F481651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 806 | 283 | 1612 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0098113|Ga0373943_0098113_738_1517 |
| Length | 259 |
| Sequence | VNETLFSQIQRLFERTYAQVGINLEDCLIDRQRCAQLSSLAGASARELSDLARTFLRRADDQLYVGIYYSRWLIEQLERHDPRAGLTDRNIRSLIMFVEEINHALHAALEFKNGRREIGGEDFARNLELQAQVDTYLVLLLFVAFFRKTQRISKTDRRWLRFHLFARQCPDAFADKNLRNRYSEVTELASSYTYFLDTLNGMRRLEEIRRFRSLDYSAKKQHIFALMDNAENKPRLQLEFVVASAAAESRHCLLRHLLC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 131 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 271 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 283 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 6.82 |
| Rhizosphere | 88.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373943_0098113 | 3300035170 | Bacteria | 1528 |
| 2 | SwRhRL3b_contig_2861724 | 2162886006 | Bacteria | 834 |
| 3 | SwRhRL2b_contig_405184 | 2162886007 | Bacteria | 3589 |
| 4 | CNXas_1000023 | 3300000545 | Bacteria | 31795 |
| 5 | JGI24737J22298_10074967 | 3300001990 | Unclassified | 1009 |
| 6 | JGI24743J22301_10020906 | 3300001991 | Eukaryota | 1248 |
| 7 | JGI24035J26624_1002091 | 3300002126 | Bacteria | 1862 |
| 8 | JGI24035J26624_1008118 | 3300002126 | Unclassified | 1025 |
| 9 | JGI25406J46586_10000005 | 3300003203 | Bacteria | 118289 |
| 10 | JGI25406J46586_10028950 | 3300003203 | Bacteria | 2103 |
| 11 | rootH2_10149846 | 3300003320 | Bacteria | 3251 |
| 12 | JGI25404J52841_10032670 | 3300003659 | Bacteria | 1109 |
| 13 | JGI25405J52794_10012476 | 3300003911 | Unclassified | 1637 |
| 14 | JGI25405J52794_10013038 | 3300003911 | Bacteria | 1607 |
| 15 | Ga0065704_10023667 | 3300005289 | Bacteria | 1895 |
| 16 | Ga0065704_10087740 | 3300005289 | Bacteria | 2998 |
| 17 | Ga0065704_10118197 | 3300005289 | Bacteria | 1820 |
| 18 | Ga0065712_10000860 | 3300005290 | Bacteria | 7736 |
| 19 | Ga0065712_10017080 | 3300005290 | Bacteria | 1389 |
| 20 | Ga0065712_10027830 | 3300005290 | Bacteria | 1098 |
| 21 | Ga0065712_10072993 | 3300005290 | Bacteria | 4533 |
| 22 | Ga0065712_10098013 | 3300005290 | Unclassified | 2133 |
| 23 | Ga0065712_10103954 | 3300005290 | Bacteria | 1973 |
| 24 | Ga0065715_10024520 | 3300005293 | Unclassified | 1271 |
| 25 | Ga0065715_10089137 | 3300005293 | Bacteria | 13653 |
| 26 | Ga0065715_10178837 | 3300005293 | Bacteria | 1491 |
| 27 | Ga0065715_10187515 | 3300005293 | Bacteria | 1436 |
| 28 | Ga0065715_10197118 | 3300005293 | Bacteria | 1381 |
| 29 | Ga0065707_10012925 | 3300005295 | Bacteria | 1927 |
| 30 | Ga0065707_10029388 | 3300005295 | Unclassified | 1206 |
| 31 | Ga0065707_10136549 | 3300005295 | Bacteria | 1833 |
| 32 | Ga0065707_10145514 | 3300005295 | Unclassified | 1718 |
| 33 | Ga0070658_10007327 | 3300005327 | Bacteria | 8909 |
| 34 | Ga0070658_10622171 | 3300005327 | Unclassified | 936 |
| 35 | Ga0070676_10000532 | 3300005328 | Bacteria | 18338 |
| 36 | Ga0070676_10004370 | 3300005328 | Bacteria | 7429 |
| 37 | Ga0070676_10019534 | 3300005328 | Bacteria | 3772 |
| 38 | Ga0070676_10237821 | 3300005328 | Bacteria | 1210 |
| 39 | Ga0070683_100581688 | 3300005329 | Unclassified | 1071 |
| 40 | Ga0070690_100370252 | 3300005330 | Bacteria | 1045 |
| 41 | Ga0070670_100033134 | 3300005331 | Unclassified | 4450 |
| 42 | Ga0070670_100040914 | 3300005331 | Unclassified | 3983 |
| 43 | Ga0070670_100075177 | 3300005331 | Unclassified | 2903 |
| 44 | Ga0070670_100178383 | 3300005331 | Bacteria | 1844 |
| 45 | Ga0070670_100195629 | 3300005331 | Unclassified | 1756 |
| 46 | Ga0070670_100751983 | 3300005331 | Bacteria | 878 |
| 47 | Ga0070677_10091378 | 3300005333 | Unclassified | 1325 |
| 48 | Ga0068869_100037030 | 3300005334 | Bacteria | 3467 |
| 49 | Ga0068869_100567605 | 3300005334 | Unclassified | 955 |
| 50 | Ga0070666_10011900 | 3300005335 | Bacteria | 5472 |
| 51 | Ga0070666_10014502 | 3300005335 | Bacteria | 5020 |
| 52 | Ga0070666_10054050 | 3300005335 | Unclassified | 2709 |
| 53 | Ga0070680_100026741 | 3300005336 | Bacteria | 4615 |
| 54 | Ga0068868_100024925 | 3300005338 | Bacteria | 4543 |
| 55 | Ga0068868_100033756 | 3300005338 | Bacteria | 3946 |
| 56 | Ga0068868_100046856 | 3300005338 | Unclassified | 3384 |
| 57 | Ga0068868_100258564 | 3300005338 | Bacteria | 1467 |
| 58 | Ga0068868_100470569 | 3300005338 | Unclassified | 1096 |
| 59 | Ga0070660_100038563 | 3300005339 | Bacteria | 3628 |
| 60 | Ga0070660_100053625 | 3300005339 | Unclassified | 3111 |
| 61 | Ga0070689_100020753 | 3300005340 | Bacteria | 4879 |
| 62 | Ga0070689_100103652 | 3300005340 | Bacteria | 2255 |
| 63 | Ga0070689_100135109 | 3300005340 | Bacteria | 1980 |
| 64 | Ga0070689_100142878 | 3300005340 | Bacteria | 1926 |
| 65 | Ga0070689_100203401 | 3300005340 | Bacteria | 1618 |
| 66 | Ga0070689_100402016 | 3300005340 | Unclassified | 1158 |
| 67 | Ga0070689_100743743 | 3300005340 | Unclassified | 859 |
| 68 | Ga0070687_100034519 | 3300005343 | Bacteria | 2504 |
| 69 | Ga0070687_100250697 | 3300005343 | Bacteria | 1100 |
| 70 | Ga0070687_100320441 | 3300005343 | Bacteria | 990 |
| 71 | Ga0070661_100041414 | 3300005344 | Bacteria | 3362 |
| 72 | Ga0070692_10158022 | 3300005345 | Bacteria | 1296 |
| 73 | Ga0070668_100006274 | 3300005347 | Bacteria | 8800 |
| 74 | Ga0070668_100009678 | 3300005347 | Bacteria | 7147 |
| 75 | Ga0070668_100011711 | 3300005347 | Bacteria | 6531 |
| 76 | Ga0070668_100078289 | 3300005347 | Unclassified | 2585 |
| 77 | Ga0070668_100495812 | 3300005347 | Bacteria | 1056 |
| 78 | Ga0070669_100004757 | 3300005353 | Bacteria | 9791 |
| 79 | Ga0070669_100054557 | 3300005353 | Bacteria | 2927 |
| 80 | Ga0070669_100058956 | 3300005353 | Unclassified | 2818 |
| 81 | Ga0070669_100230954 | 3300005353 | Unclassified | 1466 |
| 82 | Ga0070669_100364713 | 3300005353 | Bacteria | 1175 |
| 83 | Ga0070675_100011878 | 3300005354 | Bacteria | 6824 |
| 84 | Ga0070675_100023765 | 3300005354 | Unclassified | 4904 |
| 85 | Ga0070675_100043724 | 3300005354 | Bacteria | 3662 |
| 86 | Ga0070675_100057713 | 3300005354 | Bacteria | 3201 |
| 87 | Ga0070675_100063071 | 3300005354 | Bacteria | 3063 |
| 88 | Ga0070675_100102510 | 3300005354 | Unclassified | 2411 |
| 89 | Ga0070675_100106835 | 3300005354 | Bacteria | 2363 |
| 90 | Ga0070675_100144852 | 3300005354 | Bacteria | 2033 |
| 91 | Ga0070675_100150832 | 3300005354 | Bacteria | 1993 |
| 92 | Ga0070675_100220248 | 3300005354 | Bacteria | 1652 |
| 93 | Ga0070675_100414310 | 3300005354 | Unclassified | 1204 |
| 94 | Ga0070675_100842133 | 3300005354 | Bacteria | 839 |
| 95 | Ga0070671_100011573 | 3300005355 | Bacteria | 7096 |
| 96 | Ga0070671_100096670 | 3300005355 | Unclassified | 2477 |
| 97 | Ga0070671_100146020 | 3300005355 | Bacteria | 1996 |
| 98 | Ga0070671_100147873 | 3300005355 | Bacteria | 1983 |
| 99 | Ga0070671_100213497 | 3300005355 | Unclassified | 1637 |
| 100 | Ga0070671_100376014 | 3300005355 | Bacteria | 1214 |
| 101 | Ga0070674_100083299 | 3300005356 | Bacteria | 2290 |
| 102 | Ga0070674_100131839 | 3300005356 | Bacteria | 1864 |
| 103 | Ga0070673_100027043 | 3300005364 | Unclassified | 4247 |
| 104 | Ga0070673_100029054 | 3300005364 | Bacteria | 4119 |
| 105 | Ga0070673_100180862 | 3300005364 | Bacteria | 1805 |
| 106 | Ga0070673_100241584 | 3300005364 | Unclassified | 1570 |
| 107 | Ga0070673_100434650 | 3300005364 | Unclassified | 1179 |
| 108 | Ga0070688_100002037 | 3300005365 | Bacteria | 10197 |
| 109 | Ga0070688_100004071 | 3300005365 | Bacteria | 7591 |
| 110 | Ga0070688_100277618 | 3300005365 | Bacteria | 1202 |
| 111 | Ga0070659_100054333 | 3300005366 | Unclassified | 3154 |
| 112 | Ga0070667_100008695 | 3300005367 | Bacteria | 8417 |
| 113 | Ga0070667_100039941 | 3300005367 | Unclassified | 3933 |
| 114 | Ga0070667_100156552 | 3300005367 | Bacteria | 2004 |
| 115 | Ga0070667_100230640 | 3300005367 | Bacteria | 1651 |
| 116 | Ga0070667_100357165 | 3300005367 | Bacteria | 1324 |
| 117 | Ga0070667_100398494 | 3300005367 | Bacteria | 1252 |
| 118 | Ga0070709_10036549 | 3300005434 | Bacteria | 2993 |
| 119 | Ga0070709_10151845 | 3300005434 | Unclassified | 1601 |
| 120 | Ga0070709_10181957 | 3300005434 | Bacteria | 1477 |
| 121 | Ga0070714_100062398 | 3300005435 | Bacteria | 3203 |
| 122 | Ga0070713_100023951 | 3300005436 | Unclassified | 4747 |
| 123 | Ga0070713_100035001 | 3300005436 | Bacteria | 4041 |
| 124 | Ga0070710_10051552 | 3300005437 | Bacteria | 2311 |
| 125 | Ga0070710_10143876 | 3300005437 | Bacteria | 1465 |
| 126 | Ga0070710_10219430 | 3300005437 | Unclassified | 1209 |
| 127 | Ga0070710_10361247 | 3300005437 | Bacteria | 964 |
| 128 | Ga0070711_100001456 | 3300005439 | Bacteria | 13013 |
| 129 | Ga0070711_100024422 | 3300005439 | Bacteria | 3942 |
| 130 | Ga0070711_100025983 | 3300005439 | Unclassified | 3834 |
| 131 | Ga0070711_100087913 | 3300005439 | Bacteria | 2232 |
| 132 | Ga0070705_100006187 | 3300005440 | Bacteria | 5861 |
| 133 | Ga0070705_100168121 | 3300005440 | Unclassified | 1473 |
| 134 | Ga0070705_100180421 | 3300005440 | Unclassified | 1430 |
| 135 | Ga0070708_100071514 | 3300005445 | Bacteria | 3123 |
| 136 | Ga0070708_100134677 | 3300005445 | Bacteria | 2288 |
| 137 | Ga0070708_100135853 | 3300005445 | Bacteria | 2278 |
| 138 | Ga0070708_100191594 | 3300005445 | Bacteria | 1912 |
| 139 | Ga0070708_100227062 | 3300005445 | Bacteria | 1752 |
| 140 | Ga0070708_100463079 | 3300005445 | Unclassified | 1196 |
| 141 | Ga0070663_100159529 | 3300005455 | Bacteria | 1735 |
| 142 | Ga0070663_100457322 | 3300005455 | Unclassified | 1053 |
| 143 | Ga0070663_100466775 | 3300005455 | Bacteria | 1043 |
| 144 | Ga0070678_100018893 | 3300005456 | Bacteria | 4478 |
| 145 | Ga0070678_100021575 | 3300005456 | Bacteria | 4250 |
| 146 | Ga0070678_100167596 | 3300005456 | Unclassified | 1785 |
| 147 | Ga0070678_100659199 | 3300005456 | Unclassified | 939 |
| 148 | Ga0070662_100004788 | 3300005457 | Bacteria | 8573 |
| 149 | Ga0070662_100021507 | 3300005457 | Bacteria | 4405 |
