121 Bacteria 702
446 Ga0207698_10030047 3300026142 Bacteria 3902
447 Ga0207698_10463374 3300026142 Bacteria 1226
448 Ga0209813_10009225 3300027866 Bacteria 2516
449 Ga0209813_10019354 3300027866 Bacteria 1891
450 Ga0268266_10044298 3300028379 Bacteria 3804
451 Ga0268266_10069221 3300028379 Bacteria 3057
452 Ga0268266_10139059 3300028379 Bacteria 2178
453 Ga0268266_10373890 3300028379 Unclassified 1343
454 Ga0268266_10469120 3300028379 Bacteria 1198
455 Ga0268265_10021006 3300028380 Bacteria 4565
456 Ga0268265_10072069 3300028380 Bacteria 2693
457 Ga0268265_10074081 3300028380 Bacteria 2661
458 Ga0268265_10127467 3300028380 Bacteria 2109
459 Ga0268265_10299764 3300028380 Bacteria 1447
460 Ga0268264_10143915 3300028381 Bacteria 2129
461 Ga0268264_10240178 3300028381 Bacteria 1677
462 Ga0268264_10443608 3300028381 Bacteria 1256
463 Ga0268264_11847732 3300028381 Bacteria 614
464 Ga0307408_101019356 3300031548 Bacteria 764
465 Ga0307508_10742071 3300031616 Bacteria 594
466 Ga0307405_10344638 3300031731 Bacteria 1147
467 Ga0307413_10307994 3300031824 Bacteria 1204
468 Ga0307413_10472007 3300031824 Bacteria 1001
469 Ga0307406_10056387 3300031901 Bacteria 2516
470 Ga0307407_11120210 3300031903 Bacteria 612
471 Ga0307409_100655746 3300031995 Bacteria 1044
472 Ga0307416_101148363 3300032002 Bacteria 882
473 Ga0307416_103054262 3300032002 Unclassified 560
474 Ga0307414_10651903 3300032004 Bacteria 949
475 Ga0307411_10500567 3300032005 Bacteria 1027
476 Ga0307415_101095065 3300032126 Bacteria 745
477 Ga0315911_1000003 3300033442 Bacteria 502217
478 Ga0315911_1000026 3300033442 Bacteria 88844
479 Ga0373959_0064632 3300034820 Bacteria 816
480 Ga0373938_0188073 3300034957 Bacteria 567
481 Ga0373929_0145098 3300035085 Bacteria 633
482 Ga0373949_0105097 3300035090 Bacteria 778
483 Ga0373952_0027983 3300035092 Bacteria 1234
484 Ga0373946_0472467 3300035171 Bacteria 641
485 Ga0373942_0347426 3300035207 Bacteria 524
486 Ga0373961_0169960 3300035241 Bacteria 754
487 Ga0373931_0178331 3300035691 Bacteria 1257
488 Ga0373931_0515826 3300035691 Bacteria 773
489 Ga0373935_0216340 3300035692 Bacteria 1329
490 Ga0373927_0037001 3300035695 Bacteria 3172
491 Ga0373927_0168177 3300035695 Bacteria 1437
492 Ga0373933_0129578 3300035724 Bacteria 1585
493 Ga0373933_0283953 3300035724 Bacteria 1070
494 Ga0373947_0168493 3300035725 Bacteria 1420
495 Ga0373947_0510400 3300035725 Bacteria 817
496 Ga0373937_0247072 3300036401 Bacteria 1682
497 Ga0373937_1200946 3300036401 Bacteria 707
498 Ga0373925_0251272 3300037068 Bacteria 1418
499 Ga0373925_0364508 3300037068 Bacteria 1175
500 Ga0395900_0006628 3300037418 Bacteria 12050
501 Ga0395898_0001591 3300037466 Bacteria 30979
502 Ga0395901_0070444 3300038443 Bacteria 3643
503 Ga0395901_0127479 3300038443 Bacteria 2675
504 Ga0395901_0485687 3300038443 Bacteria 1259
505 Ga0436360_1096672 3300039438 Bacteria 4955
506 Ga0436363_0199614 3300039450 Bacteria 2797
507 Ga0436363_1564895 3300039450 Bacteria 1258
508 Ga0451789_1119135 3300041443 Bacteria 556
509 Ga0451800_0207391 3300041459 Bacteria 665
510 Ga0451800_0366943 3300041459 Bacteria 558
511 Ga0451802_0073502 3300041460 Bacteria 565
512 Ga0439458_0032405 3300042157 Bacteria 1249
513 Ga0439458_0196168 3300042157 Bacteria 551
514 Ga0466969_0241975 3300044656 Bacteria 819
515 Ga0466961_0676360 3300044693 Bacteria 619
516 Ga0466957_0042280 3300044842 Bacteria 2757
517 Ga0466958_0972058 3300045836 Bacteria 554
518 Ga0495617_105053 3300046452 Bacteria 916
519 Ga0495603_0024565 3300046455 Bacteria 3646
520 Ga0495603_0480230 3300046455 Bacteria 712
521 Ga0495590_0026890 3300046457 Bacteria 2019
522 Ga0495629_0244590 3300046459 Bacteria 1235
523 Ga0495629_0429810 3300046459 Bacteria 896
524 Ga0495638_0035574 3300046460 Bacteria 3174
525 Ga0495638_0042412 3300046460 Bacteria 2874
526 Ga0495641_0131304 3300046461 Bacteria 1118
527 Ga0495650_0065530 3300046471 Bacteria 1441
528 Ga0495650_0322885 3300046471 Bacteria 514
529 Ga0495580_0299719 3300046472 Bacteria 1095
530 Ga0495580_0411780 3300046472 Bacteria 910
531 Ga0495580_1024859 3300046472 Bacteria 525
532 Ga0495605_0355951 3300046474 Bacteria 613
533 Ga0495662_0423500 3300046476 Bacteria 654
534 Ga0495664_0111025 3300046477 Bacteria 1655
535 Ga0495584_0120118 3300046491 Bacteria 1331
536 Ga0495584_0209317 3300046491 Bacteria 991
537 Ga0495585_0049388 3300046492 Bacteria 2336
538 Ga0495585_0208237 3300046492 Bacteria 992
539 Ga0495594_0256606 3300046499 Bacteria 996
540 Ga0495594_0514511 3300046499 Bacteria 680
541 Ga0495606_0005366 3300046507 Bacteria 12297
542 Ga0495606_0022235 3300046507 Bacteria 4626
543 Ga0495606_0561093 3300046507 Bacteria 566
544 Ga0495610_0072592 3300046512 Bacteria 1602
545 Ga0495610_0092457 3300046512 Bacteria 1369
546 Ga0495616_0174574 3300046513 Bacteria 959
547 Ga0495620_0026798 3300046515 Bacteria 2706
548 Ga0495620_0167023 3300046515 Bacteria 854
549 Ga0495620_0284056 3300046515 Unclassified 629
550 Ga0495620_0324920 3300046515 Bacteria 584
551 Ga0495630_0400110 3300046517 Bacteria 1052
552 Ga0495632_0007139 3300046519 Bacteria 7065
553 Ga0495632_0025447 3300046519 Bacteria 3130
554 Ga0495632_0077930 3300046519 Bacteria 1584
555 Ga0495643_0077782 3300046522 Bacteria 1733
556 Ga0495643_0454240 3300046522 Bacteria 557
557 Ga0495644_0074144 3300046523 Bacteria 1280
558 Ga0495644_0168322 3300046523 Bacteria 841
559 Ga0495648_0178913 3300046524 Bacteria 1080
560 Ga0495648_0296526 3300046524 Bacteria 759
561 Ga0495648_0304512 3300046524 Bacteria 745
562 Ga0495648_0432600 3300046524 Bacteria 580
563 Ga0495663_0024482 3300046525 Bacteria 1755
564 Ga0495663_0066713 3300046525 Bacteria 1140
565 Ga0495665_0120215 3300046531 Bacteria 1376
566 Ga0495586_0256323 3300046535 Bacteria 999
567 Ga0495587_0681351 3300046536 Unclassified 564
568 Ga0495598_0019183 3300046537 Bacteria 1789
569 Ga0495598_0146206 3300046537 Bacteria 822
570 Ga0495609_0108542 3300046538 Bacteria 1199
571 Ga0495609_0118168 3300046538 Bacteria 1141
572 Ga0495597_0044661 3300046542 Bacteria 1970
573 Ga0495622_0360116 3300046557 Bacteria 629
574 Ga0495633_0129916 3300046558 Bacteria 1165
575 Ga0495633_0473451 3300046558 Bacteria 565
576 Ga0495656_0014517 3300046615 Bacteria 2955
577 Ga0495656_0061192 3300046615 Bacteria 1643
578 Ga0495656_0064841 3300046615 Bacteria 1605
579 Ga0495668_0008239 3300046616 Bacteria 6536
580 Ga0495668_0322414 3300046616 Bacteria 847
581 Ga0495668_0515042 3300046616 Unclassified 660
582 Ga0495611_0073215 3300046648 Bacteria 1568
583 Ga0495611_0304933 3300046648 Bacteria 734
584 Ga0495625_0023229 3300046660 Bacteria 4739
585 Ga0495659_0016126 3300046664 Bacteria 2462
586 Ga0495588_0004904 3300046674 Bacteria 5934
587 Ga0495588_0623900 3300046674 Bacteria 564
588 Ga0495647_0048244 3300046681 Bacteria 1646
589 Ga0495647_0327940 3300046681 Bacteria 694
590 Ga0495669_0482560 3300046684 Bacteria 602
591 Ga0495624_0146578 3300046690 Bacteria 1445
592 Ga0495624_0351138 3300046690 Bacteria 887
593 Ga0495670_0061442 3300046691 Bacteria 1889
594 Ga0495670_0161954 3300046691 Bacteria 1176
595 Ga0495649_0088871 3300046694 Bacteria 1648
596 Ga0495589_0066635 3300046794 Bacteria 1763
597 Ga0495589_0073874 3300046794 Bacteria 1664
598 Ga0495581_0219857 3300047315 Bacteria 1111
599 Ga0495581_0280558 3300047315 Bacteria 974
600 Ga0495581_0486986 3300047315 Bacteria 717
601 Ga0495636_0101178 3300047318 Bacteria 1260
602 Ga0495636_0150089 3300047318 Bacteria 1045
603 Ga0495636_0171083 3300047318 Bacteria 982
604 Ga0495674_0088630 3300047319 Bacteria 2646
605 Ga0495676_0120542 3300047321 Bacteria 1909
606 Ga0495676_0160591 3300047321 Bacteria 1591
607 Ga0495683_0079612 3300047323 Bacteria 1600
608 Ga0495683_0239033 3300047323 Bacteria 802
609 Ga0495677_0226369 3300047445 Bacteria 729
610 Ga0495679_143461 3300047446 Bacteria 644
611 Ga0495679_150925 3300047446 Bacteria 624
