F481516
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 803 | 336 | 1606 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0659868|Ga0436361_0659868_727_1122 |
| Length | 131 |
| Sequence | LTIDKRAFYSFVECLQEVMGETMPQPADLLQGTLDMLILKAIANEPQHGWAIAQRIQQVSNNVLQVGQGSLYPALHRLEYKGWIRAQWGSSENNRKARFYSLTAAGRRQLNEELENWNRLSGAVNLVLQEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 215 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 216 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 303 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 306 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.62 |
| Nodule | 0 |
| Rhizoplane | 3.61 |
| Rhizosphere | 94.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0659868 | 3300039447 | Bacteria | 2196 |
| 2 | MBSR1b_contig_6041196 | 2162886012 | Bacteria | 914 |
| 3 | JGI24737J22298_10230724 | 3300001990 | Unclassified | 546 |
| 4 | rootH2_10125721 | 3300003320 | Unclassified | 1917 |
| 5 | Ga0065712_10003469 | 3300005290 | Unclassified | 4377 |
| 6 | Ga0065712_10117542 | 3300005290 | Bacteria | 1719 |
| 7 | Ga0065712_10153160 | 3300005290 | Bacteria | 1354 |
| 8 | Ga0065715_10153321 | 3300005293 | Bacteria | 1704 |
| 9 | Ga0065715_10324945 | 3300005293 | Unclassified | 994 |
| 10 | Ga0065715_10595475 | 3300005293 | Bacteria | 711 |
| 11 | Ga0065707_10806384 | 3300005295 | Unclassified | 597 |
| 12 | Ga0070658_10240677 | 3300005327 | Bacteria | 1534 |
| 13 | Ga0070676_10157627 | 3300005328 | Unclassified | 1458 |
| 14 | Ga0070683_100002118 | 3300005329 | Bacteria | 15672 |
| 15 | Ga0070683_100002926 | 3300005329 | Bacteria | 13683 |
| 16 | Ga0070683_100003006 | 3300005329 | Bacteria | 13535 |
| 17 | Ga0070670_100142506 | 3300005331 | Unclassified | 2073 |
| 18 | Ga0068869_100064601 | 3300005334 | Bacteria | 2692 |
| 19 | Ga0068869_100202207 | 3300005334 | Bacteria | 1567 |
| 20 | Ga0070666_10021152 | 3300005335 | Bacteria | 4214 |
| 21 | Ga0070666_10725175 | 3300005335 | Bacteria | 730 |
| 22 | Ga0070680_100218402 | 3300005336 | Bacteria | 1609 |
| 23 | Ga0070680_101267874 | 3300005336 | Bacteria | 638 |
| 24 | Ga0070682_101035923 | 3300005337 | Unclassified | 683 |
| 25 | Ga0068868_101028654 | 3300005338 | Unclassified | 755 |
| 26 | Ga0070689_101527342 | 3300005340 | Unclassified | 605 |
| 27 | Ga0070691_10998250 | 3300005341 | Unclassified | 522 |
| 28 | Ga0070661_100015676 | 3300005344 | Bacteria | 5349 |
| 29 | Ga0070661_101757319 | 3300005344 | Bacteria | 526 |
| 30 | Ga0070692_10626548 | 3300005345 | Unclassified | 715 |
| 31 | Ga0070668_100229142 | 3300005347 | Unclassified | 1535 |
| 32 | Ga0070669_100276811 | 3300005353 | Bacteria | 1343 |
| 33 | Ga0070675_100257928 | 3300005354 | Unclassified | 1527 |
| 34 | Ga0070675_100527178 | 3300005354 | Bacteria | 1066 |
| 35 | Ga0070675_101003204 | 3300005354 | Unclassified | 766 |
| 36 | Ga0070671_100041979 | 3300005355 | Bacteria | 3802 |
| 37 | Ga0070671_100688876 | 3300005355 | Bacteria | 886 |
| 38 | Ga0070674_101341754 | 3300005356 | Bacteria | 639 |
| 39 | Ga0070673_100386819 | 3300005364 | Unclassified | 1248 |
| 40 | Ga0070673_101224475 | 3300005364 | Unclassified | 704 |
| 41 | Ga0070688_100205840 | 3300005365 | Bacteria | 1379 |
| 42 | Ga0070688_100705483 | 3300005365 | Bacteria | 782 |
| 43 | Ga0070659_100103714 | 3300005366 | Bacteria | 2291 |
| 44 | Ga0070659_100223352 | 3300005366 | Unclassified | 1555 |
| 45 | Ga0070667_100135520 | 3300005367 | Bacteria | 2152 |
| 46 | Ga0070667_101308381 | 3300005367 | Unclassified | 679 |
| 47 | Ga0070714_100045578 | 3300005435 | Bacteria | 3717 |
| 48 | Ga0070714_100226437 | 3300005435 | Bacteria | 1721 |
| 49 | Ga0070714_100602530 | 3300005435 | Bacteria | 1055 |
| 50 | Ga0070713_100013657 | 3300005436 | Bacteria | 6002 |
| 51 | Ga0070713_100065136 | 3300005436 | Bacteria | 3060 |
| 52 | Ga0070713_100102578 | 3300005436 | Bacteria | 2481 |
| 53 | Ga0070713_100181994 | 3300005436 | Bacteria | 1889 |
| 54 | Ga0070713_100225074 | 3300005436 | Bacteria | 1703 |
| 55 | Ga0070713_100380211 | 3300005436 | Unclassified | 1315 |
| 56 | Ga0070713_100637496 | 3300005436 | Bacteria | 1014 |
| 57 | Ga0070710_10299690 | 3300005437 | Unclassified | 1049 |
| 58 | Ga0070711_100039691 | 3300005439 | Unclassified | 3172 |
| 59 | Ga0070711_100043897 | 3300005439 | Bacteria | 3031 |
| 60 | Ga0070711_100050023 | 3300005439 | Bacteria | 2864 |
| 61 | Ga0070711_100628894 | 3300005439 | Bacteria | 898 |
| 62 | Ga0070711_101024433 | 3300005439 | Unclassified | 709 |
| 63 | Ga0070711_101037981 | 3300005439 | Unclassified | 704 |
| 64 | Ga0070705_101355854 | 3300005440 | Unclassified | 591 |
| 65 | Ga0070694_100927069 | 3300005444 | Bacteria | 720 |
| 66 | Ga0070708_100209143 | 3300005445 | Bacteria | 1828 |
| 67 | Ga0070663_100014019 | 3300005455 | Bacteria | 5133 |
| 68 | Ga0070663_100325460 | 3300005455 | Unclassified | 1237 |
| 69 | Ga0070678_100259015 | 3300005456 | Bacteria | 1462 |
| 70 | Ga0070678_101212939 | 3300005456 | Bacteria | 700 |
| 71 | Ga0070681_10601147 | 3300005458 | Bacteria | 1014 |
| 72 | Ga0070681_10727228 | 3300005458 | Bacteria | 909 |
| 73 | Ga0070681_11943024 | 3300005458 | Bacteria | 516 |
| 74 | Ga0068867_100902487 | 3300005459 | Bacteria | 795 |
| 75 | Ga0070706_100053147 | 3300005467 | Unclassified | 3739 |
| 76 | Ga0070707_100001486 | 3300005468 | Bacteria | 22863 |
| 77 | Ga0070707_100048276 | 3300005468 | Bacteria | 4078 |
| 78 | Ga0070698_100095864 | 3300005471 | Bacteria | 2944 |
| 79 | Ga0070698_101336278 | 3300005471 | Bacteria | 667 |
| 80 | Ga0070699_100039369 | 3300005518 | Bacteria | 4093 |
| 81 | Ga0070699_100241789 | 3300005518 | Bacteria | 1612 |
| 82 | Ga0070699_100415758 | 3300005518 | Unclassified | 1217 |
| 83 | Ga0070699_100680313 | 3300005518 | Unclassified | 940 |
| 84 | Ga0070699_101211899 | 3300005518 | Unclassified | 692 |
| 85 | Ga0070699_101269932 | 3300005518 | Bacteria | 675 |
| 86 | Ga0070679_100169271 | 3300005530 | Bacteria | 2158 |
| 87 | Ga0070684_100001223 | 3300005535 | Bacteria | 18439 |
| 88 | Ga0070684_100007040 | 3300005535 | Bacteria | 8741 |
| 89 | Ga0070684_100008951 | 3300005535 | Bacteria | 7862 |
| 90 | Ga0070697_100051131 | 3300005536 | Bacteria | 3357 |
| 91 | Ga0070697_101012485 | 3300005536 | Bacteria | 739 |
| 92 | Ga0070697_101346059 | 3300005536 | Unclassified | 637 |
| 93 | Ga0070697_101788100 | 3300005536 | Bacteria | 550 |
| 94 | Ga0070672_100023376 | 3300005543 | Bacteria | 4555 |
| 95 | Ga0070672_100397653 | 3300005543 | Bacteria | 1181 |
| 96 | Ga0070686_100129253 | 3300005544 | Bacteria | 1745 |
| 97 | Ga0070686_101273577 | 3300005544 | Bacteria | 613 |
| 98 | Ga0070695_100776999 | 3300005545 | Bacteria | 766 |
| 99 | Ga0070693_100019464 | 3300005547 | Unclassified | 3559 |
| 100 | Ga0070665_100000305 | 3300005548 | Bacteria | 76881 |
| 101 | Ga0070665_100280853 | 3300005548 | Bacteria | 1667 |
| 102 | Ga0070665_100687374 | 3300005548 | Bacteria | 1036 |
| 103 | Ga0070665_101020197 | 3300005548 | Unclassified | 839 |
| 104 | Ga0070665_101695752 | 3300005548 | Bacteria | 639 |
| 105 | Ga0070704_100922604 | 3300005549 | Unclassified | 786 |
| 106 | Ga0070704_101479903 | 3300005549 | Bacteria | 624 |
| 107 | Ga0068855_100052041 | 3300005563 | Bacteria | 4821 |
| 108 | Ga0070664_100002625 | 3300005564 | Bacteria | 14499 |
| 109 | Ga0070664_101555592 | 3300005564 | Bacteria | 626 |
| 110 | Ga0068857_100024998 | 3300005577 | Bacteria | 5261 |
| 111 | Ga0068857_100233078 | 3300005577 | Bacteria | 1684 |
| 112 | Ga0068856_100201286 | 3300005614 | Bacteria | 2006 |
| 113 | Ga0068856_101055706 | 3300005614 | Unclassified | 830 |
| 114 | Ga0070702_101518799 | 3300005615 | Unclassified | 551 |
| 115 | Ga0068852_101597525 | 3300005616 | Unclassified | 674 |
| 116 | Ga0068859_100852265 | 3300005617 | Unclassified | 997 |
| 117 | Ga0068859_101016264 | 3300005617 | Bacteria | 911 |
| 118 | Ga0068859_101610179 | 3300005617 | Unclassified | 717 |
| 119 | Ga0068859_101850151 | 3300005617 | Bacteria | 667 |
| 120 | Ga0068859_102841768 | 3300005617 | Bacteria | 531 |
| 121 | Ga0068864_100036334 | 3300005618 | Bacteria | 4199 |
| 122 | Ga0068866_10039195 | 3300005718 | Bacteria | 2338 |
| 123 | Ga0068861_102486822 | 3300005719 | Bacteria | 521 |
| 124 | Ga0068863_101050046 | 3300005841 | Unclassified | 818 |
| 125 | Ga0068863_101422206 | 3300005841 | Unclassified | 701 |
| 126 | Ga0068863_102157262 | 3300005841 | Bacteria | 567 |
| 127 | Ga0068858_100936339 | 3300005842 | Unclassified | 848 |
| 128 | Ga0068858_102227636 | 3300005842 | Unclassified | 542 |
| 129 | Ga0068860_100007064 | 3300005843 | Bacteria | 11239 |
| 130 | Ga0068862_100651680 | 3300005844 | Unclassified | 1016 |
| 131 | Ga0070717_10021901 | 3300006028 | Bacteria | 5042 |
| 132 | Ga0070717_10205852 | 3300006028 | Bacteria | 1725 |
| 133 | Ga0070717_10517983 | 3300006028 | Bacteria | 1079 |
| 134 | Ga0070717_10742744 | 3300006028 | Bacteria | 892 |
| 135 | Ga0070717_11021513 | 3300006028 | Unclassified | 753 |
| 136 | Ga0070715_10270119 | 3300006163 | Unclassified | 897 |
| 137 | Ga0070716_100219344 | 3300006173 | Unclassified | 1277 |
| 138 | Ga0070716_100232781 | 3300006173 | Bacteria | 1245 |
| 139 | Ga0070716_100252373 | 3300006173 | Unclassified | 1202 |
| 140 | Ga0070716_101179119 | 3300006173 | Unclassified | 614 |
| 141 | Ga0070712_100008939 | 3300006175 | Bacteria | 6310 |
| 142 | Ga0070712_100055619 | 3300006175 | Bacteria | 2772 |
| 143 | Ga0070712_100199496 | 3300006175 | Bacteria | 1571 |
| 144 | Ga0070712_101085304 | 3300006175 | Bacteria | 694 |
| 145 | Ga0070712_101126225 | 3300006175 | Unclassified | 681 |
| 146 | Ga0075367_10058183 | 3300006178 | Bacteria | 2300 |
| 147 | Ga0075367_10520253 | 3300006178 | Unclassified | 755 |
| 148 | Ga0075366_10290140 | 3300006195 | Bacteria | 1000 |
