F481651

General Info

Members Datasets Scaffolds Average Seq Length
806 283 1612 235

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0098113|Ga0373943_0098113_738_1517
Length 259
Sequence VNETLFSQIQRLFERTYAQVGINLEDCLIDRQRCAQLSSLAGASARELSDLARTFLRRADDQLYVGIYYSRWLIEQLERHDPRAGLTDRNIRSLIMFVEEINHALHAALEFKNGRREIGGEDFARNLELQAQVDTYLVLLLFVAFFRKTQRISKTDRRWLRFHLFARQCPDAFADKNLRNRYSEVTELASSYTYFLDTLNGMRRLEEIRRFRSLDYSAKKQHIFALMDNAENKPRLQLEFVVASAAAESRHCLLRHLLC

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 6.82
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 28.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0098113 3300035170 Bacteria 1528
2 SwRhRL3b_contig_2861724 2162886006 Bacteria 834
3 SwRhRL2b_contig_405184 2162886007 Bacteria 3589
4 CNXas_1000023 3300000545 Bacteria 31795
5 JGI24737J22298_10074967 3300001990 Unclassified 1009
6 JGI24743J22301_10020906 3300001991 Eukaryota 1248
7 JGI24035J26624_1002091 3300002126 Bacteria 1862
8 JGI24035J26624_1008118 3300002126 Unclassified 1025
9 JGI25406J46586_10000005 3300003203 Bacteria 118289
10 JGI25406J46586_10028950 3300003203 Bacteria 2103
11 rootH2_10149846 3300003320 Bacteria 3251
12 JGI25404J52841_10032670 3300003659 Bacteria 1109
13 JGI25405J52794_10012476 3300003911 Unclassified 1637
14 JGI25405J52794_10013038 3300003911 Bacteria 1607
15 Ga0065704_10023667 3300005289 Bacteria 1895
16 Ga0065704_10087740 3300005289 Bacteria 2998
17 Ga0065704_10118197 3300005289 Bacteria 1820
18 Ga0065712_10000860 3300005290 Bacteria 7736
19 Ga0065712_10017080 3300005290 Bacteria 1389
20 Ga0065712_10027830 3300005290 Bacteria 1098
21 Ga0065712_10072993 3300005290 Bacteria 4533
22 Ga0065712_10098013 3300005290 Unclassified 2133
23 Ga0065712_10103954 3300005290 Bacteria 1973
24 Ga0065715_10024520 3300005293 Unclassified 1271
25 Ga0065715_10089137 3300005293 Bacteria 13653
26 Ga0065715_10178837 3300005293 Bacteria 1491
27 Ga0065715_10187515 3300005293 Bacteria 1436
28 Ga0065715_10197118 3300005293 Bacteria 1381
29 Ga0065707_10012925 3300005295 Bacteria 1927
30 Ga0065707_10029388 3300005295 Unclassified 1206
31 Ga0065707_10136549 3300005295 Bacteria 1833
32 Ga0065707_10145514 3300005295 Unclassified 1718
33 Ga0070658_10007327 3300005327 Bacteria 8909
34 Ga0070658_10622171 3300005327 Unclassified 936
35 Ga0070676_10000532 3300005328 Bacteria 18338
36 Ga0070676_10004370 3300005328 Bacteria 7429
37 Ga0070676_10019534 3300005328 Bacteria 3772
38 Ga0070676_10237821 3300005328 Bacteria 1210
39 Ga0070683_100581688 3300005329 Unclassified 1071
40 Ga0070690_100370252 3300005330 Bacteria 1045
41 Ga0070670_100033134 3300005331 Unclassified 4450
42 Ga0070670_100040914 3300005331 Unclassified 3983
43 Ga0070670_100075177 3300005331 Unclassified 2903
44 Ga0070670_100178383 3300005331 Bacteria 1844
45 Ga0070670_100195629 3300005331 Unclassified 1756
46 Ga0070670_100751983 3300005331 Bacteria 878
47 Ga0070677_10091378 3300005333 Unclassified 1325
48 Ga0068869_100037030 3300005334 Bacteria 3467
49 Ga0068869_100567605 3300005334 Unclassified 955
50 Ga0070666_10011900 3300005335 Bacteria 5472
51 Ga0070666_10014502 3300005335 Bacteria 5020
52 Ga0070666_10054050 3300005335 Unclassified 2709
53 Ga0070680_100026741 3300005336 Bacteria 4615
54 Ga0068868_100024925 3300005338 Bacteria 4543
55 Ga0068868_100033756 3300005338 Bacteria 3946
56 Ga0068868_100046856 3300005338 Unclassified 3384
57 Ga0068868_100258564 3300005338 Bacteria 1467
58 Ga0068868_100470569 3300005338 Unclassified 1096
59 Ga0070660_100038563 3300005339 Bacteria 3628
60 Ga0070660_100053625 3300005339 Unclassified 3111
61 Ga0070689_100020753 3300005340 Bacteria 4879
62 Ga0070689_100103652 3300005340 Bacteria 2255
63 Ga0070689_100135109 3300005340 Bacteria 1980
64 Ga0070689_100142878 3300005340 Bacteria 1926
65 Ga0070689_100203401 3300005340 Bacteria 1618
66 Ga0070689_100402016 3300005340 Unclassified 1158
67 Ga0070689_100743743 3300005340 Unclassified 859
68 Ga0070687_100034519 3300005343 Bacteria 2504
69 Ga0070687_100250697 3300005343 Bacteria 1100
70 Ga0070687_100320441 3300005343 Bacteria 990
71 Ga0070661_100041414 3300005344 Bacteria 3362
72 Ga0070692_10158022 3300005345 Bacteria 1296
73 Ga0070668_100006274 3300005347 Bacteria 8800
74 Ga0070668_100009678 3300005347 Bacteria 7147
75 Ga0070668_100011711 3300005347 Bacteria 6531
76 Ga0070668_100078289 3300005347 Unclassified 2585
77 Ga0070668_100495812 3300005347 Bacteria 1056
78 Ga0070669_100004757 3300005353 Bacteria 9791
79 Ga0070669_100054557 3300005353 Bacteria 2927
80 Ga0070669_100058956 3300005353 Unclassified 2818
81 Ga0070669_100230954 3300005353 Unclassified 1466
82 Ga0070669_100364713 3300005353 Bacteria 1175
83 Ga0070675_100011878 3300005354 Bacteria 6824
84 Ga0070675_100023765 3300005354 Unclassified 4904
85 Ga0070675_100043724 3300005354 Bacteria 3662
86 Ga0070675_100057713 3300005354 Bacteria 3201
87 Ga0070675_100063071 3300005354 Bacteria 3063
88 Ga0070675_100102510 3300005354 Unclassified 2411
89 Ga0070675_100106835 3300005354 Bacteria 2363
90 Ga0070675_100144852 3300005354 Bacteria 2033
91 Ga0070675_100150832 3300005354 Bacteria 1993
92 Ga0070675_100220248 3300005354 Bacteria 1652
93 Ga0070675_100414310 3300005354 Unclassified 1204
94 Ga0070675_100842133 3300005354 Bacteria 839
95 Ga0070671_100011573 3300005355 Bacteria 7096
96 Ga0070671_100096670 3300005355 Unclassified 2477
97 Ga0070671_100146020 3300005355 Bacteria 1996
98 Ga0070671_100147873 3300005355 Bacteria 1983
99 Ga0070671_100213497 3300005355 Unclassified 1637
100 Ga0070671_100376014 3300005355 Bacteria 1214
101 Ga0070674_100083299 3300005356 Bacteria 2290
102 Ga0070674_100131839 3300005356 Bacteria 1864
103 Ga0070673_100027043 3300005364 Unclassified 4247
104 Ga0070673_100029054 3300005364 Bacteria 4119
105 Ga0070673_100180862 3300005364 Bacteria 1805
106 Ga0070673_100241584 3300005364 Unclassified 1570
107 Ga0070673_100434650 3300005364 Unclassified 1179
108 Ga0070688_100002037 3300005365 Bacteria 10197
109 Ga0070688_100004071 3300005365 Bacteria 7591
110 Ga0070688_100277618 3300005365 Bacteria 1202
111 Ga0070659_100054333 3300005366 Unclassified 3154
112 Ga0070667_100008695 3300005367 Bacteria 8417
113 Ga0070667_100039941 3300005367 Unclassified 3933
114 Ga0070667_100156552 3300005367 Bacteria 2004
115 Ga0070667_100230640 3300005367 Bacteria 1651
116 Ga0070667_100357165 3300005367 Bacteria 1324
117 Ga0070667_100398494 3300005367 Bacteria 1252
118 Ga0070709_10036549 3300005434 Bacteria 2993
119 Ga0070709_10151845 3300005434 Unclassified 1601
120 Ga0070709_10181957 3300005434 Bacteria 1477
121 Ga0070714_100062398 3300005435 Bacteria 3203
122 Ga0070713_100023951 3300005436 Unclassified 4747
123 Ga0070713_100035001 3300005436 Bacteria 4041
124 Ga0070710_10051552 3300005437 Bacteria 2311
125 Ga0070710_10143876 3300005437 Bacteria 1465
126 Ga0070710_10219430 3300005437 Unclassified 1209
127 Ga0070710_10361247 3300005437 Bacteria 964
128 Ga0070711_100001456 3300005439 Bacteria 13013
129 Ga0070711_100024422 3300005439 Bacteria 3942
130 Ga0070711_100025983 3300005439 Unclassified 3834
131 Ga0070711_100087913 3300005439 Bacteria 2232
132 Ga0070705_100006187 3300005440 Bacteria 5861
133 Ga0070705_100168121 3300005440 Unclassified 1473
134 Ga0070705_100180421 3300005440 Unclassified 1430
135 Ga0070708_100071514 3300005445 Bacteria 3123
136 Ga0070708_100134677 3300005445 Bacteria 2288
137 Ga0070708_100135853 3300005445 Bacteria 2278
138 Ga0070708_100191594 3300005445 Bacteria 1912
139 Ga0070708_100227062 3300005445 Bacteria 1752
140 Ga0070708_100463079 3300005445 Unclassified 1196
141 Ga0070663_100159529 3300005455 Bacteria 1735
142 Ga0070663_100457322 3300005455 Unclassified 1053
143 Ga0070663_100466775 3300005455 Bacteria 1043