612 Ga0495673_0028201 3300047469 Bacteria 2661
613 Ga0495681_0024991 3300047470 Bacteria 3133
614 Ga0495615_0059580 3300048090 Bacteria 1004
615 Ga0495626_0358202 3300048091 Bacteria 568
616 Ga0496100_0258539 3300048903 Bacteria 1291
617 Ga0496100_0401353 3300048903 Bacteria 1044
618 Ga0496100_0405264 3300048903 Bacteria 1039
619 Ga0496100_0428499 3300048903 Bacteria 1011
620 Ga0496101_0096110 3300048904 Bacteria 2211
621 Ga0496101_0188632 3300048904 Bacteria 1590
622 Ga0496101_0294795 3300048904 Bacteria 1269
623 Ga0496102_0054639 3300048905 Bacteria 3642
624 Ga0496102_0084190 3300048905 Bacteria 2935
625 Ga0496102_0283878 3300048905 Bacteria 1560
626 Ga0496102_0352023 3300048905 Bacteria 1387
627 Ga0496102_0520064 3300048905 Bacteria 1112
628 Ga0496102_0672939 3300048905 Bacteria 958
629 Ga0496102_1661710 3300048905 Bacteria 557
630 Ga0496102_1811381 3300048905 Bacteria 528
631 Ga0496103_0041153 3300048906 Bacteria 2840
632 Ga0496103_0135065 3300048906 Bacteria 1576
633 Ga0496103_0263658 3300048906 Bacteria 1108
634 Ga0496103_0423420 3300048906 Bacteria 855
635 Ga0496104_0047343 3300048907 Bacteria 4053
636 Ga0496104_0086944 3300048907 Bacteria 2985
637 Ga0496104_0652439 3300048907 Bacteria 961
638 Ga0496104_1051757 3300048907 Bacteria 718
639 Ga0496104_1277723 3300048907 Bacteria 637
640 Ga0496105_0073070 3300048908 Bacteria 2834
641 Ga0496105_0417025 3300048908 Bacteria 1063
642 Ga0496106_0003725 3300048909 Bacteria 11374
643 Ga0496106_0087570 3300048909 Bacteria 2399
644 Ga0496106_0153530 3300048909 Bacteria 1817
645 Ga0496106_0261139 3300048909 Bacteria 1386
646 Ga0496106_0544051 3300048909 Bacteria 932
647 Ga0496107_0006134 3300048910 Bacteria 8255
648 Ga0496107_0172635 3300048910 Bacteria 1604
649 Ga0496107_0219729 3300048910 Bacteria 1413
650 Ga0496108_0001186 3300048911 Bacteria 20363
651 Ga0496108_1005373 3300048911 Bacteria 712
652 Ga0496109_0003816 3300048912 Bacteria 12585
653 Ga0496109_0220911 3300048912 Bacteria 1782
654 Ga0496109_0432153 3300048912 Bacteria 1244
655 Ga0496109_1209995 3300048912 Bacteria 692
656 Ga0496109_1827657 3300048912 Bacteria 540
657 Ga0496110_0090350 3300048913 Bacteria 2738
658 Ga0496110_0539424 3300048913 Bacteria 1060
659 Ga0496111_0039399 3300048914 Bacteria 3387
660 Ga0496111_0360459 3300048914 Bacteria 1076
661 Ga0496112_0026432 3300048915 Bacteria 5585
662 Ga0496112_0049847 3300048915 Bacteria 4104
663 Ga0496112_0225106 3300048915 Bacteria 1831
664 Ga0496113_0934225 3300048916 Bacteria 685
665 Ga0496114_0072668 3300048917 Bacteria 2893
666 Ga0496114_1305904 3300048917 Bacteria 612
667 Ga0496115_0044115 3300048918 Bacteria 3556
668 Ga0496115_0116520 3300048918 Bacteria 2197
669 Ga0496115_0194733 3300048918 Bacteria 1675
670 Ga0496115_0252266 3300048918 Bacteria 1452
671 Ga0496115_0280953 3300048918 Bacteria 1367
672 Ga0496115_0284301 3300048918 Bacteria 1358
673 Ga0496115_0814624 3300048918 Bacteria 726
674 Ga0496117_0122132 3300048920 Bacteria 1598
675 Ga0496117_0194942 3300048920 Bacteria 1150
676 Ga0496118_0159277 3300048921 Bacteria 1399
677 Ga0496118_0334855 3300048921 Bacteria 814
678 Ga0496119_0082993 3300048922 Bacteria 1842
679 Ga0496119_0403999 3300048922 Bacteria 651
680 Ga0496121_0008179 3300048924 Bacteria 12417
681 Ga0496121_0017516 3300048924 Bacteria 7310
682 Ga0496121_0053903 3300048924 Bacteria 3365
683 Ga0496121_0188674 3300048924 Bacteria 1480
684 Ga0496121_0903142 3300048924 Bacteria 508
685 Ga0496125_0182927 3300048928 Bacteria 1394
686 Ga0496125_0226780 3300048928 Bacteria 1198
687 Ga0496126_0073544 3300048929 Bacteria 3038
688 Ga0496126_0276369 3300048929 Bacteria 1392
689 Ga0496126_1256860 3300048929 Bacteria 541
690 Ga0495682_0022313 3300049460 Bacteria 2368
691 Ga0495682_0053358 3300049460 Bacteria 1468
692 Ga0495682_0065985 3300049460 Bacteria 1305
693 Ga0501032_0022688 3300049569 Bacteria 4349
694 Ga0501034_1699070 3300049571 Unclassified 504
695 Ga0501038_0951768 3300049574 Bacteria 632
696 Ga0501046_0022715 3300049580 Bacteria 5166
697 Ga0501198_119467 3300049649 Bacteria 554
698 Ga0501232_085853 3300049757 Bacteria 537
699 Ga0501035_0643931 3300049822 Bacteria 860
700 nmdc:mga03683_25622_c2 3300050489 Bacteria 750
701 nmdc:mga00v17_565091_c1 3300050491 Bacteria 735
702 nmdc:mga00v17_589848_c1 3300050491 Bacteria 717
703 nmdc:mga0yw44_216003_c1 3300050492 Bacteria 1270
704 nmdc:mga0yw44_433201_c1 3300050492 Bacteria 891
705 nmdc:mga0yw44_97226_c1 3300050492 Bacteria 1870
706 nmdc:mga0k408_273333_c1 3300050493 Bacteria 1009
707 nmdc:mga0k408_7131_c1 3300050493 Bacteria 5971
708 nmdc:mga06z11_420504_c1 3300050494 Bacteria 806
709 nmdc:mga06z11_829857_c1 3300050494 Bacteria 563
710 nmdc:mga04h51_10760_c1 3300050495 Bacteria 2522
711 nmdc:mga04h51_22291_c1 3300050495 Bacteria 1915
712 nmdc:mga07m45_11841_c1 3300050496 Bacteria 4593
713 nmdc:mga07m45_529623_c1 3300050496 Bacteria 682
714 nmdc:mga08y16_372021_c1 3300050511 Bacteria 1466
715 nmdc:mga0n895_1082034_c1 3300050512 Bacteria 780
716 nmdc:mga0n895_437027_c1 3300050512 Bacteria 1322
717 nmdc:mga08x19_475459_c1 3300050514 Bacteria 881
718 nmdc:mga0a205_1159114_c1 3300050515 Bacteria 620
719 nmdc:mga0sz30_436728_c1 3300050516 Bacteria 587
720 Ga0495612_0531740 3300053078 Bacteria 541
721 Ga0495655_0169996 3300053083 Bacteria 697
722 Ga0495595_0145146 3300053084 Bacteria 1166
723 Ga0495619_0018708 3300053085 Bacteria 4397
724 Ga0500651_0242053 3300053093 Bacteria 1052
725 Ga0500641_0069021 3300053096 Bacteria 1484
726 Ga0500594_0308749 3300053118 Bacteria 531
727 Ga0500658_0253188 3300053134 Bacteria 809
728 Ga0500604_0178963 3300053151 Bacteria 726
729 Ga0587084_043493 3300059477 Bacteria 772
730 Ga0587093_022736 3300059478 Bacteria 852
731 Ga0587066_007530 3300059490 Bacteria 1480
732 Ga0587070_002819 3300059491 Bacteria 2019
733 Ga0587073_0004325 3300059492 Bacteria 2031
734 Ga0587082_007515 3300059504 Bacteria 1487
735 Ga0587083_0024129 3300059505 Bacteria 1154
736 Ga0587085_003690 3300059506 Bacteria 1688
737 Ga0587088_010239 3300059508 Bacteria 1368
738 Ga0587090_001490 3300059510 Bacteria 2385
739 Ga0587091_011803 3300059511 Bacteria 1371
740 Ga0587101_034785 3300059623 Bacteria 804
741 Ga0587128_006197 3300059630 Bacteria 1462
742 Ga0587067_045983 3300059640 Bacteria 866
743 Ga0587068_037386 3300059641 Bacteria 866
744 Ga0587069_007296 3300059642 Bacteria 1361
745 Ga0587072_033582 3300059643 Bacteria 969
746 Ga0587076_009654 3300059645 Bacteria 1375
747 Ga0587114_007319 3300059655 Bacteria 1263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0324920 Ga0495620_0324920_213_572 91
2 3300047446 Ga0495679_143461 Ga0495679_143461_34_393 91
3 3300048907 Ga0496104_1277723 Ga0496104_1277723_40_567 103
4 3300004803 Ga0058862_11790466 Ga0058862_117904661 107
5 3300005539 Ga0068853_100189483 Ga0068853_1001894832 107
6 3300005547 Ga0070693_100056201 Ga0070693_1000562013 107
7 3300005578 Ga0068854_100050437 Ga0068854_1000504372 107
8 3300005616 Ga0068852_100109971 Ga0068852_1001099712 107
9 3300009551 Ga0105238_10307127 Ga0105238_103071272 107
10 3300010375 Ga0105239_10281473 Ga0105239_102814733 107
11 3300020077 Ga0206351_10276483 Ga0206351_102764832 107
12 3300020078 Ga0206352_10195892 Ga0206352_101958922 107
13 3300020081 Ga0206354_10540424 Ga0206354_105404243 107
14 3300020082 Ga0206353_10165421 Ga0206353_101654212 107
15 3300022467 Ga0224712_10133350 Ga0224712_101333502 107
16 3300025909 Ga0207705_11428221 Ga0207705_114282212 107
17 3300025924 Ga0207694_10745891 Ga0207694_107458911 107
18 3300025944 Ga0207661_10222758 Ga0207661_102227582 107
19 3300048905 Ga0496102_1811381 Ga0496102_1811381_23_439 107
20 3300048912 Ga0496109_0220911 Ga0496109_0220911_800_1216 107
21 3300048928 Ga0496125_0182927 Ga0496125_0182927_184_600 107
22 3300048929 Ga0496126_1256860 Ga0496126_1256860_77_493 107
23 3300005344 Ga0070661_100102861 Ga0070661_1001028612 109