| 150 | Ga0070662_100304999 | 3300005457 | Unclassified | 1294 |
| 151 | Ga0070662_100444590 | 3300005457 | Bacteria | 1075 |
| 152 | Ga0070681_10047395 | 3300005458 | Bacteria | 4296 |
| 153 | Ga0068867_100138571 | 3300005459 | Bacteria | 1899 |
| 154 | Ga0068867_100566479 | 3300005459 | Unclassified | 986 |
| 155 | Ga0070685_10114100 | 3300005466 | Bacteria | 1669 |
| 156 | Ga0070706_100001307 | 3300005467 | Bacteria | 26565 |
| 157 | Ga0070706_100027211 | 3300005467 | Bacteria | 5262 |
| 158 | Ga0070706_100032192 | 3300005467 | Unclassified | 4836 |
| 159 | Ga0070706_100042736 | 3300005467 | Bacteria | 4187 |
| 160 | Ga0070706_100061826 | 3300005467 | Bacteria | 3459 |
| 161 | Ga0070706_100155959 | 3300005467 | Bacteria | 2131 |
| 162 | Ga0070706_100235151 | 3300005467 | Bacteria | 1711 |
| 163 | Ga0070706_100382897 | 3300005467 | Unclassified | 1310 |
| 164 | Ga0070706_100389349 | 3300005467 | Bacteria | 1297 |
| 165 | Ga0070706_100403416 | 3300005467 | Unclassified | 1273 |
| 166 | Ga0070706_100646808 | 3300005467 | Unclassified | 982 |
| 167 | Ga0070706_100653150 | 3300005467 | Unclassified | 976 |
| 168 | Ga0070706_100842431 | 3300005467 | Bacteria | 848 |
| 169 | Ga0070707_100013538 | 3300005468 | Bacteria | 7633 |
| 170 | Ga0070707_100014183 | 3300005468 | Bacteria | 7468 |
| 171 | Ga0070707_100017595 | 3300005468 | Bacteria | 6723 |
| 172 | Ga0070707_100023601 | 3300005468 | Bacteria | 5818 |
| 173 | Ga0070707_100039620 | 3300005468 | Bacteria | 4504 |
| 174 | Ga0070707_100057695 | 3300005468 | Unclassified | 3724 |
| 175 | Ga0070707_100073877 | 3300005468 | Bacteria | 3287 |
| 176 | Ga0070707_100081104 | 3300005468 | Bacteria | 3132 |
| 177 | Ga0070707_100166484 | 3300005468 | Bacteria | 2148 |
| 178 | Ga0070707_100235963 | 3300005468 | Bacteria | 1780 |
| 179 | Ga0070707_100523503 | 3300005468 | Unclassified | 1148 |
| 180 | Ga0070707_100586638 | 3300005468 | Unclassified | 1077 |
| 181 | Ga0070707_100589178 | 3300005468 | Bacteria | 1074 |
| 182 | Ga0070698_100000476 | 3300005471 | Bacteria | 42469 |
| 183 | Ga0070698_100001859 | 3300005471 | Bacteria | 23526 |
| 184 | Ga0070698_100007937 | 3300005471 | Bacteria | 11486 |
| 185 | Ga0070698_100042761 | 3300005471 | Bacteria | 4648 |
| 186 | Ga0070698_100045179 | 3300005471 | Bacteria | 4509 |
| 187 | Ga0070698_100228778 | 3300005471 | Unclassified | 1793 |
| 188 | Ga0070698_100316405 | 3300005471 | Unclassified | 1491 |
| 189 | Ga0070698_100507711 | 3300005471 | Unclassified | 1144 |
| 190 | Ga0070698_100732053 | 3300005471 | Unclassified | 932 |
| 191 | Ga0070699_100008608 | 3300005518 | Bacteria | 8841 |
| 192 | Ga0070699_100010237 | 3300005518 | Bacteria | 8113 |
| 193 | Ga0070699_100200718 | 3300005518 | Bacteria | 1773 |
| 194 | Ga0070699_100269318 | 3300005518 | Unclassified | 1524 |
| 195 | Ga0070699_100376594 | 3300005518 | Bacteria | 1281 |
| 196 | Ga0070684_100002754 | 3300005535 | Bacteria | 13005 |
| 197 | Ga0070697_100002854 | 3300005536 | Bacteria | 13291 |
| 198 | Ga0070697_100004951 | 3300005536 | Bacteria | 10224 |
| 199 | Ga0070697_100007131 | 3300005536 | Bacteria | 8692 |
| 200 | Ga0070697_100007454 | 3300005536 | Bacteria | 8518 |
| 201 | Ga0070697_100009154 | 3300005536 | Bacteria | 7736 |
| 202 | Ga0070697_100012623 | 3300005536 | Bacteria | 6617 |
| 203 | Ga0070697_100012771 | 3300005536 | Bacteria | 6579 |
| 204 | Ga0070697_100035473 | 3300005536 | Bacteria | 4023 |
| 205 | Ga0070697_100044349 | 3300005536 | Bacteria | 3601 |
| 206 | Ga0070697_100174287 | 3300005536 | Bacteria | 1821 |
| 207 | Ga0070697_100448443 | 3300005536 | Bacteria | 1124 |
| 208 | Ga0070697_100662361 | 3300005536 | Unclassified | 920 |
| 209 | Ga0068853_100441183 | 3300005539 | Bacteria | 1223 |
| 210 | Ga0070672_100006350 | 3300005543 | Bacteria | 7936 |
| 211 | Ga0070672_100007468 | 3300005543 | Bacteria | 7419 |
| 212 | Ga0070672_100024765 | 3300005543 | Bacteria | 4441 |
| 213 | Ga0070672_100237458 | 3300005543 | Bacteria | 1532 |
| 214 | Ga0070672_100352755 | 3300005543 | Bacteria | 1254 |
| 215 | Ga0070686_100013154 | 3300005544 | Bacteria | 4728 |
| 216 | Ga0070686_100053622 | 3300005544 | Bacteria | 2576 |
| 217 | Ga0070686_100143957 | 3300005544 | Bacteria | 1662 |
| 218 | Ga0070695_100442633 | 3300005545 | Bacteria | 994 |
| 219 | Ga0070695_100577146 | 3300005545 | Bacteria | 880 |
| 220 | Ga0070693_100319126 | 3300005547 | Bacteria | 1053 |
| 221 | Ga0070665_100036142 | 3300005548 | Bacteria | 4970 |
| 222 | Ga0070665_100036880 | 3300005548 | Bacteria | 4916 |
| 223 | Ga0070665_100200329 | 3300005548 | Unclassified | 1997 |
| 224 | Ga0070665_100210793 | 3300005548 | Unclassified | 1944 |
| 225 | Ga0070665_100264623 | 3300005548 | Unclassified | 1721 |
| 226 | Ga0070665_100329791 | 3300005548 | Bacteria | 1531 |
| 227 | Ga0070665_100461342 | 3300005548 | Unclassified | 1280 |
| 228 | Ga0070665_100473926 | 3300005548 | Unclassified | 1262 |
| 229 | Ga0070704_100003074 | 3300005549 | Bacteria | 9505 |
| 230 | Ga0070704_100237769 | 3300005549 | Bacteria | 1489 |
| 231 | Ga0068855_100064704 | 3300005563 | Unclassified | 4265 |
| 232 | Ga0068855_100185329 | 3300005563 | Unclassified | 2351 |
| 233 | Ga0070664_100031456 | 3300005564 | Bacteria | 4434 |
| 234 | Ga0070664_100313109 | 3300005564 | Unclassified | 1421 |
| 235 | Ga0068857_100906545 | 3300005577 | Bacteria | 845 |
| 236 | Ga0068854_100204319 | 3300005578 | Bacteria | 1555 |
| 237 | Ga0068852_100934931 | 3300005616 | Bacteria | 885 |
| 238 | Ga0068859_100126888 | 3300005617 | Unclassified | 2621 |
| 239 | Ga0068859_100370277 | 3300005617 | Bacteria | 1528 |
| 240 | Ga0068864_100070923 | 3300005618 | Bacteria | 3033 |
| 241 | Ga0068864_100337878 | 3300005618 | Bacteria | 1418 |
| 242 | Ga0068864_100576573 | 3300005618 | Unclassified | 1090 |
| 243 | Ga0068866_10018362 | 3300005718 | Bacteria | 3162 |
| 244 | Ga0068866_10057528 | 3300005718 | Bacteria | 2004 |
| 245 | Ga0068866_10410936 | 3300005718 | Bacteria | 875 |
| 246 | Ga0068861_100171460 | 3300005719 | Unclassified | 1799 |
| 247 | Ga0068861_100489031 | 3300005719 | Bacteria | 1110 |
| 248 | Ga0068863_100248995 | 3300005841 | Bacteria | 1716 |
| 249 | Ga0068863_100443939 | 3300005841 | Bacteria | 1273 |
| 250 | Ga0068858_100006676 | 3300005842 | Bacteria | 11224 |
| 251 | Ga0068858_100091306 | 3300005842 | Unclassified | 2834 |
| 252 | Ga0068858_100435046 | 3300005842 | Bacteria | 1263 |
| 253 | Ga0068858_100491542 | 3300005842 | Bacteria | 1185 |
| 254 | Ga0068858_101070375 | 3300005842 | Bacteria | 791 |
| 255 | Ga0068860_100001436 | 3300005843 | Bacteria | 25798 |
| 256 | Ga0068860_100017168 | 3300005843 | Bacteria | 7055 |
| 257 | Ga0068860_100127793 | 3300005843 | Bacteria | 2436 |
| 258 | Ga0068862_100023055 | 3300005844 | Bacteria | 5214 |
| 259 | Ga0068862_100050370 | 3300005844 | Bacteria | 3559 |
| 260 | Ga0068862_100471997 | 3300005844 | Bacteria | 1186 |
| 261 | Ga0081455_10001923 | 3300005937 | Bacteria | 24955 |
| 262 | Ga0081455_10006324 | 3300005937 | Bacteria | 12719 |
| 263 | Ga0081455_10008225 | 3300005937 | Bacteria | 10878 |
| 264 | Ga0081455_10040048 | 3300005937 | Bacteria | 4136 |
| 265 | Ga0081455_10045766 | 3300005937 | Bacteria | 3804 |
| 266 | Ga0081455_10107822 | 3300005937 | Bacteria | 2220 |
| 267 | Ga0081540_1000020 | 3300005983 | Bacteria | 163043 |
| 268 | Ga0081540_1020357 | 3300005983 | Bacteria | 3994 |
| 269 | Ga0081540_1043670 | 3300005983 | Bacteria | 2296 |
| 270 | Ga0081540_1117161 | 3300005983 | Bacteria | 1113 |
| 271 | Ga0081539_10000026 | 3300005985 | Bacteria | 330830 |
| 272 | Ga0081539_10000971 | 3300005985 | Bacteria | 53608 |
| 273 | Ga0081539_10020770 | 3300005985 | Bacteria | 4419 |
| 274 | Ga0081539_10033473 | 3300005985 | Bacteria | 3128 |
| 275 | Ga0081539_10044247 | 3300005985 | Unclassified | 2572 |
| 276 | Ga0081539_10115714 | 3300005985 | Unclassified | 1341 |
| 277 | Ga0070717_10000051 | 3300006028 | Bacteria | 100477 |
| 278 | Ga0070717_10009498 | 3300006028 | Bacteria | 7313 |
| 279 | Ga0070717_10017689 | 3300006028 | Bacteria | 5551 |
| 280 | Ga0070717_10105481 | 3300006028 | Unclassified | 2398 |
| 281 | Ga0070717_10111038 | 3300006028 | Bacteria | 2339 |
| 282 | Ga0070717_10299377 | 3300006028 | Unclassified | 1430 |
| 283 | Ga0070717_10493778 | 3300006028 | Unclassified | 1106 |
| 284 | Ga0070717_10816466 | 3300006028 | Unclassified | 848 |
| 285 | Ga0070715_10028495 | 3300006163 | Bacteria | 2240 |
| 286 | Ga0070716_100154525 | 3300006173 | Unclassified | 1480 |
| 287 | Ga0070716_100225434 | 3300006173 | Bacteria | 1262 |
| 288 | Ga0070712_100005338 | 3300006175 | Bacteria | 7955 |
| 289 | Ga0070712_100005594 | 3300006175 | Bacteria | 7775 |
| 290 | Ga0070712_100052022 | 3300006175 | Bacteria | 2855 |
| 291 | Ga0070712_100310730 | 3300006175 | Bacteria | 1279 |
| 292 | Ga0070712_100543255 | 3300006175 | Bacteria | 978 |
| 293 | Ga0075362_10066651 | 3300006177 | Unclassified | 1637 |
| 294 | Ga0075362_10187265 | 3300006177 | Unclassified | 1004 |
| 295 | Ga0075366_10094977 | 3300006195 | Unclassified | 1787 |
| 296 | Ga0097621_100012664 | 3300006237 | Bacteria | 6263 |
| 297 | Ga0097621_100055102 | 3300006237 | Bacteria | 3246 |
| 298 | Ga0097621_100416609 | 3300006237 | Bacteria | 1205 |
| 299 | Ga0075370_10002788 | 3300006353 | Bacteria | 8192 |
| 300 | Ga0068871_100060275 | 3300006358 | Unclassified | 3095 |
| 301 | Ga0068871_100302244 | 3300006358 | Bacteria | 1405 |
| 302 | Ga0068871_100316426 | 3300006358 | Bacteria | 1373 |
| 303 | Ga0075428_100086210 | 3300006844 | Unclassified | 3425 |
| 304 | Ga0075434_100076522 | 3300006871 | Unclassified | 3342 |
| 305 | Ga0075434_100159613 | 3300006871 | Bacteria | 2275 |
| 306 | Ga0068865_100020780 | 3300006881 | Bacteria | 4261 |
| 307 | Ga0068865_100542204 | 3300006881 | Bacteria | 976 |
| 308 | Ga0075436_100066690 | 3300006914 | Unclassified | 2488 |
| 309 | Ga0075436_100074322 | 3300006914 | Unclassified | 2353 |