144 Ga0070678_100018893 3300005456 Bacteria 4478
145 Ga0070678_100021575 3300005456 Bacteria 4250
146 Ga0070678_100167596 3300005456 Unclassified 1785
147 Ga0070678_100659199 3300005456 Unclassified 939
148 Ga0070662_100004788 3300005457 Bacteria 8573
149 Ga0070662_100021507 3300005457 Bacteria 4405
150 Ga0070662_100304999 3300005457 Unclassified 1294
151 Ga0070662_100444590 3300005457 Bacteria 1075
152 Ga0070681_10047395 3300005458 Bacteria 4296
153 Ga0068867_100138571 3300005459 Bacteria 1899
154 Ga0068867_100566479 3300005459 Unclassified 986
155 Ga0070685_10114100 3300005466 Bacteria 1669
156 Ga0070706_100001307 3300005467 Bacteria 26565
157 Ga0070706_100027211 3300005467 Bacteria 5262
158 Ga0070706_100032192 3300005467 Unclassified 4836
159 Ga0070706_100042736 3300005467 Bacteria 4187
160 Ga0070706_100061826 3300005467 Bacteria 3459
161 Ga0070706_100155959 3300005467 Bacteria 2131
162 Ga0070706_100235151 3300005467 Bacteria 1711
163 Ga0070706_100382897 3300005467 Unclassified 1310
164 Ga0070706_100389349 3300005467 Bacteria 1297
165 Ga0070706_100403416 3300005467 Unclassified 1273
166 Ga0070706_100646808 3300005467 Unclassified 982
167 Ga0070706_100653150 3300005467 Unclassified 976
168 Ga0070706_100842431 3300005467 Bacteria 848
169 Ga0070707_100013538 3300005468 Bacteria 7633
170 Ga0070707_100014183 3300005468 Bacteria 7468
171 Ga0070707_100017595 3300005468 Bacteria 6723
172 Ga0070707_100023601 3300005468 Bacteria 5818
173 Ga0070707_100039620 3300005468 Bacteria 4504
174 Ga0070707_100057695 3300005468 Unclassified 3724
175 Ga0070707_100073877 3300005468 Bacteria 3287
176 Ga0070707_100081104 3300005468 Bacteria 3132
177 Ga0070707_100166484 3300005468 Bacteria 2148
178 Ga0070707_100235963 3300005468 Bacteria 1780
179 Ga0070707_100523503 3300005468 Unclassified 1148
180 Ga0070707_100586638 3300005468 Unclassified 1077
181 Ga0070707_100589178 3300005468 Bacteria 1074
182 Ga0070698_100000476 3300005471 Bacteria 42469
183 Ga0070698_100001859 3300005471 Bacteria 23526
184 Ga0070698_100007937 3300005471 Bacteria 11486
185 Ga0070698_100042761 3300005471 Bacteria 4648
186 Ga0070698_100045179 3300005471 Bacteria 4509
187 Ga0070698_100228778 3300005471 Unclassified 1793
188 Ga0070698_100316405 3300005471 Unclassified 1491
189 Ga0070698_100507711 3300005471 Unclassified 1144
190 Ga0070698_100732053 3300005471 Unclassified 932
191 Ga0070699_100008608 3300005518 Bacteria 8841
192 Ga0070699_100010237 3300005518 Bacteria 8113
193 Ga0070699_100200718 3300005518 Bacteria 1773
194 Ga0070699_100269318 3300005518 Unclassified 1524
195 Ga0070699_100376594 3300005518 Bacteria 1281
196 Ga0070684_100002754 3300005535 Bacteria 13005
197 Ga0070697_100002854 3300005536 Bacteria 13291
198 Ga0070697_100004951 3300005536 Bacteria 10224
199 Ga0070697_100007131 3300005536 Bacteria 8692
200 Ga0070697_100007454 3300005536 Bacteria 8518
201 Ga0070697_100009154 3300005536 Bacteria 7736
202 Ga0070697_100012623 3300005536 Bacteria 6617
203 Ga0070697_100012771 3300005536 Bacteria 6579
204 Ga0070697_100035473 3300005536 Bacteria 4023
205 Ga0070697_100044349 3300005536 Bacteria 3601
206 Ga0070697_100174287 3300005536 Bacteria 1821
207 Ga0070697_100448443 3300005536 Bacteria 1124
208 Ga0070697_100662361 3300005536 Unclassified 920
209 Ga0068853_100441183 3300005539 Bacteria 1223
210 Ga0070672_100006350 3300005543 Bacteria 7936
211 Ga0070672_100007468 3300005543 Bacteria 7419
212 Ga0070672_100024765 3300005543 Bacteria 4441
213 Ga0070672_100237458 3300005543 Bacteria 1532
214 Ga0070672_100352755 3300005543 Bacteria 1254
215 Ga0070686_100013154 3300005544 Bacteria 4728
216 Ga0070686_100053622 3300005544 Bacteria 2576
217 Ga0070686_100143957 3300005544 Bacteria 1662
218 Ga0070695_100442633 3300005545 Bacteria 994
219 Ga0070695_100577146 3300005545 Bacteria 880
220 Ga0070693_100319126 3300005547 Bacteria 1053
221 Ga0070665_100036142 3300005548 Bacteria 4970
222 Ga0070665_100036880 3300005548 Bacteria 4916
223 Ga0070665_100200329 3300005548 Unclassified 1997
224 Ga0070665_100210793 3300005548 Unclassified 1944
225 Ga0070665_100264623 3300005548 Unclassified 1721
226 Ga0070665_100329791 3300005548 Bacteria 1531
227 Ga0070665_100461342 3300005548 Unclassified 1280
228 Ga0070665_100473926 3300005548 Unclassified 1262
229 Ga0070704_100003074 3300005549 Bacteria 9505
230 Ga0070704_100237769 3300005549 Bacteria 1489
231 Ga0068855_100064704 3300005563 Unclassified 4265
232 Ga0068855_100185329 3300005563 Unclassified 2351
233 Ga0070664_100031456 3300005564 Bacteria 4434
234 Ga0070664_100313109 3300005564 Unclassified 1421
235 Ga0068857_100906545 3300005577 Bacteria 845
236 Ga0068854_100204319 3300005578 Bacteria 1555
237 Ga0068852_100934931 3300005616 Bacteria 885
238 Ga0068859_100126888 3300005617 Unclassified 2621
239 Ga0068859_100370277 3300005617 Bacteria 1528
240 Ga0068864_100070923 3300005618 Bacteria 3033
241 Ga0068864_100337878 3300005618 Bacteria 1418
242 Ga0068864_100576573 3300005618 Unclassified 1090
243 Ga0068866_10018362 3300005718 Bacteria 3162
244 Ga0068866_10057528 3300005718 Bacteria 2004
245 Ga0068866_10410936 3300005718 Bacteria 875
246 Ga0068861_100171460 3300005719 Unclassified 1799
247 Ga0068861_100489031 3300005719 Bacteria 1110
248 Ga0068863_100248995 3300005841 Bacteria 1716
249 Ga0068863_100443939 3300005841 Bacteria 1273
250 Ga0068858_100006676 3300005842 Bacteria 11224
251 Ga0068858_100091306 3300005842 Unclassified 2834
252 Ga0068858_100435046 3300005842 Bacteria 1263
253 Ga0068858_100491542 3300005842 Bacteria 1185
254 Ga0068858_101070375 3300005842 Bacteria 791
255 Ga0068860_100001436 3300005843 Bacteria 25798
256 Ga0068860_100017168 3300005843 Bacteria 7055
257 Ga0068860_100127793 3300005843 Bacteria 2436
258 Ga0068862_100023055 3300005844 Bacteria 5214
259 Ga0068862_100050370 3300005844 Bacteria 3559
260 Ga0068862_100471997 3300005844 Bacteria 1186
261 Ga0081455_10001923 3300005937 Bacteria 24955
262 Ga0081455_10006324 3300005937 Bacteria 12719
263 Ga0081455_10008225 3300005937 Bacteria 10878
264 Ga0081455_10040048 3300005937 Bacteria 4136
265 Ga0081455_10045766 3300005937 Bacteria 3804
266 Ga0081455_10107822 3300005937 Bacteria 2220
267 Ga0081540_1000020 3300005983 Bacteria 163043
268 Ga0081540_1020357 3300005983 Bacteria 3994
269 Ga0081540_1043670 3300005983 Bacteria 2296
270 Ga0081540_1117161 3300005983 Bacteria 1113
271 Ga0081539_10000026 3300005985 Bacteria 330830
272 Ga0081539_10000971 3300005985 Bacteria 53608
273 Ga0081539_10020770 3300005985 Bacteria 4419
274 Ga0081539_10033473 3300005985 Bacteria 3128
275 Ga0081539_10044247 3300005985 Unclassified 2572
276 Ga0081539_10115714 3300005985 Unclassified 1341
277 Ga0070717_10000051 3300006028 Bacteria 100477
278 Ga0070717_10009498 3300006028 Bacteria 7313
279 Ga0070717_10017689 3300006028 Bacteria 5551
280 Ga0070717_10105481 3300006028 Unclassified 2398
281 Ga0070717_10111038 3300006028 Bacteria 2339
282 Ga0070717_10299377 3300006028 Unclassified 1430
283 Ga0070717_10493778 3300006028 Unclassified 1106
284 Ga0070717_10816466 3300006028 Unclassified 848
285 Ga0070715_10028495 3300006163 Bacteria 2240
286 Ga0070716_100154525 3300006173 Unclassified 1480
287 Ga0070716_100225434 3300006173 Bacteria 1262
288 Ga0070712_100005338 3300006175 Bacteria 7955
289 Ga0070712_100005594 3300006175 Bacteria 7775
290 Ga0070712_100052022 3300006175 Bacteria 2855
291 Ga0070712_100310730 3300006175 Bacteria 1279
292 Ga0070712_100543255 3300006175 Bacteria 978
293 Ga0075362_10066651 3300006177 Unclassified 1637
294 Ga0075362_10187265 3300006177 Unclassified 1004
295 Ga0075366_10094977 3300006195 Unclassified 1787
296 Ga0097621_100012664 3300006237 Bacteria 6263