24 3300005563 Ga0068855_100068129 Ga0068855_1000681292 109
25 3300009093 Ga0105240_10003169 Ga0105240_1000316919 109
26 3300009545 Ga0105237_10315105 Ga0105237_103151053 109
27 3300013104 Ga0157370_10023735 Ga0157370_100237358 109
28 3300013105 Ga0157369_10006685 Ga0157369_100066854 109
29 3300020081 Ga0206354_11591773 Ga0206354_115917732 109
30 3300022467 Ga0224712_10006650 Ga0224712_100066503 109
31 3300025913 Ga0207695_10004203 Ga0207695_1000420323 109
32 3300025920 Ga0207649_10118707 Ga0207649_101187072 109
33 3300025924 Ga0207694_10263931 Ga0207694_102639312 109
34 3300025949 Ga0207667_10101367 Ga0207667_101013672 109
35 3300026075 Ga0207708_10042216 Ga0207708_100422162 109
36 3300026116 Ga0207674_10365266 Ga0207674_103652663 109
37 3300037418 Ga0395900_0006628 Ga0395900_0006628_2628_3044 109
38 3300037466 Ga0395898_0001591 Ga0395898_0001591_8204_8620 109
39 3300038443 Ga0395901_0070444 Ga0395901_0070444_580_996 109
40 3300005340 Ga0070689_101395618 Ga0070689_1013956181 110
41 3300005347 Ga0070668_100124416 Ga0070668_1001244163 110
42 3300005457 Ga0070662_100064271 Ga0070662_1000642712 110
43 3300005718 Ga0068866_10366755 Ga0068866_103667552 110
44 3300009174 Ga0105241_11989143 Ga0105241_119891432 110
45 3300009176 Ga0105242_10193550 Ga0105242_101935503 110
46 3300013308 Ga0157375_10409710 Ga0157375_104097102 110
47 3300025899 Ga0207642_10513035 Ga0207642_105130351 110
48 3300025905 Ga0207685_10666225 Ga0207685_106662251 110
49 3300025933 Ga0207706_10039080 Ga0207706_100390803 110
50 3300025936 Ga0207670_11032893 Ga0207670_110328931 110
51 3300025960 Ga0207651_10741001 Ga0207651_107410012 110
52 3300026067 Ga0207678_10228738 Ga0207678_102287383 110
53 3300026118 Ga0207675_100665628 Ga0207675_1006656282 110
54 3300046525 Ga0495663_0066713 Ga0495663_0066713_704_1120 110
55 3300046691 Ga0495670_0161954 Ga0495670_0161954_241_657 110
56 3300048907 Ga0496104_1051757 Ga0496104_1051757_17_433 110
57 3300005334 Ga0068869_100981260 Ga0068869_1009812601 111
58 3300005337 Ga0070682_100369915 Ga0070682_1003699152 111
59 3300005356 Ga0070674_100158638 Ga0070674_1001586381 111
60 3300005366 Ga0070659_100808405 Ga0070659_1008084052 111
61 3300005455 Ga0070663_101472487 Ga0070663_1014724872 111
62 3300005564 Ga0070664_100184609 Ga0070664_1001846092 111
63 3300005577 Ga0068857_101723755 Ga0068857_1017237551 111
64 3300006358 Ga0068871_100665538 Ga0068871_1006655382 111
65 3300009177 Ga0105248_10851262 Ga0105248_108512622 111
66 3300011119 Ga0105246_10158699 Ga0105246_101586993 111
67 3300014969 Ga0157376_12440258 Ga0157376_124402581 111
68 3300009174 Ga0105241_10907795 Ga0105241_109077952 112
69 3300025315 Ga0207697_10272868 Ga0207697_102728682 112
70 3300028381 Ga0268264_11847732 Ga0268264_118477322 112
71 3300048908 Ga0496105_0417025 Ga0496105_0417025_507_923 112
72 3300005544 Ga0070686_100385788 Ga0070686_1003857882 113
73 3300035085 Ga0373929_0145098 Ga0373929_0145098_26_385 113
74 3300035171 Ga0373946_0472467 Ga0373946_0472467_198_557 113
75 3300035692 Ga0373935_0216340 Ga0373935_0216340_448_807 113
76 3300035695 Ga0373927_0037001 Ga0373927_0037001_297_656 113
77 3300035724 Ga0373933_0283953 Ga0373933_0283953_296_655 113
78 3300035725 Ga0373947_0510400 Ga0373947_0510400_36_395 113
79 3300036401 Ga0373937_1200946 Ga0373937_1200946_224_583 113
80 3300037068 Ga0373925_0364508 Ga0373925_0364508_127_486 113
81 3300046459 Ga0495629_0429810 Ga0495629_0429810_164_523 113
82 3300046472 Ga0495580_0411780 Ga0495580_0411780_415_774 113
83 3300046476 Ga0495662_0423500 Ga0495662_0423500_111_470 113
84 3300046477 Ga0495664_0111025 Ga0495664_0111025_629_988 113
85 3300046507 Ga0495606_0561093 Ga0495606_0561093_28_387 113
86 3300046531 Ga0495665_0120215 Ga0495665_0120215_668_1027 113
87 3300046535 Ga0495586_0256323 Ga0495586_0256323_185_544 113
88 3300046558 Ga0495633_0473451 Ga0495633_0473451_170_529 113
89 3300046681 Ga0495647_0048244 Ga0495647_0048244_262_621 113
90 3300047315 Ga0495581_0280558 Ga0495581_0280558_559_918 113
91 3300047319 Ga0495674_0088630 Ga0495674_0088630_675_1034 113
92 3300048922 Ga0496119_0403999 Ga0496119_0403999_267_626 113
93 3300053078 Ga0495612_0531740 Ga0495612_0531740_38_397 113
94 3300005548 Ga0070665_100177709 Ga0070665_1001777093 114
95 3300009098 Ga0105245_12227248 Ga0105245_122272481 114
96 3300025915 Ga0207693_10300822 Ga0207693_103008223 114
97 3300041460 Ga0451802_0073502 Ga0451802_0073502_150_545 114
98 3300048912 Ga0496109_0432153 Ga0496109_0432153_124_519 114
99 3300050494 nmdc:mga06z11_829857_c1 nmdc:mga06z11_829857_c1_16_432 114
100 3300005615 Ga0070702_100213092 Ga0070702_1002130922 115
101 3300006038 Ga0075365_10096387 Ga0075365_100963872 115
102 3300006177 Ga0075362_10098133 Ga0075362_100981332 115
103 3300006353 Ga0075370_10447060 Ga0075370_104470602 115
104 3300006353 Ga0075370_10449919 Ga0075370_104499191 115
105 3300009176 Ga0105242_10449779 Ga0105242_104497792 115
106 3300020082 Ga0206353_12004661 Ga0206353_120046612 115
107 3300025940 Ga0207691_10134868 Ga0207691_101348684 115
108 3300042157 Ga0439458_0032405 Ga0439458_0032405_108_503 115
109 3300050489 nmdc:mga03683_25622_c2 nmdc:mga03683_25622_c2_85_480 115
110 3300050491 nmdc:mga00v17_565091_c1 nmdc:mga00v17_565091_c1_13_408 115
111 3300050492 nmdc:mga0yw44_216003_c1 nmdc:mga0yw44_216003_c1_405_821 115
112 3300005289 Ga0065704_10530148 Ga0065704_105301481 116
113 3300005295 Ga0065707_10208440 Ga0065707_102084401 116
114 3300005328 Ga0070676_10071887 Ga0070676_100718872 116
115 3300005333 Ga0070677_10459481 Ga0070677_104594812 116
116 3300005334 Ga0068869_100098155 Ga0068869_1000981553 116
117 3300005338 Ga0068868_100704536 Ga0068868_1007045362 116
118 3300005347 Ga0070668_100060891 Ga0070668_1000608913 116
119 3300005347 Ga0070668_100063506 Ga0070668_1000635063 116
120 3300005353 Ga0070669_100052622 Ga0070669_1000526224 116
121 3300005353 Ga0070669_100067171 Ga0070669_1000671713 116
122 3300005356 Ga0070674_100504987 Ga0070674_1005049872 116
123 3300005364 Ga0070673_101192602 Ga0070673_1011926021 116
124 3300005366 Ga0070659_100165221 Ga0070659_1001652212 116
125 3300005438 Ga0070701_10264400 Ga0070701_102644002 116
126 3300005440 Ga0070705_100253471 Ga0070705_1002534712 116
127 3300005441 Ga0070700_100140108 Ga0070700_1001401083 116
128 3300005456 Ga0070678_100051415 Ga0070678_1000514153 116
129 3300005457 Ga0070662_100077064 Ga0070662_1000770642 116
130 3300005539 Ga0068853_100501426 Ga0068853_1005014262 116
131 3300005543 Ga0070672_100115623 Ga0070672_1001156234 116
132 3300005545 Ga0070695_100068752 Ga0070695_1000687523 116
133 3300005549 Ga0070704_100948833 Ga0070704_1009488332 116
134 3300005719 Ga0068861_100011944 Ga0068861_1000119446 116
135 3300005719 Ga0068861_100103055 Ga0068861_1001030552 116
136 3300005840 Ga0068870_10046886 Ga0068870_100468863 116
137 3300005842 Ga0068858_100338654 Ga0068858_1003386542 116
138 3300005843 Ga0068860_100053479 Ga0068860_1000534794 116
139 3300005843 Ga0068860_100344514 Ga0068860_1003445142 116
140 3300005844 Ga0068862_100132437 Ga0068862_1001324373 116
141 3300005844 Ga0068862_100402692 Ga0068862_1004026922 116
142 3300006881 Ga0068865_101072028 Ga0068865_1010720282 116
143 3300009092 Ga0105250_10058132 Ga0105250_100581322 116
144 3300009093 Ga0105240_10266866 Ga0105240_102668662 116
145 3300009094 Ga0111539_10404413 Ga0111539_104044133 116
146 3300009098 Ga0105245_10197636 Ga0105245_101976362 116
147 3300009101 Ga0105247_10798518 Ga0105247_107985182 116
148 3300009148 Ga0105243_10112543 Ga0105243_101125431 116
149 3300009545 Ga0105237_10082945 Ga0105237_100829454 116
150 3300009553 Ga0105249_10047434 Ga0105249_100474344 116
151 3300010375 Ga0105239_10820394 Ga0105239_108203942 116
152 3300013296 Ga0157374_10411631 Ga0157374_104116311 116
153 3300013308 Ga0157375_10149375 Ga0157375_101493752 116
154 3300014326 Ga0157380_10014810 Ga0157380_100148105 116
