F481489

General Info

Members Datasets Scaffolds Average Seq Length
803 318 802 117

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10461749|Ga0070676_104617491
Length 131
Sequence MKASMSAARKARRSKMTTPLFKKRQSRTRYKIATNSTGRPRLSIFRSGKHIYAQVIDDKTAATLASASSNEKEGRAAKTWNIDAASSVGKKIAERALASGVKQVVFDRGGYIYHGRVKALADAAREGGLEF

Samples

Sample ID Description Type Environment
1 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
305 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.75
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 0.37
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006763J43179_111127 3300002870 Bacteria 518
2 JGI25405J52794_10062281 3300003911 Bacteria 808
3 Ga0058862_12178484 3300004803 Bacteria 692
4 Ga0070658_10045521 3300005327 Bacteria 3548
5 Ga0070658_10201223 3300005327 Bacteria 1681
6 Ga0070658_10480992 3300005327 Bacteria 1072
7 Ga0070658_11848839 3300005327 Bacteria 522
8 Ga0070676_10079075 3300005328 Bacteria 1990
9 Ga0070676_10167565 3300005328 Bacteria 1418
10 Ga0070676_10461749 3300005328 Bacteria 895
11 Ga0070676_10786173 3300005328 Bacteria 701
12 Ga0070683_100187688 3300005329 Bacteria 1962
13 Ga0070683_100461762 3300005329 Bacteria 1212
14 Ga0070690_100611209 3300005330 Bacteria 829
15 Ga0070670_100641089 3300005331 Bacteria 953
16 Ga0068869_100070091 3300005334 Bacteria 2593
17 Ga0068869_101484553 3300005334 Bacteria 602
18 Ga0070666_10007106 3300005335 Bacteria 6904
19 Ga0070666_10693408 3300005335 Bacteria 746
20 Ga0070680_100002998 3300005336 Bacteria 12534
21 Ga0070680_100072787 3300005336 Bacteria 2825
22 Ga0070680_100078879 3300005336 Bacteria 2713
23 Ga0070680_101241173 3300005336 Bacteria 645
24 Ga0068868_100153898 3300005338 Bacteria 1895
25 Ga0070660_100108074 3300005339 Bacteria 2211
26 Ga0070660_100174288 3300005339 Bacteria 1739
27 Ga0070691_10149346 3300005341 Bacteria 1197
28 Ga0070691_10342674 3300005341 Bacteria 828
29 Ga0070687_100270438 3300005343 Bacteria 1065
30 Ga0070687_101055869 3300005343 Bacteria 592
31 Ga0070661_100005946 3300005344 Bacteria 8403
32 Ga0070661_100258902 3300005344 Bacteria 1345
33 Ga0070661_101407850 3300005344 Bacteria 587
34 Ga0070671_100343504 3300005355 Bacteria 1273
35 Ga0070674_102070568 3300005356 Bacteria 519
36 Ga0070673_100588849 3300005364 Bacteria 1014
37 Ga0070673_102333163 3300005364 Bacteria 509
38 Ga0070688_100357639 3300005365 Bacteria 1071
39 Ga0070688_100542982 3300005365 Bacteria 883
40 Ga0070659_100027373 3300005366 Bacteria 4393
41 Ga0070659_100713145 3300005366 Bacteria 868
42 Ga0070659_100753457 3300005366 Bacteria 845
43 Ga0070659_101495690 3300005366 Bacteria 601
44 Ga0070667_100061525 3300005367 Bacteria 3179
45 Ga0070667_100349423 3300005367 Bacteria 1338
46 Ga0070709_10171867 3300005434 Bacteria 1515
47 Ga0070709_10807109 3300005434 Bacteria 737
48 Ga0070714_100109782 3300005435 Bacteria 2441
49 Ga0070714_100911275 3300005435 Bacteria 854
50 Ga0070714_101129934 3300005435 Bacteria 764
51 Ga0070714_101310504 3300005435 Bacteria 707
52 Ga0070714_102064040 3300005435 Bacteria 556
53 Ga0070713_100213904 3300005436 Bacteria 1746
54 Ga0070713_100558156 3300005436 Bacteria 1085
55 Ga0070713_100815448 3300005436 Bacteria 895
56 Ga0070713_102368412 3300005436 Bacteria 514
57 Ga0070710_10393052 3300005437 Bacteria 928
58 Ga0070701_10424525 3300005438 Bacteria 848
59 Ga0070711_101119623 3300005439 Bacteria 679
60 Ga0070711_101520668 3300005439 Unclassified 584
61 Ga0070700_101025593 3300005441 Bacteria 680
62 Ga0070700_101777987 3300005441 Bacteria 530
63 Ga0070678_100069504 3300005456 Bacteria 2629
64 Ga0070678_101226755 3300005456 Bacteria 696
65 Ga0070678_101678149 3300005456 Bacteria 598
66 Ga0070681_10000037 3300005458 Bacteria 96087
67 Ga0070681_10034634 3300005458 Bacteria 5070
68 Ga0070681_10160044 3300005458 Bacteria 2175
69 Ga0070681_11029384 3300005458 Bacteria 744
70 Ga0068867_100091706 3300005459 Bacteria 2307
71 Ga0070685_11293727 3300005466 Bacteria 557
72 Ga0070679_100008411 3300005530 Bacteria 9712
73 Ga0070679_100064794 3300005530 Bacteria 3642
74 Ga0070679_100365821 3300005530 Bacteria 1389
75 Ga0070679_101064763 3300005530 Bacteria 753
76 Ga0070684_100283884 3300005535 Bacteria 1517
77 Ga0070684_100375804 3300005535 Bacteria 1308
78 Ga0070684_101079606 3300005535 Bacteria 754
79 Ga0070684_102244406 3300005535 Bacteria 515
80 Ga0068853_100101796 3300005539 Bacteria 2541
81 Ga0068853_100246161 3300005539 Bacteria 1640
82 Ga0068853_100436108 3300005539 Bacteria 1231
83 Ga0068853_100714452 3300005539 Bacteria 956
84 Ga0068853_101038291 3300005539 Bacteria 789
85 Ga0070686_100311002 3300005544 Bacteria 1172
86 Ga0070686_100509331 3300005544 Bacteria 935
87 Ga0070696_101323023 3300005546 Bacteria 612
88 Ga0070693_100529106 3300005547 Bacteria 841
89 Ga0070693_100815729 3300005547 Bacteria 693
90 Ga0070693_101552370 3300005547 Bacteria 519
91 Ga0070665_100023111 3300005548 Bacteria 6262
92 Ga0070665_100074982 3300005548 Bacteria 3389
93 Ga0070665_100966759 3300005548 Bacteria 864
94 Ga0070665_101010898 3300005548 Bacteria 844
95 Ga0068855_100000385 3300005563 Bacteria 54304
96 Ga0068855_100121416 3300005563 Bacteria 2990
97 Ga0068855_100128921 3300005563 Bacteria 2890
98 Ga0068855_100135692 3300005563 Bacteria 2808
99 Ga0068855_101740178 3300005563 Bacteria 635
100 Ga0068857_100403718 3300005577 Bacteria 1272
101 Ga0068856_100263376 3300005614 Bacteria 1739
102 Ga0068856_101040321 3300005614 Bacteria 837
103 Ga0068856_101808191 3300005614 Bacteria 623
104 Ga0068856_101982439 3300005614 Bacteria 593
105 Ga0068856_102058554 3300005614 Bacteria 581
106 Ga0070702_100299022 3300005615 Bacteria 1112
107 Ga0068852_100393106 3300005616 Bacteria 1362
108 Ga0068852_101342339 3300005616 Bacteria 737
109 Ga0068864_100366305 3300005618 Bacteria 1363
110 Ga0068864_101188756 3300005618 Bacteria 761
111 Ga0068861_101214834 3300005719 Bacteria 729
112 Ga0068851_10581298 3300005834 Bacteria 680
113 Ga0068870_10119202 3300005840 Bacteria 1518
114 Ga0068870_10402606 3300005840 Bacteria 891
115 Ga0068863_102146407 3300005841 Bacteria 569
116 Ga0068858_101218952 3300005842 Bacteria 740
117 Ga0081538_10050589 3300005981 Bacteria 2506
118 Ga0070715_11000328 3300006163 Bacteria 521
119 Ga0070716_100443022 3300006173 Bacteria 945
120 Ga0070712_100113045 3300006175 Bacteria 2030
121 Ga0070712_100708750 3300006175 Bacteria 858
122 Ga0070712_102059527 3300006175 Bacteria 500
123 Ga0075362_10170480 3300006177 Bacteria 1051
124 Ga0075367_10068073 3300006178 Bacteria 2135
125 Ga0075366_10016744 3300006195 Bacteria 4215
126 Ga0097621_100223165 3300006237 Bacteria 1643
127 Ga0097621_100433566 3300006237 Bacteria 1181
128 Ga0097621_100712378 3300006237 Bacteria 925
129 Ga0097621_101431758 3300006237 Bacteria 655
130 Ga0097621_101529259 3300006237 Bacteria 634
131 Ga0068871_100301487 3300006358 Bacteria 1407
132 Ga0075428_102279109 3300006844 Bacteria 558
133 Ga0075430_100194948 3300006846 Bacteria 1683
134 Ga0075430_100589606 3300006846 Bacteria 917
135 Ga0075431_100116845 3300006847 Bacteria 2753
136 Ga0075433_11605667 3300006852 Bacteria 561
137 Ga0075429_100450246 3300006880 Bacteria 1128
138 Ga0068865_100480540 3300006881 Bacteria 1032
139 Ga0068865_100700100 3300006881 Bacteria 866
140 Ga0105240_10004232 3300009093 Bacteria 21946
141 Ga0105240_10004696 3300009093 Bacteria 20647
142 Ga0105240_10025381 3300009093 Bacteria 7788
143 Ga0105240_10571025 3300009093 Bacteria 1249
144 Ga0105240_10604944 3300009093 Bacteria 1206
145 Ga0105240_10675787 3300009093 Bacteria 1129
146 Ga0105240_10772790 3300009093 Bacteria 1043
147 Ga0105240_11080765 3300009093 Bacteria 854
148 Ga0105240_11336885 3300009093 Bacteria 755
149 Ga0105240_11355769 3300009093 Bacteria 749
150 Ga0105240_11913085 3300009093 Bacteria 617
151 Ga0111539_10023579 3300009094 Bacteria 7562
152 Ga0111539_11031310 3300009094 Bacteria 956
153 Ga0105245_10230243 3300009098 Bacteria 1792
154 Ga0105245_10394924 3300009098 Bacteria 1381
155 Ga0105247_10056711 3300009101 Bacteria 2420
156 Ga0105243_10014172 3300009148 Bacteria 6032
157 Ga0105241_10609598 3300009174 Bacteria 987
158 Ga0105241_10783792 3300009174 Bacteria 877
159 Ga0105241_11448434 3300009174 Bacteria 659
160 Ga0105242_10284153 3300009176 Bacteria 1504
161 Ga0105242_10546840 3300009176 Bacteria 1109
162 Ga0105242_12440001 3300009176 Bacteria 571
163 Ga0105248_10000005 3300009177 Bacteria 673111
164 Ga0105248_10047589 3300009177 Bacteria 4810
165 Ga0105248_10256549 3300009177 Bacteria 1968
166 Ga0105248_10900403 3300009177 Bacteria 999
167 Ga0105248_12302871 3300009177 Bacteria 613
168 Ga0105248_12583146 3300009177 Bacteria 579
169 Ga0105237_10119273 3300009545 Bacteria 2632
170 Ga0105237_10158271 3300009545 Bacteria 2262
171 Ga0105237_10181890 3300009545 Bacteria 2102
172 Ga0105237_10209530 3300009545 Bacteria 1949
173 Ga0105237_11218230 3300009545 Bacteria 759
174 Ga0105237_12150218 3300009545 Bacteria 567
175 Ga0105238_10000180 3300009551 Bacteria 68847
176 Ga0105238_10055822 3300009551 Bacteria 3964
177 Ga0105238_10130022 3300009551 Bacteria 2496
178 Ga0105238_10322009 3300009551 Bacteria 1532
179 Ga0105238_10414574 3300009551 Bacteria 1341
180 Ga0105238_10738831 3300009551 Bacteria 998
181 Ga0105238_11356864 3300009551 Bacteria 738
182 Ga0105238_12443639 3300009551 Bacteria 558
183 Ga0105239_10005584 3300010375 Bacteria 14708
184 Ga0105239_10018317 3300010375 Bacteria 7741
185 Ga0105239_10026360 3300010375 Bacteria 6397
186 Ga0105239_10073553 3300010375 Bacteria 3757
187 Ga0105239_10210784 3300010375 Bacteria 2178
188 Ga0105239_10243523 3300010375 Bacteria 2018
189 Ga0105239_10259863 3300010375 Bacteria 1951
190 Ga0105239_10600711 3300010375 Bacteria 1255
191 Ga0105239_10915674 3300010375 Bacteria 1006
192 Ga0105239_12895017 3300010375 Bacteria 560
193 Ga0105246_10224000 3300011119 Bacteria 1476
194 Ga0105246_11855237 3300011119 Bacteria 577
195 Ga0157373_10565824 3300013100 Bacteria 825
196 Ga0157370_10035566 3300013104 Bacteria 4839
197 Ga0157370_10083851 3300013104 Bacteria 2996
198 Ga0157370_11553340 3300013104 Bacteria 595
199 Ga0157370_11772634 3300013104 Bacteria 554
200 Ga0157369_10033188 3300013105 Bacteria 5675
201 Ga0157369_10345530 3300013105 Bacteria 1546
202 Ga0157369_11176015 3300013105 Bacteria 783
203 Ga0157369_11997704 3300013105 Bacteria 588
204 Ga0157374_10000420 3300013296 Bacteria 38392
205 Ga0157374_10646962 3300013296 Bacteria 1069
206 Ga0157374_11811589 3300013296 Bacteria 636
207 Ga0157378_10506627 3300013297 Bacteria 1207
208 Ga0157378_11303016 3300013297 Bacteria 768
209 Ga0157378_12383229 3300013297 Bacteria 581
210 Ga0163162_12018637 3300013306 Bacteria 661
211 Ga0157372_10066383 3300013307 Bacteria 4053
212 Ga0157375_11964069 3300013308 Bacteria 695
213 Ga0163163_10008003 3300014325 Bacteria 9355
214 Ga0163163_11434683 3300014325 Bacteria 752
215 Ga0163163_12791848 3300014325 Bacteria 545
216 Ga0163163_12859732 3300014325 Bacteria 539
217 Ga0157380_10294611 3300014326 Bacteria 1491
218 Ga0157380_10662266 3300014326 Bacteria 1043
219 Ga0157380_11017165 3300014326 Bacteria 863
220 Ga0157380_11951378 3300014326 Bacteria 648
221 Ga0182008_10092023 3300014497 Bacteria 1496
