F481489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 803 | 318 | 802 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10461749|Ga0070676_104617491 |
| Length | 131 |
| Sequence | MKASMSAARKARRSKMTTPLFKKRQSRTRYKIATNSTGRPRLSIFRSGKHIYAQVIDDKTAATLASASSNEKEGRAAKTWNIDAASSVGKKIAERALASGVKQVVFDRGGYIYHGRVKALADAAREGGLEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 2 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 94 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 175 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 306 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.75 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.62 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006763J43179_111127 | 3300002870 | Bacteria | 518 |
| 2 | JGI25405J52794_10062281 | 3300003911 | Bacteria | 808 |
| 3 | Ga0058862_12178484 | 3300004803 | Bacteria | 692 |
| 4 | Ga0070658_10045521 | 3300005327 | Bacteria | 3548 |
| 5 | Ga0070658_10201223 | 3300005327 | Bacteria | 1681 |
| 6 | Ga0070658_10480992 | 3300005327 | Bacteria | 1072 |
| 7 | Ga0070658_11848839 | 3300005327 | Bacteria | 522 |
| 8 | Ga0070676_10079075 | 3300005328 | Bacteria | 1990 |
| 9 | Ga0070676_10167565 | 3300005328 | Bacteria | 1418 |
| 10 | Ga0070676_10461749 | 3300005328 | Bacteria | 895 |
| 11 | Ga0070676_10786173 | 3300005328 | Bacteria | 701 |
| 12 | Ga0070683_100187688 | 3300005329 | Bacteria | 1962 |
| 13 | Ga0070683_100461762 | 3300005329 | Bacteria | 1212 |
| 14 | Ga0070690_100611209 | 3300005330 | Bacteria | 829 |
| 15 | Ga0070670_100641089 | 3300005331 | Bacteria | 953 |
| 16 | Ga0068869_100070091 | 3300005334 | Bacteria | 2593 |
| 17 | Ga0068869_101484553 | 3300005334 | Bacteria | 602 |
| 18 | Ga0070666_10007106 | 3300005335 | Bacteria | 6904 |
| 19 | Ga0070666_10693408 | 3300005335 | Bacteria | 746 |
| 20 | Ga0070680_100002998 | 3300005336 | Bacteria | 12534 |
| 21 | Ga0070680_100072787 | 3300005336 | Bacteria | 2825 |
| 22 | Ga0070680_100078879 | 3300005336 | Bacteria | 2713 |
| 23 | Ga0070680_101241173 | 3300005336 | Bacteria | 645 |
| 24 | Ga0068868_100153898 | 3300005338 | Bacteria | 1895 |
| 25 | Ga0070660_100108074 | 3300005339 | Bacteria | 2211 |
| 26 | Ga0070660_100174288 | 3300005339 | Bacteria | 1739 |
| 27 | Ga0070691_10149346 | 3300005341 | Bacteria | 1197 |
| 28 | Ga0070691_10342674 | 3300005341 | Bacteria | 828 |
| 29 | Ga0070687_100270438 | 3300005343 | Bacteria | 1065 |
| 30 | Ga0070687_101055869 | 3300005343 | Bacteria | 592 |
| 31 | Ga0070661_100005946 | 3300005344 | Bacteria | 8403 |
| 32 | Ga0070661_100258902 | 3300005344 | Bacteria | 1345 |
| 33 | Ga0070661_101407850 | 3300005344 | Bacteria | 587 |
| 34 | Ga0070671_100343504 | 3300005355 | Bacteria | 1273 |
| 35 | Ga0070674_102070568 | 3300005356 | Bacteria | 519 |
| 36 | Ga0070673_100588849 | 3300005364 | Bacteria | 1014 |
| 37 | Ga0070673_102333163 | 3300005364 | Bacteria | 509 |
| 38 | Ga0070688_100357639 | 3300005365 | Bacteria | 1071 |
| 39 | Ga0070688_100542982 | 3300005365 | Bacteria | 883 |
| 40 | Ga0070659_100027373 | 3300005366 | Bacteria | 4393 |
| 41 | Ga0070659_100713145 | 3300005366 | Bacteria | 868 |
| 42 | Ga0070659_100753457 | 3300005366 | Bacteria | 845 |
| 43 | Ga0070659_101495690 | 3300005366 | Bacteria | 601 |
| 44 | Ga0070667_100061525 | 3300005367 | Bacteria | 3179 |
| 45 | Ga0070667_100349423 | 3300005367 | Bacteria | 1338 |
| 46 | Ga0070709_10171867 | 3300005434 | Bacteria | 1515 |
| 47 | Ga0070709_10807109 | 3300005434 | Bacteria | 737 |
| 48 | Ga0070714_100109782 | 3300005435 | Bacteria | 2441 |
| 49 | Ga0070714_100911275 | 3300005435 | Bacteria | 854 |
| 50 | Ga0070714_101129934 | 3300005435 | Bacteria | 764 |
| 51 | Ga0070714_101310504 | 3300005435 | Bacteria | 707 |
| 52 | Ga0070714_102064040 | 3300005435 | Bacteria | 556 |
| 53 | Ga0070713_100213904 | 3300005436 | Bacteria | 1746 |
| 54 | Ga0070713_100558156 | 3300005436 | Bacteria | 1085 |
| 55 | Ga0070713_100815448 | 3300005436 | Bacteria | 895 |
| 56 | Ga0070713_102368412 | 3300005436 | Bacteria | 514 |
| 57 | Ga0070710_10393052 | 3300005437 | Bacteria | 928 |
| 58 | Ga0070701_10424525 | 3300005438 | Bacteria | 848 |
| 59 | Ga0070711_101119623 | 3300005439 | Bacteria | 679 |
| 60 | Ga0070711_101520668 | 3300005439 | Unclassified | 584 |
| 61 | Ga0070700_101025593 | 3300005441 | Bacteria | 680 |
| 62 | Ga0070700_101777987 | 3300005441 | Bacteria | 530 |
| 63 | Ga0070678_100069504 | 3300005456 | Bacteria | 2629 |
| 64 | Ga0070678_101226755 | 3300005456 | Bacteria | 696 |
| 65 | Ga0070678_101678149 | 3300005456 | Bacteria | 598 |
| 66 | Ga0070681_10000037 | 3300005458 | Bacteria | 96087 |
| 67 | Ga0070681_10034634 | 3300005458 | Bacteria | 5070 |
| 68 | Ga0070681_10160044 | 3300005458 | Bacteria | 2175 |
| 69 | Ga0070681_11029384 | 3300005458 | Bacteria | 744 |
| 70 | Ga0068867_100091706 | 3300005459 | Bacteria | 2307 |
| 71 | Ga0070685_11293727 | 3300005466 | Bacteria | 557 |
| 72 | Ga0070679_100008411 | 3300005530 | Bacteria | 9712 |
| 73 | Ga0070679_100064794 | 3300005530 | Bacteria | 3642 |
| 74 | Ga0070679_100365821 | 3300005530 | Bacteria | 1389 |
| 75 | Ga0070679_101064763 | 3300005530 | Bacteria | 753 |
| 76 | Ga0070684_100283884 | 3300005535 | Bacteria | 1517 |
| 77 | Ga0070684_100375804 | 3300005535 | Bacteria | 1308 |
| 78 | Ga0070684_101079606 | 3300005535 | Bacteria | 754 |
| 79 | Ga0070684_102244406 | 3300005535 | Bacteria | 515 |
| 80 | Ga0068853_100101796 | 3300005539 | Bacteria | 2541 |
| 81 | Ga0068853_100246161 | 3300005539 | Bacteria | 1640 |
| 82 | Ga0068853_100436108 | 3300005539 | Bacteria | 1231 |
| 83 | Ga0068853_100714452 | 3300005539 | Bacteria | 956 |
| 84 | Ga0068853_101038291 | 3300005539 | Bacteria | 789 |
| 85 | Ga0070686_100311002 | 3300005544 | Bacteria | 1172 |
| 86 | Ga0070686_100509331 | 3300005544 | Bacteria | 935 |
| 87 | Ga0070696_101323023 | 3300005546 | Bacteria | 612 |
| 88 | Ga0070693_100529106 | 3300005547 | Bacteria | 841 |
| 89 | Ga0070693_100815729 | 3300005547 | Bacteria | 693 |
| 90 | Ga0070693_101552370 | 3300005547 | Bacteria | 519 |
| 91 | Ga0070665_100023111 | 3300005548 | Bacteria | 6262 |
| 92 | Ga0070665_100074982 | 3300005548 | Bacteria | 3389 |
| 93 | Ga0070665_100966759 | 3300005548 | Bacteria | 864 |
| 94 | Ga0070665_101010898 | 3300005548 | Bacteria | 844 |
| 95 | Ga0068855_100000385 | 3300005563 | Bacteria | 54304 |
| 96 | Ga0068855_100121416 | 3300005563 | Bacteria | 2990 |
| 97 | Ga0068855_100128921 | 3300005563 | Bacteria | 2890 |
| 98 | Ga0068855_100135692 | 3300005563 | Bacteria | 2808 |
| 99 | Ga0068855_101740178 | 3300005563 | Bacteria | 635 |
| 100 | Ga0068857_100403718 | 3300005577 | Bacteria | 1272 |
| 101 | Ga0068856_100263376 | 3300005614 | Bacteria | 1739 |
| 102 | Ga0068856_101040321 | 3300005614 | Bacteria | 837 |
| 103 | Ga0068856_101808191 | 3300005614 | Bacteria | 623 |
| 104 | Ga0068856_101982439 | 3300005614 | Bacteria | 593 |
| 105 | Ga0068856_102058554 | 3300005614 | Bacteria | 581 |
| 106 | Ga0070702_100299022 | 3300005615 | Bacteria | 1112 |
| 107 | Ga0068852_100393106 | 3300005616 | Bacteria | 1362 |
| 108 | Ga0068852_101342339 | 3300005616 | Bacteria | 737 |
| 109 | Ga0068864_100366305 | 3300005618 | Bacteria | 1363 |
| 110 | Ga0068864_101188756 | 3300005618 | Bacteria | 761 |
| 111 | Ga0068861_101214834 | 3300005719 | Bacteria | 729 |
| 112 | Ga0068851_10581298 | 3300005834 | Bacteria | 680 |
| 113 | Ga0068870_10119202 | 3300005840 | Bacteria | 1518 |
| 114 | Ga0068870_10402606 | 3300005840 | Bacteria | 891 |
| 115 | Ga0068863_102146407 | 3300005841 | Bacteria | 569 |
| 116 | Ga0068858_101218952 | 3300005842 | Bacteria | 740 |
| 117 | Ga0081538_10050589 | 3300005981 | Bacteria | 2506 |
| 118 | Ga0070715_11000328 | 3300006163 | Bacteria | 521 |
| 119 | Ga0070716_100443022 | 3300006173 | Bacteria | 945 |
| 120 | Ga0070712_100113045 | 3300006175 | Bacteria | 2030 |
| 121 | Ga0070712_100708750 | 3300006175 | Bacteria | 858 |
| 122 | Ga0070712_102059527 | 3300006175 | Bacteria | 500 |
| 123 | Ga0075362_10170480 | 3300006177 | Bacteria | 1051 |
| 124 | Ga0075367_10068073 | 3300006178 | Bacteria | 2135 |
| 125 | Ga0075366_10016744 | 3300006195 | Bacteria | 4215 |
| 126 | Ga0097621_100223165 | 3300006237 | Bacteria | 1643 |
| 127 | Ga0097621_100433566 | 3300006237 | Bacteria | 1181 |
| 128 | Ga0097621_100712378 | 3300006237 | Bacteria | 925 |
| 129 | Ga0097621_101431758 | 3300006237 | Bacteria | 655 |
| 130 | Ga0097621_101529259 | 3300006237 | Bacteria | 634 |
| 131 | Ga0068871_100301487 | 3300006358 | Bacteria | 1407 |
| 132 | Ga0075428_102279109 | 3300006844 | Bacteria | 558 |
| 133 | Ga0075430_100194948 | 3300006846 | Bacteria | 1683 |
| 134 | Ga0075430_100589606 | 3300006846 | Bacteria | 917 |
| 135 | Ga0075431_100116845 | 3300006847 | Bacteria | 2753 |
| 136 | Ga0075433_11605667 | 3300006852 | Bacteria | 561 |
| 137 | Ga0075429_100450246 | 3300006880 | Bacteria | 1128 |
| 138 | Ga0068865_100480540 | 3300006881 | Bacteria | 1032 |
| 139 | Ga0068865_100700100 | 3300006881 | Bacteria | 866 |
| 140 | Ga0105240_10004232 | 3300009093 | Bacteria | 21946 |
| 141 | Ga0105240_10004696 | 3300009093 | Bacteria | 20647 |
| 142 | Ga0105240_10025381 | 3300009093 | Bacteria | 7788 |
| 143 | Ga0105240_10571025 | 3300009093 | Bacteria | 1249 |
| 144 | Ga0105240_10604944 | 3300009093 | Bacteria | 1206 |
| 145 | Ga0105240_10675787 | 3300009093 | Bacteria | 1129 |
| 146 | Ga0105240_10772790 | 3300009093 | Bacteria | 1043 |
| 147 | Ga0105240_11080765 | 3300009093 | Bacteria | 854 |
| 148 | Ga0105240_11336885 | 3300009093 | Bacteria | 755 |
| 149 | Ga0105240_11355769 | 3300009093 | Bacteria | 749 |
| 150 | Ga0105240_11913085 | 3300009093 | Bacteria | 617 |
| 151 | Ga0111539_10023579 | 3300009094 | Bacteria | 7562 |
| 152 | Ga0111539_11031310 | 3300009094 | Bacteria | 956 |
| 153 | Ga0105245_10230243 | 3300009098 | Bacteria | 1792 |
| 154 | Ga0105245_10394924 | 3300009098 | Bacteria | 1381 |
| 155 | Ga0105247_10056711 | 3300009101 | Bacteria | 2420 |
| 156 | Ga0105243_10014172 | 3300009148 | Bacteria | 6032 |
| 157 | Ga0105241_10609598 | 3300009174 | Bacteria | 987 |
| 158 | Ga0105241_10783792 | 3300009174 | Bacteria | 877 |
| 159 | Ga0105241_11448434 | 3300009174 | Bacteria | 659 |
| 160 | Ga0105242_10284153 | 3300009176 | Bacteria | 1504 |
| 161 | Ga0105242_10546840 | 3300009176 | Bacteria | 1109 |
| 162 | Ga0105242_12440001 | 3300009176 | Bacteria | 571 |
| 163 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 164 | Ga0105248_10047589 | 3300009177 | Bacteria | 4810 |
| 165 | Ga0105248_10256549 | 3300009177 | Bacteria | 1968 |
| 166 | Ga0105248_10900403 | 3300009177 | Bacteria | 999 |
| 167 | Ga0105248_12302871 | 3300009177 | Bacteria | 613 |
| 168 | Ga0105248_12583146 | 3300009177 | Bacteria | 579 |
| 169 | Ga0105237_10119273 | 3300009545 | Bacteria | 2632 |