| 149 | Ga0097621_100539019 | 3300006237 | Bacteria | 1061 |
| 150 | Ga0075428_100048105 | 3300006844 | Unclassified | 4682 |
| 151 | Ga0075428_100288039 | 3300006844 | Bacteria | 1767 |
| 152 | Ga0075428_101349555 | 3300006844 | Unclassified | 749 |
| 153 | Ga0075428_101931215 | 3300006844 | Unclassified | 613 |
| 154 | Ga0075428_102056231 | 3300006844 | Unclassified | 591 |
| 155 | Ga0075430_100010851 | 3300006846 | Bacteria | 7719 |
| 156 | Ga0075430_100011268 | 3300006846 | Bacteria | 7582 |
| 157 | Ga0075430_100153666 | 3300006846 | Unclassified | 1916 |
| 158 | Ga0075430_100291823 | 3300006846 | Bacteria | 1349 |
| 159 | Ga0075431_100013537 | 3300006847 | Bacteria | 8243 |
| 160 | Ga0075431_100036052 | 3300006847 | Bacteria | 5094 |
| 161 | Ga0075431_100059206 | 3300006847 | Unclassified | 3953 |
| 162 | Ga0075431_100082497 | 3300006847 | Unclassified | 3318 |
| 163 | Ga0075431_100266535 | 3300006847 | Unclassified | 1737 |
| 164 | Ga0075431_100297831 | 3300006847 | Unclassified | 1630 |
| 165 | Ga0075431_100461419 | 3300006847 | Bacteria | 1265 |
| 166 | Ga0075431_100571227 | 3300006847 | Bacteria | 1117 |
| 167 | Ga0075431_100597298 | 3300006847 | Unclassified | 1088 |
| 168 | Ga0075431_101981742 | 3300006847 | Bacteria | 538 |
| 169 | Ga0075433_10126654 | 3300006852 | Unclassified | 2268 |
| 170 | Ga0075433_10693283 | 3300006852 | Unclassified | 892 |
| 171 | Ga0075433_11135587 | 3300006852 | Unclassified | 679 |
| 172 | Ga0075434_100063156 | 3300006871 | Bacteria | 3686 |
| 173 | Ga0075434_100105627 | 3300006871 | Bacteria | 2826 |
| 174 | Ga0075434_100133937 | 3300006871 | Unclassified | 2498 |
| 175 | Ga0075434_100195324 | 3300006871 | Unclassified | 2043 |
| 176 | Ga0075434_100400092 | 3300006871 | Unclassified | 1394 |
| 177 | Ga0075434_100914221 | 3300006871 | Unclassified | 892 |
| 178 | Ga0075434_101092807 | 3300006871 | Unclassified | 811 |
| 179 | Ga0075429_100015652 | 3300006880 | Bacteria | 6572 |
| 180 | Ga0075429_100068401 | 3300006880 | Unclassified | 3091 |
| 181 | Ga0075429_100244539 | 3300006880 | Unclassified | 1571 |
| 182 | Ga0075429_101543538 | 3300006880 | Bacteria | 577 |
| 183 | Ga0068865_100100864 | 3300006881 | Bacteria | 2113 |
| 184 | Ga0068865_101095894 | 3300006881 | Unclassified | 701 |
| 185 | Ga0068865_101877861 | 3300006881 | Bacteria | 542 |
| 186 | Ga0075436_100004974 | 3300006914 | Bacteria | 9133 |
| 187 | Ga0075436_100703962 | 3300006914 | Unclassified | 748 |
| 188 | Ga0075436_101270010 | 3300006914 | Bacteria | 557 |
| 189 | Ga0097620_100852100 | 3300006931 | Unclassified | 997 |
| 190 | Ga0097620_101016149 | 3300006931 | Bacteria | 911 |
| 191 | Ga0097620_101609630 | 3300006931 | Unclassified | 717 |
| 192 | Ga0097620_101850293 | 3300006931 | Bacteria | 667 |
| 193 | Ga0097620_102841341 | 3300006931 | Bacteria | 531 |
| 194 | Ga0075435_100069305 | 3300007076 | Bacteria | 2875 |
| 195 | Ga0075435_100125905 | 3300007076 | Unclassified | 2141 |
| 196 | Ga0075435_100131031 | 3300007076 | Bacteria | 2098 |
| 197 | Ga0075435_100197074 | 3300007076 | Unclassified | 1706 |
| 198 | Ga0075435_100441421 | 3300007076 | Unclassified | 1122 |
| 199 | Ga0075435_100637904 | 3300007076 | Unclassified | 924 |
| 200 | Ga0075435_101499260 | 3300007076 | Bacteria | 591 |
| 201 | Ga0105240_10094926 | 3300009093 | Bacteria | 3637 |
| 202 | Ga0111539_10000313 | 3300009094 | Bacteria | 59049 |
| 203 | Ga0111539_10000400 | 3300009094 | Bacteria | 53906 |
| 204 | Ga0111539_10008478 | 3300009094 | Bacteria | 13064 |
| 205 | Ga0111539_10088283 | 3300009094 | Bacteria | 3643 |
| 206 | Ga0111539_10350919 | 3300009094 | Unclassified | 1717 |
| 207 | Ga0111539_10771762 | 3300009094 | Bacteria | 1119 |
| 208 | Ga0111539_10792578 | 3300009094 | Bacteria | 1103 |
| 209 | Ga0111539_11420642 | 3300009094 | Unclassified | 805 |
| 210 | Ga0111539_12148005 | 3300009094 | Unclassified | 648 |
| 211 | Ga0111539_12309270 | 3300009094 | Bacteria | 624 |
| 212 | Ga0105245_10408970 | 3300009098 | Unclassified | 1358 |
| 213 | Ga0105245_10983504 | 3300009098 | Unclassified | 888 |
| 214 | Ga0105247_10005916 | 3300009101 | Bacteria | 7634 |
| 215 | Ga0105247_10467038 | 3300009101 | Unclassified | 913 |
| 216 | Ga0114129_10047623 | 3300009147 | Bacteria | 6023 |
| 217 | Ga0114129_10141896 | 3300009147 | Unclassified | 3292 |
| 218 | Ga0114129_10205269 | 3300009147 | Bacteria | 2667 |
| 219 | Ga0114129_10482189 | 3300009147 | Unclassified | 1622 |
| 220 | Ga0114129_11233838 | 3300009147 | Bacteria | 930 |
| 221 | Ga0114129_11604190 | 3300009147 | Bacteria | 796 |
| 222 | Ga0105243_10724958 | 3300009148 | Unclassified | 972 |
| 223 | Ga0105243_10891145 | 3300009148 | Bacteria | 884 |
| 224 | Ga0105243_11572828 | 3300009148 | Bacteria | 683 |
| 225 | Ga0105243_12020989 | 3300009148 | Bacteria | 611 |
| 226 | Ga0105243_12249929 | 3300009148 | Unclassified | 582 |
| 227 | Ga0105241_10121791 | 3300009174 | Bacteria | 2101 |
| 228 | Ga0105241_10361599 | 3300009174 | Unclassified | 1263 |
| 229 | Ga0105241_10385952 | 3300009174 | Unclassified | 1225 |
| 230 | Ga0105248_10037385 | 3300009177 | Bacteria | 5432 |
| 231 | Ga0105248_10280169 | 3300009177 | Bacteria | 1877 |
| 232 | Ga0105237_10098709 | 3300009545 | Bacteria | 2911 |
| 233 | Ga0105237_10108802 | 3300009545 | Bacteria | 2763 |
| 234 | Ga0105237_10839541 | 3300009545 | Bacteria | 925 |
| 235 | Ga0105238_10069779 | 3300009551 | Unclassified | 3514 |
| 236 | Ga0105238_10519769 | 3300009551 | Unclassified | 1193 |
| 237 | Ga0105238_11083057 | 3300009551 | Bacteria | 824 |
| 238 | Ga0105249_10219969 | 3300009553 | Unclassified | 1868 |
| 239 | Ga0105249_10983968 | 3300009553 | Bacteria | 912 |
| 240 | Ga0105246_10353817 | 3300011119 | Unclassified | 1204 |
| 241 | Ga0157370_10032505 | 3300013104 | Bacteria | 5095 |
| 242 | Ga0157370_10450325 | 3300013104 | Bacteria | 1183 |
| 243 | Ga0157370_10677157 | 3300013104 | Bacteria | 942 |
| 244 | Ga0157369_10007470 | 3300013105 | Bacteria | 12583 |
| 245 | Ga0157369_10026984 | 3300013105 | Bacteria | 6369 |
| 246 | Ga0157369_10119659 | 3300013105 | Bacteria | 2795 |
| 247 | Ga0157369_10549053 | 3300013105 | Unclassified | 1194 |
| 248 | Ga0157374_10126044 | 3300013296 | Bacteria | 2475 |
| 249 | Ga0157374_12906947 | 3300013296 | Unclassified | 506 |
| 250 | Ga0157378_11340864 | 3300013297 | Unclassified | 757 |
| 251 | Ga0163162_10927574 | 3300013306 | Bacteria | 983 |
| 252 | Ga0163162_11275920 | 3300013306 | Bacteria | 834 |
| 253 | Ga0163162_11773539 | 3300013306 | Unclassified | 705 |
| 254 | Ga0163162_12293895 | 3300013306 | Unclassified | 620 |
| 255 | Ga0157372_10065358 | 3300013307 | Bacteria | 4084 |
| 256 | Ga0157372_10202291 | 3300013307 | Bacteria | 2301 |
| 257 | Ga0157372_10331574 | 3300013307 | Bacteria | 1772 |
| 258 | Ga0157372_10449129 | 3300013307 | Bacteria | 1502 |
| 259 | Ga0157372_10666749 | 3300013307 | Unclassified | 1211 |
| 260 | Ga0157375_10319854 | 3300013308 | Bacteria | 1716 |
| 261 | Ga0157375_10930156 | 3300013308 | Bacteria | 1012 |
| 262 | Ga0157375_13382346 | 3300013308 | Unclassified | 531 |
| 263 | Ga0163163_10003214 | 3300014325 | Bacteria | 13847 |
| 264 | Ga0163163_10112317 | 3300014325 | Bacteria | 2754 |
| 265 | Ga0163163_10292575 | 3300014325 | Bacteria | 1681 |
| 266 | Ga0163163_10510416 | 3300014325 | Unclassified | 1264 |
| 267 | Ga0163163_11067960 | 3300014325 | Unclassified | 870 |
| 268 | Ga0163163_11530389 | 3300014325 | Unclassified | 728 |
| 269 | Ga0157380_10182550 | 3300014326 | Unclassified | 1845 |
| 270 | Ga0157380_10259662 | 3300014326 | Bacteria | 1577 |
| 271 | Ga0157377_11098398 | 3300014745 | Unclassified | 609 |
| 272 | Ga0157379_11043778 | 3300014968 | Unclassified | 781 |
| 273 | Ga0157376_10325890 | 3300014969 | Bacteria | 1462 |
| 274 | Ga0157376_12551731 | 3300014969 | Unclassified | 551 |
| 275 | Ga0182007_10135984 | 3300015262 | Bacteria | 829 |
| 276 | Ga0163161_11838395 | 3300017792 | Bacteria | 539 |
| 277 | Ga0213872_10001732 | 3300021361 | Bacteria | 13712 |
| 278 | Ga0213872_10036614 | 3300021361 | Bacteria | 2242 |
| 279 | Ga0213872_10192378 | 3300021361 | Bacteria | 877 |
| 280 | Ga0213875_10477826 | 3300021388 | Bacteria | 598 |
| 281 | Ga0213871_10004265 | 3300021441 | Bacteria | 2847 |
| 282 | Ga0207673_1029423 | 3300025290 | Unclassified | 758 |
| 283 | Ga0207697_10020760 | 3300025315 | Bacteria | 2688 |
| 284 | Ga0207697_10056398 | 3300025315 | Bacteria | 1630 |
| 285 | Ga0207656_10020075 | 3300025321 | Bacteria | 2651 |
| 286 | Ga0207692_10175864 | 3300025898 | Bacteria | 1244 |
| 287 | Ga0207642_10107679 | 3300025899 | Bacteria | 1413 |
| 288 | Ga0207710_10026807 | 3300025900 | Bacteria | 2491 |
| 289 | Ga0207680_10053544 | 3300025903 | Bacteria | 2423 |
| 290 | Ga0207699_10197567 | 3300025906 | Bacteria | 1361 |
| 291 | Ga0207699_10826159 | 3300025906 | Unclassified | 682 |
| 292 | Ga0207645_10389251 | 3300025907 | Unclassified | 936 |
| 293 | Ga0207645_10786636 | 3300025907 | Bacteria | 647 |
| 294 | Ga0207643_10308110 | 3300025908 | Bacteria | 987 |
| 295 | Ga0207684_10022935 | 3300025910 | Bacteria | 5330 |
| 296 | Ga0207684_10410149 | 3300025910 | Unclassified | 1164 |
| 297 | Ga0207654_10189559 | 3300025911 | Unclassified | 1347 |
| 298 | Ga0207707_10804142 | 3300025912 | Bacteria | 783 |
| 299 | Ga0207707_11071556 | 3300025912 | Bacteria | 658 |
| 300 | Ga0207695_10037686 | 3300025913 | Bacteria | 5215 |
| 301 | Ga0207671_10247063 | 3300025914 | Bacteria | 1402 |
| 302 | Ga0207671_10598592 | 3300025914 | Unclassified | 878 |
| 303 | Ga0207693_10007699 | 3300025915 | Bacteria | 8844 |
| 304 | Ga0207693_10128830 | 3300025915 | Bacteria | 1989 |
| 305 | Ga0207693_10166084 | 3300025915 | Unclassified | 1737 |
| 306 | Ga0207693_10249132 | 3300025915 | Bacteria | 1394 |
| 307 | Ga0207693_10293522 | 3300025915 | Bacteria | 1274 |