222 Ga0157379_10052289 3300014968 Bacteria 3649
223 Ga0157379_11504263 3300014968 Bacteria 655
224 Ga0157376_10311850 3300014969 Bacteria 1493
225 Ga0157376_10667399 3300014969 Bacteria 1042
226 Ga0157376_10917251 3300014969 Bacteria 895
227 Ga0157376_12671508 3300014969 Bacteria 539
228 Ga0213873_10070365 3300021358 Bacteria 963
229 Ga0213874_10002785 3300021377 Bacteria 3804
230 Ga0213874_10006777 3300021377 Bacteria 2724
231 Ga0213876_10000421 3300021384 Bacteria 35344
232 Ga0213876_10003189 3300021384 Bacteria 9433
233 Ga0213876_10164652 3300021384 Bacteria 1180
234 Ga0213875_10075279 3300021388 Bacteria 1575
235 Ga0213871_10090741 3300021441 Bacteria 885
236 Ga0207682_10329141 3300025893 Bacteria 718
237 Ga0207682_10501077 3300025893 Bacteria 575
238 Ga0207642_11000576 3300025899 Bacteria 538
239 Ga0207688_10572743 3300025901 Bacteria 711
240 Ga0207680_10002564 3300025903 Bacteria 8470
241 Ga0207645_10011392 3300025907 Bacteria 6075
242 Ga0207645_10058297 3300025907 Bacteria 2465
243 Ga0207643_10030805 3300025908 Bacteria 2989
244 Ga0207643_10477063 3300025908 Bacteria 796
245 Ga0207705_10004720 3300025909 Bacteria 10265
246 Ga0207705_10194396 3300025909 Bacteria 1535
247 Ga0207654_10172361 3300025911 Bacteria 1406
248 Ga0207654_10324382 3300025911 Bacteria 1053
249 Ga0207654_10724010 3300025911 Bacteria 716
250 Ga0207654_10796686 3300025911 Bacteria 682
251 Ga0207654_10893363 3300025911 Bacteria 644
252 Ga0207654_10976002 3300025911 Bacteria 616
253 Ga0207707_10000011 3300025912 Bacteria 282857
254 Ga0207707_10048827 3300025912 Bacteria 3687
255 Ga0207707_11449952 3300025912 Bacteria 546
256 Ga0207695_10000018 3300025913 Bacteria 766611
257 Ga0207695_10028316 3300025913 Bacteria 6218
258 Ga0207695_10040352 3300025913 Bacteria 5007
259 Ga0207695_10128661 3300025913 Bacteria 2492
260 Ga0207695_10217861 3300025913 Bacteria 1817
261 Ga0207695_10383850 3300025913 Bacteria 1290
262 Ga0207695_10592654 3300025913 Bacteria 990
263 Ga0207695_10753082 3300025913 Bacteria 854
264 Ga0207695_10926468 3300025913 Bacteria 751
265 Ga0207695_10950391 3300025913 Bacteria 739
266 Ga0207695_11234151 3300025913 Bacteria 628
267 Ga0207671_10538073 3300025914 Bacteria 931
268 Ga0207671_11087401 3300025914 Bacteria 628
269 Ga0207693_10054085 3300025915 Bacteria 3150
270 Ga0207693_10266868 3300025915 Bacteria 1341
271 Ga0207660_10003537 3300025917 Bacteria 10180
272 Ga0207660_10181434 3300025917 Bacteria 1635
273 Ga0207660_10995112 3300025917 Bacteria 684
274 Ga0207662_10413604 3300025918 Bacteria 916
275 Ga0207657_10196503 3300025919 Bacteria 1625
276 Ga0207657_10350346 3300025919 Bacteria 1164
277 Ga0207657_10586738 3300025919 Bacteria 870
278 Ga0207649_10000194 3300025920 Bacteria 50112
279 Ga0207649_10486227 3300025920 Bacteria 937
280 Ga0207649_11153903 3300025920 Bacteria 612
281 Ga0207652_10000824 3300025921 Bacteria 29561
282 Ga0207652_10115732 3300025921 Bacteria 2382
283 Ga0207652_10115916 3300025921 Bacteria 2380
284 Ga0207652_10532647 3300025921 Bacteria 1056
285 Ga0207652_10563142 3300025921 Bacteria 1023
286 Ga0207652_11396082 3300025921 Bacteria 604
287 Ga0207652_11446107 3300025921 Bacteria 591
288 Ga0207694_10000010 3300025924 Bacteria 439722
289 Ga0207694_10026889 3300025924 Bacteria 4381
290 Ga0207694_10137313 3300025924 Bacteria 1964
291 Ga0207694_10187378 3300025924 Bacteria 1680
292 Ga0207694_10353215 3300025924 Bacteria 1217
293 Ga0207694_10494689 3300025924 Bacteria 1024
294 Ga0207694_10503302 3300025924 Bacteria 1014
295 Ga0207694_10551954 3300025924 Bacteria 967
296 Ga0207694_11107393 3300025924 Bacteria 670
297 Ga0207659_11878713 3300025926 Bacteria 508
298 Ga0207687_10085895 3300025927 Bacteria 2284
299 Ga0207687_10525782 3300025927 Bacteria 990
300 Ga0207687_10721741 3300025927 Bacteria 847
301 Ga0207700_11055403 3300025928 Bacteria 727
302 Ga0207700_11621987 3300025928 Bacteria 572
303 Ga0207664_10073108 3300025929 Bacteria 2766
304 Ga0207664_10316183 3300025929 Bacteria 1377
305 Ga0207664_10411486 3300025929 Bacteria 1204
306 Ga0207644_11594106 3300025931 Bacteria 548
307 Ga0207690_10109672 3300025932 Bacteria 1985
308 Ga0207690_10627877 3300025932 Bacteria 879
309 Ga0207686_10073147 3300025934 Bacteria 2211
310 Ga0207686_10373895 3300025934 Bacteria 1079
311 Ga0207686_10410361 3300025934 Bacteria 1034
312 Ga0207686_10571050 3300025934 Bacteria 887
313 Ga0207686_10826506 3300025934 Bacteria 744
314 Ga0207709_10154513 3300025935 Bacteria 1593
315 Ga0207669_10045989 3300025937 Bacteria 2576
316 Ga0207704_10546716 3300025938 Bacteria 940
317 Ga0207711_10000002 3300025941 Bacteria 1228676
318 Ga0207711_10145656 3300025941 Bacteria 2134
319 Ga0207711_10662390 3300025941 Bacteria 974
320 Ga0207711_10676633 3300025941 Bacteria 963
321 Ga0207711_11036108 3300025941 Bacteria 760
322 Ga0207689_10127211 3300025942 Bacteria 2096
323 Ga0207661_11037548 3300025944 Bacteria 755
324 Ga0207679_10438436 3300025945 Bacteria 1156
325 Ga0207667_10000388 3300025949 Bacteria 59263
326 Ga0207667_10046421 3300025949 Bacteria 4600
327 Ga0207667_10052391 3300025949 Bacteria 4298
328 Ga0207667_10135585 3300025949 Bacteria 2535
329 Ga0207651_10382910 3300025960 Bacteria 1192
330 Ga0207658_10058513 3300025986 Bacteria 2868
331 Ga0207677_10561974 3300026023 Bacteria 996
332 Ga0207677_11486330 3300026023 Bacteria 625
333 Ga0207639_10000867 3300026041 Bacteria 20545
334 Ga0207639_10211849 3300026041 Bacteria 1668
335 Ga0207639_10482726 3300026041 Bacteria 1130
336 Ga0207702_10221951 3300026078 Bacteria 1761
337 Ga0207702_10791862 3300026078 Bacteria 937
338 Ga0207702_10831347 3300026078 Bacteria 914
339 Ga0207702_10956846 3300026078 Bacteria 849
340 Ga0207702_11918977 3300026078 Bacteria 583
341 Ga0207641_12472985 3300026088 Bacteria 518
342 Ga0207648_10120491 3300026089 Bacteria 2306
343 Ga0207676_10596303 3300026095 Bacteria 1060
344 Ga0207676_11379686 3300026095 Bacteria 700
345 Ga0207676_12030203 3300026095 Bacteria 574
346 Ga0207674_10192958 3300026116 Bacteria 1987
347 Ga0207674_10600064 3300026116 Bacteria 1063
348 Ga0207674_11200466 3300026116 Bacteria 728
349 Ga0207675_100347319 3300026118 Bacteria 1453
350 Ga0207683_10103171 3300026121 Bacteria 2547
351 Ga0207683_11450214 3300026121 Bacteria 634
352 Ga0207698_10042447 3300026142 Bacteria 3398
353 Ga0207698_10086858 3300026142 Bacteria 2545
354 Ga0207698_10431881 3300026142 Bacteria 1267
355 Ga0207428_10760687 3300027907 Bacteria 690
356 Ga0207428_11179480 3300027907 Bacteria 533
357 Ga0268266_10000557 3300028379 Bacteria 51935
358 Ga0268266_10095842 3300028379 Bacteria 2606
359 Ga0268266_10320511 3300028379 Bacteria 1450
360 Ga0268266_10816058 3300028379 Bacteria 901
361 Ga0268266_11197779 3300028379 Bacteria 734
362 Ga0268265_10229757 3300028380 Bacteria 1630
363 Ga0268264_11579843 3300028381 Bacteria 667
364 Ga0268264_12447937 3300028381 Bacteria 528
365 Ga0265337_1129141 3300028556 Bacteria 685
366 Ga0265326_10073781 3300028558 Bacteria 965
367 Ga0265334_10284866 3300028573 Bacteria 567
368 Ga0307517_10244892 3300028786 Bacteria 1059
369 Ga0265338_10000017 3300028800 Bacteria 344481
370 Ga0265338_10000401 3300028800 Bacteria 77602
371 Ga0265338_10002896 3300028800 Bacteria 24981
372 Ga0265338_10053558 3300028800 Bacteria 3607
373 Ga0265338_10315488 3300028800 Bacteria 1133
374 Ga0265338_10362361 3300028800 Bacteria 1040
375 Ga0265338_10533692 3300028800 Bacteria 823
376 Ga0307511_10224989 3300030521 Bacteria 937
377 Ga0307511_10265483 3300030521 Bacteria 809
378 Ga0265762_1054893 3300030760 Bacteria 807
379 Ga0265762_1077471 3300030760 Bacteria 707
380 Ga0265760_10126747 3300031090 Bacteria 823
381 Ga0265330_10074125 3300031235 Bacteria 1471
382 Ga0265330_10222495 3300031235 Bacteria 797
383 Ga0265330_10241361 3300031235 Bacteria 762
384 Ga0265330_10304052 3300031235 Bacteria 672
385 Ga0265332_10017915 3300031238 Bacteria 3122
386 Ga0265332_10071412 3300031238 Bacteria 1478
387 Ga0265332_10109358 3300031238 Bacteria 1165
388 Ga0265332_10226366 3300031238 Bacteria 775
389 Ga0265320_10002069 3300031240 Bacteria 14126
390 Ga0265325_10000014 3300031241 Bacteria 131579
391 Ga0265325_10026992 3300031241 Bacteria 3107
392 Ga0265325_10113161 3300031241 Bacteria 1316
393 Ga0265325_10183291 3300031241 Bacteria 974
394 Ga0265325_10232718 3300031241 Bacteria 839
395 Ga0265325_10360964 3300031241 Bacteria 640
396 Ga0265329_10025358 3300031242 Bacteria 1963
397 Ga0265329_10105250 3300031242 Bacteria 900
398 Ga0265340_10002869 3300031247 Bacteria 9812
399 Ga0265340_10038201 3300031247 Bacteria 2376
400 Ga0265340_10196059 3300031247 Bacteria 909
401 Ga0265339_10000256 3300031249 Bacteria 42839
402 Ga0265339_10104553 3300031249 Bacteria 1470
403 Ga0265339_10306913 3300031249 Bacteria 755
404 Ga0265331_10000186 3300031250 Bacteria 76149
405 Ga0265331_10003502 3300031250 Bacteria 10110
406 Ga0265331_10013838 3300031250 Bacteria 4322
407 Ga0265331_10022887 3300031250 Bacteria 3183
408 Ga0265331_10037988 3300031250 Bacteria 2356
409 Ga0265331_10135994 3300031250 Bacteria 1119
410 Ga0265327_10000392 3300031251 Bacteria 82296
411 Ga0265316_10025355 3300031344 Bacteria 4950
412 Ga0265316_10044806 3300031344 Bacteria 3516
413 Ga0265316_10086571 3300031344 Bacteria 2395
414 Ga0265316_10148087 3300031344 Bacteria 1760
415 Ga0265316_10186060 3300031344 Bacteria 1545
416 Ga0265316_10488220 3300031344 Bacteria 881
417 Ga0265316_10505152 3300031344 Bacteria 863
418 Ga0265316_10889279 3300031344 Bacteria 622
419 Ga0265316_10909968 3300031344 Bacteria 614
420 Ga0265313_10000800 3300031595 Bacteria 31814
421 Ga0265313_10012941 3300031595 Bacteria 5055
422 Ga0265313_10086987 3300031595 Bacteria 1409
423 Ga0265313_10257425 3300031595 Bacteria 710
424 Ga0307508_10339899 3300031616 Bacteria 1093
425 Ga0316575_10019455 3300031665 Bacteria 2597
426 Ga0316575_10204733 3300031665 Bacteria 822
427 Ga0265314_10000963 3300031711 Bacteria 33816
428 Ga0265314_10041547 3300031711 Bacteria 3289
429 Ga0265314_10056619 3300031711 Bacteria 2697
430 Ga0265314_10059830 3300031711 Bacteria 2603
431 Ga0265314_10060354 3300031711 Bacteria 2588
432 Ga0265314_10068911 3300031711 Bacteria 2376
433 Ga0265314_10077885 3300031711 Bacteria 2197
434 Ga0265314_10120743 3300031711 Bacteria 1650
435 Ga0265314_10157550 3300031711 Bacteria 1385
436 Ga0265314_10261666 3300031711 Bacteria 987
437 Ga0265314_10398461 3300031711 Bacteria 745
438 Ga0265314_10537414 3300031711 Bacteria 610
439 Ga0265342_10021698 3300031712 Bacteria 4095
440 Ga0265342_10072247 3300031712 Bacteria 2009
441 Ga0265342_10086258 3300031712 Bacteria 1805
442 Ga0265342_10204740 3300031712 Bacteria 1070
443 Ga0265342_10418404 3300031712 Bacteria 690
444 Ga0265342_10613447 3300031712 Bacteria 548
445 Ga0265342_10705073 3300031712 Bacteria 504
446 Ga0307516_10054857 3300031730 Bacteria 3893
447 Ga0307516_10069198 3300031730 Bacteria 3396
448 Ga0307410_10795926 3300031852 Bacteria 804
449 Ga0307416_102038770 3300032002 Bacteria 676
450 Ga0307415_100533038 3300032126 Bacteria 1033
451 Ga0316583_10103179 3300032133 Bacteria 994
452 Ga0316592_1007387 3300033524 Bacteria 2146
453 Ga0373926_0019576 3300035083 Bacteria 2334
454 Ga0373926_0376326 3300035083 Bacteria 559