297 Ga0097621_100055102 3300006237 Bacteria 3246
298 Ga0097621_100416609 3300006237 Bacteria 1205
299 Ga0075370_10002788 3300006353 Bacteria 8192
300 Ga0068871_100060275 3300006358 Unclassified 3095
301 Ga0068871_100302244 3300006358 Bacteria 1405
302 Ga0068871_100316426 3300006358 Bacteria 1373
303 Ga0075428_100086210 3300006844 Unclassified 3425
304 Ga0075434_100076522 3300006871 Unclassified 3342
305 Ga0075434_100159613 3300006871 Bacteria 2275
306 Ga0068865_100020780 3300006881 Bacteria 4261
307 Ga0068865_100542204 3300006881 Bacteria 976
308 Ga0075436_100066690 3300006914 Unclassified 2488
309 Ga0075436_100074322 3300006914 Unclassified 2353
310 Ga0075436_100107497 3300006914 Bacteria 1946
311 Ga0097620_100126884 3300006931 Unclassified 2621
312 Ga0097620_100370274 3300006931 Bacteria 1528
313 Ga0075435_100231145 3300007076 Unclassified 1571
314 Ga0075435_100614245 3300007076 Unclassified 943
315 Ga0099795_10157351 3300007788 Unclassified 935
316 Ga0105240_10000026 3300009093 Bacteria 355569
317 Ga0105240_10145769 3300009093 Bacteria 2825
318 Ga0111539_10092141 3300009094 Unclassified 3561
319 Ga0111539_10111798 3300009094 Bacteria 3205
320 Ga0111539_10229036 3300009094 Unclassified 2164
321 Ga0105245_10010117 3300009098 Bacteria 8214
322 Ga0105245_10039610 3300009098 Bacteria 4194
323 Ga0105245_10040267 3300009098 Bacteria 4162
324 Ga0105245_10160744 3300009098 Bacteria 2131
325 Ga0105245_10386990 3300009098 Bacteria 1394
326 Ga0105245_10830892 3300009098 Bacteria 963
327 Ga0114129_10008229 3300009147 Bacteria 14870
328 Ga0114129_10251643 3300009147 Bacteria 2371
329 Ga0114129_10922365 3300009147 Unclassified 1105
330 Ga0105243_10751269 3300009148 Bacteria 956
331 Ga0105242_10007342 3300009176 Bacteria 8483
332 Ga0105248_10624579 3300009177 Unclassified 1216
333 Ga0105237_10131140 3300009545 Bacteria 2501
334 Ga0105238_10177429 3300009551 Unclassified 2107
335 Ga0105249_10009152 3300009553 Bacteria 8659
336 Ga0105249_10021031 3300009553 Bacteria 5840
337 Ga0105249_10617793 3300009553 Unclassified 1139
338 Ga0099796_10046980 3300010159 Unclassified 1484
339 Ga0099796_10203152 3300010159 Unclassified 805
340 Ga0105239_10014044 3300010375 Bacteria 8890
341 Ga0105239_10090610 3300010375 Bacteria 3373
342 Ga0105239_10256900 3300010375 Bacteria 1963
343 Ga0105239_10816769 3300010375 Bacteria 1068
344 Ga0105246_10238054 3300011119 Unclassified 1437
345 Ga0105246_10447833 3300011119 Bacteria 1084
346 Ga0157373_10422298 3300013100 Unclassified 957
347 Ga0157369_10063759 3300013105 Bacteria 3970
348 Ga0157374_10000028 3300013296 Bacteria 213725
349 Ga0157374_10001376 3300013296 Bacteria 20664
350 Ga0157374_10025392 3300013296 Bacteria 5320
351 Ga0157374_10042444 3300013296 Bacteria 4195
352 Ga0157374_10054351 3300013296 Unclassified 3735
353 Ga0157374_10107811 3300013296 Unclassified 2677
354 Ga0157374_10124481 3300013296 Unclassified 2491
355 Ga0157374_10142515 3300013296 Unclassified 2327
356 Ga0157374_10208759 3300013296 Unclassified 1914
357 Ga0157374_10236857 3300013296 Bacteria 1794
358 Ga0157374_10400289 3300013296 Bacteria 1370
359 Ga0157374_10549948 3300013296 Unclassified 1162
360 Ga0157378_10010835 3300013297 Bacteria 7972
361 Ga0157378_10039247 3300013297 Bacteria 4199
362 Ga0157378_10089316 3300013297 Bacteria 2798
363 Ga0157378_10093876 3300013297 Bacteria 2732
364 Ga0157378_10101167 3300013297 Bacteria 2632
365 Ga0157378_10149284 3300013297 Bacteria 2177
366 Ga0157378_10201458 3300013297 Bacteria 1883
367 Ga0157378_10225078 3300013297 Unclassified 1785
368 Ga0157378_10462071 3300013297 Unclassified 1261
369 Ga0157378_10468437 3300013297 Bacteria 1253
370 Ga0157378_10747698 3300013297 Bacteria 1000
371 Ga0163162_10023264 3300013306 Bacteria 6114
372 Ga0163162_10031706 3300013306 Bacteria 5243
373 Ga0163162_10093012 3300013306 Bacteria 3099
374 Ga0163162_10429977 3300013306 Unclassified 1452
375 Ga0163162_10478695 3300013306 Unclassified 1376
376 Ga0157372_10018246 3300013307 Bacteria 7543
377 Ga0157372_10105148 3300013307 Bacteria 3229
378 Ga0157372_10319012 3300013307 Bacteria 1809
379 Ga0157372_10470157 3300013307 Bacteria 1466
380 Ga0157372_10566697 3300013307 Bacteria 1324
381 Ga0157372_10950037 3300013307 Unclassified 996
382 Ga0157375_10001199 3300013308 Bacteria 22351
383 Ga0157375_10052028 3300013308 Bacteria 4025
384 Ga0157375_10123174 3300013308 Unclassified 2705
385 Ga0157375_10260468 3300013308 Bacteria 1896
386 Ga0157375_10323496 3300013308 Bacteria 1707
387 Ga0157375_10338929 3300013308 Bacteria 1669
388 Ga0157375_10445094 3300013308 Unclassified 1461
389 Ga0163163_10476810 3300014325 Bacteria 1309
390 Ga0157380_11025498 3300014326 Unclassified 860
391 Ga0157377_10082043 3300014745 Unclassified 1887
392 Ga0157377_10148916 3300014745 Bacteria 1445
393 Ga0157377_10182998 3300014745 Unclassified 1319
394 Ga0157379_10029749 3300014968 Bacteria 4856
395 Ga0157379_10309428 3300014968 Bacteria 1441
396 Ga0157379_10510707 3300014968 Bacteria 1115
397 Ga0157376_10000742 3300014969 Bacteria 21200
398 Ga0157376_10022824 3300014969 Bacteria 4886
399 Ga0157376_10024813 3300014969 Bacteria 4714
400 Ga0157376_10033602 3300014969 Unclassified 4131
401 Ga0157376_10089586 3300014969 Bacteria 2660
402 Ga0157376_10142399 3300014969 Bacteria 2153
403 Ga0182005_1040853 3300015265 Unclassified 1261
404 Ga0163161_10015142 3300017792 Bacteria 5375
405 Ga0163161_10101642 3300017792 Unclassified 2141
406 Ga0213873_10028726 3300021358 Bacteria 1366
407 Ga0213872_10007470 3300021361 Bacteria 5376
408 Ga0213872_10010251 3300021361 Bacteria 4467
409 Ga0213872_10025045 3300021361 Bacteria 2744
410 Ga0213872_10052432 3300021361 Bacteria 1851
411 Ga0213872_10064573 3300021361 Unclassified 1654
412 Ga0213872_10067507 3300021361 Bacteria 1614
413 Ga0213872_10072087 3300021361 Unclassified 1556
414 Ga0213874_10004510 3300021377 Bacteria 3188
415 Ga0213874_10005188 3300021377 Bacteria 3024
416 Ga0213876_10000644 3300021384 Bacteria 25234
417 Ga0213876_10001059 3300021384 Bacteria 17756
418 Ga0213875_10034454 3300021388 Bacteria 2391
419 Ga0213871_10038458 3300021441 Unclassified 1277
420 Ga0213871_10047945 3300021441 Unclassified 1163
421 Ga0213871_10061851 3300021441 Bacteria 1044
422 Ga0207666_1011030 3300025271 Unclassified 1246
423 Ga0207673_1001952 3300025290 Unclassified 2306
424 Ga0207673_1003613 3300025290 Bacteria 1818
425 Ga0207673_1009781 3300025290 Bacteria 1227
426 Ga0209050_1001062 3300025298 Bacteria 33730
427 Ga0207697_10000802 3300025315 Bacteria 17850
428 Ga0207697_10000966 3300025315 Bacteria 16174
429 Ga0207697_10001778 3300025315 Bacteria 11550
430 Ga0207697_10003654 3300025315 Bacteria 7535
431 Ga0207697_10006438 3300025315 Bacteria 5316
432 Ga0207697_10007221 3300025315 Bacteria 4965
433 Ga0207697_10007584 3300025315 Bacteria 4822
434 Ga0207697_10023609 3300025315 Bacteria 2518
435 Ga0207682_10026259 3300025893 Bacteria 2314
436 Ga0207682_10070319 3300025893 Unclassified 1482
437 Ga0207692_10113647 3300025898 Bacteria 1505
438 Ga0207692_10130286 3300025898 Bacteria 1420
439 Ga0207688_10001123 3300025901 Bacteria 13760
440 Ga0207688_10002947 3300025901 Bacteria 9261
441 Ga0207688_10126802 3300025901 Bacteria 1493
442 Ga0207680_10019261 3300025903 Bacteria 3646
443 Ga0207680_10081970 3300025903 Unclassified 2029
444 Ga0207647_10033599 3300025904 Bacteria 3284
445 Ga0207647_10145645 3300025904 Unclassified 1386
446 Ga0207647_10214440 3300025904 Unclassified 1111
447 Ga0207685_10029012 3300025905 Bacteria 1955
448 Ga0207699_10161239 3300025906 Bacteria 1493
449 Ga0207645_10002756 3300025907 Bacteria 13685
450 Ga0207645_10002845 3300025907 Bacteria 13417
451 Ga0207645_10003147 3300025907 Bacteria 12643
452 Ga0207645_10036310 3300025907 Bacteria 3164