155 3300014968 Ga0157379_10632943 Ga0157379_106329432 116
156 3300017792 Ga0163161_10168122 Ga0163161_101681223 116
157 3300025893 Ga0207682_10365169 Ga0207682_103651692 116
158 3300025901 Ga0207688_10011296 Ga0207688_100112966 116
159 3300025903 Ga0207680_10095065 Ga0207680_100950653 116
160 3300025907 Ga0207645_10077833 Ga0207645_100778332 116
161 3300025908 Ga0207643_10016072 Ga0207643_100160724 116
162 3300025913 Ga0207695_10517429 Ga0207695_105174291 116
163 3300025914 Ga0207671_10142722 Ga0207671_101427223 116
164 3300025923 Ga0207681_10048191 Ga0207681_100481913 116
165 3300025923 Ga0207681_10186340 Ga0207681_101863402 116
166 3300025927 Ga0207687_10239474 Ga0207687_102394742 116
167 3300025933 Ga0207706_10035111 Ga0207706_100351114 116
168 3300025935 Ga0207709_10705538 Ga0207709_107055381 116
169 3300025937 Ga0207669_10158364 Ga0207669_101583642 116
170 3300025938 Ga0207704_10016904 Ga0207704_100169044 116
171 3300025942 Ga0207689_10042986 Ga0207689_100429864 116
172 3300025972 Ga0207668_10003022 Ga0207668_100030229 116
173 3300025972 Ga0207668_10061136 Ga0207668_100611363 116
174 3300026023 Ga0207677_11407138 Ga0207677_114071382 116
175 3300026035 Ga0207703_10187689 Ga0207703_101876893 116
176 3300026035 Ga0207703_10844690 Ga0207703_108446902 116
177 3300026075 Ga0207708_10024124 Ga0207708_100241244 116
178 3300026089 Ga0207648_10954745 Ga0207648_109547452 116
179 3300026118 Ga0207675_100011592 Ga0207675_1000115924 116
180 3300026118 Ga0207675_100051864 Ga0207675_1000518644 116
181 3300026121 Ga0207683_10072324 Ga0207683_100723244 116
182 3300028380 Ga0268265_10021006 Ga0268265_100210065 116
183 3300028380 Ga0268265_10074081 Ga0268265_100740814 116
184 3300028381 Ga0268264_10143915 Ga0268264_101439152 116
185 3300031548 Ga0307408_101019356 Ga0307408_1010193561 116
186 3300031901 Ga0307406_10056387 Ga0307406_100563873 116
187 3300032002 Ga0307416_101148363 Ga0307416_1011483632 116
188 3300032004 Ga0307414_10651903 Ga0307414_106519031 116
189 3300041443 Ga0451789_1119135 Ga0451789_1119135_114_530 116
190 3300047323 Ga0495683_0079612 Ga0495683_0079612_319_714 116
191 3300048905 Ga0496102_0283878 Ga0496102_0283878_1075_1470 116
192 3300048906 Ga0496103_0041153 Ga0496103_0041153_444_839 116
193 3300048920 Ga0496117_0122132 Ga0496117_0122132_807_1202 116
194 3300049649 Ga0501198_119467 Ga0501198_119467_36_431 116
195 3300049757 Ga0501232_085853 Ga0501232_085853_106_501 116
196 3300050511 nmdc:mga08y16_372021_c1 nmdc:mga08y16_372021_c1_180_575 116
197 3300053083 Ga0495655_0169996 Ga0495655_0169996_163_558 116
198 3300005328 Ga0070676_10495128 Ga0070676_104951282 117
199 3300006038 Ga0075365_10103731 Ga0075365_101037312 117
200 3300006051 Ga0075364_10343261 Ga0075364_103432612 117
201 3300006186 Ga0075369_10091001 Ga0075369_100910012 117
202 3300009176 Ga0105242_10142356 Ga0105242_101423562 117
203 3300010375 Ga0105239_10076194 Ga0105239_100761945 117
204 3300011119 Ga0105246_10362064 Ga0105246_103620641 117
205 3300013306 Ga0163162_10874763 Ga0163162_108747632 117
206 3300014968 Ga0157379_10200612 Ga0157379_102006122 117
207 3300037068 Ga0373925_0251272 Ga0373925_0251272_590_1006 117
208 3300046512 Ga0495610_0072592 Ga0495610_0072592_212_607 117
209 3300046515 Ga0495620_0167023 Ga0495620_0167023_177_572 117
210 3300046522 Ga0495643_0454240 Ga0495643_0454240_77_472 117
211 3300046524 Ga0495648_0304512 Ga0495648_0304512_177_572 117
212 3300046542 Ga0495597_0044661 Ga0495597_0044661_594_989 117
213 3300046616 Ga0495668_0322414 Ga0495668_0322414_387_782 117
214 3300046694 Ga0495649_0088871 Ga0495649_0088871_197_592 117
215 3300048091 Ga0495626_0358202 Ga0495626_0358202_161_556 117
216 3300048924 Ga0496121_0903142 Ga0496121_0903142_16_411 117
217 3300050492 nmdc:mga0yw44_97226_c1 nmdc:mga0yw44_97226_c1_481_876 117
218 3300050516 nmdc:mga0sz30_436728_c1 nmdc:mga0sz30_436728_c1_89_484 117
219 3300005329 Ga0070683_100007169 Ga0070683_1000071696 118
220 3300005335 Ga0070666_10770488 Ga0070666_107704881 118
221 3300005530 Ga0070679_101096045 Ga0070679_1010960451 118
222 3300005535 Ga0070684_100017991 Ga0070684_1000179913 118
223 3300009093 Ga0105240_10025461 Ga0105240_100254619 118
224 3300013105 Ga0157369_10589208 Ga0157369_105892082 118
225 3300020069 Ga0197907_10837939 Ga0197907_108379392 118
226 3300020070 Ga0206356_11014121 Ga0206356_110141211 118
227 3300020076 Ga0206355_1718662 Ga0206355_17186621 118
228 3300020078 Ga0206352_10797130 Ga0206352_107971302 118
229 3300022467 Ga0224712_10009636 Ga0224712_100096363 118
230 3300025913 Ga0207695_10039142 Ga0207695_100391425 118
231 3300025938 Ga0207704_10731453 Ga0207704_107314532 118
232 3300025944 Ga0207661_10000498 Ga0207661_1000049811 118
233 3300035725 Ga0373947_0168493 Ga0373947_0168493_156_557 118
234 3300046615 Ga0495656_0064841 Ga0495656_0064841_979_1374 118
235 3300047318 Ga0495636_0171083 Ga0495636_0171083_336_731 118
236 3300053085 Ga0495619_0018708 Ga0495619_0018708_1829_2245 118
237 3300005577 Ga0068857_100346055 Ga0068857_1003460552 119
238 3300005841 Ga0068863_100988446 Ga0068863_1009884462 119
239 3300009545 Ga0105237_10123651 Ga0105237_101236512 119
240 3300010375 Ga0105239_10059304 Ga0105239_100593043 119
241 3300025914 Ga0207671_10360254 Ga0207671_103602542 119
242 3300026095 Ga0207676_10216797 Ga0207676_102167972 119
243 3300046455 Ga0495603_0024565 Ga0495603_0024565_2526_2921 119
244 3300046460 Ga0495638_0042412 Ga0495638_0042412_954_1349 119
245 3300046461 Ga0495641_0131304 Ga0495641_0131304_472_867 119
246 3300046472 Ga0495580_1024859 Ga0495580_1024859_41_436 119
247 3300046474 Ga0495605_0355951 Ga0495605_0355951_117_512 119
248 3300046491 Ga0495584_0209317 Ga0495584_0209317_437_832 119
249 3300046492 Ga0495585_0208237 Ga0495585_0208237_349_744 119
250 3300046513 Ga0495616_0174574 Ga0495616_0174574_419_814 119
251 3300046519 Ga0495632_0077930 Ga0495632_0077930_675_1070 119
252 3300046523 Ga0495644_0074144 Ga0495644_0074144_96_491 119
253 3300046524 Ga0495648_0178913 Ga0495648_0178913_576_971 119
254 3300046525 Ga0495663_0024482 Ga0495663_0024482_429_824 119
255 3300046537 Ga0495598_0019183 Ga0495598_0019183_665_1060 119
256 3300046538 Ga0495609_0108542 Ga0495609_0108542_141_536 119
257 3300046557 Ga0495622_0360116 Ga0495622_0360116_26_421 119
258 3300046558 Ga0495633_0129916 Ga0495633_0129916_275_670 119
259 3300046615 Ga0495656_0061192 Ga0495656_0061192_238_633 119
260 3300046648 Ga0495611_0073215 Ga0495611_0073215_649_1044 119
261 3300046664 Ga0495659_0016126 Ga0495659_0016126_1463_1858 119
262 3300046674 Ga0495588_0004904 Ga0495588_0004904_1231_1626 119
263 3300046684 Ga0495669_0482560 Ga0495669_0482560_166_561 119
264 3300046690 Ga0495624_0351138 Ga0495624_0351138_141_536 119
265 3300046691 Ga0495670_0061442 Ga0495670_0061442_1261_1656 119
266 3300046794 Ga0495589_0073874 Ga0495589_0073874_750_1145 119
267 3300047318 Ga0495636_0101178 Ga0495636_0101178_774_1169 119
268 3300047321 Ga0495676_0120542 Ga0495676_0120542_1016_1411 119
269 3300047470 Ga0495681_0024991 Ga0495681_0024991_703_1098 119
270 3300048903 Ga0496100_0401353 Ga0496100_0401353_144_539 119
271 3300048905 Ga0496102_0084190 Ga0496102_0084190_214_609 119
272 3300048906 Ga0496103_0263658 Ga0496103_0263658_602_997 119
273 3300048909 Ga0496106_0153530 Ga0496106_0153530_1144_1539 119
274 3300048909 Ga0496106_0261139 Ga0496106_0261139_761_1177 119
275 3300048910 Ga0496107_0219729 Ga0496107_0219729_731_1126 119
276 3300048924 Ga0496121_0017516 Ga0496121_0017516_5909_6304 119
277 3300049460 Ga0495682_0065985 Ga0495682_0065985_746_1141 119
278 3300048924 Ga0496121_0053903 Ga0496121_0053903_1540_1935 120
279 3300049569 Ga0501032_0022688 Ga0501032_0022688_1387_1812 120
280 3300049580 Ga0501046_0022715 Ga0501046_0022715_2667_3083 120
281 3300005329 Ga0070683_100094392 Ga0070683_1000943925 121
282 3300005336 Ga0070680_100133457 Ga0070680_1001334572 121