455 Ga0373926_0438532 3300035083 Bacteria 518
456 Ga0373940_0006108 3300035088 Bacteria 2650
457 Ga0373944_0139499 3300035089 Bacteria 848
458 Ga0373944_0332856 3300035089 Bacteria 575
459 Ga0373944_0378439 3300035089 Bacteria 543
460 Ga0373923_0127825 3300035111 Bacteria 1140
461 Ga0373923_0655767 3300035111 Bacteria 519
462 Ga0373936_0008097 3300035113 Bacteria 3952
463 Ga0373936_0187142 3300035113 Bacteria 910
464 Ga0373939_0021311 3300035114 Bacteria 1772
465 Ga0373945_0006653 3300035116 Bacteria 3735
466 Ga0373945_0144523 3300035116 Bacteria 961
467 Ga0373956_0311788 3300035119 Bacteria 750
468 Ga0373957_0208961 3300035120 Bacteria 815
469 Ga0373960_0398125 3300035121 Bacteria 531
470 Ga0373943_0007235 3300035170 Bacteria 4980
471 Ga0373943_0458592 3300035170 Bacteria 741
472 Ga0373946_0021157 3300035171 Bacteria 2520
473 Ga0373955_0036549 3300035172 Bacteria 2607
474 Ga0373955_0236450 3300035172 Bacteria 1094
475 Ga0373924_0016976 3300035410 Bacteria 2786
476 Ga0373931_0111163 3300035691 Bacteria 1555
477 Ga0373935_0003403 3300035692 Bacteria 9238
478 Ga0373935_0027495 3300035692 Bacteria 3515
479 Ga0373935_0489250 3300035692 Bacteria 892
480 Ga0373935_0521708 3300035692 Bacteria 864
481 Ga0373927_0064151 3300035695 Bacteria 2376
482 Ga0373927_0484655 3300035695 Bacteria 817
483 Ga0373933_0484017 3300035724 Bacteria 810
484 Ga0373933_0871173 3300035724 Bacteria 593
485 Ga0373947_0011709 3300035725 Bacteria 5027
486 Ga0373947_0835731 3300035725 Bacteria 629
487 Ga0373937_0062577 3300036401 Bacteria 3421
488 Ga0373937_0070199 3300036401 Bacteria 3231
489 Ga0373937_0190143 3300036401 Bacteria 1929
490 Ga0373937_0775839 3300036401 Bacteria 906
491 Ga0316584_0280293 3300036712 Bacteria 1211
492 Ga0373925_0002514 3300037068 Bacteria 14651
493 Ga0373925_0041086 3300037068 Bacteria 3426
494 Ga0395899_0001783 3300037312 Bacteria 17833
495 Ga0395899_0185656 3300037312 Bacteria 1457
496 Ga0395900_0001968 3300037418 Bacteria 23201
497 Ga0395900_0072243 3300037418 Bacteria 3548
498 Ga0395900_0098142 3300037418 Bacteria 3010
499 Ga0395900_1109535 3300037418 Bacteria 708
500 Ga0395898_0001813 3300037466 Bacteria 27601
501 Ga0395898_0070051 3300037466 Bacteria 3392
502 Ga0395898_0172906 3300037466 Bacteria 2065
503 Ga0395898_0359028 3300037466 Bacteria 1389
504 Ga0395905_0002986 3300037471 Bacteria 18360
505 Ga0395905_0904095 3300037471 Bacteria 786
506 Ga0395905_1104307 3300037471 Bacteria 696
507 Ga0316581_0171426 3300037588 Bacteria 669
508 Ga0436364_0731250 3300037853 Bacteria 1276
509 Ga0436364_1442444 3300037853 Bacteria 2695
510 Ga0395901_0045308 3300038443 Bacteria 4564
511 Ga0395901_0130246 3300038443 Bacteria 2643
512 Ga0395901_1554232 3300038443 Bacteria 616
513 Ga0395901_1984243 3300038443 Bacteria 528
514 Ga0436365_0544722 3300039437 Bacteria 16758
515 Ga0436365_1637588 3300039437 Bacteria 49130
516 Ga0436360_0360048 3300039438 Bacteria 2053
517 Ga0436360_0716296 3300039438 Bacteria 2775
518 Ga0436360_1015806 3300039438 Bacteria 789
519 Ga0436361_0698348 3300039447 Bacteria 1269
520 Ga0436363_0427400 3300039450 Bacteria 3997
521 Ga0436363_0896516 3300039450 Bacteria 1486
522 Ga0436363_1234183 3300039450 Bacteria 784
523 Ga0436363_1470856 3300039450 Bacteria 3937
524 Ga0436362_0133744 3300039453 Bacteria 5063
525 Ga0439460_0207078 3300042461 Bacteria 669
526 Ga0466963_0654836 3300044694 Bacteria 741
527 Ga0466963_1048507 3300044694 Bacteria 574
528 Ga0466963_1080032 3300044694 Bacteria 565
529 Ga0466957_0134071 3300044842 Bacteria 1590
530 Ga0466959_1068813 3300045049 Bacteria 537
531 Ga0466959_1083066 3300045049 Bacteria 533
532 Ga0466967_0059567 3300045976 Bacteria 3380
533 Ga0466967_1086811 3300045976 Bacteria 797
534 Ga0466967_1373626 3300045976 Bacteria 703
535 Ga0495592_0176228 3300046454 Bacteria 1460
536 Ga0495592_0737513 3300046454 Bacteria 590
537 Ga0495603_0163932 3300046455 Bacteria 1289
538 Ga0495590_0022080 3300046457 Bacteria 2252
539 Ga0495629_0686141 3300046459 Bacteria 681
540 Ga0495638_0366879 3300046460 Bacteria 756
541 Ga0495653_0881506 3300046463 Unclassified 534
542 Ga0495580_0182626 3300046472 Bacteria 1448
543 Ga0495580_0387970 3300046472 Bacteria 943
544 Ga0495582_0532630 3300046473 Bacteria 679
545 Ga0495582_0653216 3300046473 Bacteria 609
546 Ga0495605_0155621 3300046474 Bacteria 1017
547 Ga0495605_0215543 3300046474 Bacteria 831
548 Ga0495662_0094538 3300046476 Bacteria 1460
549 Ga0495662_0405102 3300046476 Bacteria 670
550 Ga0495664_0034829 3300046477 Bacteria 2963
551 Ga0495584_0628674 3300046491 Bacteria 547
552 Ga0495594_0209466 3300046499 Bacteria 1111
553 Ga0495608_0843667 3300046511 Bacteria 539
554 Ga0495628_0094702 3300046516 Bacteria 2308
555 Ga0495630_0440961 3300046517 Bacteria 998
556 Ga0495630_0720911 3300046517 Bacteria 763
557 Ga0495642_0031203 3300046528 Bacteria 2136
558 Ga0495652_0445585 3300046529 Bacteria 907
559 Ga0495654_0052557 3300046530 Bacteria 1983
560 Ga0495654_0140206 3300046530 Bacteria 1078
561 Ga0495586_0076681 3300046535 Bacteria 1832
562 Ga0495586_0907405 3300046535 Bacteria 508
563 Ga0495587_0166062 3300046536 Bacteria 1255
564 Ga0495587_0204496 3300046536 Bacteria 1116
565 Ga0495587_0483584 3300046536 Bacteria 685
566 Ga0495645_0086993 3300046543 Bacteria 2236
567 Ga0495645_0219231 3300046543 Bacteria 1280
568 Ga0495645_0410490 3300046543 Bacteria 861
569 Ga0495622_0003379 3300046557 Bacteria 7527
570 Ga0495622_0005205 3300046557 Bacteria 6029
571 Ga0495622_0149869 3300046557 Bacteria 1056
572 Ga0495667_0525319 3300046559 Bacteria 740
573 Ga0495668_0516729 3300046616 Bacteria 658
574 Ga0495611_0052065 3300046648 Bacteria 1846
575 Ga0495657_0725526 3300046675 Bacteria 570
576 Ga0495623_0242409 3300046679 Bacteria 1018
577 Ga0495623_0386276 3300046679 Bacteria 756
578 Ga0495646_0447941 3300046680 Bacteria 667
579 Ga0495647_0035217 3300046681 Bacteria 1879
580 Ga0495658_0303205 3300046683 Bacteria 1011
581 Ga0495658_0510622 3300046683 Bacteria 769
582 Ga0495658_0529345 3300046683 Bacteria 754
583 Ga0495669_0166595 3300046684 Bacteria 1047
584 Ga0495613_0311412 3300046689 Bacteria 1088
585 Ga0495613_0901380 3300046689 Bacteria 572
586 Ga0495649_0014806 3300046694 Bacteria 4457
587 Ga0495589_0093052 3300046794 Bacteria 1463
588 Ga0495600_0808155 3300046809 Bacteria 558
589 Ga0495604_0810753 3300047317 Bacteria 589
590 Ga0495674_0361879 3300047319 Bacteria 1176
591 Ga0495674_0465109 3300047319 Bacteria 1015
592 Ga0495674_0769576 3300047319 Bacteria 751
593 Ga0495672_0010923 3300047320 Bacteria 6440
594 Ga0495683_0134375 3300047323 Bacteria 1164
595 Ga0495675_0062651 3300047444 Bacteria 2354
596 Ga0495675_0269418 3300047444 Bacteria 1018
597 Ga0495673_0050671 3300047469 Bacteria 1821
598 Ga0495684_0119581 3300047471 Bacteria 1985
599 Ga0495684_0193448 3300047471 Bacteria 1503
600 Ga0495684_0303399 3300047471 Bacteria 1146
601 Ga0495686_0402976 3300047472 Bacteria 734
602 Ga0495686_0429040 3300047472 Bacteria 705
603 Ga0495593_0131793 3300047673 Bacteria 1269
604 Ga0495593_0163719 3300047673 Bacteria 1122
605 Ga0495602_0175950 3300048088 Bacteria 1656
606 Ga0495602_0838259 3300048088 Bacteria 615
607 Ga0495614_0272439 3300048089 Bacteria 778
608 Ga0496107_0510076 3300048910 Bacteria 892
609 Ga0496115_0089908 3300048918 Bacteria 2508
610 Ga0496115_0490803 3300048918 Bacteria 988
611 Ga0496126_0000480 3300048929 Bacteria 79257
612 Ga0495682_0005207 3300049460 Bacteria 5432
613 Ga0501031_0068962 3300049568 Bacteria 2303
614 Ga0501031_0093984 3300049568 Bacteria 1957
615 Ga0501032_0000374 3300049569 Bacteria 36951
616 Ga0501032_0004362 3300049569 Bacteria 10681
617 Ga0501032_0059736 3300049569 Bacteria 2558
618 Ga0501032_0145528 3300049569 Bacteria 1560
619 Ga0501032_0151835 3300049569 Bacteria 1523
620 Ga0501032_0178940 3300049569 Bacteria 1389
621 Ga0501033_0012240 3300049570 Bacteria 6548
622 Ga0501033_0036296 3300049570 Bacteria 3693
623 Ga0501033_0042785 3300049570 Bacteria 3376
624 Ga0501033_0048667 3300049570 Bacteria 3148
625 Ga0501033_0312057 3300049570 Bacteria 1105
626 Ga0501033_0371078 3300049570 Bacteria 1000
627 Ga0501033_0678126 3300049570 Bacteria 702
628 Ga0501033_0784380 3300049570 Bacteria 645
629 Ga0501034_0010632 3300049571 Bacteria 9573
630 Ga0501034_0027593 3300049571 Bacteria 5774
631 Ga0501034_0091835 3300049571 Bacteria 3033
632 Ga0501034_0132960 3300049571 Bacteria 2471
633 Ga0501034_0133506 3300049571 Bacteria 2464
634 Ga0501034_0171039 3300049571 Bacteria 2140
635 Ga0501034_0251625 3300049571 Bacteria 1711
636 Ga0501034_0310860 3300049571 Bacteria 1510
637 Ga0501034_0588000 3300049571 Bacteria 1019
638 Ga0501034_0634386 3300049571 Bacteria 971
639 Ga0501034_0901392 3300049571 Bacteria 772
640 Ga0501034_1010260 3300049571 Bacteria 715
641 Ga0501036_0005653 3300049572 Bacteria 10145
642 Ga0501036_0158426 3300049572 Bacteria 1909
643 Ga0501036_0748769 3300049572 Bacteria 806
644 Ga0501036_0829619 3300049572 Bacteria 761
645 Ga0501036_0880700 3300049572 Bacteria 735
646 Ga0501037_0000862 3300049573 Bacteria 22616
647 Ga0501037_0024753 3300049573 Bacteria 4438
648 Ga0501037_0305201 3300049573 Bacteria 1104
649 Ga0501037_0379472 3300049573 Bacteria 972
650 Ga0501037_0396332 3300049573 Bacteria 947
651 Ga0501037_0441735 3300049573 Bacteria 888
652 Ga0501037_0675967 3300049573 Bacteria 689
653 Ga0501037_0784376 3300049573 Bacteria 630
654 Ga0501038_0088134 3300049574 Bacteria 2605
655 Ga0501038_0116476 3300049574 Bacteria 2208
656 Ga0501038_0131687 3300049574 Bacteria 2052
657 Ga0501038_0147189 3300049574 Bacteria 1922
658 Ga0501038_0298230 3300049574 Bacteria 1265
659 Ga0501038_0349287 3300049574 Bacteria 1152
660 Ga0501038_0931781 3300049574 Bacteria 640
661 Ga0501039_0019053 3300049575 Bacteria 5264
662 Ga0501039_0222759 3300049575 Bacteria 1483
663 Ga0501039_0797474 3300049575 Bacteria 737
664 Ga0501040_0339923 3300049576 Bacteria 1075
665 Ga0501040_1437391 3300049576 Bacteria 501
666 Ga0501041_0090359 3300049577 Bacteria 1891
667 Ga0501042_0098300 3300049578 Bacteria 2105
668 Ga0501042_0766414 3300049578 Bacteria 702
669 Ga0501043_0010388 3300049579 Bacteria 7296
670 Ga0501043_0014584 3300049579 Bacteria 6152
671 Ga0501043_0045694 3300049579 Bacteria 3444
672 Ga0501043_0076142 3300049579 Bacteria 2636
673 Ga0501043_0097012 3300049579 Bacteria 2317
674 Ga0501043_0160092 3300049579 Bacteria 1759
675 Ga0501043_0228594 3300049579 Bacteria 1437
676 Ga0501043_0286820 3300049579 Bacteria 1261
677 Ga0501043_0539165 3300049579 Bacteria 868
678 Ga0501046_0005416 3300049580 Bacteria 11410
679 Ga0501046_0011762 3300049580 Bacteria 7472
680 Ga0501046_0012992 3300049580 Bacteria 7068
681 Ga0501046_0393012 3300049580 Bacteria 1002
682 Ga0501046_0397334 3300049580 Bacteria 996
683 Ga0501046_0560881 3300049580 Bacteria 813
684 Ga0501046_0845046 3300049580 Bacteria 640
685 Ga0501047_0002319 3300049581 Bacteria 18206
686 Ga0501047_0014860 3300049581 Bacteria 7410
687 Ga0501047_0016976 3300049581 Bacteria 6961
688 Ga0501047_0033976 3300049581 Bacteria 4923
689 Ga0501047_0037637 3300049581 Bacteria 4678
690 Ga0501047_0054048 3300049581 Bacteria 3885
691 Ga0501047_0065087 3300049581 Bacteria 3514
692 Ga0501047_0079044 3300049581 Bacteria 3163