| 170 | Ga0105237_10158271 | 3300009545 | Bacteria | 2262 |
| 171 | Ga0105237_10181890 | 3300009545 | Bacteria | 2102 |
| 172 | Ga0105237_10209530 | 3300009545 | Bacteria | 1949 |
| 173 | Ga0105237_11218230 | 3300009545 | Bacteria | 759 |
| 174 | Ga0105237_12150218 | 3300009545 | Bacteria | 567 |
| 175 | Ga0105238_10000180 | 3300009551 | Bacteria | 68847 |
| 176 | Ga0105238_10055822 | 3300009551 | Bacteria | 3964 |
| 177 | Ga0105238_10130022 | 3300009551 | Bacteria | 2496 |
| 178 | Ga0105238_10322009 | 3300009551 | Bacteria | 1532 |
| 179 | Ga0105238_10414574 | 3300009551 | Bacteria | 1341 |
| 180 | Ga0105238_10738831 | 3300009551 | Bacteria | 998 |
| 181 | Ga0105238_11356864 | 3300009551 | Bacteria | 738 |
| 182 | Ga0105238_12443639 | 3300009551 | Bacteria | 558 |
| 183 | Ga0105239_10005584 | 3300010375 | Bacteria | 14708 |
| 184 | Ga0105239_10018317 | 3300010375 | Bacteria | 7741 |
| 185 | Ga0105239_10026360 | 3300010375 | Bacteria | 6397 |
| 186 | Ga0105239_10073553 | 3300010375 | Bacteria | 3757 |
| 187 | Ga0105239_10210784 | 3300010375 | Bacteria | 2178 |
| 188 | Ga0105239_10243523 | 3300010375 | Bacteria | 2018 |
| 189 | Ga0105239_10259863 | 3300010375 | Bacteria | 1951 |
| 190 | Ga0105239_10600711 | 3300010375 | Bacteria | 1255 |
| 191 | Ga0105239_10915674 | 3300010375 | Bacteria | 1006 |
| 192 | Ga0105239_12895017 | 3300010375 | Bacteria | 560 |
| 193 | Ga0105246_10224000 | 3300011119 | Bacteria | 1476 |
| 194 | Ga0105246_11855237 | 3300011119 | Bacteria | 577 |
| 195 | Ga0157373_10565824 | 3300013100 | Bacteria | 825 |
| 196 | Ga0157370_10035566 | 3300013104 | Bacteria | 4839 |
| 197 | Ga0157370_10083851 | 3300013104 | Bacteria | 2996 |
| 198 | Ga0157370_11553340 | 3300013104 | Bacteria | 595 |
| 199 | Ga0157370_11772634 | 3300013104 | Bacteria | 554 |
| 200 | Ga0157369_10033188 | 3300013105 | Bacteria | 5675 |
| 201 | Ga0157369_10345530 | 3300013105 | Bacteria | 1546 |
| 202 | Ga0157369_11176015 | 3300013105 | Bacteria | 783 |
| 203 | Ga0157369_11997704 | 3300013105 | Bacteria | 588 |
| 204 | Ga0157374_10000420 | 3300013296 | Bacteria | 38392 |
| 205 | Ga0157374_10646962 | 3300013296 | Bacteria | 1069 |
| 206 | Ga0157374_11811589 | 3300013296 | Bacteria | 636 |
| 207 | Ga0157378_10506627 | 3300013297 | Bacteria | 1207 |
| 208 | Ga0157378_11303016 | 3300013297 | Bacteria | 768 |
| 209 | Ga0157378_12383229 | 3300013297 | Bacteria | 581 |
| 210 | Ga0163162_12018637 | 3300013306 | Bacteria | 661 |
| 211 | Ga0157372_10066383 | 3300013307 | Bacteria | 4053 |
| 212 | Ga0157375_11964069 | 3300013308 | Bacteria | 695 |
| 213 | Ga0163163_10008003 | 3300014325 | Bacteria | 9355 |
| 214 | Ga0163163_11434683 | 3300014325 | Bacteria | 752 |
| 215 | Ga0163163_12791848 | 3300014325 | Bacteria | 545 |
| 216 | Ga0163163_12859732 | 3300014325 | Bacteria | 539 |
| 217 | Ga0157380_10294611 | 3300014326 | Bacteria | 1491 |
| 218 | Ga0157380_10662266 | 3300014326 | Bacteria | 1043 |
| 219 | Ga0157380_11017165 | 3300014326 | Bacteria | 863 |
| 220 | Ga0157380_11951378 | 3300014326 | Bacteria | 648 |
| 221 | Ga0182008_10092023 | 3300014497 | Bacteria | 1496 |
| 222 | Ga0157379_10052289 | 3300014968 | Bacteria | 3649 |
| 223 | Ga0157379_11504263 | 3300014968 | Bacteria | 655 |
| 224 | Ga0157376_10311850 | 3300014969 | Bacteria | 1493 |
| 225 | Ga0157376_10667399 | 3300014969 | Bacteria | 1042 |
| 226 | Ga0157376_10917251 | 3300014969 | Bacteria | 895 |
| 227 | Ga0157376_12671508 | 3300014969 | Bacteria | 539 |
| 228 | Ga0213873_10070365 | 3300021358 | Bacteria | 963 |
| 229 | Ga0213874_10002785 | 3300021377 | Bacteria | 3804 |
| 230 | Ga0213874_10006777 | 3300021377 | Bacteria | 2724 |
| 231 | Ga0213876_10000421 | 3300021384 | Bacteria | 35344 |
| 232 | Ga0213876_10003189 | 3300021384 | Bacteria | 9433 |
| 233 | Ga0213876_10164652 | 3300021384 | Bacteria | 1180 |
| 234 | Ga0213875_10075279 | 3300021388 | Bacteria | 1575 |
| 235 | Ga0213871_10090741 | 3300021441 | Bacteria | 885 |
| 236 | Ga0207682_10329141 | 3300025893 | Bacteria | 718 |
| 237 | Ga0207682_10501077 | 3300025893 | Bacteria | 575 |
| 238 | Ga0207642_11000576 | 3300025899 | Bacteria | 538 |
| 239 | Ga0207688_10572743 | 3300025901 | Bacteria | 711 |
| 240 | Ga0207680_10002564 | 3300025903 | Bacteria | 8470 |
| 241 | Ga0207645_10011392 | 3300025907 | Bacteria | 6075 |
| 242 | Ga0207645_10058297 | 3300025907 | Bacteria | 2465 |
| 243 | Ga0207643_10030805 | 3300025908 | Bacteria | 2989 |
| 244 | Ga0207643_10477063 | 3300025908 | Bacteria | 796 |
| 245 | Ga0207705_10004720 | 3300025909 | Bacteria | 10265 |
| 246 | Ga0207705_10194396 | 3300025909 | Bacteria | 1535 |
| 247 | Ga0207654_10172361 | 3300025911 | Bacteria | 1406 |
| 248 | Ga0207654_10324382 | 3300025911 | Bacteria | 1053 |
| 249 | Ga0207654_10724010 | 3300025911 | Bacteria | 716 |
| 250 | Ga0207654_10796686 | 3300025911 | Bacteria | 682 |
| 251 | Ga0207654_10893363 | 3300025911 | Bacteria | 644 |
| 252 | Ga0207654_10976002 | 3300025911 | Bacteria | 616 |
| 253 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 254 | Ga0207707_10048827 | 3300025912 | Bacteria | 3687 |
| 255 | Ga0207707_11449952 | 3300025912 | Bacteria | 546 |
| 256 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 257 | Ga0207695_10028316 | 3300025913 | Bacteria | 6218 |
| 258 | Ga0207695_10040352 | 3300025913 | Bacteria | 5007 |
| 259 | Ga0207695_10128661 | 3300025913 | Bacteria | 2492 |
| 260 | Ga0207695_10217861 | 3300025913 | Bacteria | 1817 |
| 261 | Ga0207695_10383850 | 3300025913 | Bacteria | 1290 |
| 262 | Ga0207695_10592654 | 3300025913 | Bacteria | 990 |
| 263 | Ga0207695_10753082 | 3300025913 | Bacteria | 854 |
| 264 | Ga0207695_10926468 | 3300025913 | Bacteria | 751 |
| 265 | Ga0207695_10950391 | 3300025913 | Bacteria | 739 |
| 266 | Ga0207695_11234151 | 3300025913 | Bacteria | 628 |
| 267 | Ga0207671_10538073 | 3300025914 | Bacteria | 931 |
| 268 | Ga0207671_11087401 | 3300025914 | Bacteria | 628 |
| 269 | Ga0207693_10054085 | 3300025915 | Bacteria | 3150 |
| 270 | Ga0207693_10266868 | 3300025915 | Bacteria | 1341 |
| 271 | Ga0207660_10003537 | 3300025917 | Bacteria | 10180 |
| 272 | Ga0207660_10181434 | 3300025917 | Bacteria | 1635 |
| 273 | Ga0207660_10995112 | 3300025917 | Bacteria | 684 |
| 274 | Ga0207662_10413604 | 3300025918 | Bacteria | 916 |
| 275 | Ga0207657_10196503 | 3300025919 | Bacteria | 1625 |
| 276 | Ga0207657_10350346 | 3300025919 | Bacteria | 1164 |
| 277 | Ga0207657_10586738 | 3300025919 | Bacteria | 870 |
| 278 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 279 | Ga0207649_10486227 | 3300025920 | Bacteria | 937 |
| 280 | Ga0207649_11153903 | 3300025920 | Bacteria | 612 |
| 281 | Ga0207652_10000824 | 3300025921 | Bacteria | 29561 |
| 282 | Ga0207652_10115732 | 3300025921 | Bacteria | 2382 |
| 283 | Ga0207652_10115916 | 3300025921 | Bacteria | 2380 |
| 284 | Ga0207652_10532647 | 3300025921 | Bacteria | 1056 |
| 285 | Ga0207652_10563142 | 3300025921 | Bacteria | 1023 |
| 286 | Ga0207652_11396082 | 3300025921 | Bacteria | 604 |
| 287 | Ga0207652_11446107 | 3300025921 | Bacteria | 591 |
| 288 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 289 | Ga0207694_10026889 | 3300025924 | Bacteria | 4381 |
| 290 | Ga0207694_10137313 | 3300025924 | Bacteria | 1964 |
| 291 | Ga0207694_10187378 | 3300025924 | Bacteria | 1680 |
| 292 | Ga0207694_10353215 | 3300025924 | Bacteria | 1217 |
| 293 | Ga0207694_10494689 | 3300025924 | Bacteria | 1024 |
| 294 | Ga0207694_10503302 | 3300025924 | Bacteria | 1014 |
| 295 | Ga0207694_10551954 | 3300025924 | Bacteria | 967 |
| 296 | Ga0207694_11107393 | 3300025924 | Bacteria | 670 |
| 297 | Ga0207659_11878713 | 3300025926 | Bacteria | 508 |
| 298 | Ga0207687_10085895 | 3300025927 | Bacteria | 2284 |
| 299 | Ga0207687_10525782 | 3300025927 | Bacteria | 990 |
| 300 | Ga0207687_10721741 | 3300025927 | Bacteria | 847 |
| 301 | Ga0207700_11055403 | 3300025928 | Bacteria | 727 |
| 302 | Ga0207700_11621987 | 3300025928 | Bacteria | 572 |
| 303 | Ga0207664_10073108 | 3300025929 | Bacteria | 2766 |
| 304 | Ga0207664_10316183 | 3300025929 | Bacteria | 1377 |
| 305 | Ga0207664_10411486 | 3300025929 | Bacteria | 1204 |
| 306 | Ga0207644_11594106 | 3300025931 | Bacteria | 548 |
| 307 | Ga0207690_10109672 | 3300025932 | Bacteria | 1985 |
| 308 | Ga0207690_10627877 | 3300025932 | Bacteria | 879 |
| 309 | Ga0207686_10073147 | 3300025934 | Bacteria | 2211 |
| 310 | Ga0207686_10373895 | 3300025934 | Bacteria | 1079 |
| 311 | Ga0207686_10410361 | 3300025934 | Bacteria | 1034 |
| 312 | Ga0207686_10571050 | 3300025934 | Bacteria | 887 |
| 313 | Ga0207686_10826506 | 3300025934 | Bacteria | 744 |
| 314 | Ga0207709_10154513 | 3300025935 | Bacteria | 1593 |
| 315 | Ga0207669_10045989 | 3300025937 | Bacteria | 2576 |
| 316 | Ga0207704_10546716 | 3300025938 | Bacteria | 940 |
| 317 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 318 | Ga0207711_10145656 | 3300025941 | Bacteria | 2134 |
| 319 | Ga0207711_10662390 | 3300025941 | Bacteria | 974 |
| 320 | Ga0207711_10676633 | 3300025941 | Bacteria | 963 |
| 321 | Ga0207711_11036108 | 3300025941 | Bacteria | 760 |
| 322 | Ga0207689_10127211 | 3300025942 | Bacteria | 2096 |
| 323 | Ga0207661_11037548 | 3300025944 | Bacteria | 755 |
| 324 | Ga0207679_10438436 | 3300025945 | Bacteria | 1156 |
| 325 | Ga0207667_10000388 | 3300025949 | Bacteria | 59263 |
| 326 | Ga0207667_10046421 | 3300025949 | Bacteria | 4600 |
| 327 | Ga0207667_10052391 | 3300025949 | Bacteria | 4298 |
| 328 | Ga0207667_10135585 | 3300025949 | Bacteria | 2535 |
| 329 | Ga0207651_10382910 | 3300025960 | Bacteria | 1192 |
| 330 | Ga0207658_10058513 | 3300025986 | Bacteria | 2868 |
| 331 | Ga0207677_10561974 | 3300026023 | Bacteria | 996 |
| 332 | Ga0207677_11486330 | 3300026023 | Bacteria | 625 |
| 333 | Ga0207639_10000867 | 3300026041 | Bacteria | 20545 |
| 334 | Ga0207639_10211849 | 3300026041 | Bacteria | 1668 |
| 335 | Ga0207639_10482726 | 3300026041 | Bacteria | 1130 |
| 336 | Ga0207702_10221951 | 3300026078 | Bacteria | 1761 |
| 337 | Ga0207702_10791862 | 3300026078 | Bacteria | 937 |
| 338 | Ga0207702_10831347 | 3300026078 | Bacteria | 914 |
| 339 | Ga0207702_10956846 | 3300026078 | Bacteria | 849 |
| 340 | Ga0207702_11918977 | 3300026078 | Bacteria | 583 |
| 341 | Ga0207641_12472985 | 3300026088 | Bacteria | 518 |
| 342 | Ga0207648_10120491 | 3300026089 | Bacteria | 2306 |
| 343 | Ga0207676_10596303 | 3300026095 | Bacteria | 1060 |
| 344 | Ga0207676_11379686 | 3300026095 | Bacteria | 700 |
| 345 | Ga0207676_12030203 | 3300026095 | Bacteria | 574 |
| 346 | Ga0207674_10192958 | 3300026116 | Bacteria | 1987 |
| 347 | Ga0207674_10600064 | 3300026116 | Bacteria | 1063 |
| 348 | Ga0207674_11200466 | 3300026116 | Bacteria | 728 |
| 349 | Ga0207675_100347319 | 3300026118 | Bacteria | 1453 |
| 350 | Ga0207683_10103171 | 3300026121 | Bacteria | 2547 |