| 308 | Ga0207693_10825762 | 3300025915 | Bacteria | 714 |
| 309 | Ga0207693_10942834 | 3300025915 | Bacteria | 661 |
| 310 | Ga0207663_10069223 | 3300025916 | Bacteria | 2269 |
| 311 | Ga0207663_10289456 | 3300025916 | Unclassified | 1220 |
| 312 | Ga0207663_10583271 | 3300025916 | Bacteria | 877 |
| 313 | Ga0207663_11334465 | 3300025916 | Unclassified | 578 |
| 314 | Ga0207663_11383019 | 3300025916 | Bacteria | 567 |
| 315 | Ga0207660_10158619 | 3300025917 | Bacteria | 1744 |
| 316 | Ga0207660_10693794 | 3300025917 | Unclassified | 830 |
| 317 | Ga0207657_11052955 | 3300025919 | Bacteria | 623 |
| 318 | Ga0207649_10004473 | 3300025920 | Bacteria | 7586 |
| 319 | Ga0207649_10395723 | 3300025920 | Bacteria | 1033 |
| 320 | Ga0207652_10091803 | 3300025921 | Bacteria | 2670 |
| 321 | Ga0207652_10591238 | 3300025921 | Bacteria | 996 |
| 322 | Ga0207646_10007903 | 3300025922 | Bacteria | 10736 |
| 323 | Ga0207646_10054302 | 3300025922 | Unclassified | 3584 |
| 324 | Ga0207681_10182186 | 3300025923 | Bacteria | 1601 |
| 325 | Ga0207694_10178266 | 3300025924 | Bacteria | 1722 |
| 326 | Ga0207694_10607058 | 3300025924 | Unclassified | 920 |
| 327 | Ga0207694_10818935 | 3300025924 | Unclassified | 787 |
| 328 | Ga0207650_10068777 | 3300025925 | Bacteria | 2660 |
| 329 | Ga0207650_10779338 | 3300025925 | Bacteria | 810 |
| 330 | Ga0207659_10772619 | 3300025926 | Unclassified | 825 |
| 331 | Ga0207659_10902380 | 3300025926 | Unclassified | 760 |
| 332 | Ga0207687_10020289 | 3300025927 | Bacteria | 4409 |
| 333 | Ga0207700_10005243 | 3300025928 | Bacteria | 7727 |
| 334 | Ga0207700_10034791 | 3300025928 | Bacteria | 3621 |
| 335 | Ga0207700_10054556 | 3300025928 | Bacteria | 3001 |
| 336 | Ga0207700_10082784 | 3300025928 | Bacteria | 2510 |
| 337 | Ga0207700_10105662 | 3300025928 | Bacteria | 2255 |
| 338 | Ga0207700_10159351 | 3300025928 | Bacteria | 1873 |
| 339 | Ga0207700_10249921 | 3300025928 | Unclassified | 1514 |
| 340 | Ga0207700_10917023 | 3300025928 | Unclassified | 784 |
| 341 | Ga0207664_10259455 | 3300025929 | Bacteria | 1519 |
| 342 | Ga0207664_10399036 | 3300025929 | Bacteria | 1223 |
| 343 | Ga0207664_10688903 | 3300025929 | Bacteria | 919 |
| 344 | Ga0207664_11274922 | 3300025929 | Unclassified | 654 |
| 345 | Ga0207644_10079331 | 3300025931 | Bacteria | 2422 |
| 346 | Ga0207690_10179658 | 3300025932 | Unclassified | 1592 |
| 347 | Ga0207706_10043845 | 3300025933 | Unclassified | 3963 |
| 348 | Ga0207670_11046391 | 3300025936 | Unclassified | 688 |
| 349 | Ga0207704_10128163 | 3300025938 | Bacteria | 1751 |
| 350 | Ga0207704_10151652 | 3300025938 | Bacteria | 1636 |
| 351 | Ga0207704_10229988 | 3300025938 | Bacteria | 1378 |
| 352 | Ga0207704_11078531 | 3300025938 | Unclassified | 682 |
| 353 | Ga0207665_10272595 | 3300025939 | Unclassified | 1257 |
| 354 | Ga0207665_10300332 | 3300025939 | Bacteria | 1200 |
| 355 | Ga0207665_10967961 | 3300025939 | Unclassified | 676 |
| 356 | Ga0207665_11450964 | 3300025939 | Unclassified | 546 |
| 357 | Ga0207691_10038719 | 3300025940 | Bacteria | 4412 |
| 358 | Ga0207691_10856338 | 3300025940 | Bacteria | 762 |
| 359 | Ga0207711_10476918 | 3300025941 | Unclassified | 1162 |
| 360 | Ga0207711_11076826 | 3300025941 | Bacteria | 744 |
| 361 | Ga0207689_10087223 | 3300025942 | Bacteria | 2564 |
| 362 | Ga0207689_10521547 | 3300025942 | Bacteria | 996 |
| 363 | Ga0207689_10601767 | 3300025942 | Bacteria | 925 |
| 364 | Ga0207689_11208513 | 3300025942 | Bacteria | 636 |
| 365 | Ga0207689_11810242 | 3300025942 | Bacteria | 504 |
| 366 | Ga0207661_10014057 | 3300025944 | Bacteria | 5857 |
| 367 | Ga0207661_10036533 | 3300025944 | Bacteria | 3835 |
| 368 | Ga0207661_10213074 | 3300025944 | Unclassified | 1703 |
| 369 | Ga0207679_10024498 | 3300025945 | Bacteria | 4138 |
| 370 | Ga0207679_11670969 | 3300025945 | Bacteria | 583 |
| 371 | Ga0207651_10650953 | 3300025960 | Bacteria | 925 |
| 372 | Ga0207651_10802738 | 3300025960 | Bacteria | 834 |
| 373 | Ga0207712_10104686 | 3300025961 | Bacteria | 2110 |
| 374 | Ga0207668_10212507 | 3300025972 | Unclassified | 1548 |
| 375 | Ga0207668_10912966 | 3300025972 | Unclassified | 782 |
| 376 | Ga0207658_10593604 | 3300025986 | Unclassified | 994 |
| 377 | Ga0207677_10780473 | 3300026023 | Bacteria | 854 |
| 378 | Ga0207703_10570491 | 3300026035 | Unclassified | 1068 |
| 379 | Ga0207678_10018957 | 3300026067 | Bacteria | 6046 |
| 380 | Ga0207678_10088063 | 3300026067 | Unclassified | 2654 |
| 381 | Ga0207708_10861338 | 3300026075 | Unclassified | 783 |
| 382 | Ga0207708_11299789 | 3300026075 | Bacteria | 637 |
| 383 | Ga0207702_10131473 | 3300026078 | Unclassified | 2253 |
| 384 | Ga0207702_10209850 | 3300026078 | Bacteria | 1810 |
| 385 | Ga0207702_10505557 | 3300026078 | Bacteria | 1178 |
| 386 | Ga0207702_12437106 | 3300026078 | Bacteria | 510 |
| 387 | Ga0207641_10292603 | 3300026088 | Bacteria | 1536 |
| 388 | Ga0207641_10866862 | 3300026088 | Unclassified | 896 |
| 389 | Ga0207641_11029661 | 3300026088 | Unclassified | 821 |
| 390 | Ga0207648_10192461 | 3300026089 | Bacteria | 1808 |
| 391 | Ga0207648_12268883 | 3300026089 | Unclassified | 503 |
| 392 | Ga0207676_10808650 | 3300026095 | Bacteria | 915 |
| 393 | Ga0207674_10003034 | 3300026116 | Bacteria | 20801 |
| 394 | Ga0207674_10206647 | 3300026116 | Bacteria | 1913 |
| 395 | Ga0207674_10328341 | 3300026116 | Bacteria | 1479 |
| 396 | Ga0207674_10392270 | 3300026116 | Bacteria | 1342 |
| 397 | Ga0207675_100984317 | 3300026118 | Bacteria | 861 |
| 398 | Ga0207683_10184800 | 3300026121 | Bacteria | 1891 |
| 399 | Ga0207683_10737144 | 3300026121 | Bacteria | 914 |
| 400 | Ga0207683_11595638 | 3300026121 | Unclassified | 602 |
| 401 | Ga0207698_10075087 | 3300026142 | Unclassified | 2700 |
| 402 | Ga0207698_10319519 | 3300026142 | Bacteria | 1453 |
| 403 | Ga0207428_10003504 | 3300027907 | Bacteria | 15198 |
| 404 | Ga0207428_10004719 | 3300027907 | Bacteria | 12888 |
| 405 | Ga0207428_10008874 | 3300027907 | Bacteria | 9058 |
| 406 | Ga0207428_10180417 | 3300027907 | Unclassified | 1595 |
| 407 | Ga0268266_10000077 | 3300028379 | Bacteria | 215734 |
| 408 | Ga0268266_10470170 | 3300028379 | Unclassified | 1197 |
| 409 | Ga0268266_10677349 | 3300028379 | Bacteria | 993 |
| 410 | Ga0268266_10694719 | 3300028379 | Bacteria | 980 |
| 411 | Ga0268266_10782898 | 3300028379 | Unclassified | 921 |
| 412 | Ga0268265_12429312 | 3300028380 | Unclassified | 530 |
| 413 | Ga0268264_10007676 | 3300028381 | Bacteria | 8991 |
| 414 | Ga0268264_12170594 | 3300028381 | Bacteria | 563 |
| 415 | Ga0265334_10015732 | 3300028573 | Bacteria | 3139 |
| 416 | Ga0265323_10030947 | 3300028653 | Unclassified | 1991 |
| 417 | Ga0265323_10166629 | 3300028653 | Bacteria | 701 |
| 418 | Ga0265338_10040171 | 3300028800 | Bacteria | 4399 |
| 419 | Ga0265338_10488615 | 3300028800 | Bacteria | 868 |
| 420 | Ga0265338_10773360 | 3300028800 | Unclassified | 659 |
| 421 | Ga0265324_10191587 | 3300029957 | Unclassified | 694 |
| 422 | Ga0265328_10059864 | 3300031239 | Bacteria | 1398 |
| 423 | Ga0265325_10545132 | 3300031241 | Unclassified | 502 |
| 424 | Ga0265339_10000920 | 3300031249 | Bacteria | 22633 |
| 425 | Ga0265327_10000016 | 3300031251 | Bacteria | 467439 |
| 426 | Ga0265316_10003211 | 3300031344 | Bacteria | 16613 |
| 427 | Ga0265316_10084975 | 3300031344 | Bacteria | 2422 |
| 428 | Ga0265316_10419053 | 3300031344 | Bacteria | 963 |
| 429 | Ga0265316_10447440 | 3300031344 | Bacteria | 927 |
| 430 | Ga0307408_100120542 | 3300031548 | Bacteria | 2031 |
| 431 | Ga0307408_101196854 | 3300031548 | Unclassified | 709 |
| 432 | Ga0265313_10159790 | 3300031595 | Unclassified | 958 |
| 433 | Ga0265314_10020228 | 3300031711 | Bacteria | 5140 |
| 434 | Ga0265314_10536737 | 3300031711 | Bacteria | 610 |
| 435 | Ga0265342_10029193 | 3300031712 | Bacteria | 3427 |
| 436 | Ga0265342_10214686 | 3300031712 | Unclassified | 1039 |
| 437 | Ga0307405_10220794 | 3300031731 | Bacteria | 1390 |
| 438 | Ga0307413_10284916 | 3300031824 | Unclassified | 1245 |
| 439 | Ga0307413_10485217 | 3300031824 | Bacteria | 989 |
| 440 | Ga0307413_10573155 | 3300031824 | Bacteria | 919 |
| 441 | Ga0307410_10045540 | 3300031852 | Bacteria | 2922 |
| 442 | Ga0307410_11479906 | 3300031852 | Bacteria | 598 |
| 443 | Ga0307406_10721832 | 3300031901 | Unclassified | 834 |
| 444 | Ga0307407_10269655 | 3300031903 | Bacteria | 1174 |
| 445 | Ga0307412_10089061 | 3300031911 | Bacteria | 2154 |
| 446 | Ga0307412_11400232 | 3300031911 | Bacteria | 633 |
| 447 | Ga0307409_100021627 | 3300031995 | Bacteria | 4415 |
| 448 | Ga0307409_100099304 | 3300031995 | Unclassified | 2410 |
| 449 | Ga0307409_100945975 | 3300031995 | Bacteria | 877 |
| 450 | Ga0307409_101640780 | 3300031995 | Unclassified | 671 |
| 451 | Ga0307416_100406900 | 3300032002 | Unclassified | 1400 |
| 452 | Ga0307416_101411471 | 3300032002 | Bacteria | 802 |
| 453 | Ga0307416_103040456 | 3300032002 | Viruses | 561 |
| 454 | Ga0307416_103118352 | 3300032002 | Unclassified | 554 |
| 455 | Ga0307411_10005216 | 3300032005 | Bacteria | 6362 |
| 456 | Ga0307411_10012915 | 3300032005 | Bacteria | 4582 |
| 457 | Ga0307411_10169457 | 3300032005 | Unclassified | 1645 |
| 458 | Ga0307411_11907136 | 3300032005 | Unclassified | 553 |
| 459 | Ga0307415_100036846 | 3300032126 | Bacteria | 3209 |
| 460 | Ga0373959_0176161 | 3300034820 | Unclassified | 553 |
| 461 | Ga0373934_0208686 | 3300035086 | Unclassified | 805 |
| 462 | Ga0373923_0099994 | 3300035111 | Bacteria | 1278 |
| 463 | Ga0373936_0242033 | 3300035113 | Unclassified | 804 |
| 464 | Ga0373954_0592536 | 3300035118 | Unclassified | 549 |
| 465 | Ga0373956_0265842 | 3300035119 | Unclassified | 816 |
| 466 | Ga0373956_0471781 | 3300035119 | Bacteria | 599 |
| 467 | Ga0373960_0190580 | 3300035121 | Unclassified | 720 |