693 Ga0501047_0131220 3300049581 Bacteria 2386
694 Ga0501047_0171826 3300049581 Bacteria 2036
695 Ga0501047_0176653 3300049581 Bacteria 2003
696 Ga0501047_0251827 3300049581 Bacteria 1614
697 Ga0501047_0375584 3300049581 Bacteria 1256
698 Ga0501047_0441537 3300049581 Bacteria 1131
699 Ga0501047_0736199 3300049581 Bacteria 802
700 Ga0501048_0023812 3300049582 Bacteria 4471
701 Ga0501048_0209717 3300049582 Bacteria 1382
702 Ga0501048_0476971 3300049582 Bacteria 894
703 Ga0501048_0732607 3300049582 Bacteria 710
704 Ga0501048_0749050 3300049582 Bacteria 702
705 Ga0501048_1136496 3300049582 Bacteria 562
706 Ga0501067_0001776 3300049583 Bacteria 11844
707 Ga0501068_0077512 3300049584 Bacteria 2035
708 Ga0501069_0022165 3300049585 Bacteria 3452
709 Ga0501070_0014964 3300049586 Bacteria 6527
710 Ga0501070_0143912 3300049586 Bacteria 1968
711 Ga0501070_0382617 3300049586 Bacteria 1140
712 Ga0501070_0449010 3300049586 Bacteria 1040
713 Ga0501070_0514861 3300049586 Bacteria 960
714 Ga0501071_0156932 3300049587 Bacteria 1699
715 Ga0501071_0756795 3300049587 Bacteria 749
716 Ga0501072_0097056 3300049588 Bacteria 2342
717 Ga0501072_0777805 3300049588 Bacteria 750
718 Ga0501072_0871679 3300049588 Bacteria 704
719 Ga0501073_0001669 3300049589 Bacteria 16438
720 Ga0501073_0013850 3300049589 Bacteria 5864
721 Ga0501073_0036603 3300049589 Bacteria 3487
722 Ga0501073_0059886 3300049589 Bacteria 2658
723 Ga0501073_0070275 3300049589 Bacteria 2439
724 Ga0501073_0255902 3300049589 Bacteria 1209
725 Ga0501073_0388203 3300049589 Bacteria 965
726 Ga0501074_0004453 3300049590 Bacteria 10023
727 Ga0501074_0079197 3300049590 Bacteria 2358
728 Ga0501074_1250547 3300049590 Bacteria 520
729 Ga0501076_0673885 3300049592 Bacteria 854
730 Ga0501077_0316586 3300049593 Bacteria 995
731 Ga0501079_0001478 3300049741 Bacteria 16629
732 Ga0501079_0140727 3300049741 Bacteria 1880
733 Ga0501079_0567026 3300049741 Bacteria 893
734 Ga0501079_1311378 3300049741 Bacteria 570
735 Ga0501079_1352196 3300049741 Bacteria 561
736 Ga0501080_0040364 3300049742 Bacteria 4353
737 Ga0501080_0043846 3300049742 Bacteria 4165
738 Ga0501080_0125187 3300049742 Bacteria 2380
739 Ga0501080_0164344 3300049742 Bacteria 2049
740 Ga0501080_0283362 3300049742 Bacteria 1506
741 Ga0501080_0596113 3300049742 Bacteria 981
742 Ga0501080_0675815 3300049742 Bacteria 912
743 Ga0501080_0683144 3300049742 Bacteria 906
744 Ga0501080_0882512 3300049742 Bacteria 780
745 Ga0501080_1481032 3300049742 Bacteria 577
746 Ga0501081_0195365 3300049743 Bacteria 1466
747 Ga0501083_0052937 3300049744 Bacteria 2725
748 Ga0501083_0135923 3300049744 Bacteria 1611
749 Ga0501083_0425632 3300049744 Bacteria 864
750 Ga0501035_0019622 3300049822 Bacteria 6212
751 Ga0501035_0044851 3300049822 Bacteria 3979
752 Ga0501035_0048543 3300049822 Bacteria 3807
753 Ga0501035_0085166 3300049822 Bacteria 2786
754 Ga0501035_0368131 3300049822 Bacteria 1200
755 Ga0501035_0529788 3300049822 Bacteria 967
756 Ga0501035_0667321 3300049822 Bacteria 841
757 Ga0501035_0810133 3300049822 Bacteria 747
758 Ga0501035_0936218 3300049822 Bacteria 684
759 Ga0501035_0991956 3300049822 Bacteria 661
760 Ga0501044_0015755 3300049823 Bacteria 8141
761 Ga0501044_0024878 3300049823 Bacteria 6351
762 Ga0501044_0027898 3300049823 Bacteria 5959
763 Ga0501044_0061775 3300049823 Bacteria 3832
764 Ga0501044_0114803 3300049823 Bacteria 2698
765 Ga0501044_0129184 3300049823 Bacteria 2522
766 Ga0501044_0161480 3300049823 Bacteria 2217
767 Ga0501044_0426141 3300049823 Bacteria 1236
768 Ga0501044_0456898 3300049823 Bacteria 1183
769 Ga0501044_0984593 3300049823 Bacteria 715
770 Ga0501044_1016818 3300049823 Bacteria 700
771 Ga0501044_1281205 3300049823 Bacteria 600
772 Ga0501044_1519932 3300049823 Bacteria 534
773 Ga0501045_0128835 3300049824 Bacteria 1881
774 Ga0501045_0626636 3300049824 Bacteria 796
775 nmdc:mga03683_193205_c1 3300050489 Bacteria 932
776 nmdc:mga0k408_3076_c1 3300050493 Bacteria 8839
777 nmdc:mga09592_641289_c1 3300050508 Bacteria 907
778 nmdc:mga0qj67_1078800_c1 3300050509 Bacteria 628
779 nmdc:mga08y16_19140_c1 3300050511 Bacteria 7214
780 nmdc:mga0a205_171156_c1 3300050515 Bacteria 2068
781 Ga0500635_0249855 3300053080 Bacteria 695
782 Ga0500635_0307042 3300053080 Bacteria 626
783 Ga0500646_0206960 3300053090 Bacteria 675
784 Ga0500555_039510 3300053103 Bacteria 1317
785 Ga0500594_0012014 3300053118 Bacteria 2032
786 Ga0500595_001661 3300053119 Bacteria 11694
787 Ga0500595_048974 3300053119 Bacteria 1318
788 Ga0500595_142011 3300053119 Bacteria 673
789 Ga0500595_163432 3300053119 Bacteria 620
790 Ga0500655_006392 3300053133 Bacteria 2121
791 Ga0500559_0087609 3300053136 Bacteria 1422
792 Ga0500561_0041694 3300053137 Bacteria 1215
793 Ga0500568_0047421 3300053139 Bacteria 1702
794 Ga0500573_0339658 3300053140 Bacteria 734
795 Ga0500637_0075513 3300053178 Bacteria 1942
796 Ga0500645_075788 3300053730 Bacteria 962
797 Ga0501084_0000175 3300054114 Bacteria 50123
798 Ga0501084_0007620 3300054114 Bacteria 8925
799 Ga0501082_0006964 3300060353 Bacteria 9766
800 Ga0501082_0069701 3300060353 Bacteria 3028
801 Ga0530510_0238077 3300061734 Bacteria 1355
802 Ga0530510_1292128 3300061734 Bacteria 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0731250 Ga0436364_0731250_481_843 96
2 3300005456 Ga0070678_100069504 Ga0070678_1000695044 98
3 3300025893 Ga0207682_10329141 Ga0207682_103291412 98
4 3300025931 Ga0207644_11594106 Ga0207644_115941061 98
5 3300026121 Ga0207683_10103171 Ga0207683_101031716 98
6 3300005364 Ga0070673_102333163 Ga0070673_1023331631 100
7 3300005327 Ga0070658_11848839 Ga0070658_118488391 101
8 3300005435 Ga0070714_101310504 Ga0070714_1013105041 101
9 3300005616 Ga0068852_101342339 Ga0068852_1013423392 101
10 3300026142 Ga0207698_10431881 Ga0207698_104318812 101
11 3300039447 Ga0436361_0698348 Ga0436361_0698348_321_683 101
12 3300049589 Ga0501073_0388203 Ga0501073_0388203_426_788 101
13 3300047472 Ga0495686_0402976 Ga0495686_0402976_187_555 102
14 3300005327 Ga0070658_10480992 Ga0070658_104809922 103
15 3300026116 Ga0207674_10600064 Ga0207674_106000642 103
16 3300028786 Ga0307517_10244892 Ga0307517_102448922 103
17 3300049571 Ga0501034_0310860 Ga0501034_0310860_1159_1473 103
18 3300035089 Ga0373944_0378439 Ga0373944_0378439_145_507 104
19 3300061734 Ga0530510_1292128 Ga0530510_1292128_191_508 104
20 3300039438 Ga0436360_1015806 Ga0436360_1015806_66_431 105
21 3300046472 Ga0495580_0182626 Ga0495580_0182626_395_760 105
22 3300005329 Ga0070683_100461762 Ga0070683_1004617622 106
23 3300005439 Ga0070711_101119623 Ga0070711_1011196232 106
24 3300005535 Ga0070684_100283884 Ga0070684_1002838841 106
25 3300005614 Ga0068856_102058554 Ga0068856_1020585542 106
26 3300006173 Ga0070716_100443022 Ga0070716_1004430222 106
27 3300009176 Ga0105242_10284153 Ga0105242_102841532 106
28 3300013296 Ga0157374_11811589 Ga0157374_118115892 106
29 3300025926 Ga0207659_11878713 Ga0207659_118787131 106
30 3300025927 Ga0207687_10721741 Ga0207687_107217412 106
31 3300025934 Ga0207686_10571050 Ga0207686_105710502 106
32 3300026078 Ga0207702_11918977 Ga0207702_119189772 106
33 3300035170 Ga0373943_0458592 Ga0373943_0458592_285_647 106
34 3300035410 Ga0373924_0016976 Ga0373924_0016976_1319_1681 106
35 3300035691 Ga0373931_0111163 Ga0373931_0111163_794_1156 106
36 3300035692 Ga0373935_0027495 Ga0373935_0027495_2671_3033 106
37 3300035724 Ga0373933_0871173 Ga0373933_0871173_92_454 106
38 3300036401 Ga0373937_0062577 Ga0373937_0062577_1157_1519 106
39 3300037068 Ga0373925_0041086 Ga0373925_0041086_2076_2438 106
40 3300046459 Ga0495629_0686141 Ga0495629_0686141_251_613 106
41 3300046689 Ga0495613_0901380 Ga0495613_0901380_153_515 106
42 3300047471 Ga0495684_0193448 Ga0495684_0193448_72_434 106
43 3300004803 Ga0058862_12178484 Ga0058862_121784842 108
44 3300005336 Ga0070680_100002998 Ga0070680_10000299811 108
45 3300005458 Ga0070681_10000037 Ga0070681_1000003719 108
46 3300005530 Ga0070679_100008411 Ga0070679_10000841119 108
47 3300006852 Ga0075433_11605667 Ga0075433_116056671 108
48 3300010375 Ga0105239_10005584 Ga0105239_100055844 108
49 3300013105 Ga0157369_11176015 Ga0157369_111760152 108
50 3300025912 Ga0207707_10000011 Ga0207707_1000001119 108
51 3300025917 Ga0207660_10003537 Ga0207660_1000353719 108
52 3300025921 Ga0207652_10000824 Ga0207652_1000082425 108
53 3300027907 Ga0207428_10760687 Ga0207428_107606872 108
54 3300050515 nmdc:mga0a205_171156_c1 nmdc:mga0a205_171156_c1_1691_2056 108
55 3300005618 Ga0068864_100366305 Ga0068864_1003663053 109
56 3300025921 Ga0207652_11446107 Ga0207652_114461072 109
57 3300049569 Ga0501032_0151835 Ga0501032_0151835_972_1328 109
58 3300049570 Ga0501033_0784380 Ga0501033_0784380_193_549 109
59 3300049571 Ga0501034_0588000 Ga0501034_0588000_285_641 109
60 3300049579 Ga0501043_0045694 Ga0501043_0045694_2712_3068 109
61 3300049581 Ga0501047_0002319 Ga0501047_0002319_9436_9792 109
62 3300049582 Ga0501048_0732607 Ga0501048_0732607_190_546 109
63 3300049589 Ga0501073_0255902 Ga0501073_0255902_480_836 109
64 3300049822 Ga0501035_0991956 Ga0501035_0991956_62_418 109
65 3300025921 Ga0207652_10563142 Ga0207652_105631422 110
66 3300035083 Ga0373926_0438532 Ga0373926_0438532_105_470 110
67 3300035089 Ga0373944_0332856 Ga0373944_0332856_158_523 110
68 3300035725 Ga0373947_0835731 Ga0373947_0835731_71_436 110
69 3300046681 Ga0495647_0035217 Ga0495647_0035217_969_1334 110
70 3300047471 Ga0495684_0303399 Ga0495684_0303399_590_955 110
71 3300021377 Ga0213874_10002785 Ga0213874_100027854 111
72 3300039450 Ga0436363_0427400 Ga0436363_0427400_2544_2900 111
73 3300005434 Ga0070709_10807109 Ga0070709_108071092 113
74 3300005435 Ga0070714_100911275 Ga0070714_1009112752 113
75 3300005436 Ga0070713_102368412 Ga0070713_1023684121 113
76 3300005441 Ga0070700_101777987 Ga0070700_1017779871 113
77 3300005563 Ga0068855_101740178 Ga0068855_1017401782 113
78 3300005614 Ga0068856_101982439 Ga0068856_1019824392 113
79 3300006175 Ga0070712_100113045 Ga0070712_1001130452 113
80 3300009093 Ga0105240_11080765 Ga0105240_110807652 113
81 3300009545 Ga0105237_10119273 Ga0105237_101192735 113
82 3300009551 Ga0105238_10322009 Ga0105238_103220092 113
83 3300009551 Ga0105238_10738831 Ga0105238_107388312 113
84 3300010375 Ga0105239_10026360 Ga0105239_1002636012 113
85 3300013307 Ga0157372_10066383 Ga0157372_100663836 113
86 3300021377 Ga0213874_10006777 Ga0213874_100067771 113
87 3300021384 Ga0213876_10000421 Ga0213876_1000042120 113
88 3300025913 Ga0207695_10753082 Ga0207695_107530822 113
89 3300025915 Ga0207693_10054085 Ga0207693_100540855 113
90 3300025928 Ga0207700_11621987 Ga0207700_116219872 113
91 3300025929 Ga0207664_10411486 Ga0207664_104114862 113
92 3300025934 Ga0207686_10826506 Ga0207686_108265062 113
93 3300025944 Ga0207661_11037548 Ga0207661_110375482 113
94 3300026078 Ga0207702_10791862 Ga0207702_107918622 113
95 3300028800 Ga0265338_10000401 Ga0265338_1000040159 113
96 3300031235 Ga0265330_10241361 Ga0265330_102413612 113
97 3300031241 Ga0265325_10183291 Ga0265325_101832912 113
98 3300031247 Ga0265340_10002869 Ga0265340_1000286912 113
99 3300031595 Ga0265313_10257425 Ga0265313_102574252 113
100 3300035083 Ga0373926_0376326 Ga0373926_0376326_43_405 113