453 Ga0207645_10080060 3300025907 Unclassified 2094
454 Ga0207705_10004253 3300025909 Bacteria 10838
455 Ga0207684_10001372 3300025910 Bacteria 26550
456 Ga0207684_10017981 3300025910 Bacteria 6058
457 Ga0207684_10039506 3300025910 Bacteria 4002
458 Ga0207684_10101125 3300025910 Bacteria 2464
459 Ga0207684_10104935 3300025910 Bacteria 2417
460 Ga0207684_10120519 3300025910 Bacteria 2249
461 Ga0207684_10178023 3300025910 Bacteria 1834
462 Ga0207684_10214889 3300025910 Unclassified 1659
463 Ga0207684_10271528 3300025910 Bacteria 1463
464 Ga0207707_10023125 3300025912 Bacteria 5438
465 Ga0207695_10000246 3300025913 Bacteria 140972
466 Ga0207671_10007402 3300025914 Bacteria 9527
467 Ga0207671_10380752 3300025914 Unclassified 1121
468 Ga0207693_10001148 3300025915 Bacteria 23648
469 Ga0207693_10021435 3300025915 Bacteria 5134
470 Ga0207693_10021534 3300025915 Bacteria 5122
471 Ga0207693_10027165 3300025915 Bacteria 4525
472 Ga0207693_10044452 3300025915 Unclassified 3491
473 Ga0207693_10077481 3300025915 Bacteria 2603
474 Ga0207693_10151776 3300025915 Bacteria 1822
475 Ga0207693_10163553 3300025915 Bacteria 1751
476 Ga0207663_10002379 3300025916 Bacteria 9035
477 Ga0207663_10023712 3300025916 Unclassified 3526
478 Ga0207660_10010762 3300025917 Bacteria 5943
479 Ga0207660_10308622 3300025917 Bacteria 1261
480 Ga0207662_10053725 3300025918 Bacteria 2400
481 Ga0207657_10034639 3300025919 Bacteria 4538
482 Ga0207649_10072929 3300025920 Bacteria 2198
483 Ga0207652_10045158 3300025921 Bacteria 3755
484 Ga0207646_10000761 3300025922 Bacteria 41842
485 Ga0207646_10001268 3300025922 Bacteria 31646
486 Ga0207646_10017315 3300025922 Bacteria 6745
487 Ga0207646_10030930 3300025922 Bacteria 4849
488 Ga0207646_10050145 3300025922 Unclassified 3736
489 Ga0207646_10070399 3300025922 Unclassified 3124
490 Ga0207646_10086948 3300025922 Unclassified 2797
491 Ga0207646_10098548 3300025922 Unclassified 2619
492 Ga0207646_10116002 3300025922 Bacteria 2405
493 Ga0207646_10138266 3300025922 Bacteria 2194
494 Ga0207646_10154537 3300025922 Bacteria 2069
495 Ga0207646_10364494 3300025922 Unclassified 1305
496 Ga0207646_10526509 3300025922 Bacteria 1064
497 Ga0207681_10001128 3300025923 Bacteria 17315
498 Ga0207681_10137516 3300025923 Unclassified 1815
499 Ga0207694_10719947 3300025924 Unclassified 842
500 Ga0207650_10043669 3300025925 Unclassified 3291
501 Ga0207650_10165836 3300025925 Unclassified 1753
502 Ga0207650_10212830 3300025925 Bacteria 1553
503 Ga0207659_10013166 3300025926 Bacteria 5291
504 Ga0207659_10014543 3300025926 Bacteria 5080
505 Ga0207659_10028922 3300025926 Bacteria 3770
506 Ga0207659_10066382 3300025926 Unclassified 2618
507 Ga0207659_10086006 3300025926 Unclassified 2337
508 Ga0207659_10105153 3300025926 Bacteria 2135
509 Ga0207659_10120809 3300025926 Bacteria 2007
510 Ga0207659_10152449 3300025926 Bacteria 1806
511 Ga0207659_10547369 3300025926 Bacteria 983
512 Ga0207659_10763213 3300025926 Bacteria 830
513 Ga0207687_10053160 3300025927 Bacteria 2828
514 Ga0207687_10111298 3300025927 Bacteria 2032
515 Ga0207687_10135610 3300025927 Bacteria 1861
516 Ga0207700_10008765 3300025928 Bacteria 6282
517 Ga0207700_10020492 3300025928 Bacteria 4493
518 Ga0207700_10181941 3300025928 Unclassified 1761
519 Ga0207700_10188046 3300025928 Bacteria 1734
520 Ga0207700_10373933 3300025928 Bacteria 1245
521 Ga0207664_10053301 3300025929 Bacteria 3201
522 Ga0207664_10463875 3300025929 Bacteria 1131
523 Ga0207644_10005337 3300025931 Bacteria 8386
524 Ga0207644_10091102 3300025931 Unclassified 2273
525 Ga0207644_10250468 3300025931 Bacteria 1413
526 Ga0207644_10325498 3300025931 Unclassified 1243
527 Ga0207644_10538968 3300025931 Unclassified 965
528 Ga0207690_10243141 3300025932 Bacteria 1387
529 Ga0207706_10014002 3300025933 Bacteria 7274
530 Ga0207706_10015823 3300025933 Bacteria 6820
531 Ga0207706_10044612 3300025933 Bacteria 3929
532 Ga0207706_10115786 3300025933 Bacteria 2357
533 Ga0207706_10259142 3300025933 Unclassified 1518
534 Ga0207706_10259527 3300025933 Unclassified 1517
535 Ga0207706_10333472 3300025933 Unclassified 1320
536 Ga0207670_10005331 3300025936 Bacteria 7049
537 Ga0207670_10038138 3300025936 Unclassified 3136
538 Ga0207670_10095112 3300025936 Bacteria 2115
539 Ga0207670_10167664 3300025936 Bacteria 1644
540 Ga0207670_10380279 3300025936 Unclassified 1124
541 Ga0207704_10262738 3300025938 Unclassified 1302
542 Ga0207704_10385900 3300025938 Bacteria 1101
543 Ga0207665_10010811 3300025939 Bacteria 5991
544 Ga0207665_10015284 3300025939 Bacteria 5040
545 Ga0207665_10031684 3300025939 Bacteria 3499
546 Ga0207665_10037324 3300025939 Unclassified 3234
547 Ga0207665_10120877 3300025939 Unclassified 1850
548 Ga0207665_10282754 3300025939 Bacteria 1235
549 Ga0207665_10509331 3300025939 Bacteria 931
550 Ga0207691_10001964 3300025940 Bacteria 20104
551 Ga0207691_10003946 3300025940 Bacteria 14408
552 Ga0207691_10086745 3300025940 Bacteria 2808
553 Ga0207691_10171002 3300025940 Unclassified 1903
554 Ga0207691_10190967 3300025940 Bacteria 1786
555 Ga0207691_10398230 3300025940 Bacteria 1174
556 Ga0207711_10388373 3300025941 Unclassified 1296
557 Ga0207689_10048953 3300025942 Bacteria 3487
558 Ga0207679_10111958 3300025945 Bacteria 2156
559 Ga0207679_10151802 3300025945 Unclassified 1886
560 Ga0207667_10055512 3300025949 Unclassified 4164
561 Ga0207651_10004486 3300025960 Bacteria 7043
562 Ga0207651_10005563 3300025960 Bacteria 6487
563 Ga0207651_10055413 3300025960 Unclassified 2723
564 Ga0207651_10055961 3300025960 Bacteria 2712
565 Ga0207651_10267238 3300025960 Unclassified 1407
566 Ga0207651_10597131 3300025960 Unclassified 964
567 Ga0207712_10043479 3300025961 Bacteria 3100
568 Ga0207712_10076812 3300025961 Bacteria 2419
569 Ga0207668_10017030 3300025972 Bacteria 4547
570 Ga0207668_10100385 3300025972 Bacteria 2149
571 Ga0207668_10172148 3300025972 Unclassified 1699
572 Ga0207658_10192525 3300025986 Bacteria 1696
573 Ga0207658_10212685 3300025986 Bacteria 1621
574 Ga0207658_10265951 3300025986 Bacteria 1463
575 Ga0207658_10447145 3300025986 Unclassified 1143
576 Ga0207658_10563196 3300025986 Unclassified 1021
577 Ga0207677_10007393 3300026023 Bacteria 6073
578 Ga0207677_10011093 3300026023 Bacteria 5122
579 Ga0207677_10127218 3300026023 Unclassified 1927
580 Ga0207677_10648464 3300026023 Bacteria 932
581 Ga0207703_10004657 3300026035 Bacteria 11202
582 Ga0207703_10018759 3300026035 Bacteria 5403
583 Ga0207703_10166952 3300026035 Unclassified 1932
584 Ga0207703_10545236 3300026035 Bacteria 1093
585 Ga0207639_10424440 3300026041 Bacteria 1203
586 Ga0207678_10010772 3300026067 Bacteria 8033
587 Ga0207678_10097250 3300026067 Bacteria 2516
588 Ga0207708_10077408 3300026075 Bacteria 2552
589 Ga0207702_10260289 3300026078 Bacteria 1633
590 Ga0207641_10154584 3300026088 Unclassified 2080
591 Ga0207641_10403438 3300026088 Bacteria 1313
592 Ga0207648_10014296 3300026089 Bacteria 7336
593 Ga0207676_10147013 3300026095 Bacteria 2025
594 Ga0207675_100396742 3300026118 Unclassified 1359
595 Ga0207675_100752844 3300026118 Bacteria 986
596 Ga0207683_10024023 3300026121 Bacteria 5246
597 Ga0207683_10035809 3300026121 Bacteria 4317
598 Ga0207683_10036759 3300026121 Bacteria 4265
599 Ga0207683_10114128 3300026121 Bacteria 2420
600 Ga0207683_10155538 3300026121 Unclassified 2065
601 Ga0207698_11084107 3300026142 Bacteria 813
602 Ga0268266_10012917 3300028379 Bacteria 7205
603 Ga0268266_10049192 3300028379 Bacteria 3614
604 Ga0268266_10080964 3300028379 Bacteria 2830
605 Ga0268266_10125890 3300028379 Unclassified 2286
606 Ga0268266_10156863 3300028379 Unclassified 2057
607 Ga0268265_10043487 3300028380 Bacteria 3340