283 3300005341 Ga0070691_10053511 Ga0070691_100535114 121
284 3300005458 Ga0070681_10095644 Ga0070681_100956445 121
285 3300005530 Ga0070679_100024443 Ga0070679_1000244436 121
286 3300005535 Ga0070684_100084644 Ga0070684_1000846445 121
287 3300005563 Ga0068855_100908361 Ga0068855_1009083612 121
288 3300009551 Ga0105238_10074249 Ga0105238_100742492 121
289 3300013105 Ga0157369_10031427 Ga0157369_100314272 121
290 3300013307 Ga0157372_10057686 Ga0157372_100576865 121
291 3300025912 Ga0207707_10009028 Ga0207707_1000902811 121
292 3300025917 Ga0207660_10397835 Ga0207660_103978352 121
293 3300025921 Ga0207652_10006487 Ga0207652_100064876 121
294 3300025924 Ga0207694_10322203 Ga0207694_103222033 121
295 3300025944 Ga0207661_10006552 Ga0207661_100065528 121
296 3300025949 Ga0207667_10324442 Ga0207667_103244422 121
297 3300025960 Ga0207651_11205443 Ga0207651_112054432 121
298 3300026116 Ga0207674_10182859 Ga0207674_101828593 121
299 3300028379 Ga0268266_10139059 Ga0268266_101390591 121
300 3300044693 Ga0466961_0676360 Ga0466961_0676360_48_464 121
301 3300048906 Ga0496103_0423420 Ga0496103_0423420_165_581 121
302 iso_pu_bacteria 2513237096 2513660593 121
303 iso_pu_bacteria 2513237145 2513922358 121
304 iso_pu_bacteria 2524023228 2524538863 121
305 iso_pu_bacteria 2876808645 2876816021 121
306 iso_pu_bacteria 2879110137 2879115214 121
307 iso_pu_bacteria 2889033259 2889041146 121
308 iso_pu_bacteria 2904699407 2904700603 121
309 iso_pu_bacteria 2904699407 2904701011 121
310 iso_pu_bacteria 8006964411 8006964552 121
311 iso_pu_bacteria 8006984368 8006987744 121
312 3300038443 Ga0395901_0127479 Ga0395901_0127479_1786_2202 122
313 3300041459 Ga0451800_0207391 Ga0451800_0207391_192_587 122
314 3300048922 Ga0496119_0082993 Ga0496119_0082993_690_1106 122
315 3300048924 Ga0496121_0008179 Ga0496121_0008179_11282_11698 122
316 3300005347 Ga0070668_100248878 Ga0070668_1002488781 123
317 3300005434 Ga0070709_10982653 Ga0070709_109826532 123
318 3300005435 Ga0070714_101213080 Ga0070714_1012130802 123
319 3300005436 Ga0070713_101313351 Ga0070713_1013133511 123
320 3300005439 Ga0070711_100142859 Ga0070711_1001428592 123
321 3300005546 Ga0070696_101745263 Ga0070696_1017452631 123
322 3300009553 Ga0105249_11776603 Ga0105249_117766032 123
323 3300025928 Ga0207700_11038960 Ga0207700_110389602 123
324 3300025938 Ga0207704_10321281 Ga0207704_103212811 123
325 3300025939 Ga0207665_10125470 Ga0207665_101254703 123
326 3300025972 Ga0207668_10647444 Ga0207668_106474442 123
327 3300026089 Ga0207648_10611248 Ga0207648_106112481 123
328 3300046472 Ga0495580_0299719 Ga0495580_0299719_614_1030 123
329 3300048903 Ga0496100_0258539 Ga0496100_0258539_131_526 123
330 3300048918 Ga0496115_0116520 Ga0496115_0116520_583_999 123
331 3300010375 Ga0105239_12878628 Ga0105239_128786282 124
332 3300013308 Ga0157375_10464067 Ga0157375_104640672 124
333 3300014325 Ga0163163_10148521 Ga0163163_101485213 124
334 3300021377 Ga0213874_10017730 Ga0213874_100177302 124
335 3300021384 Ga0213876_10009595 Ga0213876_100095953 124
336 3300025936 Ga0207670_10333318 Ga0207670_103333182 124
337 3300031824 Ga0307413_10307994 Ga0307413_103079942 124
338 3300031995 Ga0307409_100655746 Ga0307409_1006557462 124
339 3300032005 Ga0307411_10500567 Ga0307411_105005672 124
340 3300032126 Ga0307415_101095065 Ga0307415_1010950652 124
341 3300039438 Ga0436360_1096672 Ga0436360_1096672_2607_3023 124
342 3300039450 Ga0436363_0199614 Ga0436363_0199614_1470_1862 124
343 3300041459 Ga0451800_0366943 Ga0451800_0366943_89_505 124
344 3300005365 Ga0070688_100285441 Ga0070688_1002854411 125
345 3300005437 Ga0070710_10381949 Ga0070710_103819492 125
346 3300005466 Ga0070685_11197068 Ga0070685_111970681 125
347 3300005548 Ga0070665_100396663 Ga0070665_1003966632 125
348 3300005617 Ga0068859_101034646 Ga0068859_1010346462 125
349 3300005718 Ga0068866_10885304 Ga0068866_108853042 125
350 3300005719 Ga0068861_100557694 Ga0068861_1005576942 125
351 3300005981 Ga0081538_10008705 Ga0081538_100087056 125
352 3300006175 Ga0070712_100151969 Ga0070712_1001519693 125
353 3300006175 Ga0070712_101310831 Ga0070712_1013108311 125
354 3300006931 Ga0097620_101034440 Ga0097620_1010344402 125
355 3300009101 Ga0105247_11257300 Ga0105247_112573002 125
356 3300009174 Ga0105241_10904846 Ga0105241_109048462 125
357 3300009176 Ga0105242_12226343 Ga0105242_122263432 125
358 3300013297 Ga0157378_10307533 Ga0157378_103075333 125
359 3300013306 Ga0163162_11306753 Ga0163162_113067531 125
360 3300014325 Ga0163163_12831396 Ga0163163_128313962 125
361 3300014326 Ga0157380_10407592 Ga0157380_104075922 125
362 3300017792 Ga0163161_11742194 Ga0163161_117421942 125
363 3300025898 Ga0207692_11051946 Ga0207692_110519462 125
364 3300025899 Ga0207642_10495315 Ga0207642_104953152 125
365 3300025901 Ga0207688_10241532 Ga0207688_102415322 125
366 3300025904 Ga0207647_10227190 Ga0207647_102271902 125
367 3300025928 Ga0207700_10456768 Ga0207700_104567681 125
368 3300025931 Ga0207644_10943218 Ga0207644_109432181 125
369 3300025937 Ga0207669_10967788 Ga0207669_109677882 125
370 3300026121 Ga0207683_11202883 Ga0207683_112028832 125
371 3300028379 Ga0268266_10373890 Ga0268266_103738903 125
372 3300031616 Ga0307508_10742071 Ga0307508_107420711 125
373 3300031731 Ga0307405_10344638 Ga0307405_103446381 125
374 3300031903 Ga0307407_11120210 Ga0307407_111202101 125
375 3300033442 Ga0315911_1000003 Ga0315911_100000358 125
376 3300033442 Ga0315911_1000026 Ga0315911_1000026106 125
377 3300038443 Ga0395901_0485687 Ga0395901_0485687_808_1203 125
378 3300042157 Ga0439458_0196168 Ga0439458_0196168_40_435 125
379 3300044842 Ga0466957_0042280 Ga0466957_0042280_1101_1496 125
380 3300046515 Ga0495620_0284056 Ga0495620_0284056_213_608 125
381 3300046616 Ga0495668_0515042 Ga0495668_0515042_222_617 125
382 3300048904 Ga0496101_0096110 Ga0496101_0096110_1308_1703 125
383 3300048905 Ga0496102_0352023 Ga0496102_0352023_64_459 125
384 3300048905 Ga0496102_0672939 Ga0496102_0672939_101_496 125
385 3300048907 Ga0496104_0652439 Ga0496104_0652439_188_583 125
386 3300048911 Ga0496108_1005373 Ga0496108_1005373_201_596 125
387 3300048914 Ga0496111_0360459 Ga0496111_0360459_64_459 125
388 3300048915 Ga0496112_0026432 Ga0496112_0026432_1065_1460 125
389 3300048917 Ga0496114_1305904 Ga0496114_1305904_78_473 125
390 3300048918 Ga0496115_0194733 Ga0496115_0194733_1187_1582 125
391 3300048918 Ga0496115_0814624 Ga0496115_0814624_86_481 125
392 3300048929 Ga0496126_0073544 Ga0496126_0073544_1476_1871 125
393 3300049574 Ga0501038_0951768 Ga0501038_0951768_150_545 125
394 3300049822 Ga0501035_0643931 Ga0501035_0643931_388_783 125
395 3300053096 Ga0500641_0069021 Ga0500641_0069021_540_935 125
396 3300053118 Ga0500594_0308749 Ga0500594_0308749_118_513 125
397 3300053151 Ga0500604_0178963 Ga0500604_0178963_141_536 125
398 3300005458 Ga0070681_10013969 Ga0070681_100139696 126
399 3300005530 Ga0070679_100065969 Ga0070679_1000659693 126
400 3300025912 Ga0207707_10025826 Ga0207707_100258263 126
401 3300025921 Ga0207652_10126815 Ga0207652_101268153 126
402 3300046517 Ga0495630_0400110 Ga0495630_0400110_523_939 126
403 3300046681 Ga0495647_0327940 Ga0495647_0327940_182_598 126
404 3300053084 Ga0495595_0145146 Ga0495595_0145146_732_1148 126
405 3300003659 JGI25404J52841_10064688 JGI25404J52841_100646882 127
406 3300005983 Ga0081540_1018111 Ga0081540_10181116 127
407 3300046471 Ga0495650_0065530 Ga0495650_0065530_319_720 127
408 3300005331 Ga0070670_100286418 Ga0070670_1002864181 128
409 3300005333 Ga0070677_10592441 Ga0070677_105924412 128
410 3300005544 Ga0070686_100922270 Ga0070686_1009222702 128
411 3300009101 Ga0105247_11303288 Ga0105247_113032881 128
412 3300009148 Ga0105243_10453688 Ga0105243_104536883 128
413 3300046507 Ga0495606_0022235 Ga0495606_0022235_3387_3803 128
414 3300046537 Ga0495598_0146206 Ga0495598_0146206_271_687 128