101 3300035692 Ga0373935_0489250 Ga0373935_0489250_231_593 113
102 3300039437 Ga0436365_1637588 Ga0436365_1637588_24490_24837 113
103 3300039450 Ga0436363_1470856 Ga0436363_1470856_1938_2285 113
104 3300045976 Ga0466967_1373626 Ga0466967_1373626_260_607 113
105 3300046460 Ga0495638_0366879 Ga0495638_0366879_318_662 113
106 3300046473 Ga0495582_0532630 Ga0495582_0532630_178_540 113
107 3300047472 Ga0495686_0429040 Ga0495686_0429040_336_680 113
108 3300048089 Ga0495614_0272439 Ga0495614_0272439_107_469 113
109 3300049569 Ga0501032_0000374 Ga0501032_0000374_28772_29143 113
110 3300049569 Ga0501032_0178940 Ga0501032_0178940_169_513 113
111 3300049570 Ga0501033_0042785 Ga0501033_0042785_253_624 113
112 3300049570 Ga0501033_0048667 Ga0501033_0048667_2733_3077 113
113 3300049570 Ga0501033_0312057 Ga0501033_0312057_318_665 113
114 3300049572 Ga0501036_0158426 Ga0501036_0158426_421_792 113
115 3300049572 Ga0501036_0748769 Ga0501036_0748769_156_503 113
116 3300049573 Ga0501037_0000862 Ga0501037_0000862_15407_15778 113
117 3300049573 Ga0501037_0305201 Ga0501037_0305201_447_794 113
118 3300049573 Ga0501037_0396332 Ga0501037_0396332_80_427 113
119 3300049573 Ga0501037_0675967 Ga0501037_0675967_72_416 113
120 3300049574 Ga0501038_0116476 Ga0501038_0116476_679_1026 113
121 3300049574 Ga0501038_0131687 Ga0501038_0131687_773_1144 113
122 3300049575 Ga0501039_0797474 Ga0501039_0797474_365_712 113
123 3300049579 Ga0501043_0160092 Ga0501043_0160092_47_391 113
124 3300049579 Ga0501043_0228594 Ga0501043_0228594_19_366 113
125 3300049580 Ga0501046_0393012 Ga0501046_0393012_177_521 113
126 3300049581 Ga0501047_0033976 Ga0501047_0033976_2231_2575 113
127 3300049581 Ga0501047_0054048 Ga0501047_0054048_1433_1804 113
128 3300049581 Ga0501047_0375584 Ga0501047_0375584_574_921 113
129 3300049581 Ga0501047_0736199 Ga0501047_0736199_284_628 113
130 3300049582 Ga0501048_0476971 Ga0501048_0476971_262_633 113
131 3300049586 Ga0501070_0382617 Ga0501070_0382617_37_384 113
132 3300049744 Ga0501083_0425632 Ga0501083_0425632_229_576 113
133 3300049822 Ga0501035_0085166 Ga0501035_0085166_2420_2767 113
134 3300049822 Ga0501035_0667321 Ga0501035_0667321_131_478 113
135 3300049822 Ga0501035_0810133 Ga0501035_0810133_149_493 113
136 3300049823 Ga0501044_0061775 Ga0501044_0061775_79_450 113
137 3300049823 Ga0501044_0114803 Ga0501044_0114803_1420_1764 113
138 3300049823 Ga0501044_0456898 Ga0501044_0456898_408_752 113
139 3300049823 Ga0501044_0984593 Ga0501044_0984593_321_668 113
140 3300049823 Ga0501044_1281205 Ga0501044_1281205_38_382 113
141 3300053118 Ga0500594_0012014 Ga0500594_0012014_903_1247 113
142 3300053139 Ga0500568_0047421 Ga0500568_0047421_666_1010 113
143 3300005327 Ga0070658_10045521 Ga0070658_100455213 114
144 3300005327 Ga0070658_10201223 Ga0070658_102012233 114
145 3300005328 Ga0070676_10079075 Ga0070676_100790753 114
146 3300005328 Ga0070676_10461749 Ga0070676_104617491 114
147 3300005329 Ga0070683_100187688 Ga0070683_1001876884 114
148 3300005330 Ga0070690_100611209 Ga0070690_1006112092 114
149 3300005331 Ga0070670_100641089 Ga0070670_1006410892 114
150 3300005334 Ga0068869_100070091 Ga0068869_1000700913 114
151 3300005334 Ga0068869_101484553 Ga0068869_1014845531 114
152 3300005335 Ga0070666_10007106 Ga0070666_100071067 114
153 3300005335 Ga0070666_10693408 Ga0070666_106934081 114
154 3300005336 Ga0070680_100072787 Ga0070680_1000727871 114
155 3300005336 Ga0070680_100078879 Ga0070680_1000788795 114
156 3300005338 Ga0068868_100153898 Ga0068868_1001538982 114
157 3300005339 Ga0070660_100108074 Ga0070660_1001080743 114
158 3300005339 Ga0070660_100174288 Ga0070660_1001742882 114
159 3300005341 Ga0070691_10149346 Ga0070691_101493462 114
160 3300005341 Ga0070691_10342674 Ga0070691_103426742 114
161 3300005343 Ga0070687_101055869 Ga0070687_1010558691 114
162 3300005344 Ga0070661_100005946 Ga0070661_1000059462 114
163 3300005344 Ga0070661_100258902 Ga0070661_1002589022 114
164 3300005344 Ga0070661_101407850 Ga0070661_1014078501 114
165 3300005355 Ga0070671_100343504 Ga0070671_1003435042 114
166 3300005356 Ga0070674_102070568 Ga0070674_1020705681 114
167 3300005364 Ga0070673_100588849 Ga0070673_1005888491 114
168 3300005365 Ga0070688_100357639 Ga0070688_1003576391 114
169 3300005365 Ga0070688_100542982 Ga0070688_1005429822 114
170 3300005366 Ga0070659_100027373 Ga0070659_1000273733 114
171 3300005366 Ga0070659_100753457 Ga0070659_1007534571 114
172 3300005366 Ga0070659_101495690 Ga0070659_1014956902 114
173 3300005367 Ga0070667_100061525 Ga0070667_1000615254 114
174 3300005367 Ga0070667_100349423 Ga0070667_1003494232 114
175 3300005434 Ga0070709_10171867 Ga0070709_101718672 114
176 3300005435 Ga0070714_100109782 Ga0070714_1001097824 114
177 3300005435 Ga0070714_101129934 Ga0070714_1011299342 114
178 3300005435 Ga0070714_102064040 Ga0070714_1020640401 114
179 3300005436 Ga0070713_100213904 Ga0070713_1002139043 114
180 3300005436 Ga0070713_100815448 Ga0070713_1008154482 114
181 3300005437 Ga0070710_10393052 Ga0070710_103930522 114
182 3300005438 Ga0070701_10424525 Ga0070701_104245252 114
183 3300005456 Ga0070678_101678149 Ga0070678_1016781491 114
184 3300005458 Ga0070681_10034634 Ga0070681_100346344 114
185 3300005458 Ga0070681_10160044 Ga0070681_101600444 114
186 3300005458 Ga0070681_11029384 Ga0070681_110293842 114
187 3300005459 Ga0068867_100091706 Ga0068867_1000917061 114
188 3300005466 Ga0070685_11293727 Ga0070685_112937272 114
189 3300005530 Ga0070679_100064794 Ga0070679_1000647943 114
190 3300005530 Ga0070679_100365821 Ga0070679_1003658212 114
191 3300005535 Ga0070684_100375804 Ga0070684_1003758042 114
192 3300005539 Ga0068853_100246161 Ga0068853_1002461612 114
193 3300005539 Ga0068853_100436108 Ga0068853_1004361082 114
194 3300005539 Ga0068853_100714452 Ga0068853_1007144522 114
195 3300005539 Ga0068853_101038291 Ga0068853_1010382912 114
196 3300005544 Ga0070686_100311002 Ga0070686_1003110022 114
197 3300005547 Ga0070693_100529106 Ga0070693_1005291061 114
198 3300005547 Ga0070693_100815729 Ga0070693_1008157291 114
199 3300005548 Ga0070665_100023111 Ga0070665_1000231112 114
200 3300005548 Ga0070665_100074982 Ga0070665_1000749825 114
201 3300005548 Ga0070665_100966759 Ga0070665_1009667592 114
202 3300005548 Ga0070665_101010898 Ga0070665_1010108982 114
203 3300005563 Ga0068855_100121416 Ga0068855_1001214165 114
204 3300005563 Ga0068855_100135692 Ga0068855_1001356922 114
205 3300005577 Ga0068857_100403718 Ga0068857_1004037183 114
206 3300005614 Ga0068856_100263376 Ga0068856_1002633762 114
207 3300005614 Ga0068856_101040321 Ga0068856_1010403212 114
208 3300005614 Ga0068856_101808191 Ga0068856_1018081912 114
209 3300005615 Ga0070702_100299022 Ga0070702_1002990222 114
210 3300005719 Ga0068861_101214834 Ga0068861_1012148342 114
211 3300005834 Ga0068851_10581298 Ga0068851_105812982 114
212 3300005840 Ga0068870_10119202 Ga0068870_101192022 114
213 3300006175 Ga0070712_100708750 Ga0070712_1007087502 114
214 3300006175 Ga0070712_102059527 Ga0070712_1020595272 114
215 3300006237 Ga0097621_100223165 Ga0097621_1002231652 114
216 3300006237 Ga0097621_100433566 Ga0097621_1004335662 114
217 3300006358 Ga0068871_100301487 Ga0068871_1003014873 114
218 3300006881 Ga0068865_100480540 Ga0068865_1004805402 114
219 3300006881 Ga0068865_100700100 Ga0068865_1007001002 114
220 3300009093 Ga0105240_10004232 Ga0105240_1000423210 114
221 3300009093 Ga0105240_10025381 Ga0105240_100253814 114
222 3300009093 Ga0105240_10571025 Ga0105240_105710252 114
223 3300009093 Ga0105240_10604944 Ga0105240_106049442 114
224 3300009093 Ga0105240_10675787 Ga0105240_106757873 114
225 3300009093 Ga0105240_10772790 Ga0105240_107727902 114
226 3300009093 Ga0105240_11336885 Ga0105240_113368852 114
227 3300009094 Ga0111539_11031310 Ga0111539_110313102 114
228 3300009098 Ga0105245_10230243 Ga0105245_102302433 114
229 3300009148 Ga0105243_10014172 Ga0105243_100141725 114
230 3300009174 Ga0105241_11448434 Ga0105241_114484342 114
231 3300009176 Ga0105242_12440001 Ga0105242_124400012 114
232 3300009177 Ga0105248_10047589 Ga0105248_100475894 114
233 3300009177 Ga0105248_12302871 Ga0105248_123028711 114
234 3300009177 Ga0105248_12583146 Ga0105248_125831462 114
235 3300009545 Ga0105237_10209530 Ga0105237_102095304 114
236 3300009545 Ga0105237_11218230 Ga0105237_112182302 114
237 3300009551 Ga0105238_10130022 Ga0105238_101300224 114
238 3300009551 Ga0105238_10414574 Ga0105238_104145742 114
239 3300009551 Ga0105238_11356864 Ga0105238_113568642 114
240 3300009551 Ga0105238_12443639 Ga0105238_124436392 114
241 3300010375 Ga0105239_10210784 Ga0105239_102107844 114
242 3300010375 Ga0105239_10243523 Ga0105239_102435234 114
243 3300010375 Ga0105239_10259863 Ga0105239_102598632 114
244 3300010375 Ga0105239_10600711 Ga0105239_106007112 114
245 3300010375 Ga0105239_12895017 Ga0105239_128950171 114
246 3300011119 Ga0105246_10224000 Ga0105246_102240002 114
247 3300013100 Ga0157373_10565824 Ga0157373_105658241 114
248 3300013104 Ga0157370_10035566 Ga0157370_1003556610 114
249 3300013104 Ga0157370_10083851 Ga0157370_100838512 114
250 3300013104 Ga0157370_11553340 Ga0157370_115533401 114
251 3300013104 Ga0157370_11772634 Ga0157370_117726341 114
252 3300013105 Ga0157369_10345530 Ga0157369_103455303 114
253 3300013105 Ga0157369_11997704 Ga0157369_119977041 114
254 3300013296 Ga0157374_10646962 Ga0157374_106469622 114
255 3300013306 Ga0163162_12018637 Ga0163162_120186372 114
256 3300013308 Ga0157375_11964069 Ga0157375_119640692 114
257 3300014325 Ga0163163_10008003 Ga0163163_100080033 114
258 3300014325 Ga0163163_12859732 Ga0163163_128597322 114
259 3300014326 Ga0157380_10294611 Ga0157380_102946114 114
260 3300014326 Ga0157380_10662266 Ga0157380_106622662 114
261 3300014326 Ga0157380_11951378 Ga0157380_119513781 114
262 3300014968 Ga0157379_10052289 Ga0157379_100522895 114
263 3300014968 Ga0157379_11504263 Ga0157379_115042631 114
264 3300014969 Ga0157376_10311850 Ga0157376_103118502 114
265 3300014969 Ga0157376_10667399 Ga0157376_106673992 114
266 3300021441 Ga0213871_10090741 Ga0213871_100907412 114
267 3300025893 Ga0207682_10501077 Ga0207682_105010772 114
268 3300025899 Ga0207642_11000576 Ga0207642_110005762 114
269 3300025901 Ga0207688_10572743 Ga0207688_105727432 114
270 3300025903 Ga0207680_10002564 Ga0207680_100025647 114
271 3300025907 Ga0207645_10011392 Ga0207645_100113926 114
272 3300025907 Ga0207645_10058297 Ga0207645_100582972 114
273 3300025908 Ga0207643_10030805 Ga0207643_100308056 114
274 3300025909 Ga0207705_10004720 Ga0207705_1000472019 114
275 3300025909 Ga0207705_10194396 Ga0207705_101943962 114
276 3300025911 Ga0207654_10324382 Ga0207654_103243822 114
277 3300025911 Ga0207654_10796686 Ga0207654_107966862 114
278 3300025911 Ga0207654_10976002 Ga0207654_109760022 114
279 3300025912 Ga0207707_10048827 Ga0207707_100488275 114
280 3300025912 Ga0207707_11449952 Ga0207707_114499522 114
281 3300025913 Ga0207695_10028316 Ga0207695_100283166 114
282 3300025913 Ga0207695_10040352 Ga0207695_100403526 114
283 3300025913 Ga0207695_10128661 Ga0207695_101286614 114
284 3300025913 Ga0207695_10383850 Ga0207695_103838502 114
285 3300025913 Ga0207695_10592654 Ga0207695_105926542 114
286 3300025913 Ga0207695_10926468 Ga0207695_109264682 114