| 351 | Ga0207683_11450214 | 3300026121 | Bacteria | 634 |
| 352 | Ga0207698_10042447 | 3300026142 | Bacteria | 3398 |
| 353 | Ga0207698_10086858 | 3300026142 | Bacteria | 2545 |
| 354 | Ga0207698_10431881 | 3300026142 | Bacteria | 1267 |
| 355 | Ga0207428_10760687 | 3300027907 | Bacteria | 690 |
| 356 | Ga0207428_11179480 | 3300027907 | Bacteria | 533 |
| 357 | Ga0268266_10000557 | 3300028379 | Bacteria | 51935 |
| 358 | Ga0268266_10095842 | 3300028379 | Bacteria | 2606 |
| 359 | Ga0268266_10320511 | 3300028379 | Bacteria | 1450 |
| 360 | Ga0268266_10816058 | 3300028379 | Bacteria | 901 |
| 361 | Ga0268266_11197779 | 3300028379 | Bacteria | 734 |
| 362 | Ga0268265_10229757 | 3300028380 | Bacteria | 1630 |
| 363 | Ga0268264_11579843 | 3300028381 | Bacteria | 667 |
| 364 | Ga0268264_12447937 | 3300028381 | Bacteria | 528 |
| 365 | Ga0265337_1129141 | 3300028556 | Bacteria | 685 |
| 366 | Ga0265326_10073781 | 3300028558 | Bacteria | 965 |
| 367 | Ga0265334_10284866 | 3300028573 | Bacteria | 567 |
| 368 | Ga0307517_10244892 | 3300028786 | Bacteria | 1059 |
| 369 | Ga0265338_10000017 | 3300028800 | Bacteria | 344481 |
| 370 | Ga0265338_10000401 | 3300028800 | Bacteria | 77602 |
| 371 | Ga0265338_10002896 | 3300028800 | Bacteria | 24981 |
| 372 | Ga0265338_10053558 | 3300028800 | Bacteria | 3607 |
| 373 | Ga0265338_10315488 | 3300028800 | Bacteria | 1133 |
| 374 | Ga0265338_10362361 | 3300028800 | Bacteria | 1040 |
| 375 | Ga0265338_10533692 | 3300028800 | Bacteria | 823 |
| 376 | Ga0307511_10224989 | 3300030521 | Bacteria | 937 |
| 377 | Ga0307511_10265483 | 3300030521 | Bacteria | 809 |
| 378 | Ga0265762_1054893 | 3300030760 | Bacteria | 807 |
| 379 | Ga0265762_1077471 | 3300030760 | Bacteria | 707 |
| 380 | Ga0265760_10126747 | 3300031090 | Bacteria | 823 |
| 381 | Ga0265330_10074125 | 3300031235 | Bacteria | 1471 |
| 382 | Ga0265330_10222495 | 3300031235 | Bacteria | 797 |
| 383 | Ga0265330_10241361 | 3300031235 | Bacteria | 762 |
| 384 | Ga0265330_10304052 | 3300031235 | Bacteria | 672 |
| 385 | Ga0265332_10017915 | 3300031238 | Bacteria | 3122 |
| 386 | Ga0265332_10071412 | 3300031238 | Bacteria | 1478 |
| 387 | Ga0265332_10109358 | 3300031238 | Bacteria | 1165 |
| 388 | Ga0265332_10226366 | 3300031238 | Bacteria | 775 |
| 389 | Ga0265320_10002069 | 3300031240 | Bacteria | 14126 |
| 390 | Ga0265325_10000014 | 3300031241 | Bacteria | 131579 |
| 391 | Ga0265325_10026992 | 3300031241 | Bacteria | 3107 |
| 392 | Ga0265325_10113161 | 3300031241 | Bacteria | 1316 |
| 393 | Ga0265325_10183291 | 3300031241 | Bacteria | 974 |
| 394 | Ga0265325_10232718 | 3300031241 | Bacteria | 839 |
| 395 | Ga0265325_10360964 | 3300031241 | Bacteria | 640 |
| 396 | Ga0265329_10025358 | 3300031242 | Bacteria | 1963 |
| 397 | Ga0265329_10105250 | 3300031242 | Bacteria | 900 |
| 398 | Ga0265340_10002869 | 3300031247 | Bacteria | 9812 |
| 399 | Ga0265340_10038201 | 3300031247 | Bacteria | 2376 |
| 400 | Ga0265340_10196059 | 3300031247 | Bacteria | 909 |
| 401 | Ga0265339_10000256 | 3300031249 | Bacteria | 42839 |
| 402 | Ga0265339_10104553 | 3300031249 | Bacteria | 1470 |
| 403 | Ga0265339_10306913 | 3300031249 | Bacteria | 755 |
| 404 | Ga0265331_10000186 | 3300031250 | Bacteria | 76149 |
| 405 | Ga0265331_10003502 | 3300031250 | Bacteria | 10110 |
| 406 | Ga0265331_10013838 | 3300031250 | Bacteria | 4322 |
| 407 | Ga0265331_10022887 | 3300031250 | Bacteria | 3183 |
| 408 | Ga0265331_10037988 | 3300031250 | Bacteria | 2356 |
| 409 | Ga0265331_10135994 | 3300031250 | Bacteria | 1119 |
| 410 | Ga0265327_10000392 | 3300031251 | Bacteria | 82296 |
| 411 | Ga0265316_10025355 | 3300031344 | Bacteria | 4950 |
| 412 | Ga0265316_10044806 | 3300031344 | Bacteria | 3516 |
| 413 | Ga0265316_10086571 | 3300031344 | Bacteria | 2395 |
| 414 | Ga0265316_10148087 | 3300031344 | Bacteria | 1760 |
| 415 | Ga0265316_10186060 | 3300031344 | Bacteria | 1545 |
| 416 | Ga0265316_10488220 | 3300031344 | Bacteria | 881 |
| 417 | Ga0265316_10505152 | 3300031344 | Bacteria | 863 |
| 418 | Ga0265316_10889279 | 3300031344 | Bacteria | 622 |
| 419 | Ga0265316_10909968 | 3300031344 | Bacteria | 614 |
| 420 | Ga0265313_10000800 | 3300031595 | Bacteria | 31814 |
| 421 | Ga0265313_10012941 | 3300031595 | Bacteria | 5055 |
| 422 | Ga0265313_10086987 | 3300031595 | Bacteria | 1409 |
| 423 | Ga0265313_10257425 | 3300031595 | Bacteria | 710 |
| 424 | Ga0307508_10339899 | 3300031616 | Bacteria | 1093 |
| 425 | Ga0316575_10019455 | 3300031665 | Bacteria | 2597 |
| 426 | Ga0316575_10204733 | 3300031665 | Bacteria | 822 |
| 427 | Ga0265314_10000963 | 3300031711 | Bacteria | 33816 |
| 428 | Ga0265314_10041547 | 3300031711 | Bacteria | 3289 |
| 429 | Ga0265314_10056619 | 3300031711 | Bacteria | 2697 |
| 430 | Ga0265314_10059830 | 3300031711 | Bacteria | 2603 |
| 431 | Ga0265314_10060354 | 3300031711 | Bacteria | 2588 |
| 432 | Ga0265314_10068911 | 3300031711 | Bacteria | 2376 |
| 433 | Ga0265314_10077885 | 3300031711 | Bacteria | 2197 |
| 434 | Ga0265314_10120743 | 3300031711 | Bacteria | 1650 |
| 435 | Ga0265314_10157550 | 3300031711 | Bacteria | 1385 |
| 436 | Ga0265314_10261666 | 3300031711 | Bacteria | 987 |
| 437 | Ga0265314_10398461 | 3300031711 | Bacteria | 745 |
| 438 | Ga0265314_10537414 | 3300031711 | Bacteria | 610 |
| 439 | Ga0265342_10021698 | 3300031712 | Bacteria | 4095 |
| 440 | Ga0265342_10072247 | 3300031712 | Bacteria | 2009 |
| 441 | Ga0265342_10086258 | 3300031712 | Bacteria | 1805 |
| 442 | Ga0265342_10204740 | 3300031712 | Bacteria | 1070 |
| 443 | Ga0265342_10418404 | 3300031712 | Bacteria | 690 |
| 444 | Ga0265342_10613447 | 3300031712 | Bacteria | 548 |
| 445 | Ga0265342_10705073 | 3300031712 | Bacteria | 504 |
| 446 | Ga0307516_10054857 | 3300031730 | Bacteria | 3893 |
| 447 | Ga0307516_10069198 | 3300031730 | Bacteria | 3396 |
| 448 | Ga0307410_10795926 | 3300031852 | Bacteria | 804 |
| 449 | Ga0307416_102038770 | 3300032002 | Bacteria | 676 |
| 450 | Ga0307415_100533038 | 3300032126 | Bacteria | 1033 |
| 451 | Ga0316583_10103179 | 3300032133 | Bacteria | 994 |
| 452 | Ga0316592_1007387 | 3300033524 | Bacteria | 2146 |
| 453 | Ga0373926_0019576 | 3300035083 | Bacteria | 2334 |
| 454 | Ga0373926_0376326 | 3300035083 | Bacteria | 559 |
| 455 | Ga0373926_0438532 | 3300035083 | Bacteria | 518 |
| 456 | Ga0373940_0006108 | 3300035088 | Bacteria | 2650 |
| 457 | Ga0373944_0139499 | 3300035089 | Bacteria | 848 |
| 458 | Ga0373944_0332856 | 3300035089 | Bacteria | 575 |
| 459 | Ga0373944_0378439 | 3300035089 | Bacteria | 543 |
| 460 | Ga0373923_0127825 | 3300035111 | Bacteria | 1140 |
| 461 | Ga0373923_0655767 | 3300035111 | Bacteria | 519 |
| 462 | Ga0373936_0008097 | 3300035113 | Bacteria | 3952 |
| 463 | Ga0373936_0187142 | 3300035113 | Bacteria | 910 |
| 464 | Ga0373939_0021311 | 3300035114 | Bacteria | 1772 |
| 465 | Ga0373945_0006653 | 3300035116 | Bacteria | 3735 |
| 466 | Ga0373945_0144523 | 3300035116 | Bacteria | 961 |
| 467 | Ga0373956_0311788 | 3300035119 | Bacteria | 750 |
| 468 | Ga0373957_0208961 | 3300035120 | Bacteria | 815 |
| 469 | Ga0373960_0398125 | 3300035121 | Bacteria | 531 |
| 470 | Ga0373943_0007235 | 3300035170 | Bacteria | 4980 |
| 471 | Ga0373943_0458592 | 3300035170 | Bacteria | 741 |
| 472 | Ga0373946_0021157 | 3300035171 | Bacteria | 2520 |
| 473 | Ga0373955_0036549 | 3300035172 | Bacteria | 2607 |
| 474 | Ga0373955_0236450 | 3300035172 | Bacteria | 1094 |
| 475 | Ga0373924_0016976 | 3300035410 | Bacteria | 2786 |
| 476 | Ga0373931_0111163 | 3300035691 | Bacteria | 1555 |
| 477 | Ga0373935_0003403 | 3300035692 | Bacteria | 9238 |
| 478 | Ga0373935_0027495 | 3300035692 | Bacteria | 3515 |
| 479 | Ga0373935_0489250 | 3300035692 | Bacteria | 892 |
| 480 | Ga0373935_0521708 | 3300035692 | Bacteria | 864 |
| 481 | Ga0373927_0064151 | 3300035695 | Bacteria | 2376 |
| 482 | Ga0373927_0484655 | 3300035695 | Bacteria | 817 |
| 483 | Ga0373933_0484017 | 3300035724 | Bacteria | 810 |
| 484 | Ga0373933_0871173 | 3300035724 | Bacteria | 593 |
| 485 | Ga0373947_0011709 | 3300035725 | Bacteria | 5027 |
| 486 | Ga0373947_0835731 | 3300035725 | Bacteria | 629 |
| 487 | Ga0373937_0062577 | 3300036401 | Bacteria | 3421 |
| 488 | Ga0373937_0070199 | 3300036401 | Bacteria | 3231 |
| 489 | Ga0373937_0190143 | 3300036401 | Bacteria | 1929 |
| 490 | Ga0373937_0775839 | 3300036401 | Bacteria | 906 |
| 491 | Ga0316584_0280293 | 3300036712 | Bacteria | 1211 |
| 492 | Ga0373925_0002514 | 3300037068 | Bacteria | 14651 |
| 493 | Ga0373925_0041086 | 3300037068 | Bacteria | 3426 |
| 494 | Ga0395899_0001783 | 3300037312 | Bacteria | 17833 |
| 495 | Ga0395899_0185656 | 3300037312 | Bacteria | 1457 |
| 496 | Ga0395900_0001968 | 3300037418 | Bacteria | 23201 |
| 497 | Ga0395900_0072243 | 3300037418 | Bacteria | 3548 |
| 498 | Ga0395900_0098142 | 3300037418 | Bacteria | 3010 |
| 499 | Ga0395900_1109535 | 3300037418 | Bacteria | 708 |
| 500 | Ga0395898_0001813 | 3300037466 | Bacteria | 27601 |
| 501 | Ga0395898_0070051 | 3300037466 | Bacteria | 3392 |
| 502 | Ga0395898_0172906 | 3300037466 | Bacteria | 2065 |
| 503 | Ga0395898_0359028 | 3300037466 | Bacteria | 1389 |
| 504 | Ga0395905_0002986 | 3300037471 | Bacteria | 18360 |
| 505 | Ga0395905_0904095 | 3300037471 | Bacteria | 786 |
| 506 | Ga0395905_1104307 | 3300037471 | Bacteria | 696 |
| 507 | Ga0316581_0171426 | 3300037588 | Bacteria | 669 |
| 508 | Ga0436364_0731250 | 3300037853 | Bacteria | 1276 |
| 509 | Ga0436364_1442444 | 3300037853 | Bacteria | 2695 |
| 510 | Ga0395901_0045308 | 3300038443 | Bacteria | 4564 |
| 511 | Ga0395901_0130246 | 3300038443 | Bacteria | 2643 |
| 512 | Ga0395901_1554232 | 3300038443 | Bacteria | 616 |
| 513 | Ga0395901_1984243 | 3300038443 | Bacteria | 528 |
| 514 | Ga0436365_0544722 | 3300039437 | Bacteria | 16758 |
| 515 | Ga0436365_1637588 | 3300039437 | Bacteria | 49130 |
| 516 | Ga0436360_0360048 | 3300039438 | Bacteria | 2053 |
| 517 | Ga0436360_0716296 | 3300039438 | Bacteria | 2775 |
| 518 | Ga0436360_1015806 | 3300039438 | Bacteria | 789 |
| 519 | Ga0436361_0698348 | 3300039447 | Bacteria | 1269 |
| 520 | Ga0436363_0427400 | 3300039450 | Bacteria | 3997 |
| 521 | Ga0436363_0896516 | 3300039450 | Bacteria | 1486 |
| 522 | Ga0436363_1234183 | 3300039450 | Bacteria | 784 |
| 523 | Ga0436363_1470856 | 3300039450 | Bacteria | 3937 |
| 524 | Ga0436362_0133744 | 3300039453 | Bacteria | 5063 |
| 525 | Ga0439460_0207078 | 3300042461 | Bacteria | 669 |
| 526 | Ga0466963_0654836 | 3300044694 | Bacteria | 741 |
| 527 | Ga0466963_1048507 | 3300044694 | Bacteria | 574 |
| 528 | Ga0466963_1080032 | 3300044694 | Bacteria | 565 |
| 529 | Ga0466957_0134071 | 3300044842 | Bacteria | 1590 |
| 530 | Ga0466959_1068813 | 3300045049 | Bacteria | 537 |
| 531 | Ga0466959_1083066 | 3300045049 | Bacteria | 533 |
| 532 | Ga0466967_0059567 | 3300045976 | Bacteria | 3380 |