415 iso_pu_bacteria 2513237161 2514017537 128
416 iso_pu_bacteria 2515154112 2515628706 128
417 iso_pu_bacteria 2617270741 2617375032 128
418 iso_pu_bacteria 2791355197 2793066151 128
419 iso_pu_bacteria 2791355199 2793081383 128
420 iso_pu_bacteria 2802429603 2805922360 128
421 iso_pu_bacteria 2824704595 2824706182 128
422 iso_pu_bacteria 2824732956 2824737236 128
423 iso_pu_bacteria 2824746037 2824751867 128
424 iso_pu_bacteria 2824753945 2824758692 128
425 iso_pu_bacteria 2824763712 2824769028 128
426 iso_pu_bacteria 2841966195 2841973444 128
427 iso_pu_bacteria 2841974524 2841982467 128
428 iso_pu_bacteria 2841983080 2841988270 128
429 iso_pu_bacteria 2847939898 2847942583 128
430 iso_pu_bacteria 2874590934 2874595879 128
431 iso_pu_bacteria 2874604998 2874609304 128
432 iso_pu_bacteria 2874645413 2874649960 128
433 iso_pu_bacteria 2876771140 2876775514 128
434 iso_pu_bacteria 2876818435 2876826134 128
435 iso_pu_bacteria 2879074833 2879079399 128
436 iso_pu_bacteria 2879127579 2879132358 128
437 iso_pu_bacteria 2879142872 2879144443 128
438 iso_pu_bacteria 2885383462 2885390939 128
439 iso_pu_bacteria 2904711408 2904720205 128
440 iso_pu_bacteria 2906635258 2906639461 128
441 iso_pu_bacteria 2906660503 2906662631 128
442 iso_pu_bacteria 2908775508 2908777517 128
443 iso_pu_bacteria 2929615660 2929616018 128
444 iso_pu_bacteria 2929624759 2929624762 128
445 iso_pu_bacteria 2933577622 2933578695 128
446 iso_pu_bacteria 2935777560 2935784855 128
447 iso_pu_bacteria 2935908558 2935910574 128
448 iso_pu_bacteria 2935916978 2935918013 128
449 iso_pu_bacteria 2935926038 2935927515 128
450 iso_pu_bacteria 2935934488 2935936614 128
451 iso_pu_bacteria 2935942939 2935943834 128
452 iso_pu_bacteria 2935951376 2935952271 128
453 iso_pu_bacteria 2935967501 2935969111 128
454 iso_pu_bacteria 2935975950 2935979636 128
455 iso_pu_bacteria 3005587118 3005592059 128
456 iso_pu_bacteria 8016603502 8016609959 128
457 iso_pu_bacteria 8016613128 8016614981 128
458 iso_pu_bacteria 8019538911 8019545411 128
459 iso_pu_bacteria 8019619141 8019625972 128
460 iso_pu_bacteria 8019629233 8019636514 128
461 iso_pu_bacteria 8019659431 8019664294 128
462 iso_pu_bacteria 8019668869 8019673877 128
463 iso_pu_bacteria 8019678201 8019682235 128
464 iso_pu_bacteria 8019687851 8019696933 128
465 iso_pu_bacteria 8055742211 8055747666 128
466 3300005983 Ga0081540_1072003 Ga0081540_10720033 129
467 3300035695 Ga0373927_0168177 Ga0373927_0168177_711_1127 129
468 3300045836 Ga0466958_0972058 Ga0466958_0972058_79_486 129
469 3300046455 Ga0495603_0480230 Ga0495603_0480230_246_662 129
470 3300047315 Ga0495581_0486986 Ga0495581_0486986_213_629 129
471 3300048905 Ga0496102_1661710 Ga0496102_1661710_123_539 129
472 3300046491 Ga0495584_0120118 Ga0495584_0120118_341_757 130
473 3300005339 Ga0070660_100734171 Ga0070660_1007341712 131
474 3300005354 Ga0070675_100190447 Ga0070675_1001904472 131
475 3300005356 Ga0070674_100580414 Ga0070674_1005804142 131
476 3300005366 Ga0070659_100510271 Ga0070659_1005102712 131
477 3300005367 Ga0070667_101465595 Ga0070667_1014655952 131
478 3300005457 Ga0070662_100170400 Ga0070662_1001704002 131
479 3300005539 Ga0068853_100170689 Ga0068853_1001706892 131
480 3300005615 Ga0070702_100212412 Ga0070702_1002124123 131
481 3300005844 Ga0068862_100212162 Ga0068862_1002121623 131
482 3300006038 Ga0075365_10038504 Ga0075365_100385045 131
483 3300006042 Ga0075368_10078281 Ga0075368_100782812 131
484 3300006881 Ga0068865_100037882 Ga0068865_1000378822 131
485 3300009098 Ga0105245_10133105 Ga0105245_101331053 131
486 3300009147 Ga0114129_12016198 Ga0114129_120161982 131
487 3300009148 Ga0105243_10040330 Ga0105243_100403302 131
488 3300009545 Ga0105237_10314684 Ga0105237_103146843 131
489 3300009553 Ga0105249_10039959 Ga0105249_100399593 131
490 3300010375 Ga0105239_10090370 Ga0105239_100903702 131
491 3300012507 Ga0157342_1003257 Ga0157342_10032572 131
492 3300013297 Ga0157378_10107381 Ga0157378_101073812 131
493 3300013306 Ga0163162_10252217 Ga0163162_102522173 131
494 3300013308 Ga0157375_10660585 Ga0157375_106605852 131
495 3300014326 Ga0157380_10361200 Ga0157380_103612002 131
496 3300014968 Ga0157379_10502415 Ga0157379_105024152 131
497 3300017792 Ga0163161_10058776 Ga0163161_100587763 131
498 3300025321 Ga0207656_10428218 Ga0207656_104282182 131
499 3300025901 Ga0207688_10125739 Ga0207688_101257392 131
500 3300025907 Ga0207645_10079147 Ga0207645_100791472 131
501 3300025909 Ga0207705_10773693 Ga0207705_107736932 131
502 3300025914 Ga0207671_10193399 Ga0207671_101933992 131
503 3300025919 Ga0207657_10070158 Ga0207657_100701582 131
504 3300025926 Ga0207659_10329419 Ga0207659_103294191 131
505 3300025927 Ga0207687_10193040 Ga0207687_101930403 131
506 3300025932 Ga0207690_10768086 Ga0207690_107680862 131
507 3300025933 Ga0207706_10097952 Ga0207706_100979522 131
508 3300025935 Ga0207709_10029973 Ga0207709_100299733 131
509 3300025938 Ga0207704_10595683 Ga0207704_105956831 131
510 3300025940 Ga0207691_10163139 Ga0207691_101631393 131
511 3300025942 Ga0207689_10125553 Ga0207689_101255532 131
512 3300025972 Ga0207668_10031398 Ga0207668_100313982 131
513 3300025986 Ga0207658_11076990 Ga0207658_110769902 131
514 3300026041 Ga0207639_10126927 Ga0207639_101269273 131
515 3300026067 Ga0207678_10200287 Ga0207678_102002873 131
516 3300026095 Ga0207676_10919796 Ga0207676_109197961 131
517 3300026142 Ga0207698_10030047 Ga0207698_100300473 131
518 3300027866 Ga0209813_10009225 Ga0209813_100092252 131
519 3300028379 Ga0268266_10069221 Ga0268266_100692213 131
520 3300028380 Ga0268265_10127467 Ga0268265_101274672 131
521 3300028381 Ga0268264_10240178 Ga0268264_102401782 131
522 3300031824 Ga0307413_10472007 Ga0307413_104720072 131
523 3300032002 Ga0307416_103054262 Ga0307416_1030542621 131
524 3300048912 Ga0496109_1209995 Ga0496109_1209995_230_643 131
525 3300048918 Ga0496115_0280953 Ga0496115_0280953_193_609 131
526 3300050493 nmdc:mga0k408_273333_c1 nmdc:mga0k408_273333_c1_472_885 131
527 3300050495 nmdc:mga04h51_10760_c1 nmdc:mga04h51_10760_c1_1844_2257 131
528 3300050515 nmdc:mga0a205_1159114_c1 nmdc:mga0a205_1159114_c1_191_607 131
529 3300001991 JGI24743J22301_10115572 JGI24743J22301_101155722 132
530 3300003162 Ga0006778J45830_1084963 Ga0006778J45830_10849632 132
531 3300003308 Ga0006777J48905_1054578 Ga0006777J48905_10545783 132
532 3300003574 Ga0007410J51695_1064914 Ga0007410J51695_10649143 132
533 3300003577 Ga0007416J51690_1044015 Ga0007416J51690_10440153 132
534 3300003579 Ga0007429J51699_1071289 Ga0007429J51699_10712893 132
535 3300003579 Ga0007429J51699_1154310 Ga0007429J51699_11543101 132
536 3300003735 Ga0006780_1023625 Ga0006780_10236253 132
537 3300005327 Ga0070658_10126933 Ga0070658_101269333 132
538 3300005327 Ga0070658_10771235 Ga0070658_107712351 132
539 3300005328 Ga0070676_10382664 Ga0070676_103826642 132
540 3300005329 Ga0070683_100416434 Ga0070683_1004164342 132
541 3300005330 Ga0070690_100183123 Ga0070690_1001831232 132
542 3300005333 Ga0070677_10537169 Ga0070677_105371691 132
543 3300005334 Ga0068869_100047794 Ga0068869_1000477943 132
544 3300005336 Ga0070680_100049518 Ga0070680_1000495183 132
545 3300005337 Ga0070682_100579346 Ga0070682_1005793462 132
546 3300005338 Ga0068868_100599466 Ga0068868_1005994662 132
547 3300005338 Ga0068868_101315879 Ga0068868_1013158792 132
548 3300005344 Ga0070661_100172589 Ga0070661_1001725892 132
549 3300005347 Ga0070668_100014877 Ga0070668_1000148777 132
550 3300005347 Ga0070668_100101567 Ga0070668_1001015672 132
551 3300005353 Ga0070669_100149651 Ga0070669_1001496512 132
552 3300005354 Ga0070675_100337356 Ga0070675_1003373562 132
553 3300005355 Ga0070671_100221363 Ga0070671_1002213632 132
554 3300005356 Ga0070674_100222479 Ga0070674_1002224792 132
555 3300005356 Ga0070674_101657352 Ga0070674_1016573521 132
556 3300005366 Ga0070659_100289221 Ga0070659_1002892211 132