287 3300025913 Ga0207695_11234151 Ga0207695_112341512 114
288 3300025917 Ga0207660_10181434 Ga0207660_101814343 114
289 3300025919 Ga0207657_10196503 Ga0207657_101965032 114
290 3300025919 Ga0207657_10350346 Ga0207657_103503462 114
291 3300025919 Ga0207657_10586738 Ga0207657_105867382 114
292 3300025920 Ga0207649_10000194 Ga0207649_1000019453 114
293 3300025920 Ga0207649_11153903 Ga0207649_111539032 114
294 3300025921 Ga0207652_10115732 Ga0207652_101157323 114
295 3300025921 Ga0207652_10115916 Ga0207652_101159162 114
296 3300025921 Ga0207652_10532647 Ga0207652_105326472 114
297 3300025924 Ga0207694_10026889 Ga0207694_100268892 114
298 3300025924 Ga0207694_10187378 Ga0207694_101873781 114
299 3300025924 Ga0207694_10353215 Ga0207694_103532152 114
300 3300025924 Ga0207694_10494689 Ga0207694_104946892 114
301 3300025924 Ga0207694_10503302 Ga0207694_105033022 114
302 3300025924 Ga0207694_11107393 Ga0207694_111073932 114
303 3300025927 Ga0207687_10085895 Ga0207687_100858952 114
304 3300025928 Ga0207700_11055403 Ga0207700_110554032 114
305 3300025929 Ga0207664_10073108 Ga0207664_100731084 114
306 3300025929 Ga0207664_10316183 Ga0207664_103161832 114
307 3300025932 Ga0207690_10109672 Ga0207690_101096722 114
308 3300025932 Ga0207690_10627877 Ga0207690_106278772 114
309 3300025934 Ga0207686_10073147 Ga0207686_100731473 114
310 3300025934 Ga0207686_10410361 Ga0207686_104103612 114
311 3300025935 Ga0207709_10154513 Ga0207709_101545132 114
312 3300025937 Ga0207669_10045989 Ga0207669_100459895 114
313 3300025938 Ga0207704_10546716 Ga0207704_105467162 114
314 3300025941 Ga0207711_10145656 Ga0207711_101456562 114
315 3300025941 Ga0207711_10662390 Ga0207711_106623902 114
316 3300025941 Ga0207711_10676633 Ga0207711_106766332 114
317 3300025942 Ga0207689_10127211 Ga0207689_101272113 114
318 3300025945 Ga0207679_10438436 Ga0207679_104384362 114
319 3300025949 Ga0207667_10046421 Ga0207667_100464212 114
320 3300025949 Ga0207667_10052391 Ga0207667_100523911 114
321 3300025960 Ga0207651_10382910 Ga0207651_103829103 114
322 3300025986 Ga0207658_10058513 Ga0207658_100585135 114
323 3300026023 Ga0207677_10561974 Ga0207677_105619742 114
324 3300026023 Ga0207677_11486330 Ga0207677_114863301 114
325 3300026041 Ga0207639_10211849 Ga0207639_102118494 114
326 3300026041 Ga0207639_10482726 Ga0207639_104827262 114
327 3300026078 Ga0207702_10221951 Ga0207702_102219514 114
328 3300026078 Ga0207702_10831347 Ga0207702_108313472 114
329 3300026078 Ga0207702_10956846 Ga0207702_109568462 114
330 3300026089 Ga0207648_10120491 Ga0207648_101204915 114
331 3300026095 Ga0207676_10596303 Ga0207676_105963032 114
332 3300026116 Ga0207674_10192958 Ga0207674_101929583 114
333 3300026116 Ga0207674_11200466 Ga0207674_112004662 114
334 3300026121 Ga0207683_11450214 Ga0207683_114502142 114
335 3300028379 Ga0268266_10000557 Ga0268266_1000055719 114
336 3300028379 Ga0268266_10095842 Ga0268266_100958425 114
337 3300028379 Ga0268266_10320511 Ga0268266_103205112 114
338 3300028379 Ga0268266_10816058 Ga0268266_108160582 114
339 3300028379 Ga0268266_11197779 Ga0268266_111977792 114
340 3300028380 Ga0268265_10229757 Ga0268265_102297572 114
341 3300028556 Ga0265337_1129141 Ga0265337_11291412 114
342 3300028800 Ga0265338_10002896 Ga0265338_1000289628 114
343 3300028800 Ga0265338_10315488 Ga0265338_103154882 114
344 3300031235 Ga0265330_10074125 Ga0265330_100741253 114
345 3300031235 Ga0265330_10222495 Ga0265330_102224952 114
346 3300031235 Ga0265330_10304052 Ga0265330_103040522 114
347 3300031238 Ga0265332_10071412 Ga0265332_100714122 114
348 3300031238 Ga0265332_10109358 Ga0265332_101093582 114
349 3300031238 Ga0265332_10226366 Ga0265332_102263662 114
350 3300031240 Ga0265320_10002069 Ga0265320_1000206910 114
351 3300031241 Ga0265325_10026992 Ga0265325_100269927 114
352 3300031241 Ga0265325_10113161 Ga0265325_101131612 114
353 3300031241 Ga0265325_10232718 Ga0265325_102327182 114
354 3300031241 Ga0265325_10360964 Ga0265325_103609642 114
355 3300031242 Ga0265329_10105250 Ga0265329_101052502 114
356 3300031247 Ga0265340_10038201 Ga0265340_100382011 114
357 3300031247 Ga0265340_10196059 Ga0265340_101960592 114
358 3300031249 Ga0265339_10104553 Ga0265339_101045532 114
359 3300031249 Ga0265339_10306913 Ga0265339_103069131 114
360 3300031250 Ga0265331_10000186 Ga0265331_1000018642 114
361 3300031250 Ga0265331_10003502 Ga0265331_1000350213 114
362 3300031250 Ga0265331_10013838 Ga0265331_100138388 114
363 3300031250 Ga0265331_10022887 Ga0265331_100228874 114
364 3300031250 Ga0265331_10037988 Ga0265331_100379882 114
365 3300031250 Ga0265331_10135994 Ga0265331_101359941 114
366 3300031251 Ga0265327_10000392 Ga0265327_10000392119 114
367 3300031344 Ga0265316_10025355 Ga0265316_100253553 114
368 3300031344 Ga0265316_10044806 Ga0265316_100448063 114
369 3300031344 Ga0265316_10086571 Ga0265316_100865714 114
370 3300031344 Ga0265316_10186060 Ga0265316_101860602 114
371 3300031344 Ga0265316_10488220 Ga0265316_104882202 114
372 3300031344 Ga0265316_10505152 Ga0265316_105051522 114
373 3300031344 Ga0265316_10889279 Ga0265316_108892792 114
374 3300031344 Ga0265316_10909968 Ga0265316_109099682 114
375 3300031595 Ga0265313_10012941 Ga0265313_100129414 114
376 3300031595 Ga0265313_10086987 Ga0265313_100869872 114
377 3300031616 Ga0307508_10339899 Ga0307508_103398992 114
378 3300031665 Ga0316575_10019455 Ga0316575_100194556 114
379 3300031711 Ga0265314_10000963 Ga0265314_100009633 114
380 3300031711 Ga0265314_10041547 Ga0265314_100415472 114
381 3300031711 Ga0265314_10056619 Ga0265314_100566191 114
382 3300031711 Ga0265314_10059830 Ga0265314_100598305 114
383 3300031711 Ga0265314_10060354 Ga0265314_100603545 114
384 3300031711 Ga0265314_10077885 Ga0265314_100778855 114
385 3300031711 Ga0265314_10157550 Ga0265314_101575502 114
386 3300031711 Ga0265314_10261666 Ga0265314_102616662 114
387 3300031711 Ga0265314_10398461 Ga0265314_103984612 114
388 3300031711 Ga0265314_10537414 Ga0265314_105374142 114
389 3300031712 Ga0265342_10072247 Ga0265342_100722472 114
390 3300031712 Ga0265342_10086258 Ga0265342_100862582 114
391 3300031712 Ga0265342_10204740 Ga0265342_102047402 114
392 3300031712 Ga0265342_10418404 Ga0265342_104184041 114
393 3300031712 Ga0265342_10613447 Ga0265342_106134471 114
394 3300031712 Ga0265342_10705073 Ga0265342_107050732 114
395 3300031730 Ga0307516_10069198 Ga0307516_100691987 114
396 3300035111 Ga0373923_0655767 Ga0373923_0655767_133_480 114
397 3300035113 Ga0373936_0187142 Ga0373936_0187142_121_468 114
398 3300035172 Ga0373955_0236450 Ga0373955_0236450_230_580 114
399 3300035695 Ga0373927_0484655 Ga0373927_0484655_151_501 114
400 3300035724 Ga0373933_0484017 Ga0373933_0484017_374_724 114
401 3300036401 Ga0373937_0070199 Ga0373937_0070199_1251_1601 114
402 3300036401 Ga0373937_0190143 Ga0373937_0190143_590_940 114
403 3300037418 Ga0395900_0098142 Ga0395900_0098142_976_1326 114
404 3300037466 Ga0395898_0359028 Ga0395898_0359028_311_661 114
405 3300037471 Ga0395905_0904095 Ga0395905_0904095_235_582 114
406 3300038443 Ga0395901_1554232 Ga0395901_1554232_180_527 114
407 3300039438 Ga0436360_0360048 Ga0436360_0360048_380_727 114
408 3300039438 Ga0436360_0716296 Ga0436360_0716296_620_967 114
409 3300039450 Ga0436363_0896516 Ga0436363_0896516_656_1006 114
410 3300039450 Ga0436363_1234183 Ga0436363_1234183_411_758 114
411 3300044694 Ga0466963_0654836 Ga0466963_0654836_97_444 114
412 3300044694 Ga0466963_1080032 Ga0466963_1080032_128_478 114
413 3300044842 Ga0466957_0134071 Ga0466957_0134071_225_572 114
414 3300045049 Ga0466959_1068813 Ga0466959_1068813_116_463 114
415 3300045976 Ga0466967_0059567 Ga0466967_0059567_2014_2361 114
416 3300046454 Ga0495592_0176228 Ga0495592_0176228_303_650 114
417 3300046454 Ga0495592_0737513 Ga0495592_0737513_26_373 114
418 3300046463 Ga0495653_0881506 Ga0495653_0881506_18_365 114
419 3300046473 Ga0495582_0653216 Ga0495582_0653216_85_432 114
420 3300046474 Ga0495605_0155621 Ga0495605_0155621_269_616 114
421 3300046476 Ga0495662_0094538 Ga0495662_0094538_870_1217 114
422 3300046511 Ga0495608_0843667 Ga0495608_0843667_118_465 114
423 3300046516 Ga0495628_0094702 Ga0495628_0094702_294_641 114
424 3300046517 Ga0495630_0440961 Ga0495630_0440961_298_648 114
425 3300046517 Ga0495630_0720911 Ga0495630_0720911_225_575 114
426 3300046530 Ga0495654_0052557 Ga0495654_0052557_1513_1860 114
427 3300046535 Ga0495586_0076681 Ga0495586_0076681_1319_1669 114
428 3300046536 Ga0495587_0166062 Ga0495587_0166062_539_889 114
429 3300046536 Ga0495587_0204496 Ga0495587_0204496_354_701 114
430 3300046536 Ga0495587_0483584 Ga0495587_0483584_136_483 114
431 3300046543 Ga0495645_0410490 Ga0495645_0410490_474_824 114
432 3300046557 Ga0495622_0003379 Ga0495622_0003379_3746_4093 114
433 3300046559 Ga0495667_0525319 Ga0495667_0525319_322_672 114
434 3300046616 Ga0495668_0516729 Ga0495668_0516729_74_421 114
435 3300046675 Ga0495657_0725526 Ga0495657_0725526_24_374 114
436 3300046679 Ga0495623_0242409 Ga0495623_0242409_143_490 114
437 3300046679 Ga0495623_0386276 Ga0495623_0386276_284_631 114
438 3300046680 Ga0495646_0447941 Ga0495646_0447941_307_654 114
439 3300046683 Ga0495658_0529345 Ga0495658_0529345_158_508 114
440 3300046684 Ga0495669_0166595 Ga0495669_0166595_620_967 114
441 3300046689 Ga0495613_0311412 Ga0495613_0311412_488_835 114
442 3300046794 Ga0495589_0093052 Ga0495589_0093052_195_542 114
443 3300046809 Ga0495600_0808155 Ga0495600_0808155_128_475 114
444 3300047317 Ga0495604_0810753 Ga0495604_0810753_122_469 114
445 3300047319 Ga0495674_0361879 Ga0495674_0361879_268_618 114
446 3300047319 Ga0495674_0769576 Ga0495674_0769576_259_606 114
447 3300047323 Ga0495683_0134375 Ga0495683_0134375_66_413 114
448 3300047444 Ga0495675_0269418 Ga0495675_0269418_392_739 114
449 3300047471 Ga0495684_0119581 Ga0495684_0119581_496_846 114
450 3300047673 Ga0495593_0131793 Ga0495593_0131793_558_905 114
451 3300047673 Ga0495593_0163719 Ga0495593_0163719_339_686 114
452 3300048088 Ga0495602_0175950 Ga0495602_0175950_670_1017 114
453 3300048088 Ga0495602_0838259 Ga0495602_0838259_257_604 114
454 3300048918 Ga0496115_0490803 Ga0496115_0490803_411_761 114
455 3300048929 Ga0496126_0000480 Ga0496126_0000480_21688_22038 114
456 3300049568 Ga0501031_0068962 Ga0501031_0068962_943_1290 114
457 3300049568 Ga0501031_0093984 Ga0501031_0093984_56_406 114
458 3300049569 Ga0501032_0004362 Ga0501032_0004362_5603_5950 114
459 3300049569 Ga0501032_0059736 Ga0501032_0059736_460_810 114
460 3300049570 Ga0501033_0012240 Ga0501033_0012240_2666_3016 114
461 3300049570 Ga0501033_0036296 Ga0501033_0036296_3248_3595 114
462 3300049570 Ga0501033_0371078 Ga0501033_0371078_173_520 114
463 3300049570 Ga0501033_0678126 Ga0501033_0678126_75_422 114
464 3300049571 Ga0501034_0010632 Ga0501034_0010632_7369_7716 114
465 3300049571 Ga0501034_0027593 Ga0501034_0027593_845_1195 114
466 3300049571 Ga0501034_0091835 Ga0501034_0091835_2604_2951 114
467 3300049571 Ga0501034_0133506 Ga0501034_0133506_754_1101 114
468 3300049571 Ga0501034_0171039 Ga0501034_0171039_1095_1442 114
469 3300049571 Ga0501034_0251625 Ga0501034_0251625_879_1226 114
470 3300049571 Ga0501034_0634386 Ga0501034_0634386_521_868 114