| 533 | Ga0466967_1086811 | 3300045976 | Bacteria | 797 |
| 534 | Ga0466967_1373626 | 3300045976 | Bacteria | 703 |
| 535 | Ga0495592_0176228 | 3300046454 | Bacteria | 1460 |
| 536 | Ga0495592_0737513 | 3300046454 | Bacteria | 590 |
| 537 | Ga0495603_0163932 | 3300046455 | Bacteria | 1289 |
| 538 | Ga0495590_0022080 | 3300046457 | Bacteria | 2252 |
| 539 | Ga0495629_0686141 | 3300046459 | Bacteria | 681 |
| 540 | Ga0495638_0366879 | 3300046460 | Bacteria | 756 |
| 541 | Ga0495653_0881506 | 3300046463 | Unclassified | 534 |
| 542 | Ga0495580_0182626 | 3300046472 | Bacteria | 1448 |
| 543 | Ga0495580_0387970 | 3300046472 | Bacteria | 943 |
| 544 | Ga0495582_0532630 | 3300046473 | Bacteria | 679 |
| 545 | Ga0495582_0653216 | 3300046473 | Bacteria | 609 |
| 546 | Ga0495605_0155621 | 3300046474 | Bacteria | 1017 |
| 547 | Ga0495605_0215543 | 3300046474 | Bacteria | 831 |
| 548 | Ga0495662_0094538 | 3300046476 | Bacteria | 1460 |
| 549 | Ga0495662_0405102 | 3300046476 | Bacteria | 670 |
| 550 | Ga0495664_0034829 | 3300046477 | Bacteria | 2963 |
| 551 | Ga0495584_0628674 | 3300046491 | Bacteria | 547 |
| 552 | Ga0495594_0209466 | 3300046499 | Bacteria | 1111 |
| 553 | Ga0495608_0843667 | 3300046511 | Bacteria | 539 |
| 554 | Ga0495628_0094702 | 3300046516 | Bacteria | 2308 |
| 555 | Ga0495630_0440961 | 3300046517 | Bacteria | 998 |
| 556 | Ga0495630_0720911 | 3300046517 | Bacteria | 763 |
| 557 | Ga0495642_0031203 | 3300046528 | Bacteria | 2136 |
| 558 | Ga0495652_0445585 | 3300046529 | Bacteria | 907 |
| 559 | Ga0495654_0052557 | 3300046530 | Bacteria | 1983 |
| 560 | Ga0495654_0140206 | 3300046530 | Bacteria | 1078 |
| 561 | Ga0495586_0076681 | 3300046535 | Bacteria | 1832 |
| 562 | Ga0495586_0907405 | 3300046535 | Bacteria | 508 |
| 563 | Ga0495587_0166062 | 3300046536 | Bacteria | 1255 |
| 564 | Ga0495587_0204496 | 3300046536 | Bacteria | 1116 |
| 565 | Ga0495587_0483584 | 3300046536 | Bacteria | 685 |
| 566 | Ga0495645_0086993 | 3300046543 | Bacteria | 2236 |
| 567 | Ga0495645_0219231 | 3300046543 | Bacteria | 1280 |
| 568 | Ga0495645_0410490 | 3300046543 | Bacteria | 861 |
| 569 | Ga0495622_0003379 | 3300046557 | Bacteria | 7527 |
| 570 | Ga0495622_0005205 | 3300046557 | Bacteria | 6029 |
| 571 | Ga0495622_0149869 | 3300046557 | Bacteria | 1056 |
| 572 | Ga0495667_0525319 | 3300046559 | Bacteria | 740 |
| 573 | Ga0495668_0516729 | 3300046616 | Bacteria | 658 |
| 574 | Ga0495611_0052065 | 3300046648 | Bacteria | 1846 |
| 575 | Ga0495657_0725526 | 3300046675 | Bacteria | 570 |
| 576 | Ga0495623_0242409 | 3300046679 | Bacteria | 1018 |
| 577 | Ga0495623_0386276 | 3300046679 | Bacteria | 756 |
| 578 | Ga0495646_0447941 | 3300046680 | Bacteria | 667 |
| 579 | Ga0495647_0035217 | 3300046681 | Bacteria | 1879 |
| 580 | Ga0495658_0303205 | 3300046683 | Bacteria | 1011 |
| 581 | Ga0495658_0510622 | 3300046683 | Bacteria | 769 |
| 582 | Ga0495658_0529345 | 3300046683 | Bacteria | 754 |
| 583 | Ga0495669_0166595 | 3300046684 | Bacteria | 1047 |
| 584 | Ga0495613_0311412 | 3300046689 | Bacteria | 1088 |
| 585 | Ga0495613_0901380 | 3300046689 | Bacteria | 572 |
| 586 | Ga0495649_0014806 | 3300046694 | Bacteria | 4457 |
| 587 | Ga0495589_0093052 | 3300046794 | Bacteria | 1463 |
| 588 | Ga0495600_0808155 | 3300046809 | Bacteria | 558 |
| 589 | Ga0495604_0810753 | 3300047317 | Bacteria | 589 |
| 590 | Ga0495674_0361879 | 3300047319 | Bacteria | 1176 |
| 591 | Ga0495674_0465109 | 3300047319 | Bacteria | 1015 |
| 592 | Ga0495674_0769576 | 3300047319 | Bacteria | 751 |
| 593 | Ga0495672_0010923 | 3300047320 | Bacteria | 6440 |
| 594 | Ga0495683_0134375 | 3300047323 | Bacteria | 1164 |
| 595 | Ga0495675_0062651 | 3300047444 | Bacteria | 2354 |
| 596 | Ga0495675_0269418 | 3300047444 | Bacteria | 1018 |
| 597 | Ga0495673_0050671 | 3300047469 | Bacteria | 1821 |
| 598 | Ga0495684_0119581 | 3300047471 | Bacteria | 1985 |
| 599 | Ga0495684_0193448 | 3300047471 | Bacteria | 1503 |
| 600 | Ga0495684_0303399 | 3300047471 | Bacteria | 1146 |
| 601 | Ga0495686_0402976 | 3300047472 | Bacteria | 734 |
| 602 | Ga0495686_0429040 | 3300047472 | Bacteria | 705 |
| 603 | Ga0495593_0131793 | 3300047673 | Bacteria | 1269 |
| 604 | Ga0495593_0163719 | 3300047673 | Bacteria | 1122 |
| 605 | Ga0495602_0175950 | 3300048088 | Bacteria | 1656 |
| 606 | Ga0495602_0838259 | 3300048088 | Bacteria | 615 |
| 607 | Ga0495614_0272439 | 3300048089 | Bacteria | 778 |
| 608 | Ga0496107_0510076 | 3300048910 | Bacteria | 892 |
| 609 | Ga0496115_0089908 | 3300048918 | Bacteria | 2508 |
| 610 | Ga0496115_0490803 | 3300048918 | Bacteria | 988 |
| 611 | Ga0496126_0000480 | 3300048929 | Bacteria | 79257 |
| 612 | Ga0495682_0005207 | 3300049460 | Bacteria | 5432 |
| 613 | Ga0501031_0068962 | 3300049568 | Bacteria | 2303 |
| 614 | Ga0501031_0093984 | 3300049568 | Bacteria | 1957 |
| 615 | Ga0501032_0000374 | 3300049569 | Bacteria | 36951 |
| 616 | Ga0501032_0004362 | 3300049569 | Bacteria | 10681 |
| 617 | Ga0501032_0059736 | 3300049569 | Bacteria | 2558 |
| 618 | Ga0501032_0145528 | 3300049569 | Bacteria | 1560 |
| 619 | Ga0501032_0151835 | 3300049569 | Bacteria | 1523 |
| 620 | Ga0501032_0178940 | 3300049569 | Bacteria | 1389 |
| 621 | Ga0501033_0012240 | 3300049570 | Bacteria | 6548 |
| 622 | Ga0501033_0036296 | 3300049570 | Bacteria | 3693 |
| 623 | Ga0501033_0042785 | 3300049570 | Bacteria | 3376 |
| 624 | Ga0501033_0048667 | 3300049570 | Bacteria | 3148 |
| 625 | Ga0501033_0312057 | 3300049570 | Bacteria | 1105 |
| 626 | Ga0501033_0371078 | 3300049570 | Bacteria | 1000 |
| 627 | Ga0501033_0678126 | 3300049570 | Bacteria | 702 |
| 628 | Ga0501033_0784380 | 3300049570 | Bacteria | 645 |
| 629 | Ga0501034_0010632 | 3300049571 | Bacteria | 9573 |
| 630 | Ga0501034_0027593 | 3300049571 | Bacteria | 5774 |
| 631 | Ga0501034_0091835 | 3300049571 | Bacteria | 3033 |
| 632 | Ga0501034_0132960 | 3300049571 | Bacteria | 2471 |
| 633 | Ga0501034_0133506 | 3300049571 | Bacteria | 2464 |
| 634 | Ga0501034_0171039 | 3300049571 | Bacteria | 2140 |
| 635 | Ga0501034_0251625 | 3300049571 | Bacteria | 1711 |
| 636 | Ga0501034_0310860 | 3300049571 | Bacteria | 1510 |
| 637 | Ga0501034_0588000 | 3300049571 | Bacteria | 1019 |
| 638 | Ga0501034_0634386 | 3300049571 | Bacteria | 971 |
| 639 | Ga0501034_0901392 | 3300049571 | Bacteria | 772 |
| 640 | Ga0501034_1010260 | 3300049571 | Bacteria | 715 |
| 641 | Ga0501036_0005653 | 3300049572 | Bacteria | 10145 |
| 642 | Ga0501036_0158426 | 3300049572 | Bacteria | 1909 |
| 643 | Ga0501036_0748769 | 3300049572 | Bacteria | 806 |
| 644 | Ga0501036_0829619 | 3300049572 | Bacteria | 761 |
| 645 | Ga0501036_0880700 | 3300049572 | Bacteria | 735 |
| 646 | Ga0501037_0000862 | 3300049573 | Bacteria | 22616 |
| 647 | Ga0501037_0024753 | 3300049573 | Bacteria | 4438 |
| 648 | Ga0501037_0305201 | 3300049573 | Bacteria | 1104 |
| 649 | Ga0501037_0379472 | 3300049573 | Bacteria | 972 |
| 650 | Ga0501037_0396332 | 3300049573 | Bacteria | 947 |
| 651 | Ga0501037_0441735 | 3300049573 | Bacteria | 888 |
| 652 | Ga0501037_0675967 | 3300049573 | Bacteria | 689 |
| 653 | Ga0501037_0784376 | 3300049573 | Bacteria | 630 |
| 654 | Ga0501038_0088134 | 3300049574 | Bacteria | 2605 |
| 655 | Ga0501038_0116476 | 3300049574 | Bacteria | 2208 |
| 656 | Ga0501038_0131687 | 3300049574 | Bacteria | 2052 |
| 657 | Ga0501038_0147189 | 3300049574 | Bacteria | 1922 |
| 658 | Ga0501038_0298230 | 3300049574 | Bacteria | 1265 |
| 659 | Ga0501038_0349287 | 3300049574 | Bacteria | 1152 |
| 660 | Ga0501038_0931781 | 3300049574 | Bacteria | 640 |
| 661 | Ga0501039_0019053 | 3300049575 | Bacteria | 5264 |
| 662 | Ga0501039_0222759 | 3300049575 | Bacteria | 1483 |
| 663 | Ga0501039_0797474 | 3300049575 | Bacteria | 737 |
| 664 | Ga0501040_0339923 | 3300049576 | Bacteria | 1075 |
| 665 | Ga0501040_1437391 | 3300049576 | Bacteria | 501 |
| 666 | Ga0501041_0090359 | 3300049577 | Bacteria | 1891 |
| 667 | Ga0501042_0098300 | 3300049578 | Bacteria | 2105 |
| 668 | Ga0501042_0766414 | 3300049578 | Bacteria | 702 |
| 669 | Ga0501043_0010388 | 3300049579 | Bacteria | 7296 |
| 670 | Ga0501043_0014584 | 3300049579 | Bacteria | 6152 |
| 671 | Ga0501043_0045694 | 3300049579 | Bacteria | 3444 |
| 672 | Ga0501043_0076142 | 3300049579 | Bacteria | 2636 |
| 673 | Ga0501043_0097012 | 3300049579 | Bacteria | 2317 |
| 674 | Ga0501043_0160092 | 3300049579 | Bacteria | 1759 |
| 675 | Ga0501043_0228594 | 3300049579 | Bacteria | 1437 |
| 676 | Ga0501043_0286820 | 3300049579 | Bacteria | 1261 |
| 677 | Ga0501043_0539165 | 3300049579 | Bacteria | 868 |
| 678 | Ga0501046_0005416 | 3300049580 | Bacteria | 11410 |
| 679 | Ga0501046_0011762 | 3300049580 | Bacteria | 7472 |
| 680 | Ga0501046_0012992 | 3300049580 | Bacteria | 7068 |
| 681 | Ga0501046_0393012 | 3300049580 | Bacteria | 1002 |
| 682 | Ga0501046_0397334 | 3300049580 | Bacteria | 996 |
| 683 | Ga0501046_0560881 | 3300049580 | Bacteria | 813 |
| 684 | Ga0501046_0845046 | 3300049580 | Bacteria | 640 |
| 685 | Ga0501047_0002319 | 3300049581 | Bacteria | 18206 |
| 686 | Ga0501047_0014860 | 3300049581 | Bacteria | 7410 |
| 687 | Ga0501047_0016976 | 3300049581 | Bacteria | 6961 |
| 688 | Ga0501047_0033976 | 3300049581 | Bacteria | 4923 |
| 689 | Ga0501047_0037637 | 3300049581 | Bacteria | 4678 |
| 690 | Ga0501047_0054048 | 3300049581 | Bacteria | 3885 |
| 691 | Ga0501047_0065087 | 3300049581 | Bacteria | 3514 |
| 692 | Ga0501047_0079044 | 3300049581 | Bacteria | 3163 |
| 693 | Ga0501047_0131220 | 3300049581 | Bacteria | 2386 |
| 694 | Ga0501047_0171826 | 3300049581 | Bacteria | 2036 |
| 695 | Ga0501047_0176653 | 3300049581 | Bacteria | 2003 |
| 696 | Ga0501047_0251827 | 3300049581 | Bacteria | 1614 |
| 697 | Ga0501047_0375584 | 3300049581 | Bacteria | 1256 |
| 698 | Ga0501047_0441537 | 3300049581 | Bacteria | 1131 |
| 699 | Ga0501047_0736199 | 3300049581 | Bacteria | 802 |
| 700 | Ga0501048_0023812 | 3300049582 | Bacteria | 4471 |
| 701 | Ga0501048_0209717 | 3300049582 | Bacteria | 1382 |
| 702 | Ga0501048_0476971 | 3300049582 | Bacteria | 894 |
| 703 | Ga0501048_0732607 | 3300049582 | Bacteria | 710 |
| 704 | Ga0501048_0749050 | 3300049582 | Bacteria | 702 |
| 705 | Ga0501048_1136496 | 3300049582 | Bacteria | 562 |
| 706 | Ga0501067_0001776 | 3300049583 | Bacteria | 11844 |
| 707 | Ga0501068_0077512 | 3300049584 | Bacteria | 2035 |
| 708 | Ga0501069_0022165 | 3300049585 | Bacteria | 3452 |
| 709 | Ga0501070_0014964 | 3300049586 | Bacteria | 6527 |
| 710 | Ga0501070_0143912 | 3300049586 | Bacteria | 1968 |
| 711 | Ga0501070_0382617 | 3300049586 | Bacteria | 1140 |
| 712 | Ga0501070_0449010 | 3300049586 | Bacteria | 1040 |
| 713 | Ga0501070_0514861 | 3300049586 | Bacteria | 960 |
| 714 | Ga0501071_0156932 | 3300049587 | Bacteria | 1699 |
| 715 | Ga0501071_0756795 | 3300049587 | Bacteria | 749 |
| 716 | Ga0501072_0097056 | 3300049588 | Bacteria | 2342 |