608 Ga0268265_10212756 3300028380 Bacteria 1686
609 Ga0268265_10718570 3300028380 Bacteria 967
610 Ga0268264_10000366 3300028381 Bacteria 67007
611 Ga0268264_10145673 3300028381 Unclassified 2117
612 Ga0268264_10230145 3300028381 Bacteria 1711
613 Ga0268264_10262463 3300028381 Bacteria 1610
614 Ga0268264_10854832 3300028381 Unclassified 911
615 Ga0373944_0018025 3300035089 Unclassified 2013
616 Ga0373944_0023106 3300035089 Bacteria 1812
617 Ga0373945_0053597 3300035116 Unclassified 1489
618 Ga0373953_0051101 3300035117 Bacteria 1671
619 Ga0373953_0117552 3300035117 Bacteria 1128
620 Ga0373943_0047061 3300035170 Bacteria 2107
621 Ga0373946_0215480 3300035171 Unclassified 925
622 Ga0373955_0029291 3300035172 Bacteria 2862
623 Ga0373955_0237687 3300035172 Unclassified 1091
624 Ga0373931_0031957 3300035691 Bacteria 2721
625 Ga0373931_0186417 3300035691 Bacteria 1232
626 Ga0373935_0033855 3300035692 Bacteria 3182
627 Ga0373935_0076987 3300035692 Unclassified 2161
628 Ga0373935_0079708 3300035692 Bacteria 2126
629 Ga0373935_0188815 3300035692 Bacteria 1418
630 Ga0373935_0332324 3300035692 Unclassified 1080
631 Ga0373927_0058746 3300035695 Bacteria 2488
632 Ga0373927_0069533 3300035695 Bacteria 2278
633 Ga0373947_0066049 3300035725 Bacteria 2207
634 Ga0373947_0079687 3300035725 Bacteria 2024
635 Ga0373937_0102605 3300036401 Bacteria 2656
636 Ga0373937_0168131 3300036401 Bacteria 2057
637 Ga0373937_0206167 3300036401 Bacteria 1849
638 Ga0373937_0216054 3300036401 Bacteria 1804
639 Ga0373937_0327313 3300036401 Unclassified 1450
640 Ga0373925_0065800 3300037068 Bacteria 2731
641 Ga0373925_0143540 3300037068 Bacteria 1870
642 Ga0395900_0002938 3300037418 Bacteria 18564
643 Ga0395898_0007971 3300037466 Bacteria 11235
644 Ga0395898_0129871 3300037466 Bacteria 2413
645 Ga0395905_0019180 3300037471 Bacteria 6486
646 Ga0395905_0217961 3300037471 Bacteria 1787
647 Ga0436364_0227970 3300037853 Bacteria 7481
648 Ga0436364_0520032 3300037853 Bacteria 3834
649 Ga0436364_0802819 3300037853 Bacteria 4045
650 Ga0395901_0000503 3300038443 Bacteria 45231
651 Ga0395901_0376027 3300038443 Unclassified 1463
652 Ga0436365_0003707 3300039437 Unclassified 2362
653 Ga0436365_0742888 3300039437 Bacteria 55848
654 Ga0436365_0953982 3300039437 Unclassified 1804
655 Ga0436365_0979913 3300039437 Bacteria 23987
656 Ga0436365_1122847 3300039437 Unclassified 1299
657 Ga0436365_1753433 3300039437 Bacteria 24400
658 Ga0436360_0086757 3300039438 Unclassified 1515
659 Ga0436360_0227542 3300039438 Bacteria 1988
660 Ga0436360_0484811 3300039438 Bacteria 9203
661 Ga0436360_0885762 3300039438 Bacteria 1482
662 Ga0436360_1295629 3300039438 Bacteria 3799
663 Ga0436361_0065736 3300039447 Bacteria 5574
664 Ga0436361_0080266 3300039447 Bacteria 12753
665 Ga0436361_0097796 3300039447 Unclassified 998
666 Ga0436361_0108215 3300039447 Bacteria 6801
667 Ga0436361_0121231 3300039447 Bacteria 8306
668 Ga0436361_0491563 3300039447 Bacteria 5960
669 Ga0436361_0566372 3300039447 Unclassified 1173
670 Ga0436361_0623192 3300039447 Unclassified 1643
671 Ga0436361_1005909 3300039447 Bacteria 3668
672 Ga0436361_1171226 3300039447 Bacteria 2272
673 Ga0436363_0524079 3300039450 Bacteria 10067
674 Ga0436363_1359713 3300039450 Bacteria 21173
675 Ga0436363_1480040 3300039450 Unclassified 1656
676 Ga0436362_0365033 3300039453 Bacteria 816
677 Ga0436362_0434912 3300039453 Unclassified 1050
678 Ga0436362_0940953 3300039453 Bacteria 1802
679 Ga0436362_0986746 3300039453 Bacteria 2029
680 Ga0436362_0990369 3300039453 Unclassified 1023
681 Ga0451807_2394735 3300041486 Unclassified 1355
682 Ga0439464_0023715 3300042439 Bacteria 1695
683 Ga0466964_0065942 3300044706 Bacteria 1518
684 Ga0451576_0157759 3300045051 Bacteria 2367
685 Ga0466967_0247572 3300045976 Bacteria 1702
686 Ga0495592_0144003 3300046454 Bacteria 1654
687 Ga0495641_0055825 3300046461 Bacteria 1792
688 Ga0495651_0119375 3300046462 Bacteria 1939
689 Ga0495653_0084467 3300046463 Bacteria 2338
690 Ga0495580_0059883 3300046472 Bacteria 2676
691 Ga0495584_0052676 3300046491 Bacteria 2048
692 Ga0495584_0267126 3300046491 Unclassified 870
693 Ga0495608_0110346 3300046511 Bacteria 1769
694 Ga0495608_0411786 3300046511 Bacteria 826
695 Ga0495628_0013608 3300046516 Bacteria 6842
696 Ga0495630_0011198 3300046517 Bacteria 6491
697 Ga0495630_0042363 3300046517 Bacteria 3400
698 Ga0495630_0082504 3300046517 Bacteria 2427
699 Ga0495630_0363452 3300046517 Unclassified 1108
700 Ga0495643_0000057 3300046522 Bacteria 195145
701 Ga0495640_0068484 3300046533 Bacteria 2388
702 Ga0495586_0067469 3300046535 Unclassified 1951
703 Ga0495587_0047094 3300046536 Bacteria 2557
704 Ga0495598_0002948 3300046537 Unclassified 3568
705 Ga0495645_0009512 3300046543 Bacteria 6795
706 Ga0495645_0273682 3300046543 Bacteria 1113
707 Ga0495634_0220938 3300046642 Bacteria 1169
708 Ga0495659_0095207 3300046664 Bacteria 1147
709 Ga0495599_0001064 3300046678 Bacteria 15436
710 Ga0495646_0038169 3300046680 Bacteria 2967
711 Ga0495658_0017416 3300046683 Bacteria 3711
712 Ga0495658_0255099 3300046683 Bacteria 1103
713 Ga0495669_0011233 3300046684 Unclassified 3799
714 Ga0495624_0156209 3300046690 Bacteria 1394
715 Ga0495624_0177561 3300046690 Bacteria 1298
716 Ga0495671_0056740 3300046692 Unclassified 1939
717 Ga0495581_0313152 3300047315 Unclassified 917
718 Ga0495604_0079729 3300047317 Bacteria 2455
719 Ga0495675_0089355 3300047444 Bacteria 1934
720 Ga0495684_0077745 3300047471 Unclassified 2519
721 Ga0495684_0372247 3300047471 Bacteria 1009
722 Ga0495593_0162885 3300047673 Unclassified 1126
723 Ga0495602_0057134 3300048088 Bacteria 3426
724 Ga0496100_0165389 3300048903 Bacteria 1589
725 Ga0496101_0040171 3300048904 Bacteria 3332
726 Ga0496101_0079016 3300048904 Bacteria 2428
727 Ga0496101_0166434 3300048904 Bacteria 1693
728 Ga0496101_0542719 3300048904 Unclassified 919
729 Ga0496102_0169565 3300048905 Bacteria 2055
730 Ga0496102_0305120 3300048905 Unclassified 1500
731 Ga0496102_0317215 3300048905 Unclassified 1468
732 Ga0496102_0628144 3300048905 Bacteria 997
733 Ga0496102_0638813 3300048905 Unclassified 987
734 Ga0496103_0066511 3300048906 Bacteria 2250
735 Ga0496103_0139142 3300048906 Unclassified 1552
736 Ga0496103_0435321 3300048906 Unclassified 841
737 Ga0496104_0023095 3300048907 Bacteria 5716
738 Ga0496104_0027820 3300048907 Bacteria 5234
739 Ga0496104_0168231 3300048907 Bacteria 2102
740 Ga0496104_0191076 3300048907 Bacteria 1959
741 Ga0496104_0346300 3300048907 Bacteria 1399
742 Ga0496104_0405004 3300048907 Unclassified 1276
743 Ga0496105_0036817 3300048908 Bacteria 4032
744 Ga0496105_0046103 3300048908 Bacteria 3598
745 Ga0496105_0381032 3300048908 Unclassified 1122
746 Ga0496106_0135421 3300048909 Bacteria 1934
747 Ga0496106_0157602 3300048909 Bacteria 1794
748 Ga0496106_0299304 3300048909 Bacteria 1290
749 Ga0496106_0564232 3300048909 Unclassified 913
750 Ga0496107_0124878 3300048910 Bacteria 1897
751 Ga0496107_0176927 3300048910 Unclassified 1584
752 Ga0496107_0312232 3300048910 Bacteria 1170
753 Ga0496108_0028590 3300048911 Bacteria 4613
754 Ga0496108_0314787 3300048911 Unclassified 1364
755 Ga0496108_0377933 3300048911 Unclassified 1237
756 Ga0496109_0203729 3300048912 Bacteria 1860
757 Ga0496109_0333035 3300048912 Bacteria 1433
758 Ga0496110_0055541 3300048913 Bacteria 3485
759 Ga0496110_0465031 3300048913 Bacteria 1153
760 Ga0496110_0691877 3300048913 Unclassified 921
761 Ga0496111_0313626 3300048914 Unclassified 1162
762 Ga0496112_0025448 3300048915 Bacteria 5683
763 Ga0496112_0048842 3300048915 Bacteria 4146
764 Ga0496112_0425505 3300048915 Bacteria 1266
765 Ga0496113_0031410 3300048916 Bacteria 3855
766 Ga0496113_0102019 3300048916 Bacteria 2225