471 3300049571 Ga0501034_0901392 Ga0501034_0901392_271_618 114
472 3300049572 Ga0501036_0005653 Ga0501036_0005653_7956_8303 114
473 3300049572 Ga0501036_0880700 Ga0501036_0880700_200_547 114
474 3300049573 Ga0501037_0024753 Ga0501037_0024753_2815_3162 114
475 3300049573 Ga0501037_0441735 Ga0501037_0441735_363_710 114
476 3300049574 Ga0501038_0088134 Ga0501038_0088134_1279_1626 114
477 3300049574 Ga0501038_0147189 Ga0501038_0147189_318_665 114
478 3300049574 Ga0501038_0298230 Ga0501038_0298230_334_684 114
479 3300049574 Ga0501038_0349287 Ga0501038_0349287_629_976 114
480 3300049575 Ga0501039_0019053 Ga0501039_0019053_4568_4915 114
481 3300049575 Ga0501039_0222759 Ga0501039_0222759_294_641 114
482 3300049578 Ga0501042_0098300 Ga0501042_0098300_264_611 114
483 3300049578 Ga0501042_0766414 Ga0501042_0766414_78_425 114
484 3300049579 Ga0501043_0010388 Ga0501043_0010388_1377_1724 114
485 3300049579 Ga0501043_0014584 Ga0501043_0014584_4104_4454 114
486 3300049579 Ga0501043_0097012 Ga0501043_0097012_691_1038 114
487 3300049579 Ga0501043_0539165 Ga0501043_0539165_455_802 114
488 3300049580 Ga0501046_0005416 Ga0501046_0005416_5491_5838 114
489 3300049580 Ga0501046_0011762 Ga0501046_0011762_4970_5320 114
490 3300049580 Ga0501046_0012992 Ga0501046_0012992_6407_6754 114
491 3300049580 Ga0501046_0560881 Ga0501046_0560881_248_598 114
492 3300049580 Ga0501046_0845046 Ga0501046_0845046_245_592 114
493 3300049581 Ga0501047_0014860 Ga0501047_0014860_6676_7023 114
494 3300049581 Ga0501047_0037637 Ga0501047_0037637_59_409 114
495 3300049581 Ga0501047_0065087 Ga0501047_0065087_2934_3281 114
496 3300049581 Ga0501047_0131220 Ga0501047_0131220_1403_1750 114
497 3300049581 Ga0501047_0171826 Ga0501047_0171826_681_1031 114
498 3300049581 Ga0501047_0176653 Ga0501047_0176653_625_972 114
499 3300049581 Ga0501047_0251827 Ga0501047_0251827_581_928 114
500 3300049581 Ga0501047_0441537 Ga0501047_0441537_141_491 114
501 3300049582 Ga0501048_0023812 Ga0501048_0023812_393_740 114
502 3300049582 Ga0501048_0209717 Ga0501048_0209717_440_787 114
503 3300049582 Ga0501048_0749050 Ga0501048_0749050_20_370 114
504 3300049583 Ga0501067_0001776 Ga0501067_0001776_3465_3812 114
505 3300049584 Ga0501068_0077512 Ga0501068_0077512_603_953 114
506 3300049585 Ga0501069_0022165 Ga0501069_0022165_1064_1411 114
507 3300049586 Ga0501070_0014964 Ga0501070_0014964_2739_3086 114
508 3300049586 Ga0501070_0143912 Ga0501070_0143912_612_962 114
509 3300049587 Ga0501071_0156932 Ga0501071_0156932_847_1194 114
510 3300049588 Ga0501072_0097056 Ga0501072_0097056_1814_2161 114
511 3300049589 Ga0501073_0001669 Ga0501073_0001669_11651_11998 114
512 3300049589 Ga0501073_0036603 Ga0501073_0036603_3098_3445 114
513 3300049589 Ga0501073_0059886 Ga0501073_0059886_1126_1476 114
514 3300049589 Ga0501073_0070275 Ga0501073_0070275_1141_1488 114
515 3300049590 Ga0501074_0004453 Ga0501074_0004453_1800_2147 114
516 3300049590 Ga0501074_0079197 Ga0501074_0079197_1402_1752 114
517 3300049741 Ga0501079_0001478 Ga0501079_0001478_8008_8355 114
518 3300049741 Ga0501079_0140727 Ga0501079_0140727_819_1169 114
519 3300049742 Ga0501080_0040364 Ga0501080_0040364_570_917 114
520 3300049742 Ga0501080_0125187 Ga0501080_0125187_944_1291 114
521 3300049742 Ga0501080_0596113 Ga0501080_0596113_320_670 114
522 3300049742 Ga0501080_0675815 Ga0501080_0675815_466_813 114
523 3300049744 Ga0501083_0052937 Ga0501083_0052937_1970_2317 114
524 3300049744 Ga0501083_0135923 Ga0501083_0135923_1185_1535 114
525 3300049822 Ga0501035_0019622 Ga0501035_0019622_3841_4188 114
526 3300049822 Ga0501035_0044851 Ga0501035_0044851_2089_2436 114
527 3300049822 Ga0501035_0048543 Ga0501035_0048543_310_660 114
528 3300049822 Ga0501035_0368131 Ga0501035_0368131_293_640 114
529 3300049822 Ga0501035_0936218 Ga0501035_0936218_110_457 114
530 3300049823 Ga0501044_0015755 Ga0501044_0015755_2223_2573 114
531 3300049823 Ga0501044_0024878 Ga0501044_0024878_1307_1654 114
532 3300049823 Ga0501044_0027898 Ga0501044_0027898_106_453 114
533 3300049823 Ga0501044_0129184 Ga0501044_0129184_972_1319 114
534 3300049823 Ga0501044_0161480 Ga0501044_0161480_870_1217 114
535 3300049823 Ga0501044_1519932 Ga0501044_1519932_114_461 114
536 3300049824 Ga0501045_0626636 Ga0501045_0626636_331_678 114
537 3300053080 Ga0500635_0307042 Ga0500635_0307042_53_400 114
538 3300053103 Ga0500555_039510 Ga0500555_039510_584_931 114
539 3300053119 Ga0500595_001661 Ga0500595_001661_2283_2630 114
540 3300053119 Ga0500595_142011 Ga0500595_142011_118_465 114
541 3300053119 Ga0500595_163432 Ga0500595_163432_126_473 114
542 3300053136 Ga0500559_0087609 Ga0500559_0087609_1042_1389 114
543 3300054114 Ga0501084_0007620 Ga0501084_0007620_3458_3805 114
544 3300060353 Ga0501082_0006964 Ga0501082_0006964_5579_5926 114
545 3300060353 Ga0501082_0069701 Ga0501082_0069701_2060_2410 114
546 iso_pu_bacteria 2917554339 2917555115 114
547 3300009551 Ga0105238_10000180 Ga0105238_1000018022 115
548 3300025924 Ga0207694_10137313 Ga0207694_101373132 115
549 3300005336 Ga0070680_101241173 Ga0070680_1012411731 116
550 3300005343 Ga0070687_100270438 Ga0070687_1002704382 116
551 3300005436 Ga0070713_100558156 Ga0070713_1005581562 116
552 3300005441 Ga0070700_101025593 Ga0070700_1010255932 116
553 3300005535 Ga0070684_101079606 Ga0070684_1010796062 116
554 3300005539 Ga0068853_100101796 Ga0068853_1001017966 116
555 3300005547 Ga0070693_101552370 Ga0070693_1015523701 116
556 3300005563 Ga0068855_100000385 Ga0068855_1000003859 116
557 3300005616 Ga0068852_100393106 Ga0068852_1003931063 116
558 3300006177 Ga0075362_10170480 Ga0075362_101704802 116
559 3300006178 Ga0075367_10068073 Ga0075367_100680735 116
560 3300006195 Ga0075366_10016744 Ga0075366_100167442 116
561 3300006237 Ga0097621_100712378 Ga0097621_1007123782 116
562 3300006844 Ga0075428_102279109 Ga0075428_1022791092 116
563 3300006846 Ga0075430_100194948 Ga0075430_1001949483 116
564 3300006846 Ga0075430_100589606 Ga0075430_1005896062 116
565 3300006847 Ga0075431_100116845 Ga0075431_1001168452 116
566 3300006880 Ga0075429_100450246 Ga0075429_1004502462 116
567 3300009093 Ga0105240_10004696 Ga0105240_1000469617 116
568 3300009094 Ga0111539_10023579 Ga0111539_100235799 116
569 3300009098 Ga0105245_10394924 Ga0105245_103949243 116
570 3300009101 Ga0105247_10056711 Ga0105247_100567114 116
571 3300009174 Ga0105241_10609598 Ga0105241_106095982 116
572 3300009174 Ga0105241_10783792 Ga0105241_107837922 116
573 3300009176 Ga0105242_10546840 Ga0105242_105468402 116
574 3300009177 Ga0105248_10000005 Ga0105248_1000000519 116
575 3300009177 Ga0105248_10256549 Ga0105248_102565492 116
576 3300009177 Ga0105248_10900403 Ga0105248_109004032 116
577 3300009545 Ga0105237_10158271 Ga0105237_101582713 116
578 3300009545 Ga0105237_10181890 Ga0105237_101818905 116
579 3300009545 Ga0105237_12150218 Ga0105237_121502182 116
580 3300009551 Ga0105238_10055822 Ga0105238_100558223 116
581 3300010375 Ga0105239_10018317 Ga0105239_100183172 116
582 3300010375 Ga0105239_10073553 Ga0105239_100735534 116
583 3300011119 Ga0105246_11855237 Ga0105246_118552372 116
584 3300013105 Ga0157369_10033188 Ga0157369_100331885 116
585 3300013296 Ga0157374_10000420 Ga0157374_1000042031 116
586 3300013297 Ga0157378_10506627 Ga0157378_105066272 116
587 3300013297 Ga0157378_11303016 Ga0157378_113030162 116
588 3300014325 Ga0163163_11434683 Ga0163163_114346832 116
589 3300014325 Ga0163163_12791848 Ga0163163_127918481 116
590 3300014969 Ga0157376_10917251 Ga0157376_109172512 116
591 3300014969 Ga0157376_12671508 Ga0157376_126715081 116
592 3300021384 Ga0213876_10003189 Ga0213876_1000318919 116
593 3300025911 Ga0207654_10172361 Ga0207654_101723612 116
594 3300025911 Ga0207654_10724010 Ga0207654_107240102 116
595 3300025911 Ga0207654_10893363 Ga0207654_108933632 116
596 3300025913 Ga0207695_10000018 Ga0207695_1000001845 116
597 3300025913 Ga0207695_10217861 Ga0207695_102178613 116
598 3300025913 Ga0207695_10950391 Ga0207695_109503912 116
599 3300025914 Ga0207671_10538073 Ga0207671_105380732 116
600 3300025914 Ga0207671_11087401 Ga0207671_110874012 116
601 3300025915 Ga0207693_10266868 Ga0207693_102668682 116
602 3300025917 Ga0207660_10995112 Ga0207660_109951122 116
603 3300025918 Ga0207662_10413604 Ga0207662_104136042 116
604 3300025920 Ga0207649_10486227 Ga0207649_104862272 116
605 3300025924 Ga0207694_10000010 Ga0207694_10000010367 116
606 3300025927 Ga0207687_10525782 Ga0207687_105257821 116
607 3300025934 Ga0207686_10373895 Ga0207686_103738952 116
608 3300025941 Ga0207711_10000002 Ga0207711_1000000219 116
609 3300025941 Ga0207711_11036108 Ga0207711_110361081 116
610 3300025949 Ga0207667_10000388 Ga0207667_1000038856 116
611 3300026041 Ga0207639_10000867 Ga0207639_100008676 116
612 3300026095 Ga0207676_12030203 Ga0207676_120302031 116
613 3300026142 Ga0207698_10042447 Ga0207698_100424475 116
614 3300026142 Ga0207698_10086858 Ga0207698_100868582 116
615 3300027907 Ga0207428_11179480 Ga0207428_111794801 116
616 3300028381 Ga0268264_12447937 Ga0268264_124479372 116
617 3300028558 Ga0265326_10073781 Ga0265326_100737812 116
618 3300028800 Ga0265338_10000017 Ga0265338_10000017294 116
619 3300030521 Ga0307511_10224989 Ga0307511_102249892 116
620 3300030521 Ga0307511_10265483 Ga0307511_102654832 116
621 3300030760 Ga0265762_1077471 Ga0265762_10774712 116
622 3300031238 Ga0265332_10017915 Ga0265332_100179155 116
623 3300031241 Ga0265325_10000014 Ga0265325_10000014135 116
624 3300031242 Ga0265329_10025358 Ga0265329_100253582 116
625 3300031249 Ga0265339_10000256 Ga0265339_1000025629 116
626 3300031344 Ga0265316_10148087 Ga0265316_101480874 116
627 3300031595 Ga0265313_10000800 Ga0265313_1000080017 116
628 3300031711 Ga0265314_10068911 Ga0265314_100689115 116
629 3300031712 Ga0265342_10021698 Ga0265342_100216986 116
630 3300031730 Ga0307516_10054857 Ga0307516_100548572 116
631 3300032002 Ga0307416_102038770 Ga0307416_1020387702 116
632 3300035083 Ga0373926_0019576 Ga0373926_0019576_1793_2149 116
633 3300035088 Ga0373940_0006108 Ga0373940_0006108_845_1201 116
634 3300035111 Ga0373923_0127825 Ga0373923_0127825_435_791 116
635 3300035113 Ga0373936_0008097 Ga0373936_0008097_1334_1690 116
636 3300035114 Ga0373939_0021311 Ga0373939_0021311_267_623 116
637 3300035116 Ga0373945_0006653 Ga0373945_0006653_3251_3607 116
638 3300035119 Ga0373956_0311788 Ga0373956_0311788_216_572 116
639 3300035120 Ga0373957_0208961 Ga0373957_0208961_442_798 116
640 3300035170 Ga0373943_0007235 Ga0373943_0007235_3387_3743 116
641 3300035171 Ga0373946_0021157 Ga0373946_0021157_519_875 116
642 3300035172 Ga0373955_0036549 Ga0373955_0036549_1215_1571 116
643 3300035692 Ga0373935_0003403 Ga0373935_0003403_7631_7987 116
644 3300035695 Ga0373927_0064151 Ga0373927_0064151_1025_1381 116
645 3300035725 Ga0373947_0011709 Ga0373947_0011709_2386_2742 116
646 3300036401 Ga0373937_0775839 Ga0373937_0775839_314_670 116
647 3300037068 Ga0373925_0002514 Ga0373925_0002514_9551_9907 116
648 3300039437 Ga0436365_0544722 Ga0436365_0544722_3969_4325 116
649 3300042461 Ga0439460_0207078 Ga0439460_0207078_278_637 116
650 3300046455 Ga0495603_0163932 Ga0495603_0163932_540_896 116
651 3300046457 Ga0495590_0022080 Ga0495590_0022080_355_711 116
652 3300046472 Ga0495580_0387970 Ga0495580_0387970_97_453 116