| 468 | Ga0373955_0016742 | 3300035172 | Unclassified | 3613 |
| 469 | Ga0373955_0171311 | 3300035172 | Bacteria | 1285 |
| 470 | Ga0373955_0570079 | 3300035172 | Bacteria | 693 |
| 471 | Ga0373933_0010050 | 3300035724 | Bacteria | 5181 |
| 472 | Ga0373933_0103602 | 3300035724 | Bacteria | 1768 |
| 473 | Ga0373947_1063321 | 3300035725 | Unclassified | 552 |
| 474 | Ga0373937_0003721 | 3300036401 | Bacteria | 12888 |
| 475 | Ga0373937_0123220 | 3300036401 | Bacteria | 2417 |
| 476 | Ga0373937_0165642 | 3300036401 | Bacteria | 2073 |
| 477 | Ga0373937_0307261 | 3300036401 | Bacteria | 1500 |
| 478 | Ga0373925_0760554 | 3300037068 | Bacteria | 799 |
| 479 | Ga0436364_0538886 | 3300037853 | Bacteria | 769 |
| 480 | Ga0436364_1515509 | 3300037853 | Bacteria | 598 |
| 481 | Ga0436360_0749681 | 3300039438 | Bacteria | 1468 |
| 482 | Ga0436360_1071387 | 3300039438 | Bacteria | 10544 |
| 483 | Ga0436361_0271610 | 3300039447 | Bacteria | 15971 |
| 484 | Ga0436361_1110952 | 3300039447 | Bacteria | 4861 |
| 485 | Ga0436362_0152314 | 3300039453 | Bacteria | 586 |
| 486 | Ga0439435_0021048 | 3300042436 | Bacteria | 1689 |
| 487 | Ga0439459_0121745 | 3300042438 | Unclassified | 658 |
| 488 | Ga0439460_0124611 | 3300042461 | Bacteria | 845 |
| 489 | Ga0450916_059270 | 3300042530 | Unclassified | 619 |
| 490 | Ga0450893_0012185 | 3300042532 | Bacteria | 1427 |
| 491 | Ga0466969_0066330 | 3300044656 | Unclassified | 1743 |
| 492 | Ga0453683_0391054 | 3300044673 | Bacteria | 896 |
| 493 | Ga0466961_0262822 | 3300044693 | Bacteria | 1058 |
| 494 | Ga0453684_0044638 | 3300044712 | Bacteria | 5925 |
| 495 | Ga0466957_0373679 | 3300044842 | Bacteria | 971 |
| 496 | Ga0466957_0937338 | 3300044842 | Unclassified | 620 |
| 497 | Ga0466959_0103138 | 3300045049 | Bacteria | 2041 |
| 498 | Ga0466959_0329318 | 3300045049 | Bacteria | 1043 |
| 499 | Ga0451576_0531536 | 3300045051 | Bacteria | 1235 |
| 500 | Ga0451576_0642312 | 3300045051 | Bacteria | 1115 |
| 501 | Ga0451576_0687563 | 3300045051 | Unclassified | 1075 |
| 502 | Ga0451576_0823523 | 3300045051 | Bacteria | 974 |
| 503 | Ga0451576_0920231 | 3300045051 | Bacteria | 917 |
| 504 | Ga0451576_2054773 | 3300045051 | Unclassified | 588 |
| 505 | Ga0466958_0009398 | 3300045836 | Bacteria | 5448 |
| 506 | Ga0466958_0240925 | 3300045836 | Unclassified | 1156 |
| 507 | Ga0466967_0017072 | 3300045976 | Bacteria | 5747 |
| 508 | Ga0466967_0660447 | 3300045976 | Unclassified | 1034 |
| 509 | Ga0466967_1218629 | 3300045976 | Unclassified | 750 |
| 510 | Ga0495592_0032979 | 3300046454 | Bacteria | 3907 |
| 511 | Ga0495603_0171722 | 3300046455 | Bacteria | 1255 |
| 512 | Ga0495629_0056531 | 3300046459 | Bacteria | 2743 |
| 513 | Ga0495638_0006636 | 3300046460 | Bacteria | 8402 |
| 514 | Ga0495651_0264581 | 3300046462 | Unclassified | 1169 |
| 515 | Ga0495653_0032937 | 3300046463 | Bacteria | 4110 |
| 516 | Ga0495580_0308150 | 3300046472 | Unclassified | 1077 |
| 517 | Ga0495580_0547245 | 3300046472 | Unclassified | 769 |
| 518 | Ga0495582_0040582 | 3300046473 | Bacteria | 2564 |
| 519 | Ga0495662_0018690 | 3300046476 | Bacteria | 3355 |
| 520 | Ga0495664_0004239 | 3300046477 | Bacteria | 7827 |
| 521 | Ga0495608_0095626 | 3300046511 | Bacteria | 1919 |
| 522 | Ga0495616_0388838 | 3300046513 | Unclassified | 575 |
| 523 | Ga0495618_0038226 | 3300046514 | Bacteria | 3015 |
| 524 | Ga0495628_0027162 | 3300046516 | Bacteria | 4659 |
| 525 | Ga0495630_1003044 | 3300046517 | Unclassified | 634 |
| 526 | Ga0495652_0058848 | 3300046529 | Bacteria | 3253 |
| 527 | Ga0495652_0327442 | 3300046529 | Bacteria | 1105 |
| 528 | Ga0495586_0858147 | 3300046535 | Bacteria | 523 |
| 529 | Ga0495587_0079993 | 3300046536 | Bacteria | 1894 |
| 530 | Ga0495645_0027225 | 3300046543 | Bacteria | 4152 |
| 531 | Ga0495645_0027778 | 3300046543 | Bacteria | 4111 |
| 532 | Ga0495667_0207553 | 3300046559 | Unclassified | 1252 |
| 533 | Ga0495634_0124797 | 3300046642 | Bacteria | 1646 |
| 534 | Ga0495635_0101432 | 3300046663 | Bacteria | 1967 |
| 535 | Ga0495599_0095775 | 3300046678 | Bacteria | 1851 |
| 536 | Ga0495599_0297459 | 3300046678 | Bacteria | 975 |
| 537 | Ga0495623_0564962 | 3300046679 | Unclassified | 594 |
| 538 | Ga0495646_0527059 | 3300046680 | Unclassified | 605 |
| 539 | Ga0495658_0072407 | 3300046683 | Bacteria | 2004 |
| 540 | Ga0495669_0352705 | 3300046684 | Unclassified | 711 |
| 541 | Ga0495613_0099579 | 3300046689 | Unclassified | 2100 |
| 542 | Ga0495613_0540645 | 3300046689 | Bacteria | 781 |
| 543 | Ga0495613_0612977 | 3300046689 | Unclassified | 723 |
| 544 | Ga0495604_0169840 | 3300047317 | Bacteria | 1535 |
| 545 | Ga0495604_0827156 | 3300047317 | Bacteria | 582 |
| 546 | Ga0495674_0043863 | 3300047319 | Bacteria | 3977 |
| 547 | Ga0495680_0114977 | 3300047322 | Bacteria | 1991 |
| 548 | Ga0495675_0095472 | 3300047444 | Bacteria | 1864 |
| 549 | Ga0495675_0223475 | 3300047444 | Unclassified | 1139 |
| 550 | Ga0495684_0278908 | 3300047471 | Bacteria | 1206 |
| 551 | Ga0495684_0808672 | 3300047471 | Unclassified | 612 |
| 552 | Ga0495593_0380016 | 3300047673 | Unclassified | 706 |
| 553 | Ga0495602_0053922 | 3300048088 | Bacteria | 3556 |
| 554 | Ga0495602_0648015 | 3300048088 | Bacteria | 722 |
| 555 | Ga0496100_0901277 | 3300048903 | Unclassified | 694 |
| 556 | Ga0496100_1373550 | 3300048903 | Bacteria | 557 |
| 557 | Ga0496101_0308054 | 3300048904 | Bacteria | 1241 |
| 558 | Ga0496102_0919682 | 3300048905 | Unclassified | 796 |
| 559 | Ga0496102_1017903 | 3300048905 | Unclassified | 749 |
| 560 | Ga0496102_1407160 | 3300048905 | Bacteria | 616 |
| 561 | Ga0496104_0010323 | 3300048907 | Bacteria | 8339 |
| 562 | Ga0496104_0055967 | 3300048907 | Bacteria | 3729 |
| 563 | Ga0496104_1528335 | 3300048907 | Unclassified | 570 |
| 564 | Ga0496104_1878881 | 3300048907 | Unclassified | 501 |
| 565 | Ga0496105_0023376 | 3300048908 | Bacteria | 5012 |
| 566 | Ga0496105_0432911 | 3300048908 | Bacteria | 1040 |
| 567 | Ga0496105_1369784 | 3300048908 | Unclassified | 514 |
| 568 | Ga0496106_0119020 | 3300048909 | Bacteria | 2063 |
| 569 | Ga0496106_0355336 | 3300048909 | Unclassified | 1177 |
| 570 | Ga0496106_0752312 | 3300048909 | Unclassified | 775 |
| 571 | Ga0496107_0031763 | 3300048910 | Bacteria | 3770 |
| 572 | Ga0496108_0009855 | 3300048911 | Bacteria | 7742 |
| 573 | Ga0496109_0003064 | 3300048912 | Bacteria | 13929 |
| 574 | Ga0496109_0393304 | 3300048912 | Unclassified | 1310 |
| 575 | Ga0496110_0001226 | 3300048913 | Bacteria | 18281 |
| 576 | Ga0496110_0890333 | 3300048913 | Unclassified | 796 |
| 577 | Ga0496111_0014794 | 3300048914 | Bacteria | 5342 |
| 578 | Ga0496112_0003499 | 3300048915 | Bacteria | 13013 |
| 579 | Ga0496112_0062234 | 3300048915 | Unclassified | 3681 |
| 580 | Ga0496112_1131052 | 3300048915 | Bacteria | 701 |
| 581 | Ga0496114_0009025 | 3300048917 | Bacteria | 7905 |
| 582 | Ga0496115_0448632 | 3300048918 | Bacteria | 1042 |
| 583 | Ga0496115_1446798 | 3300048918 | Unclassified | 505 |
| 584 | Ga0496126_0162750 | 3300048929 | Bacteria | 1906 |
| 585 | Ga0501031_0098275 | 3300049568 | Bacteria | 1910 |
| 586 | Ga0501031_0211338 | 3300049568 | Unclassified | 1264 |
| 587 | Ga0501031_0448314 | 3300049568 | Bacteria | 834 |
| 588 | Ga0501032_0005331 | 3300049569 | Bacteria | 9567 |
| 589 | Ga0501032_0032446 | 3300049569 | Bacteria | 3579 |
| 590 | Ga0501032_0043920 | 3300049569 | Bacteria | 3025 |
| 591 | Ga0501032_0475657 | 3300049569 | Bacteria | 799 |
| 592 | Ga0501033_0009786 | 3300049570 | Bacteria | 7363 |
| 593 | Ga0501033_0141542 | 3300049570 | Bacteria | 1738 |
| 594 | Ga0501034_0009558 | 3300049571 | Bacteria | 10151 |
| 595 | Ga0501034_0011057 | 3300049571 | Bacteria | 9372 |
| 596 | Ga0501034_0089985 | 3300049571 | Bacteria | 3067 |
| 597 | Ga0501034_0199511 | 3300049571 | Bacteria | 1959 |
| 598 | Ga0501034_0261174 | 3300049571 | Bacteria | 1674 |
| 599 | Ga0501034_0300965 | 3300049571 | Bacteria | 1540 |
| 600 | Ga0501034_0536354 | 3300049571 | Bacteria | 1080 |
| 601 | Ga0501034_0998235 | 3300049571 | Unclassified | 721 |
| 602 | Ga0501036_0022737 | 3300049572 | Bacteria | 5278 |
| 603 | Ga0501036_0023357 | 3300049572 | Bacteria | 5208 |
| 604 | Ga0501036_0031299 | 3300049572 | Bacteria | 4496 |
| 605 | Ga0501036_0043804 | 3300049572 | Bacteria | 3790 |
| 606 | Ga0501036_1119427 | 3300049572 | Unclassified | 643 |
| 607 | Ga0501037_0005685 | 3300049573 | Bacteria | 9095 |
| 608 | Ga0501037_0080719 | 3300049573 | Bacteria | 2359 |
| 609 | Ga0501037_0469532 | 3300049573 | Unclassified | 856 |
| 610 | Ga0501038_0004757 | 3300049574 | Bacteria | 12623 |
| 611 | Ga0501038_0006572 | 3300049574 | Bacteria | 10753 |
| 612 | Ga0501038_0036543 | 3300049574 | Bacteria | 4310 |
| 613 | Ga0501038_0042973 | 3300049574 | Bacteria | 3933 |
| 614 | Ga0501038_0066720 | 3300049574 | Bacteria | 3063 |
| 615 | Ga0501039_0006893 | 3300049575 | Bacteria | 8644 |
| 616 | Ga0501039_0008669 | 3300049575 | Bacteria | 7745 |
| 617 | Ga0501039_0070387 | 3300049575 | Bacteria | 2718 |
| 618 | Ga0501039_0196384 | 3300049575 | Bacteria | 1586 |
| 619 | Ga0501039_0560829 | 3300049575 | Bacteria | 896 |
| 620 | Ga0501040_0228284 | 3300049576 | Bacteria | 1325 |
| 621 | Ga0501041_0316759 | 3300049577 | Bacteria | 984 |
| 622 | Ga0501042_0106097 | 3300049578 | Bacteria | 2022 |
| 623 | Ga0501042_0205064 | 3300049578 | Bacteria | 1422 |
| 624 | Ga0501043_0040660 | 3300049579 | Bacteria | 3654 |
| 625 | Ga0501043_0074982 | 3300049579 | Bacteria | 2657 |
| 626 | Ga0501043_0089793 | 3300049579 | Bacteria | 2415 |
| 627 | Ga0501043_0097559 | 3300049579 | Bacteria | 2310 |
| 628 | Ga0501043_0106145 | 3300049579 | Bacteria | 2206 |
| 629 | Ga0501046_0001341 | 3300049580 | Bacteria | 23838 |
| 630 | Ga0501046_0004006 | 3300049580 | Bacteria | 13451 |