557 3300005438 Ga0070701_10069565 Ga0070701_100695653 132
558 3300005439 Ga0070711_101958290 Ga0070711_1019582901 132
559 3300005440 Ga0070705_100275687 Ga0070705_1002756872 132
560 3300005455 Ga0070663_100113294 Ga0070663_1001132943 132
561 3300005456 Ga0070678_100244971 Ga0070678_1002449712 132
562 3300005457 Ga0070662_101216752 Ga0070662_1012167522 132
563 3300005458 Ga0070681_10041816 Ga0070681_100418162 132
564 3300005459 Ga0068867_100162436 Ga0068867_1001624362 132
565 3300005459 Ga0068867_101060732 Ga0068867_1010607321 132
566 3300005466 Ga0070685_10252617 Ga0070685_102526172 132
567 3300005530 Ga0070679_100102625 Ga0070679_1001026252 132
568 3300005535 Ga0070684_100002306 Ga0070684_1000023069 132
569 3300005539 Ga0068853_100152615 Ga0068853_1001526152 132
570 3300005544 Ga0070686_100060319 Ga0070686_1000603193 132
571 3300005547 Ga0070693_100070890 Ga0070693_1000708903 132
572 3300005548 Ga0070665_100060837 Ga0070665_1000608373 132
573 3300005549 Ga0070704_100876115 Ga0070704_1008761152 132
574 3300005577 Ga0068857_100347177 Ga0068857_1003471772 132
575 3300005578 Ga0068854_100024693 Ga0068854_1000246932 132
576 3300005614 Ga0068856_100986719 Ga0068856_1009867192 132
577 3300005616 Ga0068852_100374412 Ga0068852_1003744122 132
578 3300005617 Ga0068859_101767041 Ga0068859_1017670411 132
579 3300005617 Ga0068859_102927657 Ga0068859_1029276572 132
580 3300005718 Ga0068866_10063758 Ga0068866_100637582 132
581 3300005718 Ga0068866_10210981 Ga0068866_102109812 132
582 3300005719 Ga0068861_100021157 Ga0068861_1000211572 132
583 3300005719 Ga0068861_102330771 Ga0068861_1023307711 132
584 3300005840 Ga0068870_10279628 Ga0068870_102796282 132
585 3300005841 Ga0068863_100276427 Ga0068863_1002764273 132
586 3300005842 Ga0068858_100038892 Ga0068858_1000388922 132
587 3300005842 Ga0068858_100525503 Ga0068858_1005255032 132
588 3300005843 Ga0068860_100519422 Ga0068860_1005194222 132
589 3300005844 Ga0068862_100014309 Ga0068862_1000143095 132
590 3300005844 Ga0068862_100843693 Ga0068862_1008436932 132
591 3300005983 Ga0081540_1005428 Ga0081540_100542816 132
592 3300006042 Ga0075368_10047483 Ga0075368_100474833 132
593 3300006048 Ga0075363_100078217 Ga0075363_1000782172 132
594 3300006051 Ga0075364_10294320 Ga0075364_102943202 132
595 3300006163 Ga0070715_10737294 Ga0070715_107372942 132
596 3300006175 Ga0070712_100031631 Ga0070712_1000316314 132
597 3300006178 Ga0075367_10028058 Ga0075367_100280585 132
598 3300006178 Ga0075367_10070318 Ga0075367_100703182 132
599 3300006195 Ga0075366_10039539 Ga0075366_100395393 132
600 3300006195 Ga0075366_10331988 Ga0075366_103319882 132
601 3300006237 Ga0097621_100304808 Ga0097621_1003048083 132
602 3300006353 Ga0075370_10025596 Ga0075370_100255962 132
603 3300006353 Ga0075370_10046152 Ga0075370_100461524 132
604 3300006358 Ga0068871_100139398 Ga0068871_1001393983 132
605 3300006844 Ga0075428_100478587 Ga0075428_1004785872 132
606 3300006871 Ga0075434_100162551 Ga0075434_1001625511 132
607 3300006871 Ga0075434_100416744 Ga0075434_1004167442 132
608 3300006881 Ga0068865_100109633 Ga0068865_1001096333 132
609 3300006914 Ga0075436_100606798 Ga0075436_1006067981 132
610 3300006931 Ga0097620_101767572 Ga0097620_1017675721 132
611 3300006931 Ga0097620_102927523 Ga0097620_1029275232 132
612 3300007076 Ga0075435_100863691 Ga0075435_1008636912 132
613 3300009093 Ga0105240_10024045 Ga0105240_1002404511 132
614 3300009094 Ga0111539_10215440 Ga0111539_102154403 132
615 3300009094 Ga0111539_12053008 Ga0111539_120530082 132
616 3300009098 Ga0105245_10474194 Ga0105245_104741941 132
617 3300009148 Ga0105243_10007742 Ga0105243_100077427 132
618 3300009148 Ga0105243_10277296 Ga0105243_102772962 132
619 3300009174 Ga0105241_10274436 Ga0105241_102744363 132
620 3300009177 Ga0105248_10950483 Ga0105248_109504832 132
621 3300009545 Ga0105237_10352991 Ga0105237_103529913 132
622 3300009551 Ga0105238_10800313 Ga0105238_108003131 132
623 3300009553 Ga0105249_10021729 Ga0105249_100217297 132
624 3300009553 Ga0105249_10130420 Ga0105249_101304203 132
625 3300009553 Ga0105249_12150800 Ga0105249_121508001 132
626 3300010375 Ga0105239_10030105 Ga0105239_100301053 132
627 3300010375 Ga0105239_10716384 Ga0105239_107163842 132
628 3300010375 Ga0105239_12092110 Ga0105239_120921101 132
629 3300012515 Ga0157338_1051281 Ga0157338_10512811 132
630 3300013100 Ga0157373_10105493 Ga0157373_101054931 132
631 3300013105 Ga0157369_10105763 Ga0157369_101057633 132
632 3300014325 Ga0163163_11040602 Ga0163163_110406021 132
633 3300014326 Ga0157380_10265798 Ga0157380_102657982 132
634 3300014745 Ga0157377_10266568 Ga0157377_102665681 132
635 3300014968 Ga0157379_10353917 Ga0157379_103539172 132
636 3300017792 Ga0163161_10071679 Ga0163161_100716793 132
637 3300020077 Ga0206351_11013810 Ga0206351_110138102 132
638 3300020078 Ga0206352_11346378 Ga0206352_113463782 132
639 3300020080 Ga0206350_10023438 Ga0206350_100234382 132
640 3300020081 Ga0206354_11074111 Ga0206354_110741112 132
641 3300021377 Ga0213874_10175755 Ga0213874_101757551 132
642 3300022467 Ga0224712_10005349 Ga0224712_100053493 132
643 3300025315 Ga0207697_10021935 Ga0207697_100219353 132
644 3300025899 Ga0207642_10167924 Ga0207642_101679242 132
645 3300025900 Ga0207710_10199154 Ga0207710_101991542 132
646 3300025904 Ga0207647_10104056 Ga0207647_101040562 132
647 3300025905 Ga0207685_10228828 Ga0207685_102288281 132
648 3300025905 Ga0207685_10577068 Ga0207685_105770681 132
649 3300025911 Ga0207654_10551346 Ga0207654_105513462 132
650 3300025911 Ga0207654_10741329 Ga0207654_107413292 132
651 3300025912 Ga0207707_10075107 Ga0207707_100751075 132
652 3300025915 Ga0207693_10078197 Ga0207693_100781973 132
653 3300025916 Ga0207663_10143186 Ga0207663_101431863 132
654 3300025917 Ga0207660_10049242 Ga0207660_100492422 132
655 3300025919 Ga0207657_10247049 Ga0207657_102470493 132
656 3300025920 Ga0207649_10190704 Ga0207649_101907043 132
657 3300025921 Ga0207652_10056575 Ga0207652_100565753 132
658 3300025927 Ga0207687_10259478 Ga0207687_102594782 132
659 3300025927 Ga0207687_10865146 Ga0207687_108651461 132
660 3300025931 Ga0207644_10073473 Ga0207644_100734732 132
661 3300025933 Ga0207706_10033391 Ga0207706_100333912 132
662 3300025933 Ga0207706_10360941 Ga0207706_103609411 132
663 3300025935 Ga0207709_10756257 Ga0207709_107562572 132
664 3300025938 Ga0207704_10189435 Ga0207704_101894352 132
665 3300025938 Ga0207704_10610122 Ga0207704_106101222 132
666 3300025941 Ga0207711_10105189 Ga0207711_101051893 132
667 3300025942 Ga0207689_10066836 Ga0207689_100668364 132
668 3300025944 Ga0207661_10014298 Ga0207661_100142988 132
669 3300025944 Ga0207661_10628284 Ga0207661_106282842 132
670 3300025945 Ga0207679_10411920 Ga0207679_104119202 132
671 3300025949 Ga0207667_10323213 Ga0207667_103232132 132
672 3300025960 Ga0207651_10125081 Ga0207651_101250811 132
673 3300025972 Ga0207668_10065283 Ga0207668_100652833 132
674 3300025972 Ga0207668_10440055 Ga0207668_104400552 132
675 3300025981 Ga0207640_10035538 Ga0207640_100355383 132
676 3300025986 Ga0207658_10362026 Ga0207658_103620262 132
677 3300026035 Ga0207703_10070311 Ga0207703_100703115 132
678 3300026035 Ga0207703_10524514 Ga0207703_105245142 132
679 3300026067 Ga0207678_10015089 Ga0207678_100150894 132
680 3300026075 Ga0207708_10627813 Ga0207708_106278132 132
681 3300026078 Ga0207702_10347599 Ga0207702_103475992 132
682 3300026078 Ga0207702_10526278 Ga0207702_105262782 132
683 3300026088 Ga0207641_12606043 Ga0207641_126060431 132
684 3300026089 Ga0207648_11120133 Ga0207648_111201332 132
685 3300026116 Ga0207674_10076505 Ga0207674_100765053 132
686 3300026118 Ga0207675_100016273 Ga0207675_1000162733 132
687 3300026121 Ga0207683_10097453 Ga0207683_100974532 132
688 3300026142 Ga0207698_10463374 Ga0207698_104633743 132
689 3300027866 Ga0209813_10019354 Ga0209813_100193542 132