| 717 | Ga0501072_0777805 | 3300049588 | Bacteria | 750 |
| 718 | Ga0501072_0871679 | 3300049588 | Bacteria | 704 |
| 719 | Ga0501073_0001669 | 3300049589 | Bacteria | 16438 |
| 720 | Ga0501073_0013850 | 3300049589 | Bacteria | 5864 |
| 721 | Ga0501073_0036603 | 3300049589 | Bacteria | 3487 |
| 722 | Ga0501073_0059886 | 3300049589 | Bacteria | 2658 |
| 723 | Ga0501073_0070275 | 3300049589 | Bacteria | 2439 |
| 724 | Ga0501073_0255902 | 3300049589 | Bacteria | 1209 |
| 725 | Ga0501073_0388203 | 3300049589 | Bacteria | 965 |
| 726 | Ga0501074_0004453 | 3300049590 | Bacteria | 10023 |
| 727 | Ga0501074_0079197 | 3300049590 | Bacteria | 2358 |
| 728 | Ga0501074_1250547 | 3300049590 | Bacteria | 520 |
| 729 | Ga0501076_0673885 | 3300049592 | Bacteria | 854 |
| 730 | Ga0501077_0316586 | 3300049593 | Bacteria | 995 |
| 731 | Ga0501079_0001478 | 3300049741 | Bacteria | 16629 |
| 732 | Ga0501079_0140727 | 3300049741 | Bacteria | 1880 |
| 733 | Ga0501079_0567026 | 3300049741 | Bacteria | 893 |
| 734 | Ga0501079_1311378 | 3300049741 | Bacteria | 570 |
| 735 | Ga0501079_1352196 | 3300049741 | Bacteria | 561 |
| 736 | Ga0501080_0040364 | 3300049742 | Bacteria | 4353 |
| 737 | Ga0501080_0043846 | 3300049742 | Bacteria | 4165 |
| 738 | Ga0501080_0125187 | 3300049742 | Bacteria | 2380 |
| 739 | Ga0501080_0164344 | 3300049742 | Bacteria | 2049 |
| 740 | Ga0501080_0283362 | 3300049742 | Bacteria | 1506 |
| 741 | Ga0501080_0596113 | 3300049742 | Bacteria | 981 |
| 742 | Ga0501080_0675815 | 3300049742 | Bacteria | 912 |
| 743 | Ga0501080_0683144 | 3300049742 | Bacteria | 906 |
| 744 | Ga0501080_0882512 | 3300049742 | Bacteria | 780 |
| 745 | Ga0501080_1481032 | 3300049742 | Bacteria | 577 |
| 746 | Ga0501081_0195365 | 3300049743 | Bacteria | 1466 |
| 747 | Ga0501083_0052937 | 3300049744 | Bacteria | 2725 |
| 748 | Ga0501083_0135923 | 3300049744 | Bacteria | 1611 |
| 749 | Ga0501083_0425632 | 3300049744 | Bacteria | 864 |
| 750 | Ga0501035_0019622 | 3300049822 | Bacteria | 6212 |
| 751 | Ga0501035_0044851 | 3300049822 | Bacteria | 3979 |
| 752 | Ga0501035_0048543 | 3300049822 | Bacteria | 3807 |
| 753 | Ga0501035_0085166 | 3300049822 | Bacteria | 2786 |
| 754 | Ga0501035_0368131 | 3300049822 | Bacteria | 1200 |
| 755 | Ga0501035_0529788 | 3300049822 | Bacteria | 967 |
| 756 | Ga0501035_0667321 | 3300049822 | Bacteria | 841 |
| 757 | Ga0501035_0810133 | 3300049822 | Bacteria | 747 |
| 758 | Ga0501035_0936218 | 3300049822 | Bacteria | 684 |
| 759 | Ga0501035_0991956 | 3300049822 | Bacteria | 661 |
| 760 | Ga0501044_0015755 | 3300049823 | Bacteria | 8141 |
| 761 | Ga0501044_0024878 | 3300049823 | Bacteria | 6351 |
| 762 | Ga0501044_0027898 | 3300049823 | Bacteria | 5959 |
| 763 | Ga0501044_0061775 | 3300049823 | Bacteria | 3832 |
| 764 | Ga0501044_0114803 | 3300049823 | Bacteria | 2698 |
| 765 | Ga0501044_0129184 | 3300049823 | Bacteria | 2522 |
| 766 | Ga0501044_0161480 | 3300049823 | Bacteria | 2217 |
| 767 | Ga0501044_0426141 | 3300049823 | Bacteria | 1236 |
| 768 | Ga0501044_0456898 | 3300049823 | Bacteria | 1183 |
| 769 | Ga0501044_0984593 | 3300049823 | Bacteria | 715 |
| 770 | Ga0501044_1016818 | 3300049823 | Bacteria | 700 |
| 771 | Ga0501044_1281205 | 3300049823 | Bacteria | 600 |
| 772 | Ga0501044_1519932 | 3300049823 | Bacteria | 534 |
| 773 | Ga0501045_0128835 | 3300049824 | Bacteria | 1881 |
| 774 | Ga0501045_0626636 | 3300049824 | Bacteria | 796 |
| 775 | nmdc:mga03683_193205_c1 | 3300050489 | Bacteria | 932 |
| 776 | nmdc:mga0k408_3076_c1 | 3300050493 | Bacteria | 8839 |
| 777 | nmdc:mga09592_641289_c1 | 3300050508 | Bacteria | 907 |
| 778 | nmdc:mga0qj67_1078800_c1 | 3300050509 | Bacteria | 628 |
| 779 | nmdc:mga08y16_19140_c1 | 3300050511 | Bacteria | 7214 |
| 780 | nmdc:mga0a205_171156_c1 | 3300050515 | Bacteria | 2068 |
| 781 | Ga0500635_0249855 | 3300053080 | Bacteria | 695 |
| 782 | Ga0500635_0307042 | 3300053080 | Bacteria | 626 |
| 783 | Ga0500646_0206960 | 3300053090 | Bacteria | 675 |
| 784 | Ga0500555_039510 | 3300053103 | Bacteria | 1317 |
| 785 | Ga0500594_0012014 | 3300053118 | Bacteria | 2032 |
| 786 | Ga0500595_001661 | 3300053119 | Bacteria | 11694 |
| 787 | Ga0500595_048974 | 3300053119 | Bacteria | 1318 |
| 788 | Ga0500595_142011 | 3300053119 | Bacteria | 673 |
| 789 | Ga0500595_163432 | 3300053119 | Bacteria | 620 |
| 790 | Ga0500655_006392 | 3300053133 | Bacteria | 2121 |
| 791 | Ga0500559_0087609 | 3300053136 | Bacteria | 1422 |
| 792 | Ga0500561_0041694 | 3300053137 | Bacteria | 1215 |
| 793 | Ga0500568_0047421 | 3300053139 | Bacteria | 1702 |
| 794 | Ga0500573_0339658 | 3300053140 | Bacteria | 734 |
| 795 | Ga0500637_0075513 | 3300053178 | Bacteria | 1942 |
| 796 | Ga0500645_075788 | 3300053730 | Bacteria | 962 |
| 797 | Ga0501084_0000175 | 3300054114 | Bacteria | 50123 |
| 798 | Ga0501084_0007620 | 3300054114 | Bacteria | 8925 |
| 799 | Ga0501082_0006964 | 3300060353 | Bacteria | 9766 |
| 800 | Ga0501082_0069701 | 3300060353 | Bacteria | 3028 |
| 801 | Ga0530510_0238077 | 3300061734 | Bacteria | 1355 |
| 802 | Ga0530510_1292128 | 3300061734 | Bacteria | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0731250 | Ga0436364_0731250_481_843 | 96 |
| 2 | 3300005456 | Ga0070678_100069504 | Ga0070678_1000695044 | 98 |
| 3 | 3300025893 | Ga0207682_10329141 | Ga0207682_103291412 | 98 |
| 4 | 3300025931 | Ga0207644_11594106 | Ga0207644_115941061 | 98 |
| 5 | 3300026121 | Ga0207683_10103171 | Ga0207683_101031716 | 98 |
| 6 | 3300005364 | Ga0070673_102333163 | Ga0070673_1023331631 | 100 |
| 7 | 3300005327 | Ga0070658_11848839 | Ga0070658_118488391 | 101 |
| 8 | 3300005435 | Ga0070714_101310504 | Ga0070714_1013105041 | 101 |
| 9 | 3300005616 | Ga0068852_101342339 | Ga0068852_1013423392 | 101 |
| 10 | 3300026142 | Ga0207698_10431881 | Ga0207698_104318812 | 101 |
| 11 | 3300039447 | Ga0436361_0698348 | Ga0436361_0698348_321_683 | 101 |
| 12 | 3300049589 | Ga0501073_0388203 | Ga0501073_0388203_426_788 | 101 |
| 13 | 3300047472 | Ga0495686_0402976 | Ga0495686_0402976_187_555 | 102 |
| 14 | 3300005327 | Ga0070658_10480992 | Ga0070658_104809922 | 103 |
| 15 | 3300026116 | Ga0207674_10600064 | Ga0207674_106000642 | 103 |
| 16 | 3300028786 | Ga0307517_10244892 | Ga0307517_102448922 | 103 |
| 17 | 3300049571 | Ga0501034_0310860 | Ga0501034_0310860_1159_1473 | 103 |
| 18 | 3300035089 | Ga0373944_0378439 | Ga0373944_0378439_145_507 | 104 |
| 19 | 3300061734 | Ga0530510_1292128 | Ga0530510_1292128_191_508 | 104 |
| 20 | 3300039438 | Ga0436360_1015806 | Ga0436360_1015806_66_431 | 105 |
| 21 | 3300046472 | Ga0495580_0182626 | Ga0495580_0182626_395_760 | 105 |
| 22 | 3300005329 | Ga0070683_100461762 | Ga0070683_1004617622 | 106 |
| 23 | 3300005439 | Ga0070711_101119623 | Ga0070711_1011196232 | 106 |
| 24 | 3300005535 | Ga0070684_100283884 | Ga0070684_1002838841 | 106 |
| 25 | 3300005614 | Ga0068856_102058554 | Ga0068856_1020585542 | 106 |
| 26 | 3300006173 | Ga0070716_100443022 | Ga0070716_1004430222 | 106 |
| 27 | 3300009176 | Ga0105242_10284153 | Ga0105242_102841532 | 106 |
| 28 | 3300013296 | Ga0157374_11811589 | Ga0157374_118115892 | 106 |
| 29 | 3300025926 | Ga0207659_11878713 | Ga0207659_118787131 | 106 |
| 30 | 3300025927 | Ga0207687_10721741 | Ga0207687_107217412 | 106 |
| 31 | 3300025934 | Ga0207686_10571050 | Ga0207686_105710502 | 106 |
| 32 | 3300026078 | Ga0207702_11918977 | Ga0207702_119189772 | 106 |
| 33 | 3300035170 | Ga0373943_0458592 | Ga0373943_0458592_285_647 | 106 |
| 34 | 3300035410 | Ga0373924_0016976 | Ga0373924_0016976_1319_1681 | 106 |
| 35 | 3300035691 | Ga0373931_0111163 | Ga0373931_0111163_794_1156 | 106 |
| 36 | 3300035692 | Ga0373935_0027495 | Ga0373935_0027495_2671_3033 | 106 |
| 37 | 3300035724 | Ga0373933_0871173 | Ga0373933_0871173_92_454 | 106 |
| 38 | 3300036401 | Ga0373937_0062577 | Ga0373937_0062577_1157_1519 | 106 |
| 39 | 3300037068 | Ga0373925_0041086 | Ga0373925_0041086_2076_2438 | 106 |
| 40 | 3300046459 | Ga0495629_0686141 | Ga0495629_0686141_251_613 | 106 |
| 41 | 3300046689 | Ga0495613_0901380 | Ga0495613_0901380_153_515 | 106 |
| 42 | 3300047471 | Ga0495684_0193448 | Ga0495684_0193448_72_434 | 106 |
| 43 | 3300004803 | Ga0058862_12178484 | Ga0058862_121784842 | 108 |
| 44 | 3300005336 | Ga0070680_100002998 | Ga0070680_10000299811 | 108 |
| 45 | 3300005458 | Ga0070681_10000037 | Ga0070681_1000003719 | 108 |
| 46 | 3300005530 | Ga0070679_100008411 | Ga0070679_10000841119 | 108 |
| 47 | 3300006852 | Ga0075433_11605667 | Ga0075433_116056671 | 108 |
| 48 | 3300010375 | Ga0105239_10005584 | Ga0105239_100055844 | 108 |
| 49 | 3300013105 | Ga0157369_11176015 | Ga0157369_111760152 | 108 |
| 50 | 3300025912 | Ga0207707_10000011 | Ga0207707_1000001119 | 108 |
| 51 | 3300025917 | Ga0207660_10003537 | Ga0207660_1000353719 | 108 |
| 52 | 3300025921 | Ga0207652_10000824 | Ga0207652_1000082425 | 108 |
| 53 | 3300027907 | Ga0207428_10760687 | Ga0207428_107606872 | 108 |
| 54 | 3300050515 | nmdc:mga0a205_171156_c1 | nmdc:mga0a205_171156_c1_1691_2056 | 108 |
| 55 | 3300005618 | Ga0068864_100366305 | Ga0068864_1003663053 | 109 |
| 56 | 3300025921 | Ga0207652_11446107 | Ga0207652_114461072 | 109 |
| 57 | 3300049569 | Ga0501032_0151835 | Ga0501032_0151835_972_1328 | 109 |
| 58 | 3300049570 | Ga0501033_0784380 | Ga0501033_0784380_193_549 | 109 |
| 59 | 3300049571 | Ga0501034_0588000 | Ga0501034_0588000_285_641 | 109 |
| 60 | 3300049579 | Ga0501043_0045694 | Ga0501043_0045694_2712_3068 | 109 |
| 61 | 3300049581 | Ga0501047_0002319 | Ga0501047_0002319_9436_9792 | 109 |
| 62 | 3300049582 | Ga0501048_0732607 | Ga0501048_0732607_190_546 | 109 |
| 63 | 3300049589 | Ga0501073_0255902 | Ga0501073_0255902_480_836 | 109 |
| 64 | 3300049822 | Ga0501035_0991956 | Ga0501035_0991956_62_418 | 109 |
| 65 | 3300025921 | Ga0207652_10563142 | Ga0207652_105631422 | 110 |
| 66 | 3300035083 | Ga0373926_0438532 | Ga0373926_0438532_105_470 | 110 |
| 67 | 3300035089 | Ga0373944_0332856 | Ga0373944_0332856_158_523 | 110 |
| 68 | 3300035725 | Ga0373947_0835731 | Ga0373947_0835731_71_436 | 110 |
| 69 | 3300046681 | Ga0495647_0035217 | Ga0495647_0035217_969_1334 | 110 |
| 70 | 3300047471 | Ga0495684_0303399 | Ga0495684_0303399_590_955 | 110 |
| 71 | 3300021377 | Ga0213874_10002785 | Ga0213874_100027854 | 111 |
| 72 | 3300039450 | Ga0436363_0427400 | Ga0436363_0427400_2544_2900 | 111 |
| 73 | 3300005434 | Ga0070709_10807109 | Ga0070709_108071092 | 113 |
| 74 | 3300005435 | Ga0070714_100911275 | Ga0070714_1009112752 | 113 |
| 75 | 3300005436 | Ga0070713_102368412 | Ga0070713_1023684121 | 113 |
| 76 | 3300005441 | Ga0070700_101777987 | Ga0070700_1017779871 | 113 |
| 77 | 3300005563 | Ga0068855_101740178 | Ga0068855_1017401782 | 113 |
| 78 | 3300005614 | Ga0068856_101982439 | Ga0068856_1019824392 | 113 |
| 79 | 3300006175 | Ga0070712_100113045 | Ga0070712_1001130452 | 113 |
| 80 | 3300009093 | Ga0105240_11080765 | Ga0105240_110807652 | 113 |