| 310 | Ga0075436_100107497 | 3300006914 | Bacteria | 1946 |
| 311 | Ga0097620_100126884 | 3300006931 | Unclassified | 2621 |
| 312 | Ga0097620_100370274 | 3300006931 | Bacteria | 1528 |
| 313 | Ga0075435_100231145 | 3300007076 | Unclassified | 1571 |
| 314 | Ga0075435_100614245 | 3300007076 | Unclassified | 943 |
| 315 | Ga0099795_10157351 | 3300007788 | Unclassified | 935 |
| 316 | Ga0105240_10000026 | 3300009093 | Bacteria | 355569 |
| 317 | Ga0105240_10145769 | 3300009093 | Bacteria | 2825 |
| 318 | Ga0111539_10092141 | 3300009094 | Unclassified | 3561 |
| 319 | Ga0111539_10111798 | 3300009094 | Bacteria | 3205 |
| 320 | Ga0111539_10229036 | 3300009094 | Unclassified | 2164 |
| 321 | Ga0105245_10010117 | 3300009098 | Bacteria | 8214 |
| 322 | Ga0105245_10039610 | 3300009098 | Bacteria | 4194 |
| 323 | Ga0105245_10040267 | 3300009098 | Bacteria | 4162 |
| 324 | Ga0105245_10160744 | 3300009098 | Bacteria | 2131 |
| 325 | Ga0105245_10386990 | 3300009098 | Bacteria | 1394 |
| 326 | Ga0105245_10830892 | 3300009098 | Bacteria | 963 |
| 327 | Ga0114129_10008229 | 3300009147 | Bacteria | 14870 |
| 328 | Ga0114129_10251643 | 3300009147 | Bacteria | 2371 |
| 329 | Ga0114129_10922365 | 3300009147 | Unclassified | 1105 |
| 330 | Ga0105243_10751269 | 3300009148 | Bacteria | 956 |
| 331 | Ga0105242_10007342 | 3300009176 | Bacteria | 8483 |
| 332 | Ga0105248_10624579 | 3300009177 | Unclassified | 1216 |
| 333 | Ga0105237_10131140 | 3300009545 | Bacteria | 2501 |
| 334 | Ga0105238_10177429 | 3300009551 | Unclassified | 2107 |
| 335 | Ga0105249_10009152 | 3300009553 | Bacteria | 8659 |
| 336 | Ga0105249_10021031 | 3300009553 | Bacteria | 5840 |
| 337 | Ga0105249_10617793 | 3300009553 | Unclassified | 1139 |
| 338 | Ga0099796_10046980 | 3300010159 | Unclassified | 1484 |
| 339 | Ga0099796_10203152 | 3300010159 | Unclassified | 805 |
| 340 | Ga0105239_10014044 | 3300010375 | Bacteria | 8890 |
| 341 | Ga0105239_10090610 | 3300010375 | Bacteria | 3373 |
| 342 | Ga0105239_10256900 | 3300010375 | Bacteria | 1963 |
| 343 | Ga0105239_10816769 | 3300010375 | Bacteria | 1068 |
| 344 | Ga0105246_10238054 | 3300011119 | Unclassified | 1437 |
| 345 | Ga0105246_10447833 | 3300011119 | Bacteria | 1084 |
| 346 | Ga0157373_10422298 | 3300013100 | Unclassified | 957 |
| 347 | Ga0157369_10063759 | 3300013105 | Bacteria | 3970 |
| 348 | Ga0157374_10000028 | 3300013296 | Bacteria | 213725 |
| 349 | Ga0157374_10001376 | 3300013296 | Bacteria | 20664 |
| 350 | Ga0157374_10025392 | 3300013296 | Bacteria | 5320 |
| 351 | Ga0157374_10042444 | 3300013296 | Bacteria | 4195 |
| 352 | Ga0157374_10054351 | 3300013296 | Unclassified | 3735 |
| 353 | Ga0157374_10107811 | 3300013296 | Unclassified | 2677 |
| 354 | Ga0157374_10124481 | 3300013296 | Unclassified | 2491 |
| 355 | Ga0157374_10142515 | 3300013296 | Unclassified | 2327 |
| 356 | Ga0157374_10208759 | 3300013296 | Unclassified | 1914 |
| 357 | Ga0157374_10236857 | 3300013296 | Bacteria | 1794 |
| 358 | Ga0157374_10400289 | 3300013296 | Bacteria | 1370 |
| 359 | Ga0157374_10549948 | 3300013296 | Unclassified | 1162 |
| 360 | Ga0157378_10010835 | 3300013297 | Bacteria | 7972 |
| 361 | Ga0157378_10039247 | 3300013297 | Bacteria | 4199 |
| 362 | Ga0157378_10089316 | 3300013297 | Bacteria | 2798 |
| 363 | Ga0157378_10093876 | 3300013297 | Bacteria | 2732 |
| 364 | Ga0157378_10101167 | 3300013297 | Bacteria | 2632 |
| 365 | Ga0157378_10149284 | 3300013297 | Bacteria | 2177 |
| 366 | Ga0157378_10201458 | 3300013297 | Bacteria | 1883 |
| 367 | Ga0157378_10225078 | 3300013297 | Unclassified | 1785 |
| 368 | Ga0157378_10462071 | 3300013297 | Unclassified | 1261 |
| 369 | Ga0157378_10468437 | 3300013297 | Bacteria | 1253 |
| 370 | Ga0157378_10747698 | 3300013297 | Bacteria | 1000 |
| 371 | Ga0163162_10023264 | 3300013306 | Bacteria | 6114 |
| 372 | Ga0163162_10031706 | 3300013306 | Bacteria | 5243 |
| 373 | Ga0163162_10093012 | 3300013306 | Bacteria | 3099 |
| 374 | Ga0163162_10429977 | 3300013306 | Unclassified | 1452 |
| 375 | Ga0163162_10478695 | 3300013306 | Unclassified | 1376 |
| 376 | Ga0157372_10018246 | 3300013307 | Bacteria | 7543 |
| 377 | Ga0157372_10105148 | 3300013307 | Bacteria | 3229 |
| 378 | Ga0157372_10319012 | 3300013307 | Bacteria | 1809 |
| 379 | Ga0157372_10470157 | 3300013307 | Bacteria | 1466 |
| 380 | Ga0157372_10566697 | 3300013307 | Bacteria | 1324 |
| 381 | Ga0157372_10950037 | 3300013307 | Unclassified | 996 |
| 382 | Ga0157375_10001199 | 3300013308 | Bacteria | 22351 |
| 383 | Ga0157375_10052028 | 3300013308 | Bacteria | 4025 |
| 384 | Ga0157375_10123174 | 3300013308 | Unclassified | 2705 |
| 385 | Ga0157375_10260468 | 3300013308 | Bacteria | 1896 |
| 386 | Ga0157375_10323496 | 3300013308 | Bacteria | 1707 |
| 387 | Ga0157375_10338929 | 3300013308 | Bacteria | 1669 |
| 388 | Ga0157375_10445094 | 3300013308 | Unclassified | 1461 |
| 389 | Ga0163163_10476810 | 3300014325 | Bacteria | 1309 |
| 390 | Ga0157380_11025498 | 3300014326 | Unclassified | 860 |
| 391 | Ga0157377_10082043 | 3300014745 | Unclassified | 1887 |
| 392 | Ga0157377_10148916 | 3300014745 | Bacteria | 1445 |
| 393 | Ga0157377_10182998 | 3300014745 | Unclassified | 1319 |
| 394 | Ga0157379_10029749 | 3300014968 | Bacteria | 4856 |
| 395 | Ga0157379_10309428 | 3300014968 | Bacteria | 1441 |
| 396 | Ga0157379_10510707 | 3300014968 | Bacteria | 1115 |
| 397 | Ga0157376_10000742 | 3300014969 | Bacteria | 21200 |
| 398 | Ga0157376_10022824 | 3300014969 | Bacteria | 4886 |
| 399 | Ga0157376_10024813 | 3300014969 | Bacteria | 4714 |
| 400 | Ga0157376_10033602 | 3300014969 | Unclassified | 4131 |
| 401 | Ga0157376_10089586 | 3300014969 | Bacteria | 2660 |
| 402 | Ga0157376_10142399 | 3300014969 | Bacteria | 2153 |
| 403 | Ga0182005_1040853 | 3300015265 | Unclassified | 1261 |
| 404 | Ga0163161_10015142 | 3300017792 | Bacteria | 5375 |
| 405 | Ga0163161_10101642 | 3300017792 | Unclassified | 2141 |
| 406 | Ga0213873_10028726 | 3300021358 | Bacteria | 1366 |
| 407 | Ga0213872_10007470 | 3300021361 | Bacteria | 5376 |
| 408 | Ga0213872_10010251 | 3300021361 | Bacteria | 4467 |
| 409 | Ga0213872_10025045 | 3300021361 | Bacteria | 2744 |
| 410 | Ga0213872_10052432 | 3300021361 | Bacteria | 1851 |
| 411 | Ga0213872_10064573 | 3300021361 | Unclassified | 1654 |
| 412 | Ga0213872_10067507 | 3300021361 | Bacteria | 1614 |
| 413 | Ga0213872_10072087 | 3300021361 | Unclassified | 1556 |
| 414 | Ga0213874_10004510 | 3300021377 | Bacteria | 3188 |
| 415 | Ga0213874_10005188 | 3300021377 | Bacteria | 3024 |
| 416 | Ga0213876_10000644 | 3300021384 | Bacteria | 25234 |
| 417 | Ga0213876_10001059 | 3300021384 | Bacteria | 17756 |
| 418 | Ga0213875_10034454 | 3300021388 | Bacteria | 2391 |
| 419 | Ga0213871_10038458 | 3300021441 | Unclassified | 1277 |
| 420 | Ga0213871_10047945 | 3300021441 | Unclassified | 1163 |
| 421 | Ga0213871_10061851 | 3300021441 | Bacteria | 1044 |
| 422 | Ga0207666_1011030 | 3300025271 | Unclassified | 1246 |
| 423 | Ga0207673_1001952 | 3300025290 | Unclassified | 2306 |
| 424 | Ga0207673_1003613 | 3300025290 | Bacteria | 1818 |
| 425 | Ga0207673_1009781 | 3300025290 | Bacteria | 1227 |
| 426 | Ga0209050_1001062 | 3300025298 | Bacteria | 33730 |
| 427 | Ga0207697_10000802 | 3300025315 | Bacteria | 17850 |
| 428 | Ga0207697_10000966 | 3300025315 | Bacteria | 16174 |
| 429 | Ga0207697_10001778 | 3300025315 | Bacteria | 11550 |
| 430 | Ga0207697_10003654 | 3300025315 | Bacteria | 7535 |
| 431 | Ga0207697_10006438 | 3300025315 | Bacteria | 5316 |
| 432 | Ga0207697_10007221 | 3300025315 | Bacteria | 4965 |
| 433 | Ga0207697_10007584 | 3300025315 | Bacteria | 4822 |
| 434 | Ga0207697_10023609 | 3300025315 | Bacteria | 2518 |
| 435 | Ga0207682_10026259 | 3300025893 | Bacteria | 2314 |
| 436 | Ga0207682_10070319 | 3300025893 | Unclassified | 1482 |
| 437 | Ga0207692_10113647 | 3300025898 | Bacteria | 1505 |
| 438 | Ga0207692_10130286 | 3300025898 | Bacteria | 1420 |
| 439 | Ga0207688_10001123 | 3300025901 | Bacteria | 13760 |
| 440 | Ga0207688_10002947 | 3300025901 | Bacteria | 9261 |
| 441 | Ga0207688_10126802 | 3300025901 | Bacteria | 1493 |
| 442 | Ga0207680_10019261 | 3300025903 | Bacteria | 3646 |
| 443 | Ga0207680_10081970 | 3300025903 | Unclassified | 2029 |
| 444 | Ga0207647_10033599 | 3300025904 | Bacteria | 3284 |
| 445 | Ga0207647_10145645 | 3300025904 | Unclassified | 1386 |
| 446 | Ga0207647_10214440 | 3300025904 | Unclassified | 1111 |
| 447 | Ga0207685_10029012 | 3300025905 | Bacteria | 1955 |
| 448 | Ga0207699_10161239 | 3300025906 | Bacteria | 1493 |
| 449 | Ga0207645_10002756 | 3300025907 | Bacteria | 13685 |
| 450 | Ga0207645_10002845 | 3300025907 | Bacteria | 13417 |
| 451 | Ga0207645_10003147 | 3300025907 | Bacteria | 12643 |
| 452 | Ga0207645_10036310 | 3300025907 | Bacteria | 3164 |
| 453 | Ga0207645_10080060 | 3300025907 | Unclassified | 2094 |
| 454 | Ga0207705_10004253 | 3300025909 | Bacteria | 10838 |
| 455 | Ga0207684_10001372 | 3300025910 | Bacteria | 26550 |
| 456 | Ga0207684_10017981 | 3300025910 | Bacteria | 6058 |
| 457 | Ga0207684_10039506 | 3300025910 | Bacteria | 4002 |
| 458 | Ga0207684_10101125 | 3300025910 | Bacteria | 2464 |
| 459 | Ga0207684_10104935 | 3300025910 | Bacteria | 2417 |
| 460 | Ga0207684_10120519 | 3300025910 | Bacteria | 2249 |
| 461 | Ga0207684_10178023 | 3300025910 | Bacteria | 1834 |
| 462 | Ga0207684_10214889 | 3300025910 | Unclassified | 1659 |
| 463 | Ga0207684_10271528 | 3300025910 | Bacteria | 1463 |
| 464 | Ga0207707_10023125 | 3300025912 | Bacteria | 5438 |
| 465 | Ga0207695_10000246 | 3300025913 | Bacteria | 140972 |
| 466 | Ga0207671_10007402 | 3300025914 | Bacteria | 9527 |
| 467 | Ga0207671_10380752 | 3300025914 | Unclassified | 1121 |
| 468 | Ga0207693_10001148 | 3300025915 | Bacteria | 23648 |
| 469 | Ga0207693_10021435 | 3300025915 | Bacteria | 5134 |
| 470 | Ga0207693_10021534 | 3300025915 | Bacteria | 5122 |
| 471 | Ga0207693_10027165 | 3300025915 | Bacteria | 4525 |