| 631 | Ga0501046_0010822 | 3300049580 | Bacteria | 7820 |
| 632 | Ga0501046_0302878 | 3300049580 | Unclassified | 1167 |
| 633 | Ga0501046_0965182 | 3300049580 | Bacteria | 592 |
| 634 | Ga0501046_1241191 | 3300049580 | Unclassified | 511 |
| 635 | Ga0501047_0003546 | 3300049581 | Bacteria | 14738 |
| 636 | Ga0501047_0024220 | 3300049581 | Bacteria | 5828 |
| 637 | Ga0501047_0038504 | 3300049581 | Bacteria | 4626 |
| 638 | Ga0501047_0040104 | 3300049581 | Bacteria | 4528 |
| 639 | Ga0501047_0051881 | 3300049581 | Unclassified | 3964 |
| 640 | Ga0501047_0055694 | 3300049581 | Bacteria | 3823 |
| 641 | Ga0501047_0056677 | 3300049581 | Bacteria | 3790 |
| 642 | Ga0501047_0243639 | 3300049581 | Bacteria | 1647 |
| 643 | Ga0501047_0798655 | 3300049581 | Bacteria | 758 |
| 644 | Ga0501048_0005071 | 3300049582 | Bacteria | 10037 |
| 645 | Ga0501048_0039699 | 3300049582 | Bacteria | 3375 |
| 646 | Ga0501048_0191314 | 3300049582 | Bacteria | 1450 |
| 647 | Ga0501048_0338327 | 3300049582 | Bacteria | 1073 |
| 648 | Ga0501048_0424509 | 3300049582 | Bacteria | 951 |
| 649 | Ga0501067_0019007 | 3300049583 | Bacteria | 3802 |
| 650 | Ga0501067_0085405 | 3300049583 | Bacteria | 1751 |
| 651 | Ga0501068_0021742 | 3300049584 | Bacteria | 3749 |
| 652 | Ga0501068_0027253 | 3300049584 | Unclassified | 3373 |
| 653 | Ga0501068_0051883 | 3300049584 | Bacteria | 2482 |
| 654 | Ga0501069_0013052 | 3300049585 | Unclassified | 4427 |
| 655 | Ga0501069_0013303 | 3300049585 | Bacteria | 4386 |
| 656 | Ga0501069_0527831 | 3300049585 | Bacteria | 705 |
| 657 | Ga0501069_0761957 | 3300049585 | Unclassified | 585 |
| 658 | Ga0501070_0077597 | 3300049586 | Bacteria | 2749 |
| 659 | Ga0501070_0100819 | 3300049586 | Bacteria | 2388 |
| 660 | Ga0501070_0162657 | 3300049586 | Unclassified | 1840 |
| 661 | Ga0501070_0181039 | 3300049586 | Bacteria | 1734 |
| 662 | Ga0501070_0188487 | 3300049586 | Unclassified | 1696 |
| 663 | Ga0501070_0458965 | 3300049586 | Unclassified | 1027 |
| 664 | Ga0501071_0338834 | 3300049587 | Bacteria | 1143 |
| 665 | Ga0501072_0016859 | 3300049588 | Bacteria | 5612 |
| 666 | Ga0501072_0178585 | 3300049588 | Unclassified | 1693 |
| 667 | Ga0501072_0191391 | 3300049588 | Unclassified | 1631 |
| 668 | Ga0501072_0411360 | 3300049588 | Unclassified | 1073 |
| 669 | Ga0501073_0009023 | 3300049589 | Bacteria | 7361 |
| 670 | Ga0501073_0014188 | 3300049589 | Bacteria | 5786 |
| 671 | Ga0501073_0054438 | 3300049589 | Bacteria | 2801 |
| 672 | Ga0501073_0081856 | 3300049589 | Unclassified | 2245 |
| 673 | Ga0501073_0086556 | 3300049589 | Bacteria | 2179 |
| 674 | Ga0501073_0090826 | 3300049589 | Bacteria | 2122 |
| 675 | Ga0501073_0158658 | 3300049589 | Unclassified | 1567 |
| 676 | Ga0501074_0014394 | 3300049590 | Bacteria | 5758 |
| 677 | Ga0501074_0063684 | 3300049590 | Bacteria | 2656 |
| 678 | Ga0501075_0004686 | 3300049591 | Bacteria | 9284 |
| 679 | Ga0501075_0244654 | 3300049591 | Bacteria | 1367 |
| 680 | Ga0501076_0051998 | 3300049592 | Bacteria | 3244 |
| 681 | Ga0501076_0131642 | 3300049592 | Bacteria | 2029 |
| 682 | Ga0501076_0195991 | 3300049592 | Bacteria | 1649 |
| 683 | Ga0501077_0260569 | 3300049593 | Bacteria | 1103 |
| 684 | Ga0501077_0434070 | 3300049593 | Bacteria | 841 |
| 685 | Ga0501077_0532454 | 3300049593 | Unclassified | 754 |
| 686 | Ga0501199_043679 | 3300049650 | Unclassified | 588 |
| 687 | Ga0501201_019392 | 3300049651 | Unclassified | 712 |
| 688 | Ga0501202_211048 | 3300049652 | Unclassified | 534 |
| 689 | Ga0501217_123636 | 3300049661 | Unclassified | 753 |
| 690 | Ga0501239_075423 | 3300049672 | Unclassified | 532 |
| 691 | Ga0501246_020064 | 3300049676 | Unclassified | 685 |
| 692 | Ga0501079_0011030 | 3300049741 | Bacteria | 6887 |
| 693 | Ga0501079_0168294 | 3300049741 | Unclassified | 1709 |
| 694 | Ga0501079_0217135 | 3300049741 | Bacteria | 1494 |
| 695 | Ga0501080_0014480 | 3300049742 | Bacteria | 7264 |
| 696 | Ga0501080_0063735 | 3300049742 | Bacteria | 3429 |
| 697 | Ga0501080_0070874 | 3300049742 | Unclassified | 3241 |
| 698 | Ga0501080_0273912 | 3300049742 | Bacteria | 1535 |
| 699 | Ga0501080_0456994 | 3300049742 | Bacteria | 1144 |
| 700 | Ga0501080_0840165 | 3300049742 | Bacteria | 803 |
| 701 | Ga0501080_0896095 | 3300049742 | Bacteria | 773 |
| 702 | Ga0501080_1164565 | 3300049742 | Bacteria | 664 |
| 703 | Ga0501080_1202773 | 3300049742 | Unclassified | 651 |
| 704 | Ga0501080_1719975 | 3300049742 | Bacteria | 529 |
| 705 | Ga0501080_1731808 | 3300049742 | Bacteria | 526 |
| 706 | Ga0501081_0397382 | 3300049743 | Bacteria | 1020 |
| 707 | Ga0501083_0018154 | 3300049744 | Bacteria | 4903 |
| 708 | Ga0501083_0033462 | 3300049744 | Bacteria | 3519 |
| 709 | Ga0501083_0095682 | 3300049744 | Bacteria | 1959 |
| 710 | Ga0501083_0142301 | 3300049744 | Unclassified | 1570 |
| 711 | Ga0501083_0244111 | 3300049744 | Unclassified | 1169 |
| 712 | Ga0501035_0016614 | 3300049822 | Bacteria | 6785 |
| 713 | Ga0501035_0029248 | 3300049822 | Bacteria | 5024 |
| 714 | Ga0501035_0066319 | 3300049822 | Bacteria | 3203 |
| 715 | Ga0501035_0085975 | 3300049822 | Unclassified | 2771 |
| 716 | Ga0501035_0232780 | 3300049822 | Bacteria | 1570 |
| 717 | Ga0501035_0723029 | 3300049822 | Unclassified | 801 |
| 718 | Ga0501035_1456490 | 3300049822 | Unclassified | 523 |
| 719 | Ga0501044_0001449 | 3300049823 | Bacteria | 27879 |
| 720 | Ga0501044_0021436 | 3300049823 | Bacteria | 6892 |
| 721 | Ga0501044_0028000 | 3300049823 | Bacteria | 5947 |
| 722 | Ga0501044_0044039 | 3300049823 | Bacteria | 4634 |
| 723 | Ga0501044_0104235 | 3300049823 | Bacteria | 2850 |
| 724 | Ga0501045_0041165 | 3300049824 | Unclassified | 3362 |
| 725 | Ga0501045_0140065 | 3300049824 | Bacteria | 1799 |
| 726 | Ga0501045_0147902 | 3300049824 | Bacteria | 1748 |
| 727 | Ga0501045_0202959 | 3300049824 | Bacteria | 1477 |
| 728 | nmdc:mga03n38_450962_c1 | 3300050490 | Bacteria | 715 |
| 729 | nmdc:mga0k408_190699_c1 | 3300050493 | Bacteria | 1223 |
| 730 | nmdc:mga0k408_733937_c1 | 3300050493 | Unclassified | 577 |
| 731 | nmdc:mga06z11_11288_c1 | 3300050494 | Bacteria | 3847 |
| 732 | nmdc:mga06z11_477001_c1 | 3300050494 | Unclassified | 755 |
| 733 | nmdc:mga06z11_95552_c1 | 3300050494 | Bacteria | 1621 |
| 734 | nmdc:mga04h51_249879_c1 | 3300050495 | Unclassified | 710 |
| 735 | nmdc:mga05p37_1403195_c1 | 3300050507 | Bacteria | 703 |
| 736 | nmdc:mga05p37_1610111_c1 | 3300050507 | Bacteria | 639 |
| 737 | nmdc:mga05p37_220687_c1 | 3300050507 | Bacteria | 2288 |
| 738 | nmdc:mga05p37_242956_c1 | 3300050507 | Unclassified | 2163 |
| 739 | nmdc:mga05p37_337344_c1 | 3300050507 | Bacteria | 1778 |
| 740 | nmdc:mga05p37_483401_c1 | 3300050507 | Unclassified | 1426 |
| 741 | nmdc:mga05p37_50079_c1 | 3300050507 | Bacteria | 5137 |
| 742 | nmdc:mga05p37_687177_c1 | 3300050507 | Unclassified | 1139 |
| 743 | nmdc:mga09592_217158_c1 | 3300050508 | Unclassified | 1657 |
| 744 | nmdc:mga09592_348924_c1 | 3300050508 | Unclassified | 1281 |
| 745 | nmdc:mga09592_747974_c1 | 3300050508 | Unclassified | 830 |
| 746 | nmdc:mga09592_93086_c1 | 3300050508 | Unclassified | 2577 |
| 747 | nmdc:mga0qj67_180190_c1 | 3300050509 | Unclassified | 1716 |
| 748 | nmdc:mga0qj67_196590_c1 | 3300050509 | Bacteria | 1639 |
| 749 | nmdc:mga0qj67_447170_c1 | 3300050509 | Bacteria | 1041 |
| 750 | nmdc:mga0qj67_67883_c1 | 3300050509 | Bacteria | 2841 |
| 751 | nmdc:mga0qj67_8525_c1 | 3300050509 | Bacteria | 7607 |
| 752 | nmdc:mga06r32_12056_c1 | 3300050510 | Bacteria | 7791 |
| 753 | nmdc:mga06r32_13252_c1 | 3300050510 | Bacteria | 7467 |
| 754 | nmdc:mga06r32_285505_c1 | 3300050510 | Unclassified | 1637 |
| 755 | nmdc:mga06r32_326220_c1 | 3300050510 | Unclassified | 1520 |
| 756 | nmdc:mga06r32_406884_c1 | 3300050510 | Unclassified | 1343 |
| 757 | nmdc:mga06r32_410697_c1 | 3300050510 | Unclassified | 1335 |
| 758 | nmdc:mga06r32_424660_c1 | 3300050510 | Bacteria | 1310 |
| 759 | nmdc:mga06r32_669043_c1 | 3300050510 | Bacteria | 1005 |
| 760 | nmdc:mga06r32_9672_c2 | 3300050510 | Bacteria | 7789 |
| 761 | nmdc:mga08y16_1269780_c1 | 3300050511 | Bacteria | 704 |
| 762 | nmdc:mga08y16_2012478_c1 | 3300050511 | Bacteria | 527 |
| 763 | nmdc:mga08y16_2053210_c1 | 3300050511 | Bacteria | 520 |
| 764 | nmdc:mga08y16_435_c1 | 3300050511 | Bacteria | 38492 |
| 765 | nmdc:mga08y16_567_c1 | 3300050511 | Bacteria | 34334 |
| 766 | nmdc:mga08y16_8548_c1 | 3300050511 | Bacteria | 10726 |
| 767 | nmdc:mga08y16_99075_c1 | 3300050511 | Unclassified | 1645 |
| 768 | nmdc:mga0n895_103820_c1 | 3300050512 | Bacteria | 2854 |
| 769 | nmdc:mga0n895_394905_c1 | 3300050512 | Unclassified | 1399 |
| 770 | nmdc:mga0n895_881480_c1 | 3300050512 | Unclassified | 881 |
| 771 | nmdc:mga0n895_9639_c1 | 3300050512 | Bacteria | 8463 |
| 772 | nmdc:mga0rr50_126500_c2 | 3300050513 | Unclassified | 1445 |
| 773 | nmdc:mga0rr50_29380_c1 | 3300050513 | Bacteria | 3877 |
| 774 | nmdc:mga0rr50_906087_c1 | 3300050513 | Unclassified | 752 |
| 775 | nmdc:mga0rr50_939579_c1 | 3300050513 | Unclassified | 737 |
| 776 | nmdc:mga08x19_21611_c1 | 3300050514 | Bacteria | 3976 |
| 777 | nmdc:mga08x19_3193_c1 | 3300050514 | Bacteria | 9829 |
| 778 | nmdc:mga0a205_212541_c1 | 3300050515 | Unclassified | 1822 |
| 779 | nmdc:mga0a205_25222_c1 | 3300050515 | Bacteria | 5662 |
| 780 | nmdc:mga0a205_862022_c1 | 3300050515 | Bacteria | 753 |
| 781 | Ga0495601_0172774 | 3300053077 | Bacteria | 1413 |
| 782 | Ga0495619_0965024 | 3300053085 | Bacteria | 571 |
| 783 | Ga0500592_008536 | 3300053116 | Bacteria | 1626 |
| 784 | Ga0500568_0000341 | 3300053139 | Bacteria | 36559 |
| 785 | Ga0500568_0018211 | 3300053139 | Bacteria | 3080 |
| 786 | Ga0501084_0007076 | 3300054114 | Bacteria | 9243 |
| 787 | Ga0501084_0084604 | 3300054114 | Bacteria | 2663 |
| 788 | Ga0501084_0092910 | 3300054114 | Bacteria | 2532 |