767 Ga0496113_0165558 3300048916 Bacteria 1749
768 Ga0496113_0231526 3300048916 Bacteria 1473
769 Ga0496113_0379307 3300048916 Unclassified 1135
770 Ga0496114_0025836 3300048917 Bacteria 4803
771 Ga0496114_0030657 3300048917 Bacteria 4425
772 Ga0496114_0042250 3300048917 Bacteria 3779
773 Ga0496114_0249653 3300048917 Bacteria 1561
774 Ga0496115_0002890 3300048918 Bacteria 12382
775 Ga0496115_0026845 3300048918 Bacteria 4499
776 Ga0496115_0034044 3300048918 Bacteria 4026
777 Ga0496115_0058437 3300048918 Bacteria 3103
778 Ga0496121_0466454 3300048924 Bacteria 810
779 Ga0496124_0251489 3300048927 Unclassified 1307
780 Ga0496125_0000017 3300048928 Bacteria 508217
781 Ga0501080_0037313 3300049742 Bacteria 4538
782 nmdc:mga03683_108582_c1 3300050489 Unclassified 1225
783 nmdc:mga03n38_37500_c1 3300050490 Unclassified 2091
784 nmdc:mga0k408_1450_c1 3300050493 Bacteria 12815
785 nmdc:mga0k408_594_c1 3300050493 Bacteria 19993
786 nmdc:mga0k408_88430_c1 3300050493 Unclassified 1819
787 nmdc:mga07m45_1685_c2 3300050496 Bacteria 6406
788 nmdc:mga05p37_286502_c1 3300050507 Bacteria 1962
789 nmdc:mga05p37_395708_c1 3300050507 Unclassified 1614
790 nmdc:mga05p37_9589_c1 3300050507 Bacteria 11466
791 nmdc:mga0n895_238915_c1 3300050512 Bacteria 1843
792 nmdc:mga0n895_628825_c1 3300050512 Unclassified 1074
793 nmdc:mga08x19_102016_c1 3300050514 Unclassified 1905
794 nmdc:mga08x19_324949_c1 3300050514 Unclassified 1071
795 nmdc:mga08x19_71040_c1 3300050514 Bacteria 2269
796 nmdc:mga08x19_85195_c1 3300050514 Bacteria 2079
797 Ga0495601_0041630 3300053077 Bacteria 2880
798 Ga0495601_0381030 3300053077 Bacteria 915
799 Ga0495612_0123251 3300053078 Bacteria 1116
800 Ga0495655_0089716 3300053083 Unclassified 894
801 Ga0495595_0008259 3300053084 Bacteria 4275
802 Ga0495619_0411487 3300053085 Unclassified 933
803 Ga0500555_000180 3300053103 Bacteria 28779
804 Ga0500642_0065611 3300053130 Bacteria 1641
805 Ga0500616_0004903 3300053153 Bacteria 9310
806 2787507240 2786546548 Bacteria 4745694
807 Ga0373943_0098113
808 SwRhRL3b_contig_2861724
809 SwRhRL2b_contig_405184
810 CNXas_1000023
811 JGI24737J22298_10074967
812 JGI24743J22301_10020906
813 JGI24035J26624_1002091
814 JGI24035J26624_1008118
815 JGI25406J46586_10000005
816 JGI25406J46586_10028950
817 rootH2_10149846
818 JGI25404J52841_10032670
819 JGI25405J52794_10012476
820 JGI25405J52794_10013038
821 Ga0065704_10023667
822 Ga0065704_10087740
823 Ga0065704_10118197
824 Ga0065712_10000860
825 Ga0065712_10017080
826 Ga0065712_10027830
827 Ga0065712_10072993
828 Ga0065712_10098013
829 Ga0065712_10103954
830 Ga0065715_10024520
831 Ga0065715_10089137
832 Ga0065715_10178837
833 Ga0065715_10187515
834 Ga0065715_10197118
835 Ga0065707_10012925
836 Ga0065707_10029388
837 Ga0065707_10136549
838 Ga0065707_10145514
839 Ga0070658_10007327
840 Ga0070658_10622171
841 Ga0070676_10000532
842 Ga0070676_10004370
843 Ga0070676_10019534
844 Ga0070676_10237821
845 Ga0070683_100581688
846 Ga0070690_100370252
847 Ga0070670_100033134
848 Ga0070670_100040914
849 Ga0070670_100075177
850 Ga0070670_100178383
851 Ga0070670_100195629
852 Ga0070670_100751983
853 Ga0070677_10091378
854 Ga0068869_100037030
855 Ga0068869_100567605
856 Ga0070666_10011900
857 Ga0070666_10014502
858 Ga0070666_10054050
859 Ga0070680_100026741
860 Ga0068868_100024925
861 Ga0068868_100033756
862 Ga0068868_100046856
863 Ga0068868_100258564
864 Ga0068868_100470569
865 Ga0070660_100038563
866 Ga0070660_100053625
867 Ga0070689_100020753
868 Ga0070689_100103652
869 Ga0070689_100135109
870 Ga0070689_100142878
871 Ga0070689_100203401
872 Ga0070689_100402016
873 Ga0070689_100743743
874 Ga0070687_100034519
875 Ga0070687_100250697
876 Ga0070687_100320441
877 Ga0070661_100041414
878 Ga0070692_10158022
879 Ga0070668_100006274
880 Ga0070668_100009678
881 Ga0070668_100011711
882 Ga0070668_100078289
883 Ga0070668_100495812
884 Ga0070669_100004757
885 Ga0070669_100054557
886 Ga0070669_100058956
887 Ga0070669_100230954
888 Ga0070669_100364713
889 Ga0070675_100011878
890 Ga0070675_100023765
891 Ga0070675_100043724
892 Ga0070675_100057713
893 Ga0070675_100063071
894 Ga0070675_100102510
895 Ga0070675_100106835
896 Ga0070675_100144852
897 Ga0070675_100150832
898 Ga0070675_100220248
899 Ga0070675_100414310
900 Ga0070675_100842133
901 Ga0070671_100011573
902 Ga0070671_100096670
903 Ga0070671_100146020
904 Ga0070671_100147873
905 Ga0070671_100213497
906 Ga0070671_100376014
907 Ga0070674_100083299
908 Ga0070674_100131839
909 Ga0070673_100027043
910 Ga0070673_100029054
911 Ga0070673_100180862
912 Ga0070673_100241584
913 Ga0070673_100434650
914 Ga0070688_100002037
915 Ga0070688_100004071
916 Ga0070688_100277618
917 Ga0070659_100054333
918 Ga0070667_100008695
919 Ga0070667_100039941
920 Ga0070667_100156552
921 Ga0070667_100230640
922 Ga0070667_100357165
923 Ga0070667_100398494
924 Ga0070709_10036549
925 Ga0070709_10151845
926 Ga0070709_10181957
927 Ga0070714_100062398
928 Ga0070713_100023951
929 Ga0070713_100035001
930 Ga0070710_10051552
931 Ga0070710_10143876
932 Ga0070710_10219430
933 Ga0070710_10361247
934 Ga0070711_100001456
935 Ga0070711_100024422
936 Ga0070711_100025983
937 Ga0070711_100087913
938 Ga0070705_100006187
939 Ga0070705_100168121
940 Ga0070705_100180421
941 Ga0070708_100071514
942 Ga0070708_100134677
943 Ga0070708_100135853
944 Ga0070708_100191594
945 Ga0070708_100227062
946 Ga0070708_100463079
947 Ga0070663_100159529
948 Ga0070663_100457322
949 Ga0070663_100466775
950 Ga0070678_100018893
951 Ga0070678_100021575
952 Ga0070678_100167596
953 Ga0070678_100659199
954 Ga0070662_100004788
955 Ga0070662_100021507
956 Ga0070662_100304999
957 Ga0070662_100444590
958 Ga0070681_10047395
959 Ga0068867_100138571
960 Ga0068867_100566479
961 Ga0070685_10114100
962 Ga0070706_100001307
963 Ga0070706_100027211
964 Ga0070706_100032192
965 Ga0070706_100042736
966 Ga0070706_100061826
967 Ga0070706_100155959
968 Ga0070706_100235151
969 Ga0070706_100382897
970 Ga0070706_100389349
971 Ga0070706_100403416
972 Ga0070706_100646808
973 Ga0070706_100653150
974 Ga0070706_100842431
975 Ga0070707_100013538
976 Ga0070707_100014183
977 Ga0070707_100017595
978 Ga0070707_100023601
979 Ga0070707_100039620
980 Ga0070707_100057695
981 Ga0070707_100073877
982 Ga0070707_100081104
983 Ga0070707_100166484
984 Ga0070707_100235963
985 Ga0070707_100523503
986 Ga0070707_100586638
987 Ga0070707_100589178
988 Ga0070698_100000476
989 Ga0070698_100001859
990 Ga0070698_100007937
991 Ga0070698_100042761
992 Ga0070698_100045179
993 Ga0070698_100228778
994 Ga0070698_100316405
995 Ga0070698_100507711
996 Ga0070698_100732053
997 Ga0070699_100008608
998 Ga0070699_100010237
999 Ga0070699_100200718
1000 Ga0070699_100269318
1001 Ga0070699_100376594
1002 Ga0070684_100002754
1003 Ga0070697_100002854
1004 Ga0070697_100004951
1005 Ga0070697_100007131
1006 Ga0070697_100007454
1007 Ga0070697_100009154
1008 Ga0070697_100012623
1009 Ga0070697_100012771
1010 Ga0070697_100035473
1011 Ga0070697_100044349
1012 Ga0070697_100174287
1013 Ga0070697_100448443
1014 Ga0070697_100662361
1015 Ga0068853_100441183
1016 Ga0070672_100006350
1017 Ga0070672_100007468
1018 Ga0070672_100024765
1019 Ga0070672_100237458
1020 Ga0070672_100352755
1021 Ga0070686_100013154
1022 Ga0070686_100053622
1023 Ga0070686_100143957
1024 Ga0070695_100442633
1025 Ga0070695_100577146
1026 Ga0070693_100319126
1027 Ga0070665_100036142
1028 Ga0070665_100036880
1029 Ga0070665_100200329
1030 Ga0070665_100210793
1031 Ga0070665_100264623
1032 Ga0070665_100329791
1033 Ga0070665_100461342
1034 Ga0070665_100473926
1035 Ga0070704_100003074
1036 Ga0070704_100237769
1037 Ga0068855_100064704
1038 Ga0068855_100185329
1039 Ga0070664_100031456
1040 Ga0070664_100313109
1041 Ga0068857_100906545