| 472 | Ga0207693_10044452 | 3300025915 | Unclassified | 3491 |
| 473 | Ga0207693_10077481 | 3300025915 | Bacteria | 2603 |
| 474 | Ga0207693_10151776 | 3300025915 | Bacteria | 1822 |
| 475 | Ga0207693_10163553 | 3300025915 | Bacteria | 1751 |
| 476 | Ga0207663_10002379 | 3300025916 | Bacteria | 9035 |
| 477 | Ga0207663_10023712 | 3300025916 | Unclassified | 3526 |
| 478 | Ga0207660_10010762 | 3300025917 | Bacteria | 5943 |
| 479 | Ga0207660_10308622 | 3300025917 | Bacteria | 1261 |
| 480 | Ga0207662_10053725 | 3300025918 | Bacteria | 2400 |
| 481 | Ga0207657_10034639 | 3300025919 | Bacteria | 4538 |
| 482 | Ga0207649_10072929 | 3300025920 | Bacteria | 2198 |
| 483 | Ga0207652_10045158 | 3300025921 | Bacteria | 3755 |
| 484 | Ga0207646_10000761 | 3300025922 | Bacteria | 41842 |
| 485 | Ga0207646_10001268 | 3300025922 | Bacteria | 31646 |
| 486 | Ga0207646_10017315 | 3300025922 | Bacteria | 6745 |
| 487 | Ga0207646_10030930 | 3300025922 | Bacteria | 4849 |
| 488 | Ga0207646_10050145 | 3300025922 | Unclassified | 3736 |
| 489 | Ga0207646_10070399 | 3300025922 | Unclassified | 3124 |
| 490 | Ga0207646_10086948 | 3300025922 | Unclassified | 2797 |
| 491 | Ga0207646_10098548 | 3300025922 | Unclassified | 2619 |
| 492 | Ga0207646_10116002 | 3300025922 | Bacteria | 2405 |
| 493 | Ga0207646_10138266 | 3300025922 | Bacteria | 2194 |
| 494 | Ga0207646_10154537 | 3300025922 | Bacteria | 2069 |
| 495 | Ga0207646_10364494 | 3300025922 | Unclassified | 1305 |
| 496 | Ga0207646_10526509 | 3300025922 | Bacteria | 1064 |
| 497 | Ga0207681_10001128 | 3300025923 | Bacteria | 17315 |
| 498 | Ga0207681_10137516 | 3300025923 | Unclassified | 1815 |
| 499 | Ga0207694_10719947 | 3300025924 | Unclassified | 842 |
| 500 | Ga0207650_10043669 | 3300025925 | Unclassified | 3291 |
| 501 | Ga0207650_10165836 | 3300025925 | Unclassified | 1753 |
| 502 | Ga0207650_10212830 | 3300025925 | Bacteria | 1553 |
| 503 | Ga0207659_10013166 | 3300025926 | Bacteria | 5291 |
| 504 | Ga0207659_10014543 | 3300025926 | Bacteria | 5080 |
| 505 | Ga0207659_10028922 | 3300025926 | Bacteria | 3770 |
| 506 | Ga0207659_10066382 | 3300025926 | Unclassified | 2618 |
| 507 | Ga0207659_10086006 | 3300025926 | Unclassified | 2337 |
| 508 | Ga0207659_10105153 | 3300025926 | Bacteria | 2135 |
| 509 | Ga0207659_10120809 | 3300025926 | Bacteria | 2007 |
| 510 | Ga0207659_10152449 | 3300025926 | Bacteria | 1806 |
| 511 | Ga0207659_10547369 | 3300025926 | Bacteria | 983 |
| 512 | Ga0207659_10763213 | 3300025926 | Bacteria | 830 |
| 513 | Ga0207687_10053160 | 3300025927 | Bacteria | 2828 |
| 514 | Ga0207687_10111298 | 3300025927 | Bacteria | 2032 |
| 515 | Ga0207687_10135610 | 3300025927 | Bacteria | 1861 |
| 516 | Ga0207700_10008765 | 3300025928 | Bacteria | 6282 |
| 517 | Ga0207700_10020492 | 3300025928 | Bacteria | 4493 |
| 518 | Ga0207700_10181941 | 3300025928 | Unclassified | 1761 |
| 519 | Ga0207700_10188046 | 3300025928 | Bacteria | 1734 |
| 520 | Ga0207700_10373933 | 3300025928 | Bacteria | 1245 |
| 521 | Ga0207664_10053301 | 3300025929 | Bacteria | 3201 |
| 522 | Ga0207664_10463875 | 3300025929 | Bacteria | 1131 |
| 523 | Ga0207644_10005337 | 3300025931 | Bacteria | 8386 |
| 524 | Ga0207644_10091102 | 3300025931 | Unclassified | 2273 |
| 525 | Ga0207644_10250468 | 3300025931 | Bacteria | 1413 |
| 526 | Ga0207644_10325498 | 3300025931 | Unclassified | 1243 |
| 527 | Ga0207644_10538968 | 3300025931 | Unclassified | 965 |
| 528 | Ga0207690_10243141 | 3300025932 | Bacteria | 1387 |
| 529 | Ga0207706_10014002 | 3300025933 | Bacteria | 7274 |
| 530 | Ga0207706_10015823 | 3300025933 | Bacteria | 6820 |
| 531 | Ga0207706_10044612 | 3300025933 | Bacteria | 3929 |
| 532 | Ga0207706_10115786 | 3300025933 | Bacteria | 2357 |
| 533 | Ga0207706_10259142 | 3300025933 | Unclassified | 1518 |
| 534 | Ga0207706_10259527 | 3300025933 | Unclassified | 1517 |
| 535 | Ga0207706_10333472 | 3300025933 | Unclassified | 1320 |
| 536 | Ga0207670_10005331 | 3300025936 | Bacteria | 7049 |
| 537 | Ga0207670_10038138 | 3300025936 | Unclassified | 3136 |
| 538 | Ga0207670_10095112 | 3300025936 | Bacteria | 2115 |
| 539 | Ga0207670_10167664 | 3300025936 | Bacteria | 1644 |
| 540 | Ga0207670_10380279 | 3300025936 | Unclassified | 1124 |
| 541 | Ga0207704_10262738 | 3300025938 | Unclassified | 1302 |
| 542 | Ga0207704_10385900 | 3300025938 | Bacteria | 1101 |
| 543 | Ga0207665_10010811 | 3300025939 | Bacteria | 5991 |
| 544 | Ga0207665_10015284 | 3300025939 | Bacteria | 5040 |
| 545 | Ga0207665_10031684 | 3300025939 | Bacteria | 3499 |
| 546 | Ga0207665_10037324 | 3300025939 | Unclassified | 3234 |
| 547 | Ga0207665_10120877 | 3300025939 | Unclassified | 1850 |
| 548 | Ga0207665_10282754 | 3300025939 | Bacteria | 1235 |
| 549 | Ga0207665_10509331 | 3300025939 | Bacteria | 931 |
| 550 | Ga0207691_10001964 | 3300025940 | Bacteria | 20104 |
| 551 | Ga0207691_10003946 | 3300025940 | Bacteria | 14408 |
| 552 | Ga0207691_10086745 | 3300025940 | Bacteria | 2808 |
| 553 | Ga0207691_10171002 | 3300025940 | Unclassified | 1903 |
| 554 | Ga0207691_10190967 | 3300025940 | Bacteria | 1786 |
| 555 | Ga0207691_10398230 | 3300025940 | Bacteria | 1174 |
| 556 | Ga0207711_10388373 | 3300025941 | Unclassified | 1296 |
| 557 | Ga0207689_10048953 | 3300025942 | Bacteria | 3487 |
| 558 | Ga0207679_10111958 | 3300025945 | Bacteria | 2156 |
| 559 | Ga0207679_10151802 | 3300025945 | Unclassified | 1886 |
| 560 | Ga0207667_10055512 | 3300025949 | Unclassified | 4164 |
| 561 | Ga0207651_10004486 | 3300025960 | Bacteria | 7043 |
| 562 | Ga0207651_10005563 | 3300025960 | Bacteria | 6487 |
| 563 | Ga0207651_10055413 | 3300025960 | Unclassified | 2723 |
| 564 | Ga0207651_10055961 | 3300025960 | Bacteria | 2712 |
| 565 | Ga0207651_10267238 | 3300025960 | Unclassified | 1407 |
| 566 | Ga0207651_10597131 | 3300025960 | Unclassified | 964 |
| 567 | Ga0207712_10043479 | 3300025961 | Bacteria | 3100 |
| 568 | Ga0207712_10076812 | 3300025961 | Bacteria | 2419 |
| 569 | Ga0207668_10017030 | 3300025972 | Bacteria | 4547 |
| 570 | Ga0207668_10100385 | 3300025972 | Bacteria | 2149 |
| 571 | Ga0207668_10172148 | 3300025972 | Unclassified | 1699 |
| 572 | Ga0207658_10192525 | 3300025986 | Bacteria | 1696 |
| 573 | Ga0207658_10212685 | 3300025986 | Bacteria | 1621 |
| 574 | Ga0207658_10265951 | 3300025986 | Bacteria | 1463 |
| 575 | Ga0207658_10447145 | 3300025986 | Unclassified | 1143 |
| 576 | Ga0207658_10563196 | 3300025986 | Unclassified | 1021 |
| 577 | Ga0207677_10007393 | 3300026023 | Bacteria | 6073 |
| 578 | Ga0207677_10011093 | 3300026023 | Bacteria | 5122 |
| 579 | Ga0207677_10127218 | 3300026023 | Unclassified | 1927 |
| 580 | Ga0207677_10648464 | 3300026023 | Bacteria | 932 |
| 581 | Ga0207703_10004657 | 3300026035 | Bacteria | 11202 |
| 582 | Ga0207703_10018759 | 3300026035 | Bacteria | 5403 |
| 583 | Ga0207703_10166952 | 3300026035 | Unclassified | 1932 |
| 584 | Ga0207703_10545236 | 3300026035 | Bacteria | 1093 |
| 585 | Ga0207639_10424440 | 3300026041 | Bacteria | 1203 |
| 586 | Ga0207678_10010772 | 3300026067 | Bacteria | 8033 |
| 587 | Ga0207678_10097250 | 3300026067 | Bacteria | 2516 |
| 588 | Ga0207708_10077408 | 3300026075 | Bacteria | 2552 |
| 589 | Ga0207702_10260289 | 3300026078 | Bacteria | 1633 |
| 590 | Ga0207641_10154584 | 3300026088 | Unclassified | 2080 |
| 591 | Ga0207641_10403438 | 3300026088 | Bacteria | 1313 |
| 592 | Ga0207648_10014296 | 3300026089 | Bacteria | 7336 |
| 593 | Ga0207676_10147013 | 3300026095 | Bacteria | 2025 |
| 594 | Ga0207675_100396742 | 3300026118 | Unclassified | 1359 |
| 595 | Ga0207675_100752844 | 3300026118 | Bacteria | 986 |
| 596 | Ga0207683_10024023 | 3300026121 | Bacteria | 5246 |
| 597 | Ga0207683_10035809 | 3300026121 | Bacteria | 4317 |
| 598 | Ga0207683_10036759 | 3300026121 | Bacteria | 4265 |
| 599 | Ga0207683_10114128 | 3300026121 | Bacteria | 2420 |
| 600 | Ga0207683_10155538 | 3300026121 | Unclassified | 2065 |
| 601 | Ga0207698_11084107 | 3300026142 | Bacteria | 813 |
| 602 | Ga0268266_10012917 | 3300028379 | Bacteria | 7205 |
| 603 | Ga0268266_10049192 | 3300028379 | Bacteria | 3614 |
| 604 | Ga0268266_10080964 | 3300028379 | Bacteria | 2830 |
| 605 | Ga0268266_10125890 | 3300028379 | Unclassified | 2286 |
| 606 | Ga0268266_10156863 | 3300028379 | Unclassified | 2057 |
| 607 | Ga0268265_10043487 | 3300028380 | Bacteria | 3340 |
| 608 | Ga0268265_10212756 | 3300028380 | Bacteria | 1686 |
| 609 | Ga0268265_10718570 | 3300028380 | Bacteria | 967 |
| 610 | Ga0268264_10000366 | 3300028381 | Bacteria | 67007 |
| 611 | Ga0268264_10145673 | 3300028381 | Unclassified | 2117 |
| 612 | Ga0268264_10230145 | 3300028381 | Bacteria | 1711 |
| 613 | Ga0268264_10262463 | 3300028381 | Bacteria | 1610 |
| 614 | Ga0268264_10854832 | 3300028381 | Unclassified | 911 |
| 615 | Ga0373944_0018025 | 3300035089 | Unclassified | 2013 |
| 616 | Ga0373944_0023106 | 3300035089 | Bacteria | 1812 |
| 617 | Ga0373945_0053597 | 3300035116 | Unclassified | 1489 |
| 618 | Ga0373953_0051101 | 3300035117 | Bacteria | 1671 |
| 619 | Ga0373953_0117552 | 3300035117 | Bacteria | 1128 |
| 620 | Ga0373943_0047061 | 3300035170 | Bacteria | 2107 |
| 621 | Ga0373946_0215480 | 3300035171 | Unclassified | 925 |
| 622 | Ga0373955_0029291 | 3300035172 | Bacteria | 2862 |
| 623 | Ga0373955_0237687 | 3300035172 | Unclassified | 1091 |
| 624 | Ga0373931_0031957 | 3300035691 | Bacteria | 2721 |
| 625 | Ga0373931_0186417 | 3300035691 | Bacteria | 1232 |
| 626 | Ga0373935_0033855 | 3300035692 | Bacteria | 3182 |
| 627 | Ga0373935_0076987 | 3300035692 | Unclassified | 2161 |
| 628 | Ga0373935_0079708 | 3300035692 | Bacteria | 2126 |
| 629 | Ga0373935_0188815 | 3300035692 | Bacteria | 1418 |
| 630 | Ga0373935_0332324 | 3300035692 | Unclassified | 1080 |
| 631 | Ga0373927_0058746 | 3300035695 | Bacteria | 2488 |
| 632 | Ga0373927_0069533 | 3300035695 | Bacteria | 2278 |
| 633 | Ga0373947_0066049 | 3300035725 | Bacteria | 2207 |
| 634 | Ga0373947_0079687 | 3300035725 | Bacteria | 2024 |