| 81 | 3300009545 | Ga0105237_10119273 | Ga0105237_101192735 | 113 |
| 82 | 3300009551 | Ga0105238_10322009 | Ga0105238_103220092 | 113 |
| 83 | 3300009551 | Ga0105238_10738831 | Ga0105238_107388312 | 113 |
| 84 | 3300010375 | Ga0105239_10026360 | Ga0105239_1002636012 | 113 |
| 85 | 3300013307 | Ga0157372_10066383 | Ga0157372_100663836 | 113 |
| 86 | 3300021377 | Ga0213874_10006777 | Ga0213874_100067771 | 113 |
| 87 | 3300021384 | Ga0213876_10000421 | Ga0213876_1000042120 | 113 |
| 88 | 3300025913 | Ga0207695_10753082 | Ga0207695_107530822 | 113 |
| 89 | 3300025915 | Ga0207693_10054085 | Ga0207693_100540855 | 113 |
| 90 | 3300025928 | Ga0207700_11621987 | Ga0207700_116219872 | 113 |
| 91 | 3300025929 | Ga0207664_10411486 | Ga0207664_104114862 | 113 |
| 92 | 3300025934 | Ga0207686_10826506 | Ga0207686_108265062 | 113 |
| 93 | 3300025944 | Ga0207661_11037548 | Ga0207661_110375482 | 113 |
| 94 | 3300026078 | Ga0207702_10791862 | Ga0207702_107918622 | 113 |
| 95 | 3300028800 | Ga0265338_10000401 | Ga0265338_1000040159 | 113 |
| 96 | 3300031235 | Ga0265330_10241361 | Ga0265330_102413612 | 113 |
| 97 | 3300031241 | Ga0265325_10183291 | Ga0265325_101832912 | 113 |
| 98 | 3300031247 | Ga0265340_10002869 | Ga0265340_1000286912 | 113 |
| 99 | 3300031595 | Ga0265313_10257425 | Ga0265313_102574252 | 113 |
| 100 | 3300035083 | Ga0373926_0376326 | Ga0373926_0376326_43_405 | 113 |
| 101 | 3300035692 | Ga0373935_0489250 | Ga0373935_0489250_231_593 | 113 |
| 102 | 3300039437 | Ga0436365_1637588 | Ga0436365_1637588_24490_24837 | 113 |
| 103 | 3300039450 | Ga0436363_1470856 | Ga0436363_1470856_1938_2285 | 113 |
| 104 | 3300045976 | Ga0466967_1373626 | Ga0466967_1373626_260_607 | 113 |
| 105 | 3300046460 | Ga0495638_0366879 | Ga0495638_0366879_318_662 | 113 |
| 106 | 3300046473 | Ga0495582_0532630 | Ga0495582_0532630_178_540 | 113 |
| 107 | 3300047472 | Ga0495686_0429040 | Ga0495686_0429040_336_680 | 113 |
| 108 | 3300048089 | Ga0495614_0272439 | Ga0495614_0272439_107_469 | 113 |
| 109 | 3300049569 | Ga0501032_0000374 | Ga0501032_0000374_28772_29143 | 113 |
| 110 | 3300049569 | Ga0501032_0178940 | Ga0501032_0178940_169_513 | 113 |
| 111 | 3300049570 | Ga0501033_0042785 | Ga0501033_0042785_253_624 | 113 |
| 112 | 3300049570 | Ga0501033_0048667 | Ga0501033_0048667_2733_3077 | 113 |
| 113 | 3300049570 | Ga0501033_0312057 | Ga0501033_0312057_318_665 | 113 |
| 114 | 3300049572 | Ga0501036_0158426 | Ga0501036_0158426_421_792 | 113 |
| 115 | 3300049572 | Ga0501036_0748769 | Ga0501036_0748769_156_503 | 113 |
| 116 | 3300049573 | Ga0501037_0000862 | Ga0501037_0000862_15407_15778 | 113 |
| 117 | 3300049573 | Ga0501037_0305201 | Ga0501037_0305201_447_794 | 113 |
| 118 | 3300049573 | Ga0501037_0396332 | Ga0501037_0396332_80_427 | 113 |
| 119 | 3300049573 | Ga0501037_0675967 | Ga0501037_0675967_72_416 | 113 |
| 120 | 3300049574 | Ga0501038_0116476 | Ga0501038_0116476_679_1026 | 113 |
| 121 | 3300049574 | Ga0501038_0131687 | Ga0501038_0131687_773_1144 | 113 |
| 122 | 3300049575 | Ga0501039_0797474 | Ga0501039_0797474_365_712 | 113 |
| 123 | 3300049579 | Ga0501043_0160092 | Ga0501043_0160092_47_391 | 113 |
| 124 | 3300049579 | Ga0501043_0228594 | Ga0501043_0228594_19_366 | 113 |
| 125 | 3300049580 | Ga0501046_0393012 | Ga0501046_0393012_177_521 | 113 |
| 126 | 3300049581 | Ga0501047_0033976 | Ga0501047_0033976_2231_2575 | 113 |
| 127 | 3300049581 | Ga0501047_0054048 | Ga0501047_0054048_1433_1804 | 113 |
| 128 | 3300049581 | Ga0501047_0375584 | Ga0501047_0375584_574_921 | 113 |
| 129 | 3300049581 | Ga0501047_0736199 | Ga0501047_0736199_284_628 | 113 |
| 130 | 3300049582 | Ga0501048_0476971 | Ga0501048_0476971_262_633 | 113 |
| 131 | 3300049586 | Ga0501070_0382617 | Ga0501070_0382617_37_384 | 113 |
| 132 | 3300049744 | Ga0501083_0425632 | Ga0501083_0425632_229_576 | 113 |
| 133 | 3300049822 | Ga0501035_0085166 | Ga0501035_0085166_2420_2767 | 113 |
| 134 | 3300049822 | Ga0501035_0667321 | Ga0501035_0667321_131_478 | 113 |
| 135 | 3300049822 | Ga0501035_0810133 | Ga0501035_0810133_149_493 | 113 |
| 136 | 3300049823 | Ga0501044_0061775 | Ga0501044_0061775_79_450 | 113 |
| 137 | 3300049823 | Ga0501044_0114803 | Ga0501044_0114803_1420_1764 | 113 |
| 138 | 3300049823 | Ga0501044_0456898 | Ga0501044_0456898_408_752 | 113 |
| 139 | 3300049823 | Ga0501044_0984593 | Ga0501044_0984593_321_668 | 113 |
| 140 | 3300049823 | Ga0501044_1281205 | Ga0501044_1281205_38_382 | 113 |
| 141 | 3300053118 | Ga0500594_0012014 | Ga0500594_0012014_903_1247 | 113 |
| 142 | 3300053139 | Ga0500568_0047421 | Ga0500568_0047421_666_1010 | 113 |
| 143 | 3300005327 | Ga0070658_10045521 | Ga0070658_100455213 | 114 |
| 144 | 3300005327 | Ga0070658_10201223 | Ga0070658_102012233 | 114 |
| 145 | 3300005328 | Ga0070676_10079075 | Ga0070676_100790753 | 114 |
| 146 | 3300005328 | Ga0070676_10461749 | Ga0070676_104617491 | 114 |
| 147 | 3300005329 | Ga0070683_100187688 | Ga0070683_1001876884 | 114 |
| 148 | 3300005330 | Ga0070690_100611209 | Ga0070690_1006112092 | 114 |
| 149 | 3300005331 | Ga0070670_100641089 | Ga0070670_1006410892 | 114 |
| 150 | 3300005334 | Ga0068869_100070091 | Ga0068869_1000700913 | 114 |
| 151 | 3300005334 | Ga0068869_101484553 | Ga0068869_1014845531 | 114 |
| 152 | 3300005335 | Ga0070666_10007106 | Ga0070666_100071067 | 114 |
| 153 | 3300005335 | Ga0070666_10693408 | Ga0070666_106934081 | 114 |
| 154 | 3300005336 | Ga0070680_100072787 | Ga0070680_1000727871 | 114 |
| 155 | 3300005336 | Ga0070680_100078879 | Ga0070680_1000788795 | 114 |
| 156 | 3300005338 | Ga0068868_100153898 | Ga0068868_1001538982 | 114 |
| 157 | 3300005339 | Ga0070660_100108074 | Ga0070660_1001080743 | 114 |
| 158 | 3300005339 | Ga0070660_100174288 | Ga0070660_1001742882 | 114 |
| 159 | 3300005341 | Ga0070691_10149346 | Ga0070691_101493462 | 114 |
| 160 | 3300005341 | Ga0070691_10342674 | Ga0070691_103426742 | 114 |
| 161 | 3300005343 | Ga0070687_101055869 | Ga0070687_1010558691 | 114 |
| 162 | 3300005344 | Ga0070661_100005946 | Ga0070661_1000059462 | 114 |
| 163 | 3300005344 | Ga0070661_100258902 | Ga0070661_1002589022 | 114 |
| 164 | 3300005344 | Ga0070661_101407850 | Ga0070661_1014078501 | 114 |
| 165 | 3300005355 | Ga0070671_100343504 | Ga0070671_1003435042 | 114 |
| 166 | 3300005356 | Ga0070674_102070568 | Ga0070674_1020705681 | 114 |
| 167 | 3300005364 | Ga0070673_100588849 | Ga0070673_1005888491 | 114 |
| 168 | 3300005365 | Ga0070688_100357639 | Ga0070688_1003576391 | 114 |
| 169 | 3300005365 | Ga0070688_100542982 | Ga0070688_1005429822 | 114 |
| 170 | 3300005366 | Ga0070659_100027373 | Ga0070659_1000273733 | 114 |
| 171 | 3300005366 | Ga0070659_100753457 | Ga0070659_1007534571 | 114 |
| 172 | 3300005366 | Ga0070659_101495690 | Ga0070659_1014956902 | 114 |
| 173 | 3300005367 | Ga0070667_100061525 | Ga0070667_1000615254 | 114 |
| 174 | 3300005367 | Ga0070667_100349423 | Ga0070667_1003494232 | 114 |
| 175 | 3300005434 | Ga0070709_10171867 | Ga0070709_101718672 | 114 |
| 176 | 3300005435 | Ga0070714_100109782 | Ga0070714_1001097824 | 114 |
| 177 | 3300005435 | Ga0070714_101129934 | Ga0070714_1011299342 | 114 |
| 178 | 3300005435 | Ga0070714_102064040 | Ga0070714_1020640401 | 114 |
| 179 | 3300005436 | Ga0070713_100213904 | Ga0070713_1002139043 | 114 |
| 180 | 3300005436 | Ga0070713_100815448 | Ga0070713_1008154482 | 114 |
| 181 | 3300005437 | Ga0070710_10393052 | Ga0070710_103930522 | 114 |
| 182 | 3300005438 | Ga0070701_10424525 | Ga0070701_104245252 | 114 |
| 183 | 3300005456 | Ga0070678_101678149 | Ga0070678_1016781491 | 114 |
| 184 | 3300005458 | Ga0070681_10034634 | Ga0070681_100346344 | 114 |
| 185 | 3300005458 | Ga0070681_10160044 | Ga0070681_101600444 | 114 |
| 186 | 3300005458 | Ga0070681_11029384 | Ga0070681_110293842 | 114 |
| 187 | 3300005459 | Ga0068867_100091706 | Ga0068867_1000917061 | 114 |
| 188 | 3300005466 | Ga0070685_11293727 | Ga0070685_112937272 | 114 |
| 189 | 3300005530 | Ga0070679_100064794 | Ga0070679_1000647943 | 114 |
| 190 | 3300005530 | Ga0070679_100365821 | Ga0070679_1003658212 | 114 |
| 191 | 3300005535 | Ga0070684_100375804 | Ga0070684_1003758042 | 114 |
| 192 | 3300005539 | Ga0068853_100246161 | Ga0068853_1002461612 | 114 |
| 193 | 3300005539 | Ga0068853_100436108 | Ga0068853_1004361082 | 114 |
| 194 | 3300005539 | Ga0068853_100714452 | Ga0068853_1007144522 | 114 |
| 195 | 3300005539 | Ga0068853_101038291 | Ga0068853_1010382912 | 114 |
| 196 | 3300005544 | Ga0070686_100311002 | Ga0070686_1003110022 | 114 |
| 197 | 3300005547 | Ga0070693_100529106 | Ga0070693_1005291061 | 114 |
| 198 | 3300005547 | Ga0070693_100815729 | Ga0070693_1008157291 | 114 |
| 199 | 3300005548 | Ga0070665_100023111 | Ga0070665_1000231112 | 114 |
| 200 | 3300005548 | Ga0070665_100074982 | Ga0070665_1000749825 | 114 |
| 201 | 3300005548 | Ga0070665_100966759 | Ga0070665_1009667592 | 114 |
| 202 | 3300005548 | Ga0070665_101010898 | Ga0070665_1010108982 | 114 |
| 203 | 3300005563 | Ga0068855_100121416 | Ga0068855_1001214165 | 114 |
| 204 | 3300005563 | Ga0068855_100135692 | Ga0068855_1001356922 | 114 |
| 205 | 3300005577 | Ga0068857_100403718 | Ga0068857_1004037183 | 114 |
| 206 | 3300005614 | Ga0068856_100263376 | Ga0068856_1002633762 | 114 |
| 207 | 3300005614 | Ga0068856_101040321 | Ga0068856_1010403212 | 114 |
| 208 | 3300005614 | Ga0068856_101808191 | Ga0068856_1018081912 | 114 |
| 209 | 3300005615 | Ga0070702_100299022 | Ga0070702_1002990222 | 114 |
| 210 | 3300005719 | Ga0068861_101214834 | Ga0068861_1012148342 | 114 |
| 211 | 3300005834 | Ga0068851_10581298 | Ga0068851_105812982 | 114 |
| 212 | 3300005840 | Ga0068870_10119202 | Ga0068870_101192022 | 114 |
| 213 | 3300006175 | Ga0070712_100708750 | Ga0070712_1007087502 | 114 |
| 214 | 3300006175 | Ga0070712_102059527 | Ga0070712_1020595272 | 114 |
| 215 | 3300006237 | Ga0097621_100223165 | Ga0097621_1002231652 | 114 |
| 216 | 3300006237 | Ga0097621_100433566 | Ga0097621_1004335662 | 114 |
| 217 | 3300006358 | Ga0068871_100301487 | Ga0068871_1003014873 | 114 |
| 218 | 3300006881 | Ga0068865_100480540 | Ga0068865_1004805402 | 114 |
| 219 | 3300006881 | Ga0068865_100700100 | Ga0068865_1007001002 | 114 |
| 220 | 3300009093 | Ga0105240_10004232 | Ga0105240_1000423210 | 114 |
| 221 | 3300009093 | Ga0105240_10025381 | Ga0105240_100253814 | 114 |
| 222 | 3300009093 | Ga0105240_10571025 | Ga0105240_105710252 | 114 |
| 223 | 3300009093 | Ga0105240_10604944 | Ga0105240_106049442 | 114 |
| 224 | 3300009093 | Ga0105240_10675787 | Ga0105240_106757873 | 114 |
| 225 | 3300009093 | Ga0105240_10772790 | Ga0105240_107727902 | 114 |
| 226 | 3300009093 | Ga0105240_11336885 | Ga0105240_113368852 | 114 |
| 227 | 3300009094 | Ga0111539_11031310 | Ga0111539_110313102 | 114 |
| 228 | 3300009098 | Ga0105245_10230243 | Ga0105245_102302433 | 114 |
| 229 | 3300009148 | Ga0105243_10014172 | Ga0105243_100141725 | 114 |