1042 Ga0068854_100204319
1043 Ga0068852_100934931
1044 Ga0068859_100126888
1045 Ga0068859_100370277
1046 Ga0068864_100070923
1047 Ga0068864_100337878
1048 Ga0068864_100576573
1049 Ga0068866_10018362
1050 Ga0068866_10057528
1051 Ga0068866_10410936
1052 Ga0068861_100171460
1053 Ga0068861_100489031
1054 Ga0068863_100248995
1055 Ga0068863_100443939
1056 Ga0068858_100006676
1057 Ga0068858_100091306
1058 Ga0068858_100435046
1059 Ga0068858_100491542
1060 Ga0068858_101070375
1061 Ga0068860_100001436
1062 Ga0068860_100017168
1063 Ga0068860_100127793
1064 Ga0068862_100023055
1065 Ga0068862_100050370
1066 Ga0068862_100471997
1067 Ga0081455_10001923
1068 Ga0081455_10006324
1069 Ga0081455_10008225
1070 Ga0081455_10040048
1071 Ga0081455_10045766
1072 Ga0081455_10107822
1073 Ga0081540_1000020
1074 Ga0081540_1020357
1075 Ga0081540_1043670
1076 Ga0081540_1117161
1077 Ga0081539_10000026
1078 Ga0081539_10000971
1079 Ga0081539_10020770
1080 Ga0081539_10033473
1081 Ga0081539_10044247
1082 Ga0081539_10115714
1083 Ga0070717_10000051
1084 Ga0070717_10009498
1085 Ga0070717_10017689
1086 Ga0070717_10105481
1087 Ga0070717_10111038
1088 Ga0070717_10299377
1089 Ga0070717_10493778
1090 Ga0070717_10816466
1091 Ga0070715_10028495
1092 Ga0070716_100154525
1093 Ga0070716_100225434
1094 Ga0070712_100005338
1095 Ga0070712_100005594
1096 Ga0070712_100052022
1097 Ga0070712_100310730
1098 Ga0070712_100543255
1099 Ga0075362_10066651
1100 Ga0075362_10187265
1101 Ga0075366_10094977
1102 Ga0097621_100012664
1103 Ga0097621_100055102
1104 Ga0097621_100416609
1105 Ga0075370_10002788
1106 Ga0068871_100060275
1107 Ga0068871_100302244
1108 Ga0068871_100316426
1109 Ga0075428_100086210
1110 Ga0075434_100076522
1111 Ga0075434_100159613
1112 Ga0068865_100020780
1113 Ga0068865_100542204
1114 Ga0075436_100066690
1115 Ga0075436_100074322
1116 Ga0075436_100107497
1117 Ga0097620_100126884
1118 Ga0097620_100370274
1119 Ga0075435_100231145
1120 Ga0075435_100614245
1121 Ga0099795_10157351
1122 Ga0105240_10000026
1123 Ga0105240_10145769
1124 Ga0111539_10092141
1125 Ga0111539_10111798
1126 Ga0111539_10229036
1127 Ga0105245_10010117
1128 Ga0105245_10039610
1129 Ga0105245_10040267
1130 Ga0105245_10160744
1131 Ga0105245_10386990
1132 Ga0105245_10830892
1133 Ga0114129_10008229
1134 Ga0114129_10251643
1135 Ga0114129_10922365
1136 Ga0105243_10751269
1137 Ga0105242_10007342
1138 Ga0105248_10624579
1139 Ga0105237_10131140
1140 Ga0105238_10177429
1141 Ga0105249_10009152
1142 Ga0105249_10021031
1143 Ga0105249_10617793
1144 Ga0099796_10046980
1145 Ga0099796_10203152
1146 Ga0105239_10014044
1147 Ga0105239_10090610
1148 Ga0105239_10256900
1149 Ga0105239_10816769
1150 Ga0105246_10238054
1151 Ga0105246_10447833
1152 Ga0157373_10422298
1153 Ga0157369_10063759
1154 Ga0157374_10000028
1155 Ga0157374_10001376
1156 Ga0157374_10025392
1157 Ga0157374_10042444
1158 Ga0157374_10054351
1159 Ga0157374_10107811
1160 Ga0157374_10124481
1161 Ga0157374_10142515
1162 Ga0157374_10208759
1163 Ga0157374_10236857
1164 Ga0157374_10400289
1165 Ga0157374_10549948
1166 Ga0157378_10010835
1167 Ga0157378_10039247
1168 Ga0157378_10089316
1169 Ga0157378_10093876
1170 Ga0157378_10101167
1171 Ga0157378_10149284
1172 Ga0157378_10201458
1173 Ga0157378_10225078
1174 Ga0157378_10462071
1175 Ga0157378_10468437
1176 Ga0157378_10747698
1177 Ga0163162_10023264
1178 Ga0163162_10031706
1179 Ga0163162_10093012
1180 Ga0163162_10429977
1181 Ga0163162_10478695
1182 Ga0157372_10018246
1183 Ga0157372_10105148
1184 Ga0157372_10319012
1185 Ga0157372_10470157
1186 Ga0157372_10566697
1187 Ga0157372_10950037
1188 Ga0157375_10001199
1189 Ga0157375_10052028
1190 Ga0157375_10123174
1191 Ga0157375_10260468
1192 Ga0157375_10323496
1193 Ga0157375_10338929
1194 Ga0157375_10445094
1195 Ga0163163_10476810
1196 Ga0157380_11025498
1197 Ga0157377_10082043
1198 Ga0157377_10148916
1199 Ga0157377_10182998
1200 Ga0157379_10029749
1201 Ga0157379_10309428
1202 Ga0157379_10510707
1203 Ga0157376_10000742
1204 Ga0157376_10022824
1205 Ga0157376_10024813
1206 Ga0157376_10033602
1207 Ga0157376_10089586
1208 Ga0157376_10142399
1209 Ga0182005_1040853
1210 Ga0163161_10015142
1211 Ga0163161_10101642
1212 Ga0213873_10028726
1213 Ga0213872_10007470
1214 Ga0213872_10010251
1215 Ga0213872_10025045
1216 Ga0213872_10052432
1217 Ga0213872_10064573
1218 Ga0213872_10067507
1219 Ga0213872_10072087
1220 Ga0213874_10004510
1221 Ga0213874_10005188
1222 Ga0213876_10000644
1223 Ga0213876_10001059
1224 Ga0213875_10034454
1225 Ga0213871_10038458
1226 Ga0213871_10047945
1227 Ga0213871_10061851
1228 Ga0207666_1011030
1229 Ga0207673_1001952
1230 Ga0207673_1003613
1231 Ga0207673_1009781
1232 Ga0209050_1001062
1233 Ga0207697_10000802
1234 Ga0207697_10000966
1235 Ga0207697_10001778
1236 Ga0207697_10003654
1237 Ga0207697_10006438
1238 Ga0207697_10007221
1239 Ga0207697_10007584
1240 Ga0207697_10023609
1241 Ga0207682_10026259
1242 Ga0207682_10070319
1243 Ga0207692_10113647
1244 Ga0207692_10130286
1245 Ga0207688_10001123
1246 Ga0207688_10002947
1247 Ga0207688_10126802
1248 Ga0207680_10019261
1249 Ga0207680_10081970
1250 Ga0207647_10033599
1251 Ga0207647_10145645
1252 Ga0207647_10214440
1253 Ga0207685_10029012
1254 Ga0207699_10161239
1255 Ga0207645_10002756
1256 Ga0207645_10002845
1257 Ga0207645_10003147
1258 Ga0207645_10036310
1259 Ga0207645_10080060
1260 Ga0207705_10004253
1261 Ga0207684_10001372
1262 Ga0207684_10017981
1263 Ga0207684_10039506
1264 Ga0207684_10101125
1265 Ga0207684_10104935
1266 Ga0207684_10120519
1267 Ga0207684_10178023
1268 Ga0207684_10214889
1269 Ga0207684_10271528
1270 Ga0207707_10023125
1271 Ga0207695_10000246
1272 Ga0207671_10007402
1273 Ga0207671_10380752
1274 Ga0207693_10001148
1275 Ga0207693_10021435
1276 Ga0207693_10021534
1277 Ga0207693_10027165
1278 Ga0207693_10044452
1279 Ga0207693_10077481
1280 Ga0207693_10151776
1281 Ga0207693_10163553
1282 Ga0207663_10002379
1283 Ga0207663_10023712
1284 Ga0207660_10010762
1285 Ga0207660_10308622
1286 Ga0207662_10053725
1287 Ga0207657_10034639
1288 Ga0207649_10072929
1289 Ga0207652_10045158
1290 Ga0207646_10000761
1291 Ga0207646_10001268
1292 Ga0207646_10017315
1293 Ga0207646_10030930
1294 Ga0207646_10050145
1295 Ga0207646_10070399
1296 Ga0207646_10086948
1297 Ga0207646_10098548
1298 Ga0207646_10116002
1299 Ga0207646_10138266
1300 Ga0207646_10154537
1301 Ga0207646_10364494
1302 Ga0207646_10526509
1303 Ga0207681_10001128
1304 Ga0207681_10137516
1305 Ga0207694_10719947
1306 Ga0207650_10043669
1307 Ga0207650_10165836
1308 Ga0207650_10212830
1309 Ga0207659_10013166
1310 Ga0207659_10014543
1311 Ga0207659_10028922
1312 Ga0207659_10066382
1313 Ga0207659_10086006
1314 Ga0207659_10105153
1315 Ga0207659_10120809
1316 Ga0207659_10152449
1317 Ga0207659_10547369
1318 Ga0207659_10763213
1319 Ga0207687_10053160
1320 Ga0207687_10111298
1321 Ga0207687_10135610
1322 Ga0207700_10008765
1323 Ga0207700_10020492
1324 Ga0207700_10181941
1325 Ga0207700_10188046
1326 Ga0207700_10373933
1327 Ga0207664_10053301
1328 Ga0207664_10463875
1329 Ga0207644_10005337
1330 Ga0207644_10091102
1331 Ga0207644_10250468
1332 Ga0207644_10325498
1333 Ga0207644_10538968
1334 Ga0207690_10243141
1335 Ga0207706_10014002
1336 Ga0207706_10015823
1337 Ga0207706_10044612
1338 Ga0207706_10115786
1339 Ga0207706_10259142
1340 Ga0207706_10259527
1341 Ga0207706_10333472
1342 Ga0207670_10005331
1343 Ga0207670_10038138
1344 Ga0207670_10095112
1345 Ga0207670_10167664
1346 Ga0207670_10380279
1347 Ga0207704_10262738
1348 Ga0207704_10385900
1349 Ga0207665_10010811
1350 Ga0207665_10015284
1351 Ga0207665_10031684
1352 Ga0207665_10037324
1353 Ga0207665_10120877
1354 Ga0207665_10282754
1355 Ga0207665_10509331
1356 Ga0207691_10001964
1357 Ga0207691_10003946
1358 Ga0207691_10086745
1359 Ga0207691_10171002