| 635 | Ga0373937_0102605 | 3300036401 | Bacteria | 2656 |
| 636 | Ga0373937_0168131 | 3300036401 | Bacteria | 2057 |
| 637 | Ga0373937_0206167 | 3300036401 | Bacteria | 1849 |
| 638 | Ga0373937_0216054 | 3300036401 | Bacteria | 1804 |
| 639 | Ga0373937_0327313 | 3300036401 | Unclassified | 1450 |
| 640 | Ga0373925_0065800 | 3300037068 | Bacteria | 2731 |
| 641 | Ga0373925_0143540 | 3300037068 | Bacteria | 1870 |
| 642 | Ga0395900_0002938 | 3300037418 | Bacteria | 18564 |
| 643 | Ga0395898_0007971 | 3300037466 | Bacteria | 11235 |
| 644 | Ga0395898_0129871 | 3300037466 | Bacteria | 2413 |
| 645 | Ga0395905_0019180 | 3300037471 | Bacteria | 6486 |
| 646 | Ga0395905_0217961 | 3300037471 | Bacteria | 1787 |
| 647 | Ga0436364_0227970 | 3300037853 | Bacteria | 7481 |
| 648 | Ga0436364_0520032 | 3300037853 | Bacteria | 3834 |
| 649 | Ga0436364_0802819 | 3300037853 | Bacteria | 4045 |
| 650 | Ga0395901_0000503 | 3300038443 | Bacteria | 45231 |
| 651 | Ga0395901_0376027 | 3300038443 | Unclassified | 1463 |
| 652 | Ga0436365_0003707 | 3300039437 | Unclassified | 2362 |
| 653 | Ga0436365_0742888 | 3300039437 | Bacteria | 55848 |
| 654 | Ga0436365_0953982 | 3300039437 | Unclassified | 1804 |
| 655 | Ga0436365_0979913 | 3300039437 | Bacteria | 23987 |
| 656 | Ga0436365_1122847 | 3300039437 | Unclassified | 1299 |
| 657 | Ga0436365_1753433 | 3300039437 | Bacteria | 24400 |
| 658 | Ga0436360_0086757 | 3300039438 | Unclassified | 1515 |
| 659 | Ga0436360_0227542 | 3300039438 | Bacteria | 1988 |
| 660 | Ga0436360_0484811 | 3300039438 | Bacteria | 9203 |
| 661 | Ga0436360_0885762 | 3300039438 | Bacteria | 1482 |
| 662 | Ga0436360_1295629 | 3300039438 | Bacteria | 3799 |
| 663 | Ga0436361_0065736 | 3300039447 | Bacteria | 5574 |
| 664 | Ga0436361_0080266 | 3300039447 | Bacteria | 12753 |
| 665 | Ga0436361_0097796 | 3300039447 | Unclassified | 998 |
| 666 | Ga0436361_0108215 | 3300039447 | Bacteria | 6801 |
| 667 | Ga0436361_0121231 | 3300039447 | Bacteria | 8306 |
| 668 | Ga0436361_0491563 | 3300039447 | Bacteria | 5960 |
| 669 | Ga0436361_0566372 | 3300039447 | Unclassified | 1173 |
| 670 | Ga0436361_0623192 | 3300039447 | Unclassified | 1643 |
| 671 | Ga0436361_1005909 | 3300039447 | Bacteria | 3668 |
| 672 | Ga0436361_1171226 | 3300039447 | Bacteria | 2272 |
| 673 | Ga0436363_0524079 | 3300039450 | Bacteria | 10067 |
| 674 | Ga0436363_1359713 | 3300039450 | Bacteria | 21173 |
| 675 | Ga0436363_1480040 | 3300039450 | Unclassified | 1656 |
| 676 | Ga0436362_0365033 | 3300039453 | Bacteria | 816 |
| 677 | Ga0436362_0434912 | 3300039453 | Unclassified | 1050 |
| 678 | Ga0436362_0940953 | 3300039453 | Bacteria | 1802 |
| 679 | Ga0436362_0986746 | 3300039453 | Bacteria | 2029 |
| 680 | Ga0436362_0990369 | 3300039453 | Unclassified | 1023 |
| 681 | Ga0451807_2394735 | 3300041486 | Unclassified | 1355 |
| 682 | Ga0439464_0023715 | 3300042439 | Bacteria | 1695 |
| 683 | Ga0466964_0065942 | 3300044706 | Bacteria | 1518 |
| 684 | Ga0451576_0157759 | 3300045051 | Bacteria | 2367 |
| 685 | Ga0466967_0247572 | 3300045976 | Bacteria | 1702 |
| 686 | Ga0495592_0144003 | 3300046454 | Bacteria | 1654 |
| 687 | Ga0495641_0055825 | 3300046461 | Bacteria | 1792 |
| 688 | Ga0495651_0119375 | 3300046462 | Bacteria | 1939 |
| 689 | Ga0495653_0084467 | 3300046463 | Bacteria | 2338 |
| 690 | Ga0495580_0059883 | 3300046472 | Bacteria | 2676 |
| 691 | Ga0495584_0052676 | 3300046491 | Bacteria | 2048 |
| 692 | Ga0495584_0267126 | 3300046491 | Unclassified | 870 |
| 693 | Ga0495608_0110346 | 3300046511 | Bacteria | 1769 |
| 694 | Ga0495608_0411786 | 3300046511 | Bacteria | 826 |
| 695 | Ga0495628_0013608 | 3300046516 | Bacteria | 6842 |
| 696 | Ga0495630_0011198 | 3300046517 | Bacteria | 6491 |
| 697 | Ga0495630_0042363 | 3300046517 | Bacteria | 3400 |
| 698 | Ga0495630_0082504 | 3300046517 | Bacteria | 2427 |
| 699 | Ga0495630_0363452 | 3300046517 | Unclassified | 1108 |
| 700 | Ga0495643_0000057 | 3300046522 | Bacteria | 195145 |
| 701 | Ga0495640_0068484 | 3300046533 | Bacteria | 2388 |
| 702 | Ga0495586_0067469 | 3300046535 | Unclassified | 1951 |
| 703 | Ga0495587_0047094 | 3300046536 | Bacteria | 2557 |
| 704 | Ga0495598_0002948 | 3300046537 | Unclassified | 3568 |
| 705 | Ga0495645_0009512 | 3300046543 | Bacteria | 6795 |
| 706 | Ga0495645_0273682 | 3300046543 | Bacteria | 1113 |
| 707 | Ga0495634_0220938 | 3300046642 | Bacteria | 1169 |
| 708 | Ga0495659_0095207 | 3300046664 | Bacteria | 1147 |
| 709 | Ga0495599_0001064 | 3300046678 | Bacteria | 15436 |
| 710 | Ga0495646_0038169 | 3300046680 | Bacteria | 2967 |
| 711 | Ga0495658_0017416 | 3300046683 | Bacteria | 3711 |
| 712 | Ga0495658_0255099 | 3300046683 | Bacteria | 1103 |
| 713 | Ga0495669_0011233 | 3300046684 | Unclassified | 3799 |
| 714 | Ga0495624_0156209 | 3300046690 | Bacteria | 1394 |
| 715 | Ga0495624_0177561 | 3300046690 | Bacteria | 1298 |
| 716 | Ga0495671_0056740 | 3300046692 | Unclassified | 1939 |
| 717 | Ga0495581_0313152 | 3300047315 | Unclassified | 917 |
| 718 | Ga0495604_0079729 | 3300047317 | Bacteria | 2455 |
| 719 | Ga0495675_0089355 | 3300047444 | Bacteria | 1934 |
| 720 | Ga0495684_0077745 | 3300047471 | Unclassified | 2519 |
| 721 | Ga0495684_0372247 | 3300047471 | Bacteria | 1009 |
| 722 | Ga0495593_0162885 | 3300047673 | Unclassified | 1126 |
| 723 | Ga0495602_0057134 | 3300048088 | Bacteria | 3426 |
| 724 | Ga0496100_0165389 | 3300048903 | Bacteria | 1589 |
| 725 | Ga0496101_0040171 | 3300048904 | Bacteria | 3332 |
| 726 | Ga0496101_0079016 | 3300048904 | Bacteria | 2428 |
| 727 | Ga0496101_0166434 | 3300048904 | Bacteria | 1693 |
| 728 | Ga0496101_0542719 | 3300048904 | Unclassified | 919 |
| 729 | Ga0496102_0169565 | 3300048905 | Bacteria | 2055 |
| 730 | Ga0496102_0305120 | 3300048905 | Unclassified | 1500 |
| 731 | Ga0496102_0317215 | 3300048905 | Unclassified | 1468 |
| 732 | Ga0496102_0628144 | 3300048905 | Bacteria | 997 |
| 733 | Ga0496102_0638813 | 3300048905 | Unclassified | 987 |
| 734 | Ga0496103_0066511 | 3300048906 | Bacteria | 2250 |
| 735 | Ga0496103_0139142 | 3300048906 | Unclassified | 1552 |
| 736 | Ga0496103_0435321 | 3300048906 | Unclassified | 841 |
| 737 | Ga0496104_0023095 | 3300048907 | Bacteria | 5716 |
| 738 | Ga0496104_0027820 | 3300048907 | Bacteria | 5234 |
| 739 | Ga0496104_0168231 | 3300048907 | Bacteria | 2102 |
| 740 | Ga0496104_0191076 | 3300048907 | Bacteria | 1959 |
| 741 | Ga0496104_0346300 | 3300048907 | Bacteria | 1399 |
| 742 | Ga0496104_0405004 | 3300048907 | Unclassified | 1276 |
| 743 | Ga0496105_0036817 | 3300048908 | Bacteria | 4032 |
| 744 | Ga0496105_0046103 | 3300048908 | Bacteria | 3598 |
| 745 | Ga0496105_0381032 | 3300048908 | Unclassified | 1122 |
| 746 | Ga0496106_0135421 | 3300048909 | Bacteria | 1934 |
| 747 | Ga0496106_0157602 | 3300048909 | Bacteria | 1794 |
| 748 | Ga0496106_0299304 | 3300048909 | Bacteria | 1290 |
| 749 | Ga0496106_0564232 | 3300048909 | Unclassified | 913 |
| 750 | Ga0496107_0124878 | 3300048910 | Bacteria | 1897 |
| 751 | Ga0496107_0176927 | 3300048910 | Unclassified | 1584 |
| 752 | Ga0496107_0312232 | 3300048910 | Bacteria | 1170 |
| 753 | Ga0496108_0028590 | 3300048911 | Bacteria | 4613 |
| 754 | Ga0496108_0314787 | 3300048911 | Unclassified | 1364 |
| 755 | Ga0496108_0377933 | 3300048911 | Unclassified | 1237 |
| 756 | Ga0496109_0203729 | 3300048912 | Bacteria | 1860 |
| 757 | Ga0496109_0333035 | 3300048912 | Bacteria | 1433 |
| 758 | Ga0496110_0055541 | 3300048913 | Bacteria | 3485 |
| 759 | Ga0496110_0465031 | 3300048913 | Bacteria | 1153 |
| 760 | Ga0496110_0691877 | 3300048913 | Unclassified | 921 |
| 761 | Ga0496111_0313626 | 3300048914 | Unclassified | 1162 |
| 762 | Ga0496112_0025448 | 3300048915 | Bacteria | 5683 |
| 763 | Ga0496112_0048842 | 3300048915 | Bacteria | 4146 |
| 764 | Ga0496112_0425505 | 3300048915 | Bacteria | 1266 |
| 765 | Ga0496113_0031410 | 3300048916 | Bacteria | 3855 |
| 766 | Ga0496113_0102019 | 3300048916 | Bacteria | 2225 |
| 767 | Ga0496113_0165558 | 3300048916 | Bacteria | 1749 |
| 768 | Ga0496113_0231526 | 3300048916 | Bacteria | 1473 |
| 769 | Ga0496113_0379307 | 3300048916 | Unclassified | 1135 |
| 770 | Ga0496114_0025836 | 3300048917 | Bacteria | 4803 |
| 771 | Ga0496114_0030657 | 3300048917 | Bacteria | 4425 |
| 772 | Ga0496114_0042250 | 3300048917 | Bacteria | 3779 |
| 773 | Ga0496114_0249653 | 3300048917 | Bacteria | 1561 |
| 774 | Ga0496115_0002890 | 3300048918 | Bacteria | 12382 |
| 775 | Ga0496115_0026845 | 3300048918 | Bacteria | 4499 |
| 776 | Ga0496115_0034044 | 3300048918 | Bacteria | 4026 |
| 777 | Ga0496115_0058437 | 3300048918 | Bacteria | 3103 |
| 778 | Ga0496121_0466454 | 3300048924 | Bacteria | 810 |
| 779 | Ga0496124_0251489 | 3300048927 | Unclassified | 1307 |
| 780 | Ga0496125_0000017 | 3300048928 | Bacteria | 508217 |
| 781 | Ga0501080_0037313 | 3300049742 | Bacteria | 4538 |
| 782 | nmdc:mga03683_108582_c1 | 3300050489 | Unclassified | 1225 |
| 783 | nmdc:mga03n38_37500_c1 | 3300050490 | Unclassified | 2091 |
| 784 | nmdc:mga0k408_1450_c1 | 3300050493 | Bacteria | 12815 |
| 785 | nmdc:mga0k408_594_c1 | 3300050493 | Bacteria | 19993 |
| 786 | nmdc:mga0k408_88430_c1 | 3300050493 | Unclassified | 1819 |
| 787 | nmdc:mga07m45_1685_c2 | 3300050496 | Bacteria | 6406 |
| 788 | nmdc:mga05p37_286502_c1 | 3300050507 | Bacteria | 1962 |
| 789 | nmdc:mga05p37_395708_c1 | 3300050507 | Unclassified | 1614 |
| 790 | nmdc:mga05p37_9589_c1 | 3300050507 | Bacteria | 11466 |
| 791 | nmdc:mga0n895_238915_c1 | 3300050512 | Bacteria | 1843 |
| 792 | nmdc:mga0n895_628825_c1 | 3300050512 | Unclassified | 1074 |
| 793 | nmdc:mga08x19_102016_c1 | 3300050514 | Unclassified | 1905 |
| 794 | nmdc:mga08x19_324949_c1 | 3300050514 | Unclassified | 1071 |
| 795 | nmdc:mga08x19_71040_c1 | 3300050514 | Bacteria | 2269 |
| 796 | nmdc:mga08x19_85195_c1 | 3300050514 | Bacteria | 2079 |
| 797 | Ga0495601_0041630 | 3300053077 | Bacteria | 2880 |