653 3300046474 Ga0495605_0215543 Ga0495605_0215543_455_811 116
654 3300046477 Ga0495664_0034829 Ga0495664_0034829_2269_2625 116
655 3300046491 Ga0495584_0628674 Ga0495584_0628674_23_379 116
656 3300046499 Ga0495594_0209466 Ga0495594_0209466_101_457 116
657 3300046528 Ga0495642_0031203 Ga0495642_0031203_1385_1741 116
658 3300046529 Ga0495652_0445585 Ga0495652_0445585_379_735 116
659 3300046530 Ga0495654_0140206 Ga0495654_0140206_585_941 116
660 3300046543 Ga0495645_0086993 Ga0495645_0086993_782_1138 116
661 3300046543 Ga0495645_0219231 Ga0495645_0219231_103_459 116
662 3300046557 Ga0495622_0005205 Ga0495622_0005205_2578_2934 116
663 3300046557 Ga0495622_0149869 Ga0495622_0149869_657_1013 116
664 3300046648 Ga0495611_0052065 Ga0495611_0052065_1334_1690 116
665 3300046683 Ga0495658_0510622 Ga0495658_0510622_285_641 116
666 3300046694 Ga0495649_0014806 Ga0495649_0014806_3689_4045 116
667 3300047319 Ga0495674_0465109 Ga0495674_0465109_517_873 116
668 3300047320 Ga0495672_0010923 Ga0495672_0010923_4001_4357 116
669 3300047444 Ga0495675_0062651 Ga0495675_0062651_1168_1524 116
670 3300047469 Ga0495673_0050671 Ga0495673_0050671_878_1234 116
671 3300048910 Ga0496107_0510076 Ga0496107_0510076_323_679 116
672 3300048918 Ga0496115_0089908 Ga0496115_0089908_235_591 116
673 3300049460 Ga0495682_0005207 Ga0495682_0005207_5036_5392 116
674 3300049572 Ga0501036_0829619 Ga0501036_0829619_180_536 116
675 3300049573 Ga0501037_0784376 Ga0501037_0784376_121_480 116
676 3300049574 Ga0501038_0931781 Ga0501038_0931781_241_597 116
677 3300049576 Ga0501040_0339923 Ga0501040_0339923_60_416 116
678 3300049576 Ga0501040_1437391 Ga0501040_1437391_32_388 116
679 3300049579 Ga0501043_0076142 Ga0501043_0076142_742_1098 116
680 3300049580 Ga0501046_0397334 Ga0501046_0397334_318_677 116
681 3300049581 Ga0501047_0079044 Ga0501047_0079044_2544_2900 116
682 3300049586 Ga0501070_0449010 Ga0501070_0449010_482_838 116
683 3300049587 Ga0501071_0756795 Ga0501071_0756795_205_561 116
684 3300049588 Ga0501072_0777805 Ga0501072_0777805_376_735 116
685 3300049588 Ga0501072_0871679 Ga0501072_0871679_194_550 116
686 3300049589 Ga0501073_0013850 Ga0501073_0013850_2170_2526 116
687 3300049592 Ga0501076_0673885 Ga0501076_0673885_355_711 116
688 3300049593 Ga0501077_0316586 Ga0501077_0316586_271_627 116
689 3300049741 Ga0501079_1311378 Ga0501079_1311378_100_456 116
690 3300049741 Ga0501079_1352196 Ga0501079_1352196_106_462 116
691 3300049742 Ga0501080_0043846 Ga0501080_0043846_615_971 116
692 3300049742 Ga0501080_0283362 Ga0501080_0283362_504_860 116
693 3300049742 Ga0501080_0882512 Ga0501080_0882512_190_546 116
694 3300049742 Ga0501080_1481032 Ga0501080_1481032_34_393 116
695 3300049743 Ga0501081_0195365 Ga0501081_0195365_883_1242 116
696 3300049823 Ga0501044_0426141 Ga0501044_0426141_697_1053 116
697 3300049823 Ga0501044_1016818 Ga0501044_1016818_231_587 116
698 3300049824 Ga0501045_0128835 Ga0501045_0128835_840_1199 116
699 3300050489 nmdc:mga03683_193205_c1 nmdc:mga03683_193205_c1_143_499 116
700 3300050493 nmdc:mga0k408_3076_c1 nmdc:mga0k408_3076_c1_6698_7054 116
701 3300050508 nmdc:mga09592_641289_c1 nmdc:mga09592_641289_c1_493_852 116
702 3300050509 nmdc:mga0qj67_1078800_c1 nmdc:mga0qj67_1078800_c1_190_549 116
703 3300050511 nmdc:mga08y16_19140_c1 nmdc:mga08y16_19140_c1_2973_3332 116
704 3300053080 Ga0500635_0249855 Ga0500635_0249855_258_614 116
705 3300053090 Ga0500646_0206960 Ga0500646_0206960_254_610 116
706 3300053119 Ga0500595_048974 Ga0500595_048974_933_1289 116
707 3300053133 Ga0500655_006392 Ga0500655_006392_190_546 116
708 3300053137 Ga0500561_0041694 Ga0500561_0041694_818_1174 116
709 3300053140 Ga0500573_0339658 Ga0500573_0339658_67_432 116
710 3300053178 Ga0500637_0075513 Ga0500637_0075513_378_734 116
711 3300054114 Ga0501084_0000175 Ga0501084_0000175_41780_42136 116
712 3300061734 Ga0530510_0238077 Ga0530510_0238077_338_697 116
713 3300005563 Ga0068855_100128921 Ga0068855_1001289214 117
714 3300005981 Ga0081538_10050589 Ga0081538_100505895 117
715 3300021358 Ga0213873_10070365 Ga0213873_100703651 117
716 3300021384 Ga0213876_10164652 Ga0213876_101646521 117
717 3300021388 Ga0213875_10075279 Ga0213875_100752793 117
718 3300025949 Ga0207667_10135585 Ga0207667_101355854 117
719 3300037312 Ga0395899_0001783 Ga0395899_0001783_1873_2229 117
720 3300037312 Ga0395899_0185656 Ga0395899_0185656_435_791 117
721 3300037418 Ga0395900_0001968 Ga0395900_0001968_15692_16048 117
722 3300037418 Ga0395900_0072243 Ga0395900_0072243_3087_3443 117
723 3300037466 Ga0395898_0001813 Ga0395898_0001813_7145_7501 117
724 3300037466 Ga0395898_0070051 Ga0395898_0070051_357_713 117
725 3300037471 Ga0395905_0002986 Ga0395905_0002986_10672_11028 117
726 3300038443 Ga0395901_0045308 Ga0395901_0045308_4165_4521 117
727 3300039453 Ga0436362_0133744 Ga0436362_0133744_418_786 117
728 3300045976 Ga0466967_1086811 Ga0466967_1086811_173_535 117
729 3300049742 Ga0501080_0164344 Ga0501080_0164344_563_919 117
730 3300002870 Ga0006763J43179_111127 Ga0006763J43179_1111271 118
731 3300003911 JGI25405J52794_10062281 JGI25405J52794_100622812 118
732 3300005328 Ga0070676_10167565 Ga0070676_101675652 118
733 3300005328 Ga0070676_10786173 Ga0070676_107861731 118
734 3300005366 Ga0070659_100713145 Ga0070659_1007131452 118
735 3300005439 Ga0070711_101520668 Ga0070711_1015206681 118
736 3300005456 Ga0070678_101226755 Ga0070678_1012267551 118
737 3300005530 Ga0070679_101064763 Ga0070679_1010647631 118
738 3300005535 Ga0070684_102244406 Ga0070684_1022444061 118
739 3300005544 Ga0070686_100509331 Ga0070686_1005093312 118
740 3300005546 Ga0070696_101323023 Ga0070696_1013230231 118
741 3300005618 Ga0068864_101188756 Ga0068864_1011887562 118
742 3300005840 Ga0068870_10402606 Ga0068870_104026061 118
743 3300005841 Ga0068863_102146407 Ga0068863_1021464072 118
744 3300005842 Ga0068858_101218952 Ga0068858_1012189522 118
745 3300006163 Ga0070715_11000328 Ga0070715_110003282 118
746 3300006237 Ga0097621_101431758 Ga0097621_1014317582 118
747 3300006237 Ga0097621_101529259 Ga0097621_1015292591 118
748 3300009093 Ga0105240_11355769 Ga0105240_113557692 118
749 3300009093 Ga0105240_11913085 Ga0105240_119130851 118
750 3300010375 Ga0105239_10915674 Ga0105239_109156742 118
751 3300013297 Ga0157378_12383229 Ga0157378_123832291 118
752 3300014326 Ga0157380_11017165 Ga0157380_110171652 118
753 3300014497 Ga0182008_10092023 Ga0182008_100920232 118
754 3300025908 Ga0207643_10477063 Ga0207643_104770632 118
755 3300025921 Ga0207652_11396082 Ga0207652_113960822 118
756 3300025924 Ga0207694_10551954 Ga0207694_105519542 118
757 3300026088 Ga0207641_12472985 Ga0207641_124729851 118
758 3300026095 Ga0207676_11379686 Ga0207676_113796862 118
759 3300026118 Ga0207675_100347319 Ga0207675_1003473193 118
760 3300028381 Ga0268264_11579843 Ga0268264_115798432 118
761 3300028573 Ga0265334_10284866 Ga0265334_102848662 118
762 3300028800 Ga0265338_10053558 Ga0265338_100535582 118
763 3300028800 Ga0265338_10362361 Ga0265338_103623611 118
764 3300028800 Ga0265338_10533692 Ga0265338_105336922 118
765 3300030760 Ga0265762_1054893 Ga0265762_10548932 118
766 3300031090 Ga0265760_10126747 Ga0265760_101267472 118
767 3300031665 Ga0316575_10204733 Ga0316575_102047332 118
768 3300031711 Ga0265314_10120743 Ga0265314_101207434 118
769 3300031852 Ga0307410_10795926 Ga0307410_107959261 118
770 3300032126 Ga0307415_100533038 Ga0307415_1005330382 118
771 3300032133 Ga0316583_10103179 Ga0316583_101031792 118
772 3300033524 Ga0316592_1007387 Ga0316592_10073874 118
773 3300035089 Ga0373944_0139499 Ga0373944_0139499_32_394 118
774 3300035116 Ga0373945_0144523 Ga0373945_0144523_206_568 118
775 3300035121 Ga0373960_0398125 Ga0373960_0398125_154_516 118
776 3300035692 Ga0373935_0521708 Ga0373935_0521708_310_672 118
777 3300036712 Ga0316584_0280293 Ga0316584_0280293_553_915 118
778 3300037418 Ga0395900_1109535 Ga0395900_1109535_208_570 118
779 3300037466 Ga0395898_0172906 Ga0395898_0172906_1496_1858 118
780 3300037471 Ga0395905_1104307 Ga0395905_1104307_317_676 118
781 3300037588 Ga0316581_0171426 Ga0316581_0171426_60_422 118
782 3300037853 Ga0436364_1442444 Ga0436364_1442444_736_1098 118
783 3300038443 Ga0395901_0130246 Ga0395901_0130246_1570_1932 118
784 3300038443 Ga0395901_1984243 Ga0395901_1984243_16_378 118
785 3300044694 Ga0466963_1048507 Ga0466963_1048507_98_460 118
786 3300045049 Ga0466959_1083066 Ga0466959_1083066_33_395 118
787 3300046476 Ga0495662_0405102 Ga0495662_0405102_213_575 118
788 3300046535 Ga0495586_0907405 Ga0495586_0907405_28_390 118
789 3300046683 Ga0495658_0303205 Ga0495658_0303205_213_578 118
790 3300049569 Ga0501032_0145528 Ga0501032_0145528_715_1077 118
791 3300049571 Ga0501034_0132960 Ga0501034_0132960_125_487 118
792 3300049571 Ga0501034_1010260 Ga0501034_1010260_131_493 118
793 3300049573 Ga0501037_0379472 Ga0501037_0379472_598_960 118
794 3300049577 Ga0501041_0090359 Ga0501041_0090359_1275_1637 118
795 3300049579 Ga0501043_0286820 Ga0501043_0286820_171_533 118
796 3300049581 Ga0501047_0016976 Ga0501047_0016976_6402_6764 118
797 3300049582 Ga0501048_1136496 Ga0501048_1136496_40_402 118
798 3300049586 Ga0501070_0514861 Ga0501070_0514861_136_498 118
799 3300049590 Ga0501074_1250547 Ga0501074_1250547_105_473 118
800 3300049741 Ga0501079_0567026 Ga0501079_0567026_255_623 118
801 3300049742 Ga0501080_0683144 Ga0501080_0683144_130_498 118
802 3300049822 Ga0501035_0529788 Ga0501035_0529788_521_883 118
803 3300053730 Ga0500645_075788 Ga0500645_075788_406_768 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

8

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9r-assembly2.cif.gz_DS crystal structure of antibiotic dityromycin bound to 70s ribosome 0.953 3 118
6ddd-assembly1.cif.gz_a structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5 0.9523 7 115
4w2e-assembly1.cif.gz_S crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome 0.9501 3 118
6b4v-assembly1.cif.gz_P antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.9488 3 118
4v9r-assembly2.cif.gz_DS crystal structure of antibiotic dityromycin bound to 70s ribosome 0.9448 3 118
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9693 24 118 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9558 26 118 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9517 23 118 3.30.420.100
4dhcS01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9367 15 118 3.30.420.100
4pecO00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9287 3 118 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A2M7DRY4-F1-model_v4 Large ribosomal subunit protein uL18 0.9864 24 118 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A6N7M4M4-F1-model_v4 Large ribosomal subunit protein uL18 0.9799 6 118 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-D4IMK7-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9788 28 118 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7C4EZ79-F1-model_v4 Large ribosomal subunit protein uL18 0.9736 6 118 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2E1VVJ5-F1-model_v4 Large ribosomal subunit protein uL18 0.9727 7 118 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
82.99 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map