1360 Ga0207691_10190967
1361 Ga0207691_10398230
1362 Ga0207711_10388373
1363 Ga0207689_10048953
1364 Ga0207679_10111958
1365 Ga0207679_10151802
1366 Ga0207667_10055512
1367 Ga0207651_10004486
1368 Ga0207651_10005563
1369 Ga0207651_10055413
1370 Ga0207651_10055961
1371 Ga0207651_10267238
1372 Ga0207651_10597131
1373 Ga0207712_10043479
1374 Ga0207712_10076812
1375 Ga0207668_10017030
1376 Ga0207668_10100385
1377 Ga0207668_10172148
1378 Ga0207658_10192525
1379 Ga0207658_10212685
1380 Ga0207658_10265951
1381 Ga0207658_10447145
1382 Ga0207658_10563196
1383 Ga0207677_10007393
1384 Ga0207677_10011093
1385 Ga0207677_10127218
1386 Ga0207677_10648464
1387 Ga0207703_10004657
1388 Ga0207703_10018759
1389 Ga0207703_10166952
1390 Ga0207703_10545236
1391 Ga0207639_10424440
1392 Ga0207678_10010772
1393 Ga0207678_10097250
1394 Ga0207708_10077408
1395 Ga0207702_10260289
1396 Ga0207641_10154584
1397 Ga0207641_10403438
1398 Ga0207648_10014296
1399 Ga0207676_10147013
1400 Ga0207675_100396742
1401 Ga0207675_100752844
1402 Ga0207683_10024023
1403 Ga0207683_10035809
1404 Ga0207683_10036759
1405 Ga0207683_10114128
1406 Ga0207683_10155538
1407 Ga0207698_11084107
1408 Ga0268266_10012917
1409 Ga0268266_10049192
1410 Ga0268266_10080964
1411 Ga0268266_10125890
1412 Ga0268266_10156863
1413 Ga0268265_10043487
1414 Ga0268265_10212756
1415 Ga0268265_10718570
1416 Ga0268264_10000366
1417 Ga0268264_10145673
1418 Ga0268264_10230145
1419 Ga0268264_10262463
1420 Ga0268264_10854832
1421 Ga0373944_0018025
1422 Ga0373944_0023106
1423 Ga0373945_0053597
1424 Ga0373953_0051101
1425 Ga0373953_0117552
1426 Ga0373943_0047061
1427 Ga0373946_0215480
1428 Ga0373955_0029291
1429 Ga0373955_0237687
1430 Ga0373931_0031957
1431 Ga0373931_0186417
1432 Ga0373935_0033855
1433 Ga0373935_0076987
1434 Ga0373935_0079708
1435 Ga0373935_0188815
1436 Ga0373935_0332324
1437 Ga0373927_0058746
1438 Ga0373927_0069533
1439 Ga0373947_0066049
1440 Ga0373947_0079687
1441 Ga0373937_0102605
1442 Ga0373937_0168131
1443 Ga0373937_0206167
1444 Ga0373937_0216054
1445 Ga0373937_0327313
1446 Ga0373925_0065800
1447 Ga0373925_0143540
1448 Ga0395900_0002938
1449 Ga0395898_0007971
1450 Ga0395898_0129871
1451 Ga0395905_0019180
1452 Ga0395905_0217961
1453 Ga0436364_0227970
1454 Ga0436364_0520032
1455 Ga0436364_0802819
1456 Ga0395901_0000503
1457 Ga0395901_0376027
1458 Ga0436365_0003707
1459 Ga0436365_0742888
1460 Ga0436365_0953982
1461 Ga0436365_0979913
1462 Ga0436365_1122847
1463 Ga0436365_1753433
1464 Ga0436360_0086757
1465 Ga0436360_0227542
1466 Ga0436360_0484811
1467 Ga0436360_0885762
1468 Ga0436360_1295629
1469 Ga0436361_0065736
1470 Ga0436361_0080266
1471 Ga0436361_0097796
1472 Ga0436361_0108215
1473 Ga0436361_0121231
1474 Ga0436361_0491563
1475 Ga0436361_0566372
1476 Ga0436361_0623192
1477 Ga0436361_1005909
1478 Ga0436361_1171226
1479 Ga0436363_0524079
1480 Ga0436363_1359713
1481 Ga0436363_1480040
1482 Ga0436362_0365033
1483 Ga0436362_0434912
1484 Ga0436362_0940953
1485 Ga0436362_0986746
1486 Ga0436362_0990369
1487 Ga0451807_2394735
1488 Ga0439464_0023715
1489 Ga0466964_0065942
1490 Ga0451576_0157759
1491 Ga0466967_0247572
1492 Ga0495592_0144003
1493 Ga0495641_0055825
1494 Ga0495651_0119375
1495 Ga0495653_0084467
1496 Ga0495580_0059883
1497 Ga0495584_0052676
1498 Ga0495584_0267126
1499 Ga0495608_0110346
1500 Ga0495608_0411786
1501 Ga0495628_0013608
1502 Ga0495630_0011198
1503 Ga0495630_0042363
1504 Ga0495630_0082504
1505 Ga0495630_0363452
1506 Ga0495643_0000057
1507 Ga0495640_0068484
1508 Ga0495586_0067469
1509 Ga0495587_0047094
1510 Ga0495598_0002948
1511 Ga0495645_0009512
1512 Ga0495645_0273682
1513 Ga0495634_0220938
1514 Ga0495659_0095207
1515 Ga0495599_0001064
1516 Ga0495646_0038169
1517 Ga0495658_0017416
1518 Ga0495658_0255099
1519 Ga0495669_0011233
1520 Ga0495624_0156209
1521 Ga0495624_0177561
1522 Ga0495671_0056740
1523 Ga0495581_0313152
1524 Ga0495604_0079729
1525 Ga0495675_0089355
1526 Ga0495684_0077745
1527 Ga0495684_0372247
1528 Ga0495593_0162885
1529 Ga0495602_0057134
1530 Ga0496100_0165389
1531 Ga0496101_0040171
1532 Ga0496101_0079016
1533 Ga0496101_0166434
1534 Ga0496101_0542719
1535 Ga0496102_0169565
1536 Ga0496102_0305120
1537 Ga0496102_0317215
1538 Ga0496102_0628144
1539 Ga0496102_0638813
1540 Ga0496103_0066511
1541 Ga0496103_0139142
1542 Ga0496103_0435321
1543 Ga0496104_0023095
1544 Ga0496104_0027820
1545 Ga0496104_0168231
1546 Ga0496104_0191076
1547 Ga0496104_0346300
1548 Ga0496104_0405004
1549 Ga0496105_0036817
1550 Ga0496105_0046103
1551 Ga0496105_0381032
1552 Ga0496106_0135421
1553 Ga0496106_0157602
1554 Ga0496106_0299304
1555 Ga0496106_0564232
1556 Ga0496107_0124878
1557 Ga0496107_0176927
1558 Ga0496107_0312232
1559 Ga0496108_0028590
1560 Ga0496108_0314787
1561 Ga0496108_0377933
1562 Ga0496109_0203729
1563 Ga0496109_0333035
1564 Ga0496110_0055541
1565 Ga0496110_0465031
1566 Ga0496110_0691877
1567 Ga0496111_0313626
1568 Ga0496112_0025448
1569 Ga0496112_0048842
1570 Ga0496112_0425505
1571 Ga0496113_0031410
1572 Ga0496113_0102019
1573 Ga0496113_0165558
1574 Ga0496113_0231526
1575 Ga0496113_0379307
1576 Ga0496114_0025836
1577 Ga0496114_0030657
1578 Ga0496114_0042250
1579 Ga0496114_0249653
1580 Ga0496115_0002890
1581 Ga0496115_0026845
1582 Ga0496115_0034044
1583 Ga0496115_0058437
1584 Ga0496121_0466454
1585 Ga0496124_0251489
1586 Ga0496125_0000017
1587 Ga0501080_0037313
1588 nmdc:mga03683_108582_c1
1589 nmdc:mga03n38_37500_c1
1590 nmdc:mga0k408_1450_c1
1591 nmdc:mga0k408_594_c1
1592 nmdc:mga0k408_88430_c1
1593 nmdc:mga07m45_1685_c2
1594 nmdc:mga05p37_286502_c1
1595 nmdc:mga05p37_395708_c1
1596 nmdc:mga05p37_9589_c1
1597 nmdc:mga0n895_238915_c1
1598 nmdc:mga0n895_628825_c1
1599 nmdc:mga08x19_102016_c1
1600 nmdc:mga08x19_324949_c1
1601 nmdc:mga08x19_71040_c1
1602 nmdc:mga08x19_85195_c1
1603 Ga0495601_0041630
1604 Ga0495601_0381030
1605 Ga0495612_0123251
1606 Ga0495655_0089716
1607 Ga0495595_0008259
1608 Ga0495619_0411487
1609 Ga0500555_000180
1610 Ga0500642_0065611
1611 Ga0500616_0004903
1612 2787507240

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yfd-assembly1.cif.gz_A cryo-em structure of the imetit-bound histamine h4 receptor and gq complex 0.4803 28 71
5xn6-assembly2.cif.gz_B heterodimer crystal structure of geranylgeranyl diphosphate synthases 1 with ggpps recruiting protein(osgrp) from oryza sativa 0.417 73 190
5tvg-assembly6.cif.gz_F crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp-forming) from burkholderia vietnamiensis 0.4164 54 110
5tvg-assembly5.cif.gz_G crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp-forming) from burkholderia vietnamiensis 0.4 28 107
7s8o-assembly1.cif.gz_B cryoem structure of gi-coupled mrgprx2 with small molecule agonist (r)-zinc-3573 0.362 8 69
ID Description Score Start End Superfamily
4qiwJ05 Alpha Beta;Alpha-Beta Complex;Hypothetical Protein Ta0175; Chain: A, domain 2; 0.4527 33 70 3.90.1070.20
af_Q4D8V0_29_236_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.4471 8 187 3.40.390.10
af_Q4D8V0_29_236_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.4034 8 187 3.40.390.10
af_Q14204_3801_3895_1.10.8.1220 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3768 129 223 1.10.8.1220
af_Q7XVH8_131_295_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.3733 38 72 2.10.25.10
ID Description Score Start End GO Terms
AF-A0A2V6F301-F1-model_v4 Uncharacterized protein 0.9838 126 229 GO:0016020
AF-A0A2V5Z1T6-F1-model_v4 PII-uridylyltransferase/Glutamine-synthetase adenylyltransferase domain-containing protein 0.9747 60 229
AF-A0A2V5MN64-F1-model_v4 Uncharacterized protein 0.9734 42 227
AF-A0A2V6C660-F1-model_v4 Uncharacterized protein 0.9726 92 229
AF-A0A2V5SYK8-F1-model_v4 Uncharacterized protein 0.9649 109 226

Map