| 798 | Ga0495601_0381030 | 3300053077 | Bacteria | 915 |
| 799 | Ga0495612_0123251 | 3300053078 | Bacteria | 1116 |
| 800 | Ga0495655_0089716 | 3300053083 | Unclassified | 894 |
| 801 | Ga0495595_0008259 | 3300053084 | Bacteria | 4275 |
| 802 | Ga0495619_0411487 | 3300053085 | Unclassified | 933 |
| 803 | Ga0500555_000180 | 3300053103 | Bacteria | 28779 |
| 804 | Ga0500642_0065611 | 3300053130 | Bacteria | 1641 |
| 805 | Ga0500616_0004903 | 3300053153 | Bacteria | 9310 |
| 806 | 2787507240 | 2786546548 | Bacteria | 4745694 |
| 807 | Ga0373943_0098113 | |||
| 808 | SwRhRL3b_contig_2861724 | |||
| 809 | SwRhRL2b_contig_405184 | |||
| 810 | CNXas_1000023 | |||
| 811 | JGI24737J22298_10074967 | |||
| 812 | JGI24743J22301_10020906 | |||
| 813 | JGI24035J26624_1002091 | |||
| 814 | JGI24035J26624_1008118 | |||
| 815 | JGI25406J46586_10000005 | |||
| 816 | JGI25406J46586_10028950 | |||
| 817 | rootH2_10149846 | |||
| 818 | JGI25404J52841_10032670 | |||
| 819 | JGI25405J52794_10012476 | |||
| 820 | JGI25405J52794_10013038 | |||
| 821 | Ga0065704_10023667 | |||
| 822 | Ga0065704_10087740 | |||
| 823 | Ga0065704_10118197 | |||
| 824 | Ga0065712_10000860 | |||
| 825 | Ga0065712_10017080 | |||
| 826 | Ga0065712_10027830 | |||
| 827 | Ga0065712_10072993 | |||
| 828 | Ga0065712_10098013 | |||
| 829 | Ga0065712_10103954 | |||
| 830 | Ga0065715_10024520 | |||
| 831 | Ga0065715_10089137 | |||
| 832 | Ga0065715_10178837 | |||
| 833 | Ga0065715_10187515 | |||
| 834 | Ga0065715_10197118 | |||
| 835 | Ga0065707_10012925 | |||
| 836 | Ga0065707_10029388 | |||
| 837 | Ga0065707_10136549 | |||
| 838 | Ga0065707_10145514 | |||
| 839 | Ga0070658_10007327 | |||
| 840 | Ga0070658_10622171 | |||
| 841 | Ga0070676_10000532 | |||
| 842 | Ga0070676_10004370 | |||
| 843 | Ga0070676_10019534 | |||
| 844 | Ga0070676_10237821 | |||
| 845 | Ga0070683_100581688 | |||
| 846 | Ga0070690_100370252 | |||
| 847 | Ga0070670_100033134 | |||
| 848 | Ga0070670_100040914 | |||
| 849 | Ga0070670_100075177 | |||
| 850 | Ga0070670_100178383 | |||
| 851 | Ga0070670_100195629 | |||
| 852 | Ga0070670_100751983 | |||
| 853 | Ga0070677_10091378 | |||
| 854 | Ga0068869_100037030 | |||
| 855 | Ga0068869_100567605 | |||
| 856 | Ga0070666_10011900 | |||
| 857 | Ga0070666_10014502 | |||
| 858 | Ga0070666_10054050 | |||
| 859 | Ga0070680_100026741 | |||
| 860 | Ga0068868_100024925 | |||
| 861 | Ga0068868_100033756 | |||
| 862 | Ga0068868_100046856 | |||
| 863 | Ga0068868_100258564 | |||
| 864 | Ga0068868_100470569 | |||
| 865 | Ga0070660_100038563 | |||
| 866 | Ga0070660_100053625 | |||
| 867 | Ga0070689_100020753 | |||
| 868 | Ga0070689_100103652 | |||
| 869 | Ga0070689_100135109 | |||
| 870 | Ga0070689_100142878 | |||
| 871 | Ga0070689_100203401 | |||
| 872 | Ga0070689_100402016 | |||
| 873 | Ga0070689_100743743 | |||
| 874 | Ga0070687_100034519 | |||
| 875 | Ga0070687_100250697 | |||
| 876 | Ga0070687_100320441 | |||
| 877 | Ga0070661_100041414 | |||
| 878 | Ga0070692_10158022 | |||
| 879 | Ga0070668_100006274 | |||
| 880 | Ga0070668_100009678 | |||
| 881 | Ga0070668_100011711 | |||
| 882 | Ga0070668_100078289 | |||
| 883 | Ga0070668_100495812 | |||
| 884 | Ga0070669_100004757 | |||
| 885 | Ga0070669_100054557 | |||
| 886 | Ga0070669_100058956 | |||
| 887 | Ga0070669_100230954 | |||
| 888 | Ga0070669_100364713 | |||
| 889 | Ga0070675_100011878 | |||
| 890 | Ga0070675_100023765 | |||
| 891 | Ga0070675_100043724 | |||
| 892 | Ga0070675_100057713 | |||
| 893 | Ga0070675_100063071 | |||
| 894 | Ga0070675_100102510 | |||
| 895 | Ga0070675_100106835 | |||
| 896 | Ga0070675_100144852 | |||
| 897 | Ga0070675_100150832 | |||
| 898 | Ga0070675_100220248 | |||
| 899 | Ga0070675_100414310 | |||
| 900 | Ga0070675_100842133 | |||
| 901 | Ga0070671_100011573 | |||
| 902 | Ga0070671_100096670 | |||
| 903 | Ga0070671_100146020 | |||
| 904 | Ga0070671_100147873 | |||
| 905 | Ga0070671_100213497 | |||
| 906 | Ga0070671_100376014 | |||
| 907 | Ga0070674_100083299 | |||
| 908 | Ga0070674_100131839 | |||
| 909 | Ga0070673_100027043 | |||
| 910 | Ga0070673_100029054 | |||
| 911 | Ga0070673_100180862 | |||
| 912 | Ga0070673_100241584 | |||
| 913 | Ga0070673_100434650 | |||
| 914 | Ga0070688_100002037 | |||
| 915 | Ga0070688_100004071 | |||
| 916 | Ga0070688_100277618 | |||
| 917 | Ga0070659_100054333 | |||
| 918 | Ga0070667_100008695 | |||
| 919 | Ga0070667_100039941 | |||
| 920 | Ga0070667_100156552 | |||
| 921 | Ga0070667_100230640 | |||
| 922 | Ga0070667_100357165 | |||
| 923 | Ga0070667_100398494 | |||
| 924 | Ga0070709_10036549 | |||
| 925 | Ga0070709_10151845 | |||
| 926 | Ga0070709_10181957 | |||
| 927 | Ga0070714_100062398 | |||
| 928 | Ga0070713_100023951 | |||
| 929 | Ga0070713_100035001 | |||
| 930 | Ga0070710_10051552 | |||
| 931 | Ga0070710_10143876 | |||
| 932 | Ga0070710_10219430 | |||
| 933 | Ga0070710_10361247 | |||
| 934 | Ga0070711_100001456 | |||
| 935 | Ga0070711_100024422 | |||
| 936 | Ga0070711_100025983 | |||
| 937 | Ga0070711_100087913 | |||
| 938 | Ga0070705_100006187 | |||
| 939 | Ga0070705_100168121 | |||
| 940 | Ga0070705_100180421 | |||
| 941 | Ga0070708_100071514 | |||
| 942 | Ga0070708_100134677 | |||
| 943 | Ga0070708_100135853 | |||
| 944 | Ga0070708_100191594 | |||
| 945 | Ga0070708_100227062 | |||
| 946 | Ga0070708_100463079 | |||
| 947 | Ga0070663_100159529 | |||
| 948 | Ga0070663_100457322 | |||
| 949 | Ga0070663_100466775 | |||
| 950 | Ga0070678_100018893 | |||
| 951 | Ga0070678_100021575 | |||
| 952 | Ga0070678_100167596 | |||
| 953 | Ga0070678_100659199 | |||
| 954 | Ga0070662_100004788 | |||
| 955 | Ga0070662_100021507 | |||
| 956 | Ga0070662_100304999 | |||
| 957 | Ga0070662_100444590 | |||
| 958 | Ga0070681_10047395 | |||
| 959 | Ga0068867_100138571 | |||
| 960 | Ga0068867_100566479 | |||
| 961 | Ga0070685_10114100 | |||
| 962 | Ga0070706_100001307 | |||
| 963 | Ga0070706_100027211 | |||
| 964 | Ga0070706_100032192 | |||
| 965 | Ga0070706_100042736 | |||
| 966 | Ga0070706_100061826 | |||
| 967 | Ga0070706_100155959 | |||
| 968 | Ga0070706_100235151 | |||
| 969 | Ga0070706_100382897 | |||
| 970 | Ga0070706_100389349 | |||
| 971 | Ga0070706_100403416 | |||
| 972 | Ga0070706_100646808 | |||
| 973 | Ga0070706_100653150 | |||
| 974 | Ga0070706_100842431 | |||
| 975 | Ga0070707_100013538 | |||
| 976 | Ga0070707_100014183 | |||
| 977 | Ga0070707_100017595 | |||
| 978 | Ga0070707_100023601 | |||
| 979 | Ga0070707_100039620 | |||
| 980 | Ga0070707_100057695 | |||
| 981 | Ga0070707_100073877 | |||
| 982 | Ga0070707_100081104 | |||
| 983 | Ga0070707_100166484 | |||
| 984 | Ga0070707_100235963 | |||
| 985 | Ga0070707_100523503 | |||
| 986 | Ga0070707_100586638 | |||
| 987 | Ga0070707_100589178 | |||
| 988 | Ga0070698_100000476 | |||
| 989 | Ga0070698_100001859 | |||
| 990 | Ga0070698_100007937 | |||
| 991 | Ga0070698_100042761 | |||
| 992 | Ga0070698_100045179 | |||
| 993 | Ga0070698_100228778 | |||
| 994 | Ga0070698_100316405 | |||
| 995 | Ga0070698_100507711 | |||
| 996 | Ga0070698_100732053 | |||
| 997 | Ga0070699_100008608 | |||
| 998 | Ga0070699_100010237 | |||
| 999 | Ga0070699_100200718 | |||
| 1000 | Ga0070699_100269318 | |||
| 1001 | Ga0070699_100376594 | |||
| 1002 | Ga0070684_100002754 | |||
| 1003 | Ga0070697_100002854 | |||
| 1004 | Ga0070697_100004951 | |||
| 1005 | Ga0070697_100007131 | |||
| 1006 | Ga0070697_100007454 | |||
| 1007 | Ga0070697_100009154 | |||
| 1008 | Ga0070697_100012623 | |||
| 1009 | Ga0070697_100012771 | |||
| 1010 | Ga0070697_100035473 | |||
| 1011 | Ga0070697_100044349 | |||
| 1012 | Ga0070697_100174287 | |||
| 1013 | Ga0070697_100448443 | |||
| 1014 | Ga0070697_100662361 | |||
| 1015 | Ga0068853_100441183 | |||
| 1016 | Ga0070672_100006350 | |||
| 1017 | Ga0070672_100007468 | |||
| 1018 | Ga0070672_100024765 | |||
| 1019 | Ga0070672_100237458 | |||
| 1020 | Ga0070672_100352755 | |||
| 1021 | Ga0070686_100013154 | |||
| 1022 | Ga0070686_100053622 | |||
| 1023 | Ga0070686_100143957 | |||
| 1024 | Ga0070695_100442633 | |||
| 1025 | Ga0070695_100577146 | |||
| 1026 | Ga0070693_100319126 | |||
| 1027 | Ga0070665_100036142 | |||
| 1028 | Ga0070665_100036880 | |||
| 1029 | Ga0070665_100200329 | |||
| 1030 | Ga0070665_100210793 | |||
| 1031 | Ga0070665_100264623 | |||
| 1032 | Ga0070665_100329791 | |||
| 1033 | Ga0070665_100461342 | |||
| 1034 | Ga0070665_100473926 | |||
| 1035 | Ga0070704_100003074 | |||
| 1036 | Ga0070704_100237769 | |||
| 1037 | Ga0068855_100064704 | |||
| 1038 | Ga0068855_100185329 | |||
| 1039 | Ga0070664_100031456 | |||
| 1040 | Ga0070664_100313109 | |||
| 1041 | Ga0068857_100906545 | |||
| 1042 | Ga0068854_100204319 | |||
| 1043 | Ga0068852_100934931 | |||
| 1044 | Ga0068859_100126888 | |||
| 1045 | Ga0068859_100370277 | |||
| 1046 | Ga0068864_100070923 | |||
| 1047 | Ga0068864_100337878 | |||
| 1048 | Ga0068864_100576573 | |||
| 1049 | Ga0068866_10018362 | |||
| 1050 | Ga0068866_10057528 | |||
| 1051 | Ga0068866_10410936 | |||
| 1052 | Ga0068861_100171460 | |||
| 1053 | Ga0068861_100489031 | |||
| 1054 | Ga0068863_100248995 | |||
| 1055 | Ga0068863_100443939 | |||
| 1056 | Ga0068858_100006676 | |||
| 1057 | Ga0068858_100091306 | |||
| 1058 | Ga0068858_100435046 | |||
| 1059 | Ga0068858_100491542 | |||
| 1060 | Ga0068858_101070375 | |||
| 1061 | Ga0068860_100001436 | |||
| 1062 | Ga0068860_100017168 | |||
| 1063 | Ga0068860_100127793 | |||
| 1064 | Ga0068862_100023055 | |||
| 1065 | Ga0068862_100050370 | |||
| 1066 | Ga0068862_100471997 | |||
| 1067 | Ga0081455_10001923 | |||
| 1068 | Ga0081455_10006324 | |||
| 1069 | Ga0081455_10008225 | |||
| 1070 | Ga0081455_10040048 | |||
| 1071 | Ga0081455_10045766 | |||
| 1072 | Ga0081455_10107822 | |||
| 1073 | Ga0081540_1000020 | |||
| 1074 | Ga0081540_1020357 | |||
| 1075 | Ga0081540_1043670 | |||
| 1076 | Ga0081540_1117161 | |||
| 1077 | Ga0081539_10000026 | |||
| 1078 | Ga0081539_10000971 | |||
| 1079 | Ga0081539_10020770 | |||
| 1080 | Ga0081539_10033473 | |||
| 1081 | Ga0081539_10044247 | |||