| 789 | Ga0501084_0442035 | 3300054114 | Unclassified | 1099 |
| 790 | Ga0501084_0446084 | 3300054114 | Unclassified | 1094 |
| 791 | Ga0590071_053127 | 3300059421 | Bacteria | 984 |
| 792 | Ga0590075_032471 | 3300059424 | Unclassified | 1325 |
| 793 | Ga0590075_035371 | 3300059424 | Unclassified | 1272 |
| 794 | Ga0501082_0009105 | 3300060353 | Bacteria | 8564 |
| 795 | Ga0501082_0035998 | 3300060353 | Bacteria | 4265 |
| 796 | Ga0501082_0066958 | 3300060353 | Bacteria | 3092 |
| 797 | Ga0501082_0251424 | 3300060353 | Bacteria | 1538 |
| 798 | Ga0501082_0252215 | 3300060353 | Bacteria | 1535 |
| 799 | Ga0501082_0583421 | 3300060353 | Bacteria | 978 |
| 800 | Ga0501082_0752340 | 3300060353 | Unclassified | 853 |
| 801 | Ga0501082_1532696 | 3300060353 | Unclassified | 582 |
| 802 | Ga0501082_1768095 | 3300060353 | Bacteria | 539 |
| 803 | Ga0530510_0438589 | 3300061734 | Unclassified | 987 |
| 804 | Ga0436361_0659868 | |||
| 805 | MBSR1b_contig_6041196 | |||
| 806 | JGI24737J22298_10230724 | |||
| 807 | rootH2_10125721 | |||
| 808 | Ga0065712_10003469 | |||
| 809 | Ga0065712_10117542 | |||
| 810 | Ga0065712_10153160 | |||
| 811 | Ga0065715_10153321 | |||
| 812 | Ga0065715_10324945 | |||
| 813 | Ga0065715_10595475 | |||
| 814 | Ga0065707_10806384 | |||
| 815 | Ga0070658_10240677 | |||
| 816 | Ga0070676_10157627 | |||
| 817 | Ga0070683_100002118 | |||
| 818 | Ga0070683_100002926 | |||
| 819 | Ga0070683_100003006 | |||
| 820 | Ga0070670_100142506 | |||
| 821 | Ga0068869_100064601 | |||
| 822 | Ga0068869_100202207 | |||
| 823 | Ga0070666_10021152 | |||
| 824 | Ga0070666_10725175 | |||
| 825 | Ga0070680_100218402 | |||
| 826 | Ga0070680_101267874 | |||
| 827 | Ga0070682_101035923 | |||
| 828 | Ga0068868_101028654 | |||
| 829 | Ga0070689_101527342 | |||
| 830 | Ga0070691_10998250 | |||
| 831 | Ga0070661_100015676 | |||
| 832 | Ga0070661_101757319 | |||
| 833 | Ga0070692_10626548 | |||
| 834 | Ga0070668_100229142 | |||
| 835 | Ga0070669_100276811 | |||
| 836 | Ga0070675_100257928 | |||
| 837 | Ga0070675_100527178 | |||
| 838 | Ga0070675_101003204 | |||
| 839 | Ga0070671_100041979 | |||
| 840 | Ga0070671_100688876 | |||
| 841 | Ga0070674_101341754 | |||
| 842 | Ga0070673_100386819 | |||
| 843 | Ga0070673_101224475 | |||
| 844 | Ga0070688_100205840 | |||
| 845 | Ga0070688_100705483 | |||
| 846 | Ga0070659_100103714 | |||
| 847 | Ga0070659_100223352 | |||
| 848 | Ga0070667_100135520 | |||
| 849 | Ga0070667_101308381 | |||
| 850 | Ga0070714_100045578 | |||
| 851 | Ga0070714_100226437 | |||
| 852 | Ga0070714_100602530 | |||
| 853 | Ga0070713_100013657 | |||
| 854 | Ga0070713_100065136 | |||
| 855 | Ga0070713_100102578 | |||
| 856 | Ga0070713_100181994 | |||
| 857 | Ga0070713_100225074 | |||
| 858 | Ga0070713_100380211 | |||
| 859 | Ga0070713_100637496 | |||
| 860 | Ga0070710_10299690 | |||
| 861 | Ga0070711_100039691 | |||
| 862 | Ga0070711_100043897 | |||
| 863 | Ga0070711_100050023 | |||
| 864 | Ga0070711_100628894 | |||
| 865 | Ga0070711_101024433 | |||
| 866 | Ga0070711_101037981 | |||
| 867 | Ga0070705_101355854 | |||
| 868 | Ga0070694_100927069 | |||
| 869 | Ga0070708_100209143 | |||
| 870 | Ga0070663_100014019 | |||
| 871 | Ga0070663_100325460 | |||
| 872 | Ga0070678_100259015 | |||
| 873 | Ga0070678_101212939 | |||
| 874 | Ga0070681_10601147 | |||
| 875 | Ga0070681_10727228 | |||
| 876 | Ga0070681_11943024 | |||
| 877 | Ga0068867_100902487 | |||
| 878 | Ga0070706_100053147 | |||
| 879 | Ga0070707_100001486 | |||
| 880 | Ga0070707_100048276 | |||
| 881 | Ga0070698_100095864 | |||
| 882 | Ga0070698_101336278 | |||
| 883 | Ga0070699_100039369 | |||
| 884 | Ga0070699_100241789 | |||
| 885 | Ga0070699_100415758 | |||
| 886 | Ga0070699_100680313 | |||
| 887 | Ga0070699_101211899 | |||
| 888 | Ga0070699_101269932 | |||
| 889 | Ga0070679_100169271 | |||
| 890 | Ga0070684_100001223 | |||
| 891 | Ga0070684_100007040 | |||
| 892 | Ga0070684_100008951 | |||
| 893 | Ga0070697_100051131 | |||
| 894 | Ga0070697_101012485 | |||
| 895 | Ga0070697_101346059 | |||
| 896 | Ga0070697_101788100 | |||
| 897 | Ga0070672_100023376 | |||
| 898 | Ga0070672_100397653 | |||
| 899 | Ga0070686_100129253 | |||
| 900 | Ga0070686_101273577 | |||
| 901 | Ga0070695_100776999 | |||
| 902 | Ga0070693_100019464 | |||
| 903 | Ga0070665_100000305 | |||
| 904 | Ga0070665_100280853 | |||
| 905 | Ga0070665_100687374 | |||
| 906 | Ga0070665_101020197 | |||
| 907 | Ga0070665_101695752 | |||
| 908 | Ga0070704_100922604 | |||
| 909 | Ga0070704_101479903 | |||
| 910 | Ga0068855_100052041 | |||
| 911 | Ga0070664_100002625 | |||
| 912 | Ga0070664_101555592 | |||
| 913 | Ga0068857_100024998 | |||
| 914 | Ga0068857_100233078 | |||
| 915 | Ga0068856_100201286 | |||
| 916 | Ga0068856_101055706 | |||
| 917 | Ga0070702_101518799 | |||
| 918 | Ga0068852_101597525 | |||
| 919 | Ga0068859_100852265 | |||
| 920 | Ga0068859_101016264 | |||
| 921 | Ga0068859_101610179 | |||
| 922 | Ga0068859_101850151 | |||
| 923 | Ga0068859_102841768 | |||
| 924 | Ga0068864_100036334 | |||
| 925 | Ga0068866_10039195 | |||
| 926 | Ga0068861_102486822 | |||
| 927 | Ga0068863_101050046 | |||
| 928 | Ga0068863_101422206 | |||
| 929 | Ga0068863_102157262 | |||
| 930 | Ga0068858_100936339 | |||
| 931 | Ga0068858_102227636 | |||
| 932 | Ga0068860_100007064 | |||
| 933 | Ga0068862_100651680 | |||
| 934 | Ga0070717_10021901 | |||
| 935 | Ga0070717_10205852 | |||
| 936 | Ga0070717_10517983 | |||
| 937 | Ga0070717_10742744 | |||
| 938 | Ga0070717_11021513 | |||
| 939 | Ga0070715_10270119 | |||
| 940 | Ga0070716_100219344 | |||
| 941 | Ga0070716_100232781 | |||
| 942 | Ga0070716_100252373 | |||
| 943 | Ga0070716_101179119 | |||
| 944 | Ga0070712_100008939 | |||
| 945 | Ga0070712_100055619 | |||
| 946 | Ga0070712_100199496 | |||
| 947 | Ga0070712_101085304 | |||
| 948 | Ga0070712_101126225 | |||
| 949 | Ga0075367_10058183 | |||
| 950 | Ga0075367_10520253 | |||
| 951 | Ga0075366_10290140 | |||
| 952 | Ga0097621_100539019 | |||
| 953 | Ga0075428_100048105 | |||
| 954 | Ga0075428_100288039 | |||
| 955 | Ga0075428_101349555 | |||
| 956 | Ga0075428_101931215 | |||
| 957 | Ga0075428_102056231 | |||
| 958 | Ga0075430_100010851 | |||
| 959 | Ga0075430_100011268 | |||
| 960 | Ga0075430_100153666 | |||
| 961 | Ga0075430_100291823 | |||
| 962 | Ga0075431_100013537 | |||
| 963 | Ga0075431_100036052 | |||
| 964 | Ga0075431_100059206 | |||
| 965 | Ga0075431_100082497 | |||
| 966 | Ga0075431_100266535 | |||
| 967 | Ga0075431_100297831 | |||
| 968 | Ga0075431_100461419 | |||
| 969 | Ga0075431_100571227 | |||
| 970 | Ga0075431_100597298 | |||
| 971 | Ga0075431_101981742 | |||
| 972 | Ga0075433_10126654 | |||
| 973 | Ga0075433_10693283 | |||
| 974 | Ga0075433_11135587 | |||
| 975 | Ga0075434_100063156 | |||
| 976 | Ga0075434_100105627 | |||
| 977 | Ga0075434_100133937 | |||
| 978 | Ga0075434_100195324 | |||
| 979 | Ga0075434_100400092 | |||
| 980 | Ga0075434_100914221 | |||
| 981 | Ga0075434_101092807 | |||
| 982 | Ga0075429_100015652 | |||
| 983 | Ga0075429_100068401 | |||
| 984 | Ga0075429_100244539 | |||
| 985 | Ga0075429_101543538 | |||
| 986 | Ga0068865_100100864 | |||
| 987 | Ga0068865_101095894 | |||
| 988 | Ga0068865_101877861 | |||
| 989 | Ga0075436_100004974 | |||
| 990 | Ga0075436_100703962 | |||
| 991 | Ga0075436_101270010 | |||
| 992 | Ga0097620_100852100 | |||
| 993 | Ga0097620_101016149 | |||
| 994 | Ga0097620_101609630 | |||
| 995 | Ga0097620_101850293 | |||
| 996 | Ga0097620_102841341 | |||
| 997 | Ga0075435_100069305 | |||
| 998 | Ga0075435_100125905 | |||
| 999 | Ga0075435_100131031 | |||
| 1000 | Ga0075435_100197074 | |||
| 1001 | Ga0075435_100441421 | |||
| 1002 | Ga0075435_100637904 | |||
| 1003 | Ga0075435_101499260 | |||
| 1004 | Ga0105240_10094926 | |||
| 1005 | Ga0111539_10000313 | |||
| 1006 | Ga0111539_10000400 | |||
| 1007 | Ga0111539_10008478 | |||
| 1008 | Ga0111539_10088283 | |||
| 1009 | Ga0111539_10350919 | |||
| 1010 | Ga0111539_10771762 | |||
| 1011 | Ga0111539_10792578 | |||
| 1012 | Ga0111539_11420642 | |||
| 1013 | Ga0111539_12148005 | |||
| 1014 | Ga0111539_12309270 | |||
| 1015 | Ga0105245_10408970 | |||
| 1016 | Ga0105245_10983504 | |||
| 1017 | Ga0105247_10005916 | |||
| 1018 | Ga0105247_10467038 | |||
| 1019 | Ga0114129_10047623 | |||
| 1020 | Ga0114129_10141896 | |||
| 1021 | Ga0114129_10205269 | |||
| 1022 | Ga0114129_10482189 | |||
| 1023 | Ga0114129_11233838 | |||
| 1024 | Ga0114129_11604190 | |||
| 1025 | Ga0105243_10724958 | |||
| 1026 | Ga0105243_10891145 | |||
| 1027 | Ga0105243_11572828 | |||
| 1028 | Ga0105243_12020989 | |||
| 1029 | Ga0105243_12249929 | |||
| 1030 | Ga0105241_10121791 | |||
| 1031 | Ga0105241_10361599 | |||
| 1032 | Ga0105241_10385952 | |||
| 1033 | Ga0105248_10037385 | |||
| 1034 | Ga0105248_10280169 | |||
| 1035 | Ga0105237_10098709 | |||
| 1036 | Ga0105237_10108802 | |||
| 1037 | Ga0105237_10839541 | |||
| 1038 | Ga0105238_10069779 | |||
| 1039 | Ga0105238_10519769 | |||
| 1040 | Ga0105238_11083057 | |||
| 1041 | Ga0105249_10219969 | |||
| 1042 | Ga0105249_10983968 | |||
| 1043 | Ga0105246_10353817 | |||
| 1044 | Ga0157370_10032505 | |||
| 1045 | Ga0157370_10450325 | |||
| 1046 | Ga0157370_10677157 | |||
| 1047 | Ga0157369_10007470 | |||
| 1048 | Ga0157369_10026984 | |||
| 1049 | Ga0157369_10119659 | |||
| 1050 | Ga0157369_10549053 | |||
| 1051 | Ga0157374_10126044 | |||
| 1052 | Ga0157374_12906947 | |||
| 1053 | Ga0157378_11340864 | |||
| 1054 | Ga0163162_10927574 | |||
| 1055 | Ga0163162_11275920 | |||
| 1056 | Ga0163162_11773539 | |||
| 1057 | Ga0163162_12293895 | |||
| 1058 | Ga0157372_10065358 | |||
| 1059 | Ga0157372_10202291 | |||
| 1060 | Ga0157372_10331574 | |||
| 1061 | Ga0157372_10449129 | |||
| 1062 | Ga0157372_10666749 | |||
| 1063 | Ga0157375_10319854 | |||
| 1064 | Ga0157375_10930156 | |||