| 230 | 3300009174 | Ga0105241_11448434 | Ga0105241_114484342 | 114 |
| 231 | 3300009176 | Ga0105242_12440001 | Ga0105242_124400012 | 114 |
| 232 | 3300009177 | Ga0105248_10047589 | Ga0105248_100475894 | 114 |
| 233 | 3300009177 | Ga0105248_12302871 | Ga0105248_123028711 | 114 |
| 234 | 3300009177 | Ga0105248_12583146 | Ga0105248_125831462 | 114 |
| 235 | 3300009545 | Ga0105237_10209530 | Ga0105237_102095304 | 114 |
| 236 | 3300009545 | Ga0105237_11218230 | Ga0105237_112182302 | 114 |
| 237 | 3300009551 | Ga0105238_10130022 | Ga0105238_101300224 | 114 |
| 238 | 3300009551 | Ga0105238_10414574 | Ga0105238_104145742 | 114 |
| 239 | 3300009551 | Ga0105238_11356864 | Ga0105238_113568642 | 114 |
| 240 | 3300009551 | Ga0105238_12443639 | Ga0105238_124436392 | 114 |
| 241 | 3300010375 | Ga0105239_10210784 | Ga0105239_102107844 | 114 |
| 242 | 3300010375 | Ga0105239_10243523 | Ga0105239_102435234 | 114 |
| 243 | 3300010375 | Ga0105239_10259863 | Ga0105239_102598632 | 114 |
| 244 | 3300010375 | Ga0105239_10600711 | Ga0105239_106007112 | 114 |
| 245 | 3300010375 | Ga0105239_12895017 | Ga0105239_128950171 | 114 |
| 246 | 3300011119 | Ga0105246_10224000 | Ga0105246_102240002 | 114 |
| 247 | 3300013100 | Ga0157373_10565824 | Ga0157373_105658241 | 114 |
| 248 | 3300013104 | Ga0157370_10035566 | Ga0157370_1003556610 | 114 |
| 249 | 3300013104 | Ga0157370_10083851 | Ga0157370_100838512 | 114 |
| 250 | 3300013104 | Ga0157370_11553340 | Ga0157370_115533401 | 114 |
| 251 | 3300013104 | Ga0157370_11772634 | Ga0157370_117726341 | 114 |
| 252 | 3300013105 | Ga0157369_10345530 | Ga0157369_103455303 | 114 |
| 253 | 3300013105 | Ga0157369_11997704 | Ga0157369_119977041 | 114 |
| 254 | 3300013296 | Ga0157374_10646962 | Ga0157374_106469622 | 114 |
| 255 | 3300013306 | Ga0163162_12018637 | Ga0163162_120186372 | 114 |
| 256 | 3300013308 | Ga0157375_11964069 | Ga0157375_119640692 | 114 |
| 257 | 3300014325 | Ga0163163_10008003 | Ga0163163_100080033 | 114 |
| 258 | 3300014325 | Ga0163163_12859732 | Ga0163163_128597322 | 114 |
| 259 | 3300014326 | Ga0157380_10294611 | Ga0157380_102946114 | 114 |
| 260 | 3300014326 | Ga0157380_10662266 | Ga0157380_106622662 | 114 |
| 261 | 3300014326 | Ga0157380_11951378 | Ga0157380_119513781 | 114 |
| 262 | 3300014968 | Ga0157379_10052289 | Ga0157379_100522895 | 114 |
| 263 | 3300014968 | Ga0157379_11504263 | Ga0157379_115042631 | 114 |
| 264 | 3300014969 | Ga0157376_10311850 | Ga0157376_103118502 | 114 |
| 265 | 3300014969 | Ga0157376_10667399 | Ga0157376_106673992 | 114 |
| 266 | 3300021441 | Ga0213871_10090741 | Ga0213871_100907412 | 114 |
| 267 | 3300025893 | Ga0207682_10501077 | Ga0207682_105010772 | 114 |
| 268 | 3300025899 | Ga0207642_11000576 | Ga0207642_110005762 | 114 |
| 269 | 3300025901 | Ga0207688_10572743 | Ga0207688_105727432 | 114 |
| 270 | 3300025903 | Ga0207680_10002564 | Ga0207680_100025647 | 114 |
| 271 | 3300025907 | Ga0207645_10011392 | Ga0207645_100113926 | 114 |
| 272 | 3300025907 | Ga0207645_10058297 | Ga0207645_100582972 | 114 |
| 273 | 3300025908 | Ga0207643_10030805 | Ga0207643_100308056 | 114 |
| 274 | 3300025909 | Ga0207705_10004720 | Ga0207705_1000472019 | 114 |
| 275 | 3300025909 | Ga0207705_10194396 | Ga0207705_101943962 | 114 |
| 276 | 3300025911 | Ga0207654_10324382 | Ga0207654_103243822 | 114 |
| 277 | 3300025911 | Ga0207654_10796686 | Ga0207654_107966862 | 114 |
| 278 | 3300025911 | Ga0207654_10976002 | Ga0207654_109760022 | 114 |
| 279 | 3300025912 | Ga0207707_10048827 | Ga0207707_100488275 | 114 |
| 280 | 3300025912 | Ga0207707_11449952 | Ga0207707_114499522 | 114 |
| 281 | 3300025913 | Ga0207695_10028316 | Ga0207695_100283166 | 114 |
| 282 | 3300025913 | Ga0207695_10040352 | Ga0207695_100403526 | 114 |
| 283 | 3300025913 | Ga0207695_10128661 | Ga0207695_101286614 | 114 |
| 284 | 3300025913 | Ga0207695_10383850 | Ga0207695_103838502 | 114 |
| 285 | 3300025913 | Ga0207695_10592654 | Ga0207695_105926542 | 114 |
| 286 | 3300025913 | Ga0207695_10926468 | Ga0207695_109264682 | 114 |
| 287 | 3300025913 | Ga0207695_11234151 | Ga0207695_112341512 | 114 |
| 288 | 3300025917 | Ga0207660_10181434 | Ga0207660_101814343 | 114 |
| 289 | 3300025919 | Ga0207657_10196503 | Ga0207657_101965032 | 114 |
| 290 | 3300025919 | Ga0207657_10350346 | Ga0207657_103503462 | 114 |
| 291 | 3300025919 | Ga0207657_10586738 | Ga0207657_105867382 | 114 |
| 292 | 3300025920 | Ga0207649_10000194 | Ga0207649_1000019453 | 114 |
| 293 | 3300025920 | Ga0207649_11153903 | Ga0207649_111539032 | 114 |
| 294 | 3300025921 | Ga0207652_10115732 | Ga0207652_101157323 | 114 |
| 295 | 3300025921 | Ga0207652_10115916 | Ga0207652_101159162 | 114 |
| 296 | 3300025921 | Ga0207652_10532647 | Ga0207652_105326472 | 114 |
| 297 | 3300025924 | Ga0207694_10026889 | Ga0207694_100268892 | 114 |
| 298 | 3300025924 | Ga0207694_10187378 | Ga0207694_101873781 | 114 |
| 299 | 3300025924 | Ga0207694_10353215 | Ga0207694_103532152 | 114 |
| 300 | 3300025924 | Ga0207694_10494689 | Ga0207694_104946892 | 114 |
| 301 | 3300025924 | Ga0207694_10503302 | Ga0207694_105033022 | 114 |
| 302 | 3300025924 | Ga0207694_11107393 | Ga0207694_111073932 | 114 |
| 303 | 3300025927 | Ga0207687_10085895 | Ga0207687_100858952 | 114 |
| 304 | 3300025928 | Ga0207700_11055403 | Ga0207700_110554032 | 114 |
| 305 | 3300025929 | Ga0207664_10073108 | Ga0207664_100731084 | 114 |
| 306 | 3300025929 | Ga0207664_10316183 | Ga0207664_103161832 | 114 |
| 307 | 3300025932 | Ga0207690_10109672 | Ga0207690_101096722 | 114 |
| 308 | 3300025932 | Ga0207690_10627877 | Ga0207690_106278772 | 114 |
| 309 | 3300025934 | Ga0207686_10073147 | Ga0207686_100731473 | 114 |
| 310 | 3300025934 | Ga0207686_10410361 | Ga0207686_104103612 | 114 |
| 311 | 3300025935 | Ga0207709_10154513 | Ga0207709_101545132 | 114 |
| 312 | 3300025937 | Ga0207669_10045989 | Ga0207669_100459895 | 114 |
| 313 | 3300025938 | Ga0207704_10546716 | Ga0207704_105467162 | 114 |
| 314 | 3300025941 | Ga0207711_10145656 | Ga0207711_101456562 | 114 |
| 315 | 3300025941 | Ga0207711_10662390 | Ga0207711_106623902 | 114 |
| 316 | 3300025941 | Ga0207711_10676633 | Ga0207711_106766332 | 114 |
| 317 | 3300025942 | Ga0207689_10127211 | Ga0207689_101272113 | 114 |
| 318 | 3300025945 | Ga0207679_10438436 | Ga0207679_104384362 | 114 |
| 319 | 3300025949 | Ga0207667_10046421 | Ga0207667_100464212 | 114 |
| 320 | 3300025949 | Ga0207667_10052391 | Ga0207667_100523911 | 114 |
| 321 | 3300025960 | Ga0207651_10382910 | Ga0207651_103829103 | 114 |
| 322 | 3300025986 | Ga0207658_10058513 | Ga0207658_100585135 | 114 |
| 323 | 3300026023 | Ga0207677_10561974 | Ga0207677_105619742 | 114 |
| 324 | 3300026023 | Ga0207677_11486330 | Ga0207677_114863301 | 114 |
| 325 | 3300026041 | Ga0207639_10211849 | Ga0207639_102118494 | 114 |
| 326 | 3300026041 | Ga0207639_10482726 | Ga0207639_104827262 | 114 |
| 327 | 3300026078 | Ga0207702_10221951 | Ga0207702_102219514 | 114 |
| 328 | 3300026078 | Ga0207702_10831347 | Ga0207702_108313472 | 114 |
| 329 | 3300026078 | Ga0207702_10956846 | Ga0207702_109568462 | 114 |
| 330 | 3300026089 | Ga0207648_10120491 | Ga0207648_101204915 | 114 |
| 331 | 3300026095 | Ga0207676_10596303 | Ga0207676_105963032 | 114 |
| 332 | 3300026116 | Ga0207674_10192958 | Ga0207674_101929583 | 114 |
| 333 | 3300026116 | Ga0207674_11200466 | Ga0207674_112004662 | 114 |
| 334 | 3300026121 | Ga0207683_11450214 | Ga0207683_114502142 | 114 |
| 335 | 3300028379 | Ga0268266_10000557 | Ga0268266_1000055719 | 114 |
| 336 | 3300028379 | Ga0268266_10095842 | Ga0268266_100958425 | 114 |
| 337 | 3300028379 | Ga0268266_10320511 | Ga0268266_103205112 | 114 |
| 338 | 3300028379 | Ga0268266_10816058 | Ga0268266_108160582 | 114 |
| 339 | 3300028379 | Ga0268266_11197779 | Ga0268266_111977792 | 114 |
| 340 | 3300028380 | Ga0268265_10229757 | Ga0268265_102297572 | 114 |
| 341 | 3300028556 | Ga0265337_1129141 | Ga0265337_11291412 | 114 |
| 342 | 3300028800 | Ga0265338_10002896 | Ga0265338_1000289628 | 114 |
| 343 | 3300028800 | Ga0265338_10315488 | Ga0265338_103154882 | 114 |
| 344 | 3300031235 | Ga0265330_10074125 | Ga0265330_100741253 | 114 |
| 345 | 3300031235 | Ga0265330_10222495 | Ga0265330_102224952 | 114 |
| 346 | 3300031235 | Ga0265330_10304052 | Ga0265330_103040522 | 114 |
| 347 | 3300031238 | Ga0265332_10071412 | Ga0265332_100714122 | 114 |
| 348 | 3300031238 | Ga0265332_10109358 | Ga0265332_101093582 | 114 |
| 349 | 3300031238 | Ga0265332_10226366 | Ga0265332_102263662 | 114 |
| 350 | 3300031240 | Ga0265320_10002069 | Ga0265320_1000206910 | 114 |
| 351 | 3300031241 | Ga0265325_10026992 | Ga0265325_100269927 | 114 |
| 352 | 3300031241 | Ga0265325_10113161 | Ga0265325_101131612 | 114 |
| 353 | 3300031241 | Ga0265325_10232718 | Ga0265325_102327182 | 114 |
| 354 | 3300031241 | Ga0265325_10360964 | Ga0265325_103609642 | 114 |
| 355 | 3300031242 | Ga0265329_10105250 | Ga0265329_101052502 | 114 |
| 356 | 3300031247 | Ga0265340_10038201 | Ga0265340_100382011 | 114 |
| 357 | 3300031247 | Ga0265340_10196059 | Ga0265340_101960592 | 114 |
| 358 | 3300031249 | Ga0265339_10104553 | Ga0265339_101045532 | 114 |
| 359 | 3300031249 | Ga0265339_10306913 | Ga0265339_103069131 | 114 |
| 360 | 3300031250 | Ga0265331_10000186 | Ga0265331_1000018642 | 114 |
| 361 | 3300031250 | Ga0265331_10003502 | Ga0265331_1000350213 | 114 |
| 362 | 3300031250 | Ga0265331_10013838 | Ga0265331_100138388 | 114 |
| 363 | 3300031250 | Ga0265331_10022887 | Ga0265331_100228874 | 114 |
| 364 | 3300031250 | Ga0265331_10037988 | Ga0265331_100379882 | 114 |
| 365 | 3300031250 | Ga0265331_10135994 | Ga0265331_101359941 | 114 |
| 366 | 3300031251 | Ga0265327_10000392 | Ga0265327_10000392119 | 114 |
| 367 | 3300031344 | Ga0265316_10025355 | Ga0265316_100253553 | 114 |
| 368 | 3300031344 | Ga0265316_10044806 | Ga0265316_100448063 | 114 |
| 369 | 3300031344 | Ga0265316_10086571 | Ga0265316_100865714 | 114 |
| 370 | 3300031344 | Ga0265316_10186060 | Ga0265316_101860602 | 114 |
| 371 | 3300031344 | Ga0265316_10488220 | Ga0265316_104882202 | 114 |
| 372 | 3300031344 | Ga0265316_10505152 | Ga0265316_105051522 | 114 |
| 373 | 3300031344 | Ga0265316_10889279 | Ga0265316_108892792 | 114 |
| 374 | 3300031344 | Ga0265316_10909968 | Ga0265316_109099682 | 114 |
| 375 | 3300031595 | Ga0265313_10012941 | Ga0265313_100129414 | 114 |
| 376 | 3300031595 | Ga0265313_10086987 | Ga0265313_100869872 | 114 |
| 377 | 3300031616 | Ga0307508_10339899 | Ga0307508_103398992 | 114 |
| 378 | 3300031665 | Ga0316575_10019455 | Ga0316575_100194556 | 114 |
| 379 | 3300031711 | Ga0265314_10000963 | Ga0265314_100009633 | 114 |
| 380 | 3300031711 | Ga0265314_10041547 | Ga0265314_100415472 | 114 |
| 381 | 3300031711 | Ga0265314_10056619 | Ga0265314_100566191 | 114 |
| 382 | 3300031711 | Ga0265314_10059830 | Ga0265314_100598305 | 114 |
| 383 | 3300031711 | Ga0265314_10060354 | Ga0265314_100603545 | 114 |