| 1082 | Ga0081539_10115714 | |||
| 1083 | Ga0070717_10000051 | |||
| 1084 | Ga0070717_10009498 | |||
| 1085 | Ga0070717_10017689 | |||
| 1086 | Ga0070717_10105481 | |||
| 1087 | Ga0070717_10111038 | |||
| 1088 | Ga0070717_10299377 | |||
| 1089 | Ga0070717_10493778 | |||
| 1090 | Ga0070717_10816466 | |||
| 1091 | Ga0070715_10028495 | |||
| 1092 | Ga0070716_100154525 | |||
| 1093 | Ga0070716_100225434 | |||
| 1094 | Ga0070712_100005338 | |||
| 1095 | Ga0070712_100005594 | |||
| 1096 | Ga0070712_100052022 | |||
| 1097 | Ga0070712_100310730 | |||
| 1098 | Ga0070712_100543255 | |||
| 1099 | Ga0075362_10066651 | |||
| 1100 | Ga0075362_10187265 | |||
| 1101 | Ga0075366_10094977 | |||
| 1102 | Ga0097621_100012664 | |||
| 1103 | Ga0097621_100055102 | |||
| 1104 | Ga0097621_100416609 | |||
| 1105 | Ga0075370_10002788 | |||
| 1106 | Ga0068871_100060275 | |||
| 1107 | Ga0068871_100302244 | |||
| 1108 | Ga0068871_100316426 | |||
| 1109 | Ga0075428_100086210 | |||
| 1110 | Ga0075434_100076522 | |||
| 1111 | Ga0075434_100159613 | |||
| 1112 | Ga0068865_100020780 | |||
| 1113 | Ga0068865_100542204 | |||
| 1114 | Ga0075436_100066690 | |||
| 1115 | Ga0075436_100074322 | |||
| 1116 | Ga0075436_100107497 | |||
| 1117 | Ga0097620_100126884 | |||
| 1118 | Ga0097620_100370274 | |||
| 1119 | Ga0075435_100231145 | |||
| 1120 | Ga0075435_100614245 | |||
| 1121 | Ga0099795_10157351 | |||
| 1122 | Ga0105240_10000026 | |||
| 1123 | Ga0105240_10145769 | |||
| 1124 | Ga0111539_10092141 | |||
| 1125 | Ga0111539_10111798 | |||
| 1126 | Ga0111539_10229036 | |||
| 1127 | Ga0105245_10010117 | |||
| 1128 | Ga0105245_10039610 | |||
| 1129 | Ga0105245_10040267 | |||
| 1130 | Ga0105245_10160744 | |||
| 1131 | Ga0105245_10386990 | |||
| 1132 | Ga0105245_10830892 | |||
| 1133 | Ga0114129_10008229 | |||
| 1134 | Ga0114129_10251643 | |||
| 1135 | Ga0114129_10922365 | |||
| 1136 | Ga0105243_10751269 | |||
| 1137 | Ga0105242_10007342 | |||
| 1138 | Ga0105248_10624579 | |||
| 1139 | Ga0105237_10131140 | |||
| 1140 | Ga0105238_10177429 | |||
| 1141 | Ga0105249_10009152 | |||
| 1142 | Ga0105249_10021031 | |||
| 1143 | Ga0105249_10617793 | |||
| 1144 | Ga0099796_10046980 | |||
| 1145 | Ga0099796_10203152 | |||
| 1146 | Ga0105239_10014044 | |||
| 1147 | Ga0105239_10090610 | |||
| 1148 | Ga0105239_10256900 | |||
| 1149 | Ga0105239_10816769 | |||
| 1150 | Ga0105246_10238054 | |||
| 1151 | Ga0105246_10447833 | |||
| 1152 | Ga0157373_10422298 | |||
| 1153 | Ga0157369_10063759 | |||
| 1154 | Ga0157374_10000028 | |||
| 1155 | Ga0157374_10001376 | |||
| 1156 | Ga0157374_10025392 | |||
| 1157 | Ga0157374_10042444 | |||
| 1158 | Ga0157374_10054351 | |||
| 1159 | Ga0157374_10107811 | |||
| 1160 | Ga0157374_10124481 | |||
| 1161 | Ga0157374_10142515 | |||
| 1162 | Ga0157374_10208759 | |||
| 1163 | Ga0157374_10236857 | |||
| 1164 | Ga0157374_10400289 | |||
| 1165 | Ga0157374_10549948 | |||
| 1166 | Ga0157378_10010835 | |||
| 1167 | Ga0157378_10039247 | |||
| 1168 | Ga0157378_10089316 | |||
| 1169 | Ga0157378_10093876 | |||
| 1170 | Ga0157378_10101167 | |||
| 1171 | Ga0157378_10149284 | |||
| 1172 | Ga0157378_10201458 | |||
| 1173 | Ga0157378_10225078 | |||
| 1174 | Ga0157378_10462071 | |||
| 1175 | Ga0157378_10468437 | |||
| 1176 | Ga0157378_10747698 | |||
| 1177 | Ga0163162_10023264 | |||
| 1178 | Ga0163162_10031706 | |||
| 1179 | Ga0163162_10093012 | |||
| 1180 | Ga0163162_10429977 | |||
| 1181 | Ga0163162_10478695 | |||
| 1182 | Ga0157372_10018246 | |||
| 1183 | Ga0157372_10105148 | |||
| 1184 | Ga0157372_10319012 | |||
| 1185 | Ga0157372_10470157 | |||
| 1186 | Ga0157372_10566697 | |||
| 1187 | Ga0157372_10950037 | |||
| 1188 | Ga0157375_10001199 | |||
| 1189 | Ga0157375_10052028 | |||
| 1190 | Ga0157375_10123174 | |||
| 1191 | Ga0157375_10260468 | |||
| 1192 | Ga0157375_10323496 | |||
| 1193 | Ga0157375_10338929 | |||
| 1194 | Ga0157375_10445094 | |||
| 1195 | Ga0163163_10476810 | |||
| 1196 | Ga0157380_11025498 | |||
| 1197 | Ga0157377_10082043 | |||
| 1198 | Ga0157377_10148916 | |||
| 1199 | Ga0157377_10182998 | |||
| 1200 | Ga0157379_10029749 | |||
| 1201 | Ga0157379_10309428 | |||
| 1202 | Ga0157379_10510707 | |||
| 1203 | Ga0157376_10000742 | |||
| 1204 | Ga0157376_10022824 | |||
| 1205 | Ga0157376_10024813 | |||
| 1206 | Ga0157376_10033602 | |||
| 1207 | Ga0157376_10089586 | |||
| 1208 | Ga0157376_10142399 | |||
| 1209 | Ga0182005_1040853 | |||
| 1210 | Ga0163161_10015142 | |||
| 1211 | Ga0163161_10101642 | |||
| 1212 | Ga0213873_10028726 | |||
| 1213 | Ga0213872_10007470 | |||
| 1214 | Ga0213872_10010251 | |||
| 1215 | Ga0213872_10025045 | |||
| 1216 | Ga0213872_10052432 | |||
| 1217 | Ga0213872_10064573 | |||
| 1218 | Ga0213872_10067507 | |||
| 1219 | Ga0213872_10072087 | |||
| 1220 | Ga0213874_10004510 | |||
| 1221 | Ga0213874_10005188 | |||
| 1222 | Ga0213876_10000644 | |||
| 1223 | Ga0213876_10001059 | |||
| 1224 | Ga0213875_10034454 | |||
| 1225 | Ga0213871_10038458 | |||
| 1226 | Ga0213871_10047945 | |||
| 1227 | Ga0213871_10061851 | |||
| 1228 | Ga0207666_1011030 | |||
| 1229 | Ga0207673_1001952 | |||
| 1230 | Ga0207673_1003613 | |||
| 1231 | Ga0207673_1009781 | |||
| 1232 | Ga0209050_1001062 | |||
| 1233 | Ga0207697_10000802 | |||
| 1234 | Ga0207697_10000966 | |||
| 1235 | Ga0207697_10001778 | |||
| 1236 | Ga0207697_10003654 | |||
| 1237 | Ga0207697_10006438 | |||
| 1238 | Ga0207697_10007221 | |||
| 1239 | Ga0207697_10007584 | |||
| 1240 | Ga0207697_10023609 | |||
| 1241 | Ga0207682_10026259 | |||
| 1242 | Ga0207682_10070319 | |||
| 1243 | Ga0207692_10113647 | |||
| 1244 | Ga0207692_10130286 | |||
| 1245 | Ga0207688_10001123 | |||
| 1246 | Ga0207688_10002947 | |||
| 1247 | Ga0207688_10126802 | |||
| 1248 | Ga0207680_10019261 | |||
| 1249 | Ga0207680_10081970 | |||
| 1250 | Ga0207647_10033599 | |||
| 1251 | Ga0207647_10145645 | |||
| 1252 | Ga0207647_10214440 | |||
| 1253 | Ga0207685_10029012 | |||
| 1254 | Ga0207699_10161239 | |||
| 1255 | Ga0207645_10002756 | |||
| 1256 | Ga0207645_10002845 | |||
| 1257 | Ga0207645_10003147 | |||
| 1258 | Ga0207645_10036310 | |||
| 1259 | Ga0207645_10080060 | |||
| 1260 | Ga0207705_10004253 | |||
| 1261 | Ga0207684_10001372 | |||
| 1262 | Ga0207684_10017981 | |||
| 1263 | Ga0207684_10039506 | |||
| 1264 | Ga0207684_10101125 | |||
| 1265 | Ga0207684_10104935 | |||
| 1266 | Ga0207684_10120519 | |||
| 1267 | Ga0207684_10178023 | |||
| 1268 | Ga0207684_10214889 | |||
| 1269 | Ga0207684_10271528 | |||
| 1270 | Ga0207707_10023125 | |||
| 1271 | Ga0207695_10000246 | |||
| 1272 | Ga0207671_10007402 | |||
| 1273 | Ga0207671_10380752 | |||
| 1274 | Ga0207693_10001148 | |||
| 1275 | Ga0207693_10021435 | |||
| 1276 | Ga0207693_10021534 | |||
| 1277 | Ga0207693_10027165 | |||
| 1278 | Ga0207693_10044452 | |||
| 1279 | Ga0207693_10077481 | |||
| 1280 | Ga0207693_10151776 | |||
| 1281 | Ga0207693_10163553 | |||
| 1282 | Ga0207663_10002379 | |||
| 1283 | Ga0207663_10023712 | |||
| 1284 | Ga0207660_10010762 | |||
| 1285 | Ga0207660_10308622 | |||
| 1286 | Ga0207662_10053725 | |||
| 1287 | Ga0207657_10034639 | |||
| 1288 | Ga0207649_10072929 | |||
| 1289 | Ga0207652_10045158 | |||
| 1290 | Ga0207646_10000761 | |||
| 1291 | Ga0207646_10001268 | |||
| 1292 | Ga0207646_10017315 | |||
| 1293 | Ga0207646_10030930 | |||
| 1294 | Ga0207646_10050145 | |||
| 1295 | Ga0207646_10070399 | |||
| 1296 | Ga0207646_10086948 | |||
| 1297 | Ga0207646_10098548 | |||
| 1298 | Ga0207646_10116002 | |||
| 1299 | Ga0207646_10138266 | |||
| 1300 | Ga0207646_10154537 | |||
| 1301 | Ga0207646_10364494 | |||
| 1302 | Ga0207646_10526509 | |||
| 1303 | Ga0207681_10001128 | |||
| 1304 | Ga0207681_10137516 | |||
| 1305 | Ga0207694_10719947 | |||
| 1306 | Ga0207650_10043669 | |||
| 1307 | Ga0207650_10165836 | |||
| 1308 | Ga0207650_10212830 | |||
| 1309 | Ga0207659_10013166 | |||
| 1310 | Ga0207659_10014543 | |||
| 1311 | Ga0207659_10028922 | |||
| 1312 | Ga0207659_10066382 | |||
| 1313 | Ga0207659_10086006 | |||
| 1314 | Ga0207659_10105153 | |||
| 1315 | Ga0207659_10120809 | |||
| 1316 | Ga0207659_10152449 | |||
| 1317 | Ga0207659_10547369 | |||
| 1318 | Ga0207659_10763213 | |||
| 1319 | Ga0207687_10053160 | |||
| 1320 | Ga0207687_10111298 | |||
| 1321 | Ga0207687_10135610 | |||
| 1322 | Ga0207700_10008765 | |||
| 1323 | Ga0207700_10020492 | |||
| 1324 | Ga0207700_10181941 | |||
| 1325 | Ga0207700_10188046 | |||
| 1326 | Ga0207700_10373933 | |||
| 1327 | Ga0207664_10053301 | |||
| 1328 | Ga0207664_10463875 | |||
| 1329 | Ga0207644_10005337 | |||
| 1330 | Ga0207644_10091102 | |||
| 1331 | Ga0207644_10250468 | |||
| 1332 | Ga0207644_10325498 | |||
| 1333 | Ga0207644_10538968 | |||
| 1334 | Ga0207690_10243141 | |||
| 1335 | Ga0207706_10014002 | |||
| 1336 | Ga0207706_10015823 | |||
| 1337 | Ga0207706_10044612 | |||
| 1338 | Ga0207706_10115786 | |||
| 1339 | Ga0207706_10259142 | |||
| 1340 | Ga0207706_10259527 | |||
| 1341 | Ga0207706_10333472 | |||
| 1342 | Ga0207670_10005331 | |||
| 1343 | Ga0207670_10038138 | |||
| 1344 | Ga0207670_10095112 | |||
| 1345 | Ga0207670_10167664 | |||
| 1346 | Ga0207670_10380279 | |||
| 1347 | Ga0207704_10262738 | |||
| 1348 | Ga0207704_10385900 | |||
| 1349 | Ga0207665_10010811 | |||
| 1350 | Ga0207665_10015284 | |||
| 1351 | Ga0207665_10031684 | |||
| 1352 | Ga0207665_10037324 | |||
| 1353 | Ga0207665_10120877 | |||
| 1354 | Ga0207665_10282754 | |||
| 1355 | Ga0207665_10509331 | |||
| 1356 | Ga0207691_10001964 | |||
| 1357 | Ga0207691_10003946 | |||
| 1358 | Ga0207691_10086745 | |||
| 1359 | Ga0207691_10171002 | |||
| 1360 | Ga0207691_10190967 | |||
| 1361 | Ga0207691_10398230 | |||
| 1362 | Ga0207711_10388373 | |||
| 1363 | Ga0207689_10048953 | |||
| 1364 | Ga0207679_10111958 | |||
| 1365 | Ga0207679_10151802 | |||
| 1366 | Ga0207667_10055512 | |||
| 1367 | Ga0207651_10004486 | |||
| 1368 | Ga0207651_10005563 | |||
| 1369 | Ga0207651_10055413 | |||
| 1370 | Ga0207651_10055961 | |||
| 1371 | Ga0207651_10267238 | |||
| 1372 | Ga0207651_10597131 | |||