690 3300028379 Ga0268266_10044298 Ga0268266_100442983 132
691 3300028379 Ga0268266_10469120 Ga0268266_104691203 132
692 3300028380 Ga0268265_10072069 Ga0268265_100720693 132
693 3300028380 Ga0268265_10299764 Ga0268265_102997643 132
694 3300028381 Ga0268264_10443608 Ga0268264_104436081 132
695 3300034820 Ga0373959_0064632 Ga0373959_0064632_310_726 132
696 3300034957 Ga0373938_0188073 Ga0373938_0188073_130_546 132
697 3300035090 Ga0373949_0105097 Ga0373949_0105097_248_664 132
698 3300035092 Ga0373952_0027983 Ga0373952_0027983_799_1215 132
699 3300035207 Ga0373942_0347426 Ga0373942_0347426_28_444 132
700 3300035241 Ga0373961_0169960 Ga0373961_0169960_29_445 132
701 3300035691 Ga0373931_0178331 Ga0373931_0178331_513_929 132
702 3300035691 Ga0373931_0515826 Ga0373931_0515826_36_452 132
703 3300035724 Ga0373933_0129578 Ga0373933_0129578_738_1154 132
704 3300036401 Ga0373937_0247072 Ga0373937_0247072_105_521 132
705 3300039450 Ga0436363_1564895 Ga0436363_1564895_324_740 132
706 3300044656 Ga0466969_0241975 Ga0466969_0241975_102_518 132
707 3300046452 Ga0495617_105053 Ga0495617_105053_261_677 132
708 3300046457 Ga0495590_0026890 Ga0495590_0026890_420_836 132
709 3300046459 Ga0495629_0244590 Ga0495629_0244590_791_1207 132
710 3300046460 Ga0495638_0035574 Ga0495638_0035574_2007_2423 132
711 3300046471 Ga0495650_0322885 Ga0495650_0322885_64_480 132
712 3300046492 Ga0495585_0049388 Ga0495585_0049388_762_1178 132
713 3300046499 Ga0495594_0256606 Ga0495594_0256606_490_906 132
714 3300046499 Ga0495594_0514511 Ga0495594_0514511_228_644 132
715 3300046507 Ga0495606_0005366 Ga0495606_0005366_872_1288 132
716 3300046512 Ga0495610_0092457 Ga0495610_0092457_591_1007 132
717 3300046515 Ga0495620_0026798 Ga0495620_0026798_296_712 132
718 3300046519 Ga0495632_0007139 Ga0495632_0007139_2187_2603 132
719 3300046519 Ga0495632_0025447 Ga0495632_0025447_1672_2088 132
720 3300046522 Ga0495643_0077782 Ga0495643_0077782_604_1020 132
721 3300046523 Ga0495644_0168322 Ga0495644_0168322_223_639 132
722 3300046524 Ga0495648_0296526 Ga0495648_0296526_304_720 132
723 3300046524 Ga0495648_0432600 Ga0495648_0432600_21_437 132
724 3300046536 Ga0495587_0681351 Ga0495587_0681351_75_491 132
725 3300046538 Ga0495609_0118168 Ga0495609_0118168_30_446 132
726 3300046615 Ga0495656_0014517 Ga0495656_0014517_1632_2048 132
727 3300046616 Ga0495668_0008239 Ga0495668_0008239_3359_3775 132
728 3300046648 Ga0495611_0304933 Ga0495611_0304933_58_474 132
729 3300046660 Ga0495625_0023229 Ga0495625_0023229_3572_3988 132
730 3300046674 Ga0495588_0623900 Ga0495588_0623900_32_448 132
731 3300046690 Ga0495624_0146578 Ga0495624_0146578_626_1042 132
732 3300046794 Ga0495589_0066635 Ga0495589_0066635_35_451 132
733 3300047315 Ga0495581_0219857 Ga0495581_0219857_519_935 132
734 3300047318 Ga0495636_0150089 Ga0495636_0150089_135_551 132
735 3300047321 Ga0495676_0160591 Ga0495676_0160591_822_1238 132
736 3300047323 Ga0495683_0239033 Ga0495683_0239033_294_710 132
737 3300047445 Ga0495677_0226369 Ga0495677_0226369_147_563 132
738 3300047446 Ga0495679_150925 Ga0495679_150925_80_496 132
739 3300047469 Ga0495673_0028201 Ga0495673_0028201_1698_2114 132
740 3300048090 Ga0495615_0059580 Ga0495615_0059580_367_783 132
741 3300048903 Ga0496100_0405264 Ga0496100_0405264_462_878 132
742 3300048903 Ga0496100_0428499 Ga0496100_0428499_466_882 132
743 3300048904 Ga0496101_0188632 Ga0496101_0188632_580_996 132
744 3300048904 Ga0496101_0294795 Ga0496101_0294795_118_534 132
745 3300048905 Ga0496102_0054639 Ga0496102_0054639_761_1177 132
746 3300048905 Ga0496102_0520064 Ga0496102_0520064_322_738 132
747 3300048906 Ga0496103_0135065 Ga0496103_0135065_615_1031 132
748 3300048907 Ga0496104_0047343 Ga0496104_0047343_972_1388 132
749 3300048907 Ga0496104_0086944 Ga0496104_0086944_1238_1654 132
750 3300048908 Ga0496105_0073070 Ga0496105_0073070_2150_2566 132
751 3300048909 Ga0496106_0003725 Ga0496106_0003725_9105_9521 132
752 3300048909 Ga0496106_0087570 Ga0496106_0087570_590_1006 132
753 3300048909 Ga0496106_0544051 Ga0496106_0544051_428_844 132
754 3300048910 Ga0496107_0006134 Ga0496107_0006134_5362_5778 132
755 3300048910 Ga0496107_0172635 Ga0496107_0172635_79_495 132
756 3300048911 Ga0496108_0001186 Ga0496108_0001186_17626_18042 132
757 3300048912 Ga0496109_0003816 Ga0496109_0003816_6597_7013 132
758 3300048912 Ga0496109_1827657 Ga0496109_1827657_33_449 132
759 3300048913 Ga0496110_0090350 Ga0496110_0090350_1594_2010 132
760 3300048913 Ga0496110_0539424 Ga0496110_0539424_190_606 132
761 3300048914 Ga0496111_0039399 Ga0496111_0039399_1514_1930 132
762 3300048915 Ga0496112_0049847 Ga0496112_0049847_1554_1970 132
763 3300048915 Ga0496112_0225106 Ga0496112_0225106_873_1289 132
764 3300048916 Ga0496113_0934225 Ga0496113_0934225_60_476 132
765 3300048917 Ga0496114_0072668 Ga0496114_0072668_682_1098 132
766 3300048918 Ga0496115_0044115 Ga0496115_0044115_1618_2034 132
767 3300048918 Ga0496115_0252266 Ga0496115_0252266_255_671 132
768 3300048918 Ga0496115_0284301 Ga0496115_0284301_225_641 132
769 3300048920 Ga0496117_0194942 Ga0496117_0194942_244_660 132
770 3300048921 Ga0496118_0159277 Ga0496118_0159277_630_1046 132
771 3300048921 Ga0496118_0334855 Ga0496118_0334855_115_531 132
772 3300048924 Ga0496121_0188674 Ga0496121_0188674_657_1073 132
773 3300048928 Ga0496125_0226780 Ga0496125_0226780_630_1046 132
774 3300048929 Ga0496126_0276369 Ga0496126_0276369_874_1290 132
775 3300049460 Ga0495682_0022313 Ga0495682_0022313_1872_2288 132
776 3300049460 Ga0495682_0053358 Ga0495682_0053358_1027_1443 132
777 3300049571 Ga0501034_1699070 Ga0501034_1699070_17_433 132
778 3300050491 nmdc:mga00v17_589848_c1 nmdc:mga00v17_589848_c1_227_643 132
779 3300050492 nmdc:mga0yw44_433201_c1 nmdc:mga0yw44_433201_c1_403_819 132
780 3300050493 nmdc:mga0k408_7131_c1 nmdc:mga0k408_7131_c1_3890_4306 132
781 3300050494 nmdc:mga06z11_420504_c1 nmdc:mga06z11_420504_c1_355_771 132
782 3300050495 nmdc:mga04h51_22291_c1 nmdc:mga04h51_22291_c1_307_723 132
783 3300050496 nmdc:mga07m45_11841_c1 nmdc:mga07m45_11841_c1_2729_3145 132
784 3300050496 nmdc:mga07m45_529623_c1 nmdc:mga07m45_529623_c1_211_627 132
785 3300050512 nmdc:mga0n895_1082034_c1 nmdc:mga0n895_1082034_c1_259_675 132
786 3300050512 nmdc:mga0n895_437027_c1 nmdc:mga0n895_437027_c1_443_859 132
787 3300050514 nmdc:mga08x19_475459_c1 nmdc:mga08x19_475459_c1_87_503 132
788 3300053093 Ga0500651_0242053 Ga0500651_0242053_582_998 132
789 3300053134 Ga0500658_0253188 Ga0500658_0253188_18_434 132
790 3300059477 Ga0587084_043493 Ga0587084_043493_289_705 132
791 3300059478 Ga0587093_022736 Ga0587093_022736_402_818 132
792 3300059490 Ga0587066_007530 Ga0587066_007530_1001_1417 132
793 3300059491 Ga0587070_002819 Ga0587070_002819_1522_1938 132
794 3300059492 Ga0587073_0004325 Ga0587073_0004325_1532_1948 132
795 3300059504 Ga0587082_007515 Ga0587082_007515_1008_1424 132
796 3300059505 Ga0587083_0024129 Ga0587083_0024129_655_1071 132
797 3300059506 Ga0587085_003690 Ga0587085_003690_1249_1665 132
798 3300059508 Ga0587088_010239 Ga0587088_010239_885_1301 132
799 3300059510 Ga0587090_001490 Ga0587090_001490_1172_1588 132
800 3300059511 Ga0587091_011803 Ga0587091_011803_872_1288 132
801 3300059623 Ga0587101_034785 Ga0587101_034785_325_741 132
802 3300059630 Ga0587128_006197 Ga0587128_006197_64_480 132
803 3300059640 Ga0587067_045983 Ga0587067_045983_66_482 132
804 3300059641 Ga0587068_037386 Ga0587068_037386_41_457 132
805 3300059642 Ga0587069_007296 Ga0587069_007296_64_480 132
806 3300059643 Ga0587072_033582 Ga0587072_033582_66_482 132
807 3300059645 Ga0587076_009654 Ga0587076_009654_803_1219 132
808 3300059655 Ga0587114_007319 Ga0587114_007319_780_1196 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07332

Phage_holin_3_6

Putative Actinobacterial Holin-X, holin superfamily III

18

134

0.96

Feature Viewer

pLDDT pTM Quality
66.89 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map