| 1065 | Ga0157375_13382346 | |||
| 1066 | Ga0163163_10003214 | |||
| 1067 | Ga0163163_10112317 | |||
| 1068 | Ga0163163_10292575 | |||
| 1069 | Ga0163163_10510416 | |||
| 1070 | Ga0163163_11067960 | |||
| 1071 | Ga0163163_11530389 | |||
| 1072 | Ga0157380_10182550 | |||
| 1073 | Ga0157380_10259662 | |||
| 1074 | Ga0157377_11098398 | |||
| 1075 | Ga0157379_11043778 | |||
| 1076 | Ga0157376_10325890 | |||
| 1077 | Ga0157376_12551731 | |||
| 1078 | Ga0182007_10135984 | |||
| 1079 | Ga0163161_11838395 | |||
| 1080 | Ga0213872_10001732 | |||
| 1081 | Ga0213872_10036614 | |||
| 1082 | Ga0213872_10192378 | |||
| 1083 | Ga0213875_10477826 | |||
| 1084 | Ga0213871_10004265 | |||
| 1085 | Ga0207673_1029423 | |||
| 1086 | Ga0207697_10020760 | |||
| 1087 | Ga0207697_10056398 | |||
| 1088 | Ga0207656_10020075 | |||
| 1089 | Ga0207692_10175864 | |||
| 1090 | Ga0207642_10107679 | |||
| 1091 | Ga0207710_10026807 | |||
| 1092 | Ga0207680_10053544 | |||
| 1093 | Ga0207699_10197567 | |||
| 1094 | Ga0207699_10826159 | |||
| 1095 | Ga0207645_10389251 | |||
| 1096 | Ga0207645_10786636 | |||
| 1097 | Ga0207643_10308110 | |||
| 1098 | Ga0207684_10022935 | |||
| 1099 | Ga0207684_10410149 | |||
| 1100 | Ga0207654_10189559 | |||
| 1101 | Ga0207707_10804142 | |||
| 1102 | Ga0207707_11071556 | |||
| 1103 | Ga0207695_10037686 | |||
| 1104 | Ga0207671_10247063 | |||
| 1105 | Ga0207671_10598592 | |||
| 1106 | Ga0207693_10007699 | |||
| 1107 | Ga0207693_10128830 | |||
| 1108 | Ga0207693_10166084 | |||
| 1109 | Ga0207693_10249132 | |||
| 1110 | Ga0207693_10293522 | |||
| 1111 | Ga0207693_10825762 | |||
| 1112 | Ga0207693_10942834 | |||
| 1113 | Ga0207663_10069223 | |||
| 1114 | Ga0207663_10289456 | |||
| 1115 | Ga0207663_10583271 | |||
| 1116 | Ga0207663_11334465 | |||
| 1117 | Ga0207663_11383019 | |||
| 1118 | Ga0207660_10158619 | |||
| 1119 | Ga0207660_10693794 | |||
| 1120 | Ga0207657_11052955 | |||
| 1121 | Ga0207649_10004473 | |||
| 1122 | Ga0207649_10395723 | |||
| 1123 | Ga0207652_10091803 | |||
| 1124 | Ga0207652_10591238 | |||
| 1125 | Ga0207646_10007903 | |||
| 1126 | Ga0207646_10054302 | |||
| 1127 | Ga0207681_10182186 | |||
| 1128 | Ga0207694_10178266 | |||
| 1129 | Ga0207694_10607058 | |||
| 1130 | Ga0207694_10818935 | |||
| 1131 | Ga0207650_10068777 | |||
| 1132 | Ga0207650_10779338 | |||
| 1133 | Ga0207659_10772619 | |||
| 1134 | Ga0207659_10902380 | |||
| 1135 | Ga0207687_10020289 | |||
| 1136 | Ga0207700_10005243 | |||
| 1137 | Ga0207700_10034791 | |||
| 1138 | Ga0207700_10054556 | |||
| 1139 | Ga0207700_10082784 | |||
| 1140 | Ga0207700_10105662 | |||
| 1141 | Ga0207700_10159351 | |||
| 1142 | Ga0207700_10249921 | |||
| 1143 | Ga0207700_10917023 | |||
| 1144 | Ga0207664_10259455 | |||
| 1145 | Ga0207664_10399036 | |||
| 1146 | Ga0207664_10688903 | |||
| 1147 | Ga0207664_11274922 | |||
| 1148 | Ga0207644_10079331 | |||
| 1149 | Ga0207690_10179658 | |||
| 1150 | Ga0207706_10043845 | |||
| 1151 | Ga0207670_11046391 | |||
| 1152 | Ga0207704_10128163 | |||
| 1153 | Ga0207704_10151652 | |||
| 1154 | Ga0207704_10229988 | |||
| 1155 | Ga0207704_11078531 | |||
| 1156 | Ga0207665_10272595 | |||
| 1157 | Ga0207665_10300332 | |||
| 1158 | Ga0207665_10967961 | |||
| 1159 | Ga0207665_11450964 | |||
| 1160 | Ga0207691_10038719 | |||
| 1161 | Ga0207691_10856338 | |||
| 1162 | Ga0207711_10476918 | |||
| 1163 | Ga0207711_11076826 | |||
| 1164 | Ga0207689_10087223 | |||
| 1165 | Ga0207689_10521547 | |||
| 1166 | Ga0207689_10601767 | |||
| 1167 | Ga0207689_11208513 | |||
| 1168 | Ga0207689_11810242 | |||
| 1169 | Ga0207661_10014057 | |||
| 1170 | Ga0207661_10036533 | |||
| 1171 | Ga0207661_10213074 | |||
| 1172 | Ga0207679_10024498 | |||
| 1173 | Ga0207679_11670969 | |||
| 1174 | Ga0207651_10650953 | |||
| 1175 | Ga0207651_10802738 | |||
| 1176 | Ga0207712_10104686 | |||
| 1177 | Ga0207668_10212507 | |||
| 1178 | Ga0207668_10912966 | |||
| 1179 | Ga0207658_10593604 | |||
| 1180 | Ga0207677_10780473 | |||
| 1181 | Ga0207703_10570491 | |||
| 1182 | Ga0207678_10018957 | |||
| 1183 | Ga0207678_10088063 | |||
| 1184 | Ga0207708_10861338 | |||
| 1185 | Ga0207708_11299789 | |||
| 1186 | Ga0207702_10131473 | |||
| 1187 | Ga0207702_10209850 | |||
| 1188 | Ga0207702_10505557 | |||
| 1189 | Ga0207702_12437106 | |||
| 1190 | Ga0207641_10292603 | |||
| 1191 | Ga0207641_10866862 | |||
| 1192 | Ga0207641_11029661 | |||
| 1193 | Ga0207648_10192461 | |||
| 1194 | Ga0207648_12268883 | |||
| 1195 | Ga0207676_10808650 | |||
| 1196 | Ga0207674_10003034 | |||
| 1197 | Ga0207674_10206647 | |||
| 1198 | Ga0207674_10328341 | |||
| 1199 | Ga0207674_10392270 | |||
| 1200 | Ga0207675_100984317 | |||
| 1201 | Ga0207683_10184800 | |||
| 1202 | Ga0207683_10737144 | |||
| 1203 | Ga0207683_11595638 | |||
| 1204 | Ga0207698_10075087 | |||
| 1205 | Ga0207698_10319519 | |||
| 1206 | Ga0207428_10003504 | |||
| 1207 | Ga0207428_10004719 | |||
| 1208 | Ga0207428_10008874 | |||
| 1209 | Ga0207428_10180417 | |||
| 1210 | Ga0268266_10000077 | |||
| 1211 | Ga0268266_10470170 | |||
| 1212 | Ga0268266_10677349 | |||
| 1213 | Ga0268266_10694719 | |||
| 1214 | Ga0268266_10782898 | |||
| 1215 | Ga0268265_12429312 | |||
| 1216 | Ga0268264_10007676 | |||
| 1217 | Ga0268264_12170594 | |||
| 1218 | Ga0265334_10015732 | |||
| 1219 | Ga0265323_10030947 | |||
| 1220 | Ga0265323_10166629 | |||
| 1221 | Ga0265338_10040171 | |||
| 1222 | Ga0265338_10488615 | |||
| 1223 | Ga0265338_10773360 | |||
| 1224 | Ga0265324_10191587 | |||
| 1225 | Ga0265328_10059864 | |||
| 1226 | Ga0265325_10545132 | |||
| 1227 | Ga0265339_10000920 | |||
| 1228 | Ga0265327_10000016 | |||
| 1229 | Ga0265316_10003211 | |||
| 1230 | Ga0265316_10084975 | |||
| 1231 | Ga0265316_10419053 | |||
| 1232 | Ga0265316_10447440 | |||
| 1233 | Ga0307408_100120542 | |||
| 1234 | Ga0307408_101196854 | |||
| 1235 | Ga0265313_10159790 | |||
| 1236 | Ga0265314_10020228 | |||
| 1237 | Ga0265314_10536737 | |||
| 1238 | Ga0265342_10029193 | |||
| 1239 | Ga0265342_10214686 | |||
| 1240 | Ga0307405_10220794 | |||
| 1241 | Ga0307413_10284916 | |||
| 1242 | Ga0307413_10485217 | |||
| 1243 | Ga0307413_10573155 | |||
| 1244 | Ga0307410_10045540 | |||
| 1245 | Ga0307410_11479906 | |||
| 1246 | Ga0307406_10721832 | |||
| 1247 | Ga0307407_10269655 | |||
| 1248 | Ga0307412_10089061 | |||
| 1249 | Ga0307412_11400232 | |||
| 1250 | Ga0307409_100021627 | |||
| 1251 | Ga0307409_100099304 | |||
| 1252 | Ga0307409_100945975 | |||
| 1253 | Ga0307409_101640780 | |||
| 1254 | Ga0307416_100406900 | |||
| 1255 | Ga0307416_101411471 | |||
| 1256 | Ga0307416_103040456 | |||
| 1257 | Ga0307416_103118352 | |||
| 1258 | Ga0307411_10005216 | |||
| 1259 | Ga0307411_10012915 | |||
| 1260 | Ga0307411_10169457 | |||
| 1261 | Ga0307411_11907136 | |||
| 1262 | Ga0307415_100036846 | |||
| 1263 | Ga0373959_0176161 | |||
| 1264 | Ga0373934_0208686 | |||
| 1265 | Ga0373923_0099994 | |||
| 1266 | Ga0373936_0242033 | |||
| 1267 | Ga0373954_0592536 | |||
| 1268 | Ga0373956_0265842 | |||
| 1269 | Ga0373956_0471781 | |||
| 1270 | Ga0373960_0190580 | |||
| 1271 | Ga0373955_0016742 | |||
| 1272 | Ga0373955_0171311 | |||
| 1273 | Ga0373955_0570079 | |||
| 1274 | Ga0373933_0010050 | |||
| 1275 | Ga0373933_0103602 | |||
| 1276 | Ga0373947_1063321 | |||
| 1277 | Ga0373937_0003721 | |||
| 1278 | Ga0373937_0123220 | |||
| 1279 | Ga0373937_0165642 | |||
| 1280 | Ga0373937_0307261 | |||
| 1281 | Ga0373925_0760554 | |||
| 1282 | Ga0436364_0538886 | |||
| 1283 | Ga0436364_1515509 | |||
| 1284 | Ga0436360_0749681 | |||
| 1285 | Ga0436360_1071387 | |||
| 1286 | Ga0436361_0271610 | |||
| 1287 | Ga0436361_1110952 | |||
| 1288 | Ga0436362_0152314 | |||
| 1289 | Ga0439435_0021048 | |||
| 1290 | Ga0439459_0121745 | |||
| 1291 | Ga0439460_0124611 | |||
| 1292 | Ga0450916_059270 | |||
| 1293 | Ga0450893_0012185 | |||
| 1294 | Ga0466969_0066330 | |||
| 1295 | Ga0453683_0391054 | |||
| 1296 | Ga0466961_0262822 | |||
| 1297 | Ga0453684_0044638 | |||
| 1298 | Ga0466957_0373679 | |||
| 1299 | Ga0466957_0937338 | |||
| 1300 | Ga0466959_0103138 | |||
| 1301 | Ga0466959_0329318 | |||
| 1302 | Ga0451576_0531536 | |||
| 1303 | Ga0451576_0642312 | |||
| 1304 | Ga0451576_0687563 | |||
| 1305 | Ga0451576_0823523 | |||
| 1306 | Ga0451576_0920231 | |||
| 1307 | Ga0451576_2054773 | |||
| 1308 | Ga0466958_0009398 | |||
| 1309 | Ga0466958_0240925 | |||
| 1310 | Ga0466967_0017072 | |||
| 1311 | Ga0466967_0660447 | |||
| 1312 | Ga0466967_1218629 | |||
| 1313 | Ga0495592_0032979 | |||
| 1314 | Ga0495603_0171722 | |||
| 1315 | Ga0495629_0056531 | |||
| 1316 | Ga0495638_0006636 | |||
| 1317 | Ga0495651_0264581 | |||
| 1318 | Ga0495653_0032937 | |||
| 1319 | Ga0495580_0308150 | |||
| 1320 | Ga0495580_0547245 | |||
| 1321 | Ga0495582_0040582 | |||
| 1322 | Ga0495662_0018690 | |||
| 1323 | Ga0495664_0004239 | |||
| 1324 | Ga0495608_0095626 | |||
| 1325 | Ga0495616_0388838 | |||
| 1326 | Ga0495618_0038226 | |||
| 1327 | Ga0495628_0027162 | |||
| 1328 | Ga0495630_1003044 | |||
| 1329 | Ga0495652_0058848 | |||
| 1330 | Ga0495652_0327442 | |||
| 1331 | Ga0495586_0858147 | |||
| 1332 | Ga0495587_0079993 | |||
| 1333 | Ga0495645_0027225 | |||
| 1334 | Ga0495645_0027778 | |||
| 1335 | Ga0495667_0207553 | |||
| 1336 | Ga0495634_0124797 | |||
| 1337 | Ga0495635_0101432 | |||
| 1338 | Ga0495599_0095775 | |||
| 1339 | Ga0495599_0297459 | |||
| 1340 | Ga0495623_0564962 | |||
| 1341 | Ga0495646_0527059 | |||
| 1342 | Ga0495658_0072407 | |||
| 1343 | Ga0495669_0352705 | |||
| 1344 | Ga0495613_0099579 | |||
| 1345 | Ga0495613_0540645 | |||
| 1346 | Ga0495613_0612977 | |||
| 1347 | Ga0495604_0169840 | |||
| 1348 | Ga0495604_0827156 | |||
| 1349 | Ga0495674_0043863 | |||
| 1350 | Ga0495680_0114977 | |||
| 1351 | Ga0495675_0095472 | |||
| 1352 | Ga0495675_0223475 | |||
| 1353 | Ga0495684_0278908 | |||