| 1373 | Ga0207712_10043479 | |||
| 1374 | Ga0207712_10076812 | |||
| 1375 | Ga0207668_10017030 | |||
| 1376 | Ga0207668_10100385 | |||
| 1377 | Ga0207668_10172148 | |||
| 1378 | Ga0207658_10192525 | |||
| 1379 | Ga0207658_10212685 | |||
| 1380 | Ga0207658_10265951 | |||
| 1381 | Ga0207658_10447145 | |||
| 1382 | Ga0207658_10563196 | |||
| 1383 | Ga0207677_10007393 | |||
| 1384 | Ga0207677_10011093 | |||
| 1385 | Ga0207677_10127218 | |||
| 1386 | Ga0207677_10648464 | |||
| 1387 | Ga0207703_10004657 | |||
| 1388 | Ga0207703_10018759 | |||
| 1389 | Ga0207703_10166952 | |||
| 1390 | Ga0207703_10545236 | |||
| 1391 | Ga0207639_10424440 | |||
| 1392 | Ga0207678_10010772 | |||
| 1393 | Ga0207678_10097250 | |||
| 1394 | Ga0207708_10077408 | |||
| 1395 | Ga0207702_10260289 | |||
| 1396 | Ga0207641_10154584 | |||
| 1397 | Ga0207641_10403438 | |||
| 1398 | Ga0207648_10014296 | |||
| 1399 | Ga0207676_10147013 | |||
| 1400 | Ga0207675_100396742 | |||
| 1401 | Ga0207675_100752844 | |||
| 1402 | Ga0207683_10024023 | |||
| 1403 | Ga0207683_10035809 | |||
| 1404 | Ga0207683_10036759 | |||
| 1405 | Ga0207683_10114128 | |||
| 1406 | Ga0207683_10155538 | |||
| 1407 | Ga0207698_11084107 | |||
| 1408 | Ga0268266_10012917 | |||
| 1409 | Ga0268266_10049192 | |||
| 1410 | Ga0268266_10080964 | |||
| 1411 | Ga0268266_10125890 | |||
| 1412 | Ga0268266_10156863 | |||
| 1413 | Ga0268265_10043487 | |||
| 1414 | Ga0268265_10212756 | |||
| 1415 | Ga0268265_10718570 | |||
| 1416 | Ga0268264_10000366 | |||
| 1417 | Ga0268264_10145673 | |||
| 1418 | Ga0268264_10230145 | |||
| 1419 | Ga0268264_10262463 | |||
| 1420 | Ga0268264_10854832 | |||
| 1421 | Ga0373944_0018025 | |||
| 1422 | Ga0373944_0023106 | |||
| 1423 | Ga0373945_0053597 | |||
| 1424 | Ga0373953_0051101 | |||
| 1425 | Ga0373953_0117552 | |||
| 1426 | Ga0373943_0047061 | |||
| 1427 | Ga0373946_0215480 | |||
| 1428 | Ga0373955_0029291 | |||
| 1429 | Ga0373955_0237687 | |||
| 1430 | Ga0373931_0031957 | |||
| 1431 | Ga0373931_0186417 | |||
| 1432 | Ga0373935_0033855 | |||
| 1433 | Ga0373935_0076987 | |||
| 1434 | Ga0373935_0079708 | |||
| 1435 | Ga0373935_0188815 | |||
| 1436 | Ga0373935_0332324 | |||
| 1437 | Ga0373927_0058746 | |||
| 1438 | Ga0373927_0069533 | |||
| 1439 | Ga0373947_0066049 | |||
| 1440 | Ga0373947_0079687 | |||
| 1441 | Ga0373937_0102605 | |||
| 1442 | Ga0373937_0168131 | |||
| 1443 | Ga0373937_0206167 | |||
| 1444 | Ga0373937_0216054 | |||
| 1445 | Ga0373937_0327313 | |||
| 1446 | Ga0373925_0065800 | |||
| 1447 | Ga0373925_0143540 | |||
| 1448 | Ga0395900_0002938 | |||
| 1449 | Ga0395898_0007971 | |||
| 1450 | Ga0395898_0129871 | |||
| 1451 | Ga0395905_0019180 | |||
| 1452 | Ga0395905_0217961 | |||
| 1453 | Ga0436364_0227970 | |||
| 1454 | Ga0436364_0520032 | |||
| 1455 | Ga0436364_0802819 | |||
| 1456 | Ga0395901_0000503 | |||
| 1457 | Ga0395901_0376027 | |||
| 1458 | Ga0436365_0003707 | |||
| 1459 | Ga0436365_0742888 | |||
| 1460 | Ga0436365_0953982 | |||
| 1461 | Ga0436365_0979913 | |||
| 1462 | Ga0436365_1122847 | |||
| 1463 | Ga0436365_1753433 | |||
| 1464 | Ga0436360_0086757 | |||
| 1465 | Ga0436360_0227542 | |||
| 1466 | Ga0436360_0484811 | |||
| 1467 | Ga0436360_0885762 | |||
| 1468 | Ga0436360_1295629 | |||
| 1469 | Ga0436361_0065736 | |||
| 1470 | Ga0436361_0080266 | |||
| 1471 | Ga0436361_0097796 | |||
| 1472 | Ga0436361_0108215 | |||
| 1473 | Ga0436361_0121231 | |||
| 1474 | Ga0436361_0491563 | |||
| 1475 | Ga0436361_0566372 | |||
| 1476 | Ga0436361_0623192 | |||
| 1477 | Ga0436361_1005909 | |||
| 1478 | Ga0436361_1171226 | |||
| 1479 | Ga0436363_0524079 | |||
| 1480 | Ga0436363_1359713 | |||
| 1481 | Ga0436363_1480040 | |||
| 1482 | Ga0436362_0365033 | |||
| 1483 | Ga0436362_0434912 | |||
| 1484 | Ga0436362_0940953 | |||
| 1485 | Ga0436362_0986746 | |||
| 1486 | Ga0436362_0990369 | |||
| 1487 | Ga0451807_2394735 | |||
| 1488 | Ga0439464_0023715 | |||
| 1489 | Ga0466964_0065942 | |||
| 1490 | Ga0451576_0157759 | |||
| 1491 | Ga0466967_0247572 | |||
| 1492 | Ga0495592_0144003 | |||
| 1493 | Ga0495641_0055825 | |||
| 1494 | Ga0495651_0119375 | |||
| 1495 | Ga0495653_0084467 | |||
| 1496 | Ga0495580_0059883 | |||
| 1497 | Ga0495584_0052676 | |||
| 1498 | Ga0495584_0267126 | |||
| 1499 | Ga0495608_0110346 | |||
| 1500 | Ga0495608_0411786 | |||
| 1501 | Ga0495628_0013608 | |||
| 1502 | Ga0495630_0011198 | |||
| 1503 | Ga0495630_0042363 | |||
| 1504 | Ga0495630_0082504 | |||
| 1505 | Ga0495630_0363452 | |||
| 1506 | Ga0495643_0000057 | |||
| 1507 | Ga0495640_0068484 | |||
| 1508 | Ga0495586_0067469 | |||
| 1509 | Ga0495587_0047094 | |||
| 1510 | Ga0495598_0002948 | |||
| 1511 | Ga0495645_0009512 | |||
| 1512 | Ga0495645_0273682 | |||
| 1513 | Ga0495634_0220938 | |||
| 1514 | Ga0495659_0095207 | |||
| 1515 | Ga0495599_0001064 | |||
| 1516 | Ga0495646_0038169 | |||
| 1517 | Ga0495658_0017416 | |||
| 1518 | Ga0495658_0255099 | |||
| 1519 | Ga0495669_0011233 | |||
| 1520 | Ga0495624_0156209 | |||
| 1521 | Ga0495624_0177561 | |||
| 1522 | Ga0495671_0056740 | |||
| 1523 | Ga0495581_0313152 | |||
| 1524 | Ga0495604_0079729 | |||
| 1525 | Ga0495675_0089355 | |||
| 1526 | Ga0495684_0077745 | |||
| 1527 | Ga0495684_0372247 | |||
| 1528 | Ga0495593_0162885 | |||
| 1529 | Ga0495602_0057134 | |||
| 1530 | Ga0496100_0165389 | |||
| 1531 | Ga0496101_0040171 | |||
| 1532 | Ga0496101_0079016 | |||
| 1533 | Ga0496101_0166434 | |||
| 1534 | Ga0496101_0542719 | |||
| 1535 | Ga0496102_0169565 | |||
| 1536 | Ga0496102_0305120 | |||
| 1537 | Ga0496102_0317215 | |||
| 1538 | Ga0496102_0628144 | |||
| 1539 | Ga0496102_0638813 | |||
| 1540 | Ga0496103_0066511 | |||
| 1541 | Ga0496103_0139142 | |||
| 1542 | Ga0496103_0435321 | |||
| 1543 | Ga0496104_0023095 | |||
| 1544 | Ga0496104_0027820 | |||
| 1545 | Ga0496104_0168231 | |||
| 1546 | Ga0496104_0191076 | |||
| 1547 | Ga0496104_0346300 | |||
| 1548 | Ga0496104_0405004 | |||
| 1549 | Ga0496105_0036817 | |||
| 1550 | Ga0496105_0046103 | |||
| 1551 | Ga0496105_0381032 | |||
| 1552 | Ga0496106_0135421 | |||
| 1553 | Ga0496106_0157602 | |||
| 1554 | Ga0496106_0299304 | |||
| 1555 | Ga0496106_0564232 | |||
| 1556 | Ga0496107_0124878 | |||
| 1557 | Ga0496107_0176927 | |||
| 1558 | Ga0496107_0312232 | |||
| 1559 | Ga0496108_0028590 | |||
| 1560 | Ga0496108_0314787 | |||
| 1561 | Ga0496108_0377933 | |||
| 1562 | Ga0496109_0203729 | |||
| 1563 | Ga0496109_0333035 | |||
| 1564 | Ga0496110_0055541 | |||
| 1565 | Ga0496110_0465031 | |||
| 1566 | Ga0496110_0691877 | |||
| 1567 | Ga0496111_0313626 | |||
| 1568 | Ga0496112_0025448 | |||
| 1569 | Ga0496112_0048842 | |||
| 1570 | Ga0496112_0425505 | |||
| 1571 | Ga0496113_0031410 | |||
| 1572 | Ga0496113_0102019 | |||
| 1573 | Ga0496113_0165558 | |||
| 1574 | Ga0496113_0231526 | |||
| 1575 | Ga0496113_0379307 | |||
| 1576 | Ga0496114_0025836 | |||
| 1577 | Ga0496114_0030657 | |||
| 1578 | Ga0496114_0042250 | |||
| 1579 | Ga0496114_0249653 | |||
| 1580 | Ga0496115_0002890 | |||
| 1581 | Ga0496115_0026845 | |||
| 1582 | Ga0496115_0034044 | |||
| 1583 | Ga0496115_0058437 | |||
| 1584 | Ga0496121_0466454 | |||
| 1585 | Ga0496124_0251489 | |||
| 1586 | Ga0496125_0000017 | |||
| 1587 | Ga0501080_0037313 | |||
| 1588 | nmdc:mga03683_108582_c1 | |||
| 1589 | nmdc:mga03n38_37500_c1 | |||
| 1590 | nmdc:mga0k408_1450_c1 | |||
| 1591 | nmdc:mga0k408_594_c1 | |||
| 1592 | nmdc:mga0k408_88430_c1 | |||
| 1593 | nmdc:mga07m45_1685_c2 | |||
| 1594 | nmdc:mga05p37_286502_c1 | |||
| 1595 | nmdc:mga05p37_395708_c1 | |||
| 1596 | nmdc:mga05p37_9589_c1 | |||
| 1597 | nmdc:mga0n895_238915_c1 | |||
| 1598 | nmdc:mga0n895_628825_c1 | |||
| 1599 | nmdc:mga08x19_102016_c1 | |||
| 1600 | nmdc:mga08x19_324949_c1 | |||
| 1601 | nmdc:mga08x19_71040_c1 | |||
| 1602 | nmdc:mga08x19_85195_c1 | |||
| 1603 | Ga0495601_0041630 | |||
| 1604 | Ga0495601_0381030 | |||
| 1605 | Ga0495612_0123251 | |||
| 1606 | Ga0495655_0089716 | |||
| 1607 | Ga0495595_0008259 | |||
| 1608 | Ga0495619_0411487 | |||
| 1609 | Ga0500555_000180 | |||
| 1610 | Ga0500642_0065611 | |||
| 1611 | Ga0500616_0004903 | |||
| 1612 | 2787507240 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yfd-assembly1.cif.gz_A | cryo-em structure of the imetit-bound histamine h4 receptor and gq complex | 0.4803 | 28 | 71 |
| 5xn6-assembly2.cif.gz_B | heterodimer crystal structure of geranylgeranyl diphosphate synthases 1 with ggpps recruiting protein(osgrp) from oryza sativa | 0.417 | 73 | 190 |
| 5tvg-assembly6.cif.gz_F | crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp-forming) from burkholderia vietnamiensis | 0.4164 | 54 | 110 |
| 5tvg-assembly5.cif.gz_G | crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp-forming) from burkholderia vietnamiensis | 0.4 | 28 | 107 |
| 7s8o-assembly1.cif.gz_B | cryoem structure of gi-coupled mrgprx2 with small molecule agonist (r)-zinc-3573 | 0.362 | 8 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qiwJ05 | Alpha Beta;Alpha-Beta Complex;Hypothetical Protein Ta0175; Chain: A, domain 2; | 0.4527 | 33 | 70 | 3.90.1070.20 |
| af_Q4D8V0_29_236_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.4471 | 8 | 187 | 3.40.390.10 |
| af_Q4D8V0_29_236_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.4034 | 8 | 187 | 3.40.390.10 |
| af_Q14204_3801_3895_1.10.8.1220 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.3768 | 129 | 223 | 1.10.8.1220 |
| af_Q7XVH8_131_295_2.10.25.10 | Mainly Beta;Ribbon;Laminin;Laminin | 0.3733 | 38 | 72 | 2.10.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6F301-F1-model_v4 | Uncharacterized protein | 0.9838 | 126 | 229 |
GO:0016020
|
| AF-A0A2V5Z1T6-F1-model_v4 | PII-uridylyltransferase/Glutamine-synthetase adenylyltransferase domain-containing protein | 0.9747 | 60 | 229 |
|
| AF-A0A2V5MN64-F1-model_v4 | Uncharacterized protein | 0.9734 | 42 | 227 |
|
| AF-A0A2V6C660-F1-model_v4 | Uncharacterized protein | 0.9726 | 92 | 229 |
|
| AF-A0A2V5SYK8-F1-model_v4 | Uncharacterized protein | 0.9649 | 109 | 226 |
|