| 1354 | Ga0495684_0808672 | |||
| 1355 | Ga0495593_0380016 | |||
| 1356 | Ga0495602_0053922 | |||
| 1357 | Ga0495602_0648015 | |||
| 1358 | Ga0496100_0901277 | |||
| 1359 | Ga0496100_1373550 | |||
| 1360 | Ga0496101_0308054 | |||
| 1361 | Ga0496102_0919682 | |||
| 1362 | Ga0496102_1017903 | |||
| 1363 | Ga0496102_1407160 | |||
| 1364 | Ga0496104_0010323 | |||
| 1365 | Ga0496104_0055967 | |||
| 1366 | Ga0496104_1528335 | |||
| 1367 | Ga0496104_1878881 | |||
| 1368 | Ga0496105_0023376 | |||
| 1369 | Ga0496105_0432911 | |||
| 1370 | Ga0496105_1369784 | |||
| 1371 | Ga0496106_0119020 | |||
| 1372 | Ga0496106_0355336 | |||
| 1373 | Ga0496106_0752312 | |||
| 1374 | Ga0496107_0031763 | |||
| 1375 | Ga0496108_0009855 | |||
| 1376 | Ga0496109_0003064 | |||
| 1377 | Ga0496109_0393304 | |||
| 1378 | Ga0496110_0001226 | |||
| 1379 | Ga0496110_0890333 | |||
| 1380 | Ga0496111_0014794 | |||
| 1381 | Ga0496112_0003499 | |||
| 1382 | Ga0496112_0062234 | |||
| 1383 | Ga0496112_1131052 | |||
| 1384 | Ga0496114_0009025 | |||
| 1385 | Ga0496115_0448632 | |||
| 1386 | Ga0496115_1446798 | |||
| 1387 | Ga0496126_0162750 | |||
| 1388 | Ga0501031_0098275 | |||
| 1389 | Ga0501031_0211338 | |||
| 1390 | Ga0501031_0448314 | |||
| 1391 | Ga0501032_0005331 | |||
| 1392 | Ga0501032_0032446 | |||
| 1393 | Ga0501032_0043920 | |||
| 1394 | Ga0501032_0475657 | |||
| 1395 | Ga0501033_0009786 | |||
| 1396 | Ga0501033_0141542 | |||
| 1397 | Ga0501034_0009558 | |||
| 1398 | Ga0501034_0011057 | |||
| 1399 | Ga0501034_0089985 | |||
| 1400 | Ga0501034_0199511 | |||
| 1401 | Ga0501034_0261174 | |||
| 1402 | Ga0501034_0300965 | |||
| 1403 | Ga0501034_0536354 | |||
| 1404 | Ga0501034_0998235 | |||
| 1405 | Ga0501036_0022737 | |||
| 1406 | Ga0501036_0023357 | |||
| 1407 | Ga0501036_0031299 | |||
| 1408 | Ga0501036_0043804 | |||
| 1409 | Ga0501036_1119427 | |||
| 1410 | Ga0501037_0005685 | |||
| 1411 | Ga0501037_0080719 | |||
| 1412 | Ga0501037_0469532 | |||
| 1413 | Ga0501038_0004757 | |||
| 1414 | Ga0501038_0006572 | |||
| 1415 | Ga0501038_0036543 | |||
| 1416 | Ga0501038_0042973 | |||
| 1417 | Ga0501038_0066720 | |||
| 1418 | Ga0501039_0006893 | |||
| 1419 | Ga0501039_0008669 | |||
| 1420 | Ga0501039_0070387 | |||
| 1421 | Ga0501039_0196384 | |||
| 1422 | Ga0501039_0560829 | |||
| 1423 | Ga0501040_0228284 | |||
| 1424 | Ga0501041_0316759 | |||
| 1425 | Ga0501042_0106097 | |||
| 1426 | Ga0501042_0205064 | |||
| 1427 | Ga0501043_0040660 | |||
| 1428 | Ga0501043_0074982 | |||
| 1429 | Ga0501043_0089793 | |||
| 1430 | Ga0501043_0097559 | |||
| 1431 | Ga0501043_0106145 | |||
| 1432 | Ga0501046_0001341 | |||
| 1433 | Ga0501046_0004006 | |||
| 1434 | Ga0501046_0010822 | |||
| 1435 | Ga0501046_0302878 | |||
| 1436 | Ga0501046_0965182 | |||
| 1437 | Ga0501046_1241191 | |||
| 1438 | Ga0501047_0003546 | |||
| 1439 | Ga0501047_0024220 | |||
| 1440 | Ga0501047_0038504 | |||
| 1441 | Ga0501047_0040104 | |||
| 1442 | Ga0501047_0051881 | |||
| 1443 | Ga0501047_0055694 | |||
| 1444 | Ga0501047_0056677 | |||
| 1445 | Ga0501047_0243639 | |||
| 1446 | Ga0501047_0798655 | |||
| 1447 | Ga0501048_0005071 | |||
| 1448 | Ga0501048_0039699 | |||
| 1449 | Ga0501048_0191314 | |||
| 1450 | Ga0501048_0338327 | |||
| 1451 | Ga0501048_0424509 | |||
| 1452 | Ga0501067_0019007 | |||
| 1453 | Ga0501067_0085405 | |||
| 1454 | Ga0501068_0021742 | |||
| 1455 | Ga0501068_0027253 | |||
| 1456 | Ga0501068_0051883 | |||
| 1457 | Ga0501069_0013052 | |||
| 1458 | Ga0501069_0013303 | |||
| 1459 | Ga0501069_0527831 | |||
| 1460 | Ga0501069_0761957 | |||
| 1461 | Ga0501070_0077597 | |||
| 1462 | Ga0501070_0100819 | |||
| 1463 | Ga0501070_0162657 | |||
| 1464 | Ga0501070_0181039 | |||
| 1465 | Ga0501070_0188487 | |||
| 1466 | Ga0501070_0458965 | |||
| 1467 | Ga0501071_0338834 | |||
| 1468 | Ga0501072_0016859 | |||
| 1469 | Ga0501072_0178585 | |||
| 1470 | Ga0501072_0191391 | |||
| 1471 | Ga0501072_0411360 | |||
| 1472 | Ga0501073_0009023 | |||
| 1473 | Ga0501073_0014188 | |||
| 1474 | Ga0501073_0054438 | |||
| 1475 | Ga0501073_0081856 | |||
| 1476 | Ga0501073_0086556 | |||
| 1477 | Ga0501073_0090826 | |||
| 1478 | Ga0501073_0158658 | |||
| 1479 | Ga0501074_0014394 | |||
| 1480 | Ga0501074_0063684 | |||
| 1481 | Ga0501075_0004686 | |||
| 1482 | Ga0501075_0244654 | |||
| 1483 | Ga0501076_0051998 | |||
| 1484 | Ga0501076_0131642 | |||
| 1485 | Ga0501076_0195991 | |||
| 1486 | Ga0501077_0260569 | |||
| 1487 | Ga0501077_0434070 | |||
| 1488 | Ga0501077_0532454 | |||
| 1489 | Ga0501199_043679 | |||
| 1490 | Ga0501201_019392 | |||
| 1491 | Ga0501202_211048 | |||
| 1492 | Ga0501217_123636 | |||
| 1493 | Ga0501239_075423 | |||
| 1494 | Ga0501246_020064 | |||
| 1495 | Ga0501079_0011030 | |||
| 1496 | Ga0501079_0168294 | |||
| 1497 | Ga0501079_0217135 | |||
| 1498 | Ga0501080_0014480 | |||
| 1499 | Ga0501080_0063735 | |||
| 1500 | Ga0501080_0070874 | |||
| 1501 | Ga0501080_0273912 | |||
| 1502 | Ga0501080_0456994 | |||
| 1503 | Ga0501080_0840165 | |||
| 1504 | Ga0501080_0896095 | |||
| 1505 | Ga0501080_1164565 | |||
| 1506 | Ga0501080_1202773 | |||
| 1507 | Ga0501080_1719975 | |||
| 1508 | Ga0501080_1731808 | |||
| 1509 | Ga0501081_0397382 | |||
| 1510 | Ga0501083_0018154 | |||
| 1511 | Ga0501083_0033462 | |||
| 1512 | Ga0501083_0095682 | |||
| 1513 | Ga0501083_0142301 | |||
| 1514 | Ga0501083_0244111 | |||
| 1515 | Ga0501035_0016614 | |||
| 1516 | Ga0501035_0029248 | |||
| 1517 | Ga0501035_0066319 | |||
| 1518 | Ga0501035_0085975 | |||
| 1519 | Ga0501035_0232780 | |||
| 1520 | Ga0501035_0723029 | |||
| 1521 | Ga0501035_1456490 | |||
| 1522 | Ga0501044_0001449 | |||
| 1523 | Ga0501044_0021436 | |||
| 1524 | Ga0501044_0028000 | |||
| 1525 | Ga0501044_0044039 | |||
| 1526 | Ga0501044_0104235 | |||
| 1527 | Ga0501045_0041165 | |||
| 1528 | Ga0501045_0140065 | |||
| 1529 | Ga0501045_0147902 | |||
| 1530 | Ga0501045_0202959 | |||
| 1531 | nmdc:mga03n38_450962_c1 | |||
| 1532 | nmdc:mga0k408_190699_c1 | |||
| 1533 | nmdc:mga0k408_733937_c1 | |||
| 1534 | nmdc:mga06z11_11288_c1 | |||
| 1535 | nmdc:mga06z11_477001_c1 | |||
| 1536 | nmdc:mga06z11_95552_c1 | |||
| 1537 | nmdc:mga04h51_249879_c1 | |||
| 1538 | nmdc:mga05p37_1403195_c1 | |||
| 1539 | nmdc:mga05p37_1610111_c1 | |||
| 1540 | nmdc:mga05p37_220687_c1 | |||
| 1541 | nmdc:mga05p37_242956_c1 | |||
| 1542 | nmdc:mga05p37_337344_c1 | |||
| 1543 | nmdc:mga05p37_483401_c1 | |||
| 1544 | nmdc:mga05p37_50079_c1 | |||
| 1545 | nmdc:mga05p37_687177_c1 | |||
| 1546 | nmdc:mga09592_217158_c1 | |||
| 1547 | nmdc:mga09592_348924_c1 | |||
| 1548 | nmdc:mga09592_747974_c1 | |||
| 1549 | nmdc:mga09592_93086_c1 | |||
| 1550 | nmdc:mga0qj67_180190_c1 | |||
| 1551 | nmdc:mga0qj67_196590_c1 | |||
| 1552 | nmdc:mga0qj67_447170_c1 | |||
| 1553 | nmdc:mga0qj67_67883_c1 | |||
| 1554 | nmdc:mga0qj67_8525_c1 | |||
| 1555 | nmdc:mga06r32_12056_c1 | |||
| 1556 | nmdc:mga06r32_13252_c1 | |||
| 1557 | nmdc:mga06r32_285505_c1 | |||
| 1558 | nmdc:mga06r32_326220_c1 | |||
| 1559 | nmdc:mga06r32_406884_c1 | |||
| 1560 | nmdc:mga06r32_410697_c1 | |||
| 1561 | nmdc:mga06r32_424660_c1 | |||
| 1562 | nmdc:mga06r32_669043_c1 | |||
| 1563 | nmdc:mga06r32_9672_c2 | |||
| 1564 | nmdc:mga08y16_1269780_c1 | |||
| 1565 | nmdc:mga08y16_2012478_c1 | |||
| 1566 | nmdc:mga08y16_2053210_c1 | |||
| 1567 | nmdc:mga08y16_435_c1 | |||
| 1568 | nmdc:mga08y16_567_c1 | |||
| 1569 | nmdc:mga08y16_8548_c1 | |||
| 1570 | nmdc:mga08y16_99075_c1 | |||
| 1571 | nmdc:mga0n895_103820_c1 | |||
| 1572 | nmdc:mga0n895_394905_c1 | |||
| 1573 | nmdc:mga0n895_881480_c1 | |||
| 1574 | nmdc:mga0n895_9639_c1 | |||
| 1575 | nmdc:mga0rr50_126500_c2 | |||
| 1576 | nmdc:mga0rr50_29380_c1 | |||
| 1577 | nmdc:mga0rr50_906087_c1 | |||
| 1578 | nmdc:mga0rr50_939579_c1 | |||
| 1579 | nmdc:mga08x19_21611_c1 | |||
| 1580 | nmdc:mga08x19_3193_c1 | |||
| 1581 | nmdc:mga0a205_212541_c1 | |||
| 1582 | nmdc:mga0a205_25222_c1 | |||
| 1583 | nmdc:mga0a205_862022_c1 | |||
| 1584 | Ga0495601_0172774 | |||
| 1585 | Ga0495619_0965024 | |||
| 1586 | Ga0500592_008536 | |||
| 1587 | Ga0500568_0000341 | |||
| 1588 | Ga0500568_0018211 | |||
| 1589 | Ga0501084_0007076 | |||
| 1590 | Ga0501084_0084604 | |||
| 1591 | Ga0501084_0092910 | |||
| 1592 | Ga0501084_0442035 | |||
| 1593 | Ga0501084_0446084 | |||
| 1594 | Ga0590071_053127 | |||
| 1595 | Ga0590075_032471 | |||
| 1596 | Ga0590075_035371 | |||
| 1597 | Ga0501082_0009105 | |||
| 1598 | Ga0501082_0035998 | |||
| 1599 | Ga0501082_0066958 | |||
| 1600 | Ga0501082_0251424 | |||
| 1601 | Ga0501082_0252215 | |||
| 1602 | Ga0501082_0583421 | |||
| 1603 | Ga0501082_0752340 | |||
| 1604 | Ga0501082_1532696 | |||
| 1605 | Ga0501082_1768095 | |||
| 1606 | Ga0530510_0438589 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9286 | 5 | 105 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9233 | 5 | 103 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9225 | 5 | 107 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.9144 | 1 | 107 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9141 | 5 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9571 | 9 | 103 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9212 | 7 | 105 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9141 | 5 | 103 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9075 | 10 | 106 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9017 | 12 | 92 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8EBH7-F1-model_v4 | PadR family transcriptional regulator | 0.9973 | 9 | 106 |
|
| AF-A0A7S7NR82-F1-model_v4 | PadR family transcriptional regulator | 0.9958 | 15 | 107 |
|
| AF-A0A3N5XMC9-F1-model_v4 | PadR family transcriptional regulator | 0.9944 | 15 | 106 |
|
| AF-A0A5B9EGF4-F1-model_v4 | PadR family transcriptional regulator | 0.994 | 15 | 107 |
|
| AF-A0A3A5G5J2-F1-model_v4 | deleted | 0.9938 | 15 | 107 |
|