| 384 | 3300031711 | Ga0265314_10077885 | Ga0265314_100778855 | 114 |
| 385 | 3300031711 | Ga0265314_10157550 | Ga0265314_101575502 | 114 |
| 386 | 3300031711 | Ga0265314_10261666 | Ga0265314_102616662 | 114 |
| 387 | 3300031711 | Ga0265314_10398461 | Ga0265314_103984612 | 114 |
| 388 | 3300031711 | Ga0265314_10537414 | Ga0265314_105374142 | 114 |
| 389 | 3300031712 | Ga0265342_10072247 | Ga0265342_100722472 | 114 |
| 390 | 3300031712 | Ga0265342_10086258 | Ga0265342_100862582 | 114 |
| 391 | 3300031712 | Ga0265342_10204740 | Ga0265342_102047402 | 114 |
| 392 | 3300031712 | Ga0265342_10418404 | Ga0265342_104184041 | 114 |
| 393 | 3300031712 | Ga0265342_10613447 | Ga0265342_106134471 | 114 |
| 394 | 3300031712 | Ga0265342_10705073 | Ga0265342_107050732 | 114 |
| 395 | 3300031730 | Ga0307516_10069198 | Ga0307516_100691987 | 114 |
| 396 | 3300035111 | Ga0373923_0655767 | Ga0373923_0655767_133_480 | 114 |
| 397 | 3300035113 | Ga0373936_0187142 | Ga0373936_0187142_121_468 | 114 |
| 398 | 3300035172 | Ga0373955_0236450 | Ga0373955_0236450_230_580 | 114 |
| 399 | 3300035695 | Ga0373927_0484655 | Ga0373927_0484655_151_501 | 114 |
| 400 | 3300035724 | Ga0373933_0484017 | Ga0373933_0484017_374_724 | 114 |
| 401 | 3300036401 | Ga0373937_0070199 | Ga0373937_0070199_1251_1601 | 114 |
| 402 | 3300036401 | Ga0373937_0190143 | Ga0373937_0190143_590_940 | 114 |
| 403 | 3300037418 | Ga0395900_0098142 | Ga0395900_0098142_976_1326 | 114 |
| 404 | 3300037466 | Ga0395898_0359028 | Ga0395898_0359028_311_661 | 114 |
| 405 | 3300037471 | Ga0395905_0904095 | Ga0395905_0904095_235_582 | 114 |
| 406 | 3300038443 | Ga0395901_1554232 | Ga0395901_1554232_180_527 | 114 |
| 407 | 3300039438 | Ga0436360_0360048 | Ga0436360_0360048_380_727 | 114 |
| 408 | 3300039438 | Ga0436360_0716296 | Ga0436360_0716296_620_967 | 114 |
| 409 | 3300039450 | Ga0436363_0896516 | Ga0436363_0896516_656_1006 | 114 |
| 410 | 3300039450 | Ga0436363_1234183 | Ga0436363_1234183_411_758 | 114 |
| 411 | 3300044694 | Ga0466963_0654836 | Ga0466963_0654836_97_444 | 114 |
| 412 | 3300044694 | Ga0466963_1080032 | Ga0466963_1080032_128_478 | 114 |
| 413 | 3300044842 | Ga0466957_0134071 | Ga0466957_0134071_225_572 | 114 |
| 414 | 3300045049 | Ga0466959_1068813 | Ga0466959_1068813_116_463 | 114 |
| 415 | 3300045976 | Ga0466967_0059567 | Ga0466967_0059567_2014_2361 | 114 |
| 416 | 3300046454 | Ga0495592_0176228 | Ga0495592_0176228_303_650 | 114 |
| 417 | 3300046454 | Ga0495592_0737513 | Ga0495592_0737513_26_373 | 114 |
| 418 | 3300046463 | Ga0495653_0881506 | Ga0495653_0881506_18_365 | 114 |
| 419 | 3300046473 | Ga0495582_0653216 | Ga0495582_0653216_85_432 | 114 |
| 420 | 3300046474 | Ga0495605_0155621 | Ga0495605_0155621_269_616 | 114 |
| 421 | 3300046476 | Ga0495662_0094538 | Ga0495662_0094538_870_1217 | 114 |
| 422 | 3300046511 | Ga0495608_0843667 | Ga0495608_0843667_118_465 | 114 |
| 423 | 3300046516 | Ga0495628_0094702 | Ga0495628_0094702_294_641 | 114 |
| 424 | 3300046517 | Ga0495630_0440961 | Ga0495630_0440961_298_648 | 114 |
| 425 | 3300046517 | Ga0495630_0720911 | Ga0495630_0720911_225_575 | 114 |
| 426 | 3300046530 | Ga0495654_0052557 | Ga0495654_0052557_1513_1860 | 114 |
| 427 | 3300046535 | Ga0495586_0076681 | Ga0495586_0076681_1319_1669 | 114 |
| 428 | 3300046536 | Ga0495587_0166062 | Ga0495587_0166062_539_889 | 114 |
| 429 | 3300046536 | Ga0495587_0204496 | Ga0495587_0204496_354_701 | 114 |
| 430 | 3300046536 | Ga0495587_0483584 | Ga0495587_0483584_136_483 | 114 |
| 431 | 3300046543 | Ga0495645_0410490 | Ga0495645_0410490_474_824 | 114 |
| 432 | 3300046557 | Ga0495622_0003379 | Ga0495622_0003379_3746_4093 | 114 |
| 433 | 3300046559 | Ga0495667_0525319 | Ga0495667_0525319_322_672 | 114 |
| 434 | 3300046616 | Ga0495668_0516729 | Ga0495668_0516729_74_421 | 114 |
| 435 | 3300046675 | Ga0495657_0725526 | Ga0495657_0725526_24_374 | 114 |
| 436 | 3300046679 | Ga0495623_0242409 | Ga0495623_0242409_143_490 | 114 |
| 437 | 3300046679 | Ga0495623_0386276 | Ga0495623_0386276_284_631 | 114 |
| 438 | 3300046680 | Ga0495646_0447941 | Ga0495646_0447941_307_654 | 114 |
| 439 | 3300046683 | Ga0495658_0529345 | Ga0495658_0529345_158_508 | 114 |
| 440 | 3300046684 | Ga0495669_0166595 | Ga0495669_0166595_620_967 | 114 |
| 441 | 3300046689 | Ga0495613_0311412 | Ga0495613_0311412_488_835 | 114 |
| 442 | 3300046794 | Ga0495589_0093052 | Ga0495589_0093052_195_542 | 114 |
| 443 | 3300046809 | Ga0495600_0808155 | Ga0495600_0808155_128_475 | 114 |
| 444 | 3300047317 | Ga0495604_0810753 | Ga0495604_0810753_122_469 | 114 |
| 445 | 3300047319 | Ga0495674_0361879 | Ga0495674_0361879_268_618 | 114 |
| 446 | 3300047319 | Ga0495674_0769576 | Ga0495674_0769576_259_606 | 114 |
| 447 | 3300047323 | Ga0495683_0134375 | Ga0495683_0134375_66_413 | 114 |
| 448 | 3300047444 | Ga0495675_0269418 | Ga0495675_0269418_392_739 | 114 |
| 449 | 3300047471 | Ga0495684_0119581 | Ga0495684_0119581_496_846 | 114 |
| 450 | 3300047673 | Ga0495593_0131793 | Ga0495593_0131793_558_905 | 114 |
| 451 | 3300047673 | Ga0495593_0163719 | Ga0495593_0163719_339_686 | 114 |
| 452 | 3300048088 | Ga0495602_0175950 | Ga0495602_0175950_670_1017 | 114 |
| 453 | 3300048088 | Ga0495602_0838259 | Ga0495602_0838259_257_604 | 114 |
| 454 | 3300048918 | Ga0496115_0490803 | Ga0496115_0490803_411_761 | 114 |
| 455 | 3300048929 | Ga0496126_0000480 | Ga0496126_0000480_21688_22038 | 114 |
| 456 | 3300049568 | Ga0501031_0068962 | Ga0501031_0068962_943_1290 | 114 |
| 457 | 3300049568 | Ga0501031_0093984 | Ga0501031_0093984_56_406 | 114 |
| 458 | 3300049569 | Ga0501032_0004362 | Ga0501032_0004362_5603_5950 | 114 |
| 459 | 3300049569 | Ga0501032_0059736 | Ga0501032_0059736_460_810 | 114 |
| 460 | 3300049570 | Ga0501033_0012240 | Ga0501033_0012240_2666_3016 | 114 |
| 461 | 3300049570 | Ga0501033_0036296 | Ga0501033_0036296_3248_3595 | 114 |
| 462 | 3300049570 | Ga0501033_0371078 | Ga0501033_0371078_173_520 | 114 |
| 463 | 3300049570 | Ga0501033_0678126 | Ga0501033_0678126_75_422 | 114 |
| 464 | 3300049571 | Ga0501034_0010632 | Ga0501034_0010632_7369_7716 | 114 |
| 465 | 3300049571 | Ga0501034_0027593 | Ga0501034_0027593_845_1195 | 114 |
| 466 | 3300049571 | Ga0501034_0091835 | Ga0501034_0091835_2604_2951 | 114 |
| 467 | 3300049571 | Ga0501034_0133506 | Ga0501034_0133506_754_1101 | 114 |
| 468 | 3300049571 | Ga0501034_0171039 | Ga0501034_0171039_1095_1442 | 114 |
| 469 | 3300049571 | Ga0501034_0251625 | Ga0501034_0251625_879_1226 | 114 |
| 470 | 3300049571 | Ga0501034_0634386 | Ga0501034_0634386_521_868 | 114 |
| 471 | 3300049571 | Ga0501034_0901392 | Ga0501034_0901392_271_618 | 114 |
| 472 | 3300049572 | Ga0501036_0005653 | Ga0501036_0005653_7956_8303 | 114 |
| 473 | 3300049572 | Ga0501036_0880700 | Ga0501036_0880700_200_547 | 114 |
| 474 | 3300049573 | Ga0501037_0024753 | Ga0501037_0024753_2815_3162 | 114 |
| 475 | 3300049573 | Ga0501037_0441735 | Ga0501037_0441735_363_710 | 114 |
| 476 | 3300049574 | Ga0501038_0088134 | Ga0501038_0088134_1279_1626 | 114 |
| 477 | 3300049574 | Ga0501038_0147189 | Ga0501038_0147189_318_665 | 114 |
| 478 | 3300049574 | Ga0501038_0298230 | Ga0501038_0298230_334_684 | 114 |
| 479 | 3300049574 | Ga0501038_0349287 | Ga0501038_0349287_629_976 | 114 |
| 480 | 3300049575 | Ga0501039_0019053 | Ga0501039_0019053_4568_4915 | 114 |
| 481 | 3300049575 | Ga0501039_0222759 | Ga0501039_0222759_294_641 | 114 |
| 482 | 3300049578 | Ga0501042_0098300 | Ga0501042_0098300_264_611 | 114 |
| 483 | 3300049578 | Ga0501042_0766414 | Ga0501042_0766414_78_425 | 114 |
| 484 | 3300049579 | Ga0501043_0010388 | Ga0501043_0010388_1377_1724 | 114 |
| 485 | 3300049579 | Ga0501043_0014584 | Ga0501043_0014584_4104_4454 | 114 |
| 486 | 3300049579 | Ga0501043_0097012 | Ga0501043_0097012_691_1038 | 114 |
| 487 | 3300049579 | Ga0501043_0539165 | Ga0501043_0539165_455_802 | 114 |
| 488 | 3300049580 | Ga0501046_0005416 | Ga0501046_0005416_5491_5838 | 114 |
| 489 | 3300049580 | Ga0501046_0011762 | Ga0501046_0011762_4970_5320 | 114 |
| 490 | 3300049580 | Ga0501046_0012992 | Ga0501046_0012992_6407_6754 | 114 |
| 491 | 3300049580 | Ga0501046_0560881 | Ga0501046_0560881_248_598 | 114 |
| 492 | 3300049580 | Ga0501046_0845046 | Ga0501046_0845046_245_592 | 114 |
| 493 | 3300049581 | Ga0501047_0014860 | Ga0501047_0014860_6676_7023 | 114 |
| 494 | 3300049581 | Ga0501047_0037637 | Ga0501047_0037637_59_409 | 114 |
| 495 | 3300049581 | Ga0501047_0065087 | Ga0501047_0065087_2934_3281 | 114 |
| 496 | 3300049581 | Ga0501047_0131220 | Ga0501047_0131220_1403_1750 | 114 |
| 497 | 3300049581 | Ga0501047_0171826 | Ga0501047_0171826_681_1031 | 114 |
| 498 | 3300049581 | Ga0501047_0176653 | Ga0501047_0176653_625_972 | 114 |
| 499 | 3300049581 | Ga0501047_0251827 | Ga0501047_0251827_581_928 | 114 |
| 500 | 3300049581 | Ga0501047_0441537 | Ga0501047_0441537_141_491 | 114 |
| 501 | 3300049582 | Ga0501048_0023812 | Ga0501048_0023812_393_740 | 114 |
| 502 | 3300049582 | Ga0501048_0209717 | Ga0501048_0209717_440_787 | 114 |
| 503 | 3300049582 | Ga0501048_0749050 | Ga0501048_0749050_20_370 | 114 |
| 504 | 3300049583 | Ga0501067_0001776 | Ga0501067_0001776_3465_3812 | 114 |
| 505 | 3300049584 | Ga0501068_0077512 | Ga0501068_0077512_603_953 | 114 |
| 506 | 3300049585 | Ga0501069_0022165 | Ga0501069_0022165_1064_1411 | 114 |
| 507 | 3300049586 | Ga0501070_0014964 | Ga0501070_0014964_2739_3086 | 114 |
| 508 | 3300049586 | Ga0501070_0143912 | Ga0501070_0143912_612_962 | 114 |
| 509 | 3300049587 | Ga0501071_0156932 | Ga0501071_0156932_847_1194 | 114 |
| 510 | 3300049588 | Ga0501072_0097056 | Ga0501072_0097056_1814_2161 | 114 |
| 511 | 3300049589 | Ga0501073_0001669 | Ga0501073_0001669_11651_11998 | 114 |
| 512 | 3300049589 | Ga0501073_0036603 | Ga0501073_0036603_3098_3445 | 114 |
| 513 | 3300049589 | Ga0501073_0059886 | Ga0501073_0059886_1126_1476 | 114 |
| 514 | 3300049589 | Ga0501073_0070275 | Ga0501073_0070275_1141_1488 | 114 |
| 515 | 3300049590 | Ga0501074_0004453 | Ga0501074_0004453_1800_2147 | 114 |
| 516 | 3300049590 | Ga0501074_0079197 | Ga0501074_0079197_1402_1752 | 114 |
| 517 | 3300049741 | Ga0501079_0001478 | Ga0501079_0001478_8008_8355 | 114 |
| 518 | 3300049741 | Ga0501079_0140727 | Ga0501079_0140727_819_1169 | 114 |
| 519 | 3300049742 | Ga0501080_0040364 | Ga0501080_0040364_570_917 | 114 |
| 520 | 3300049742 | Ga0501080_0125187 | Ga0501080_0125187_944_1291 | 114 |
| 521 | 3300049742 | Ga0501080_0596113 | Ga0501080_0596113_320_670 | 114 |
| 522 | 3300049742 | Ga0501080_0675815 | Ga0501080_0675815_466_813 | 114 |
| 523 | 3300049744 | Ga0501083_0052937 | Ga0501083_0052937_1970_2317 | 114 |
| 524 | 3300049744 | Ga0501083_0135923 | Ga0501083_0135923_1185_1535 | 114 |
| 525 | 3300049822 | Ga0501035_0019622 | Ga0501035_0019622_3841_4188 | 114 |
| 526 | 3300049822 | Ga0501035_0044851 | Ga0501035_0044851_2089_2436 | 114 |
| 527 | 3300049822 | Ga0501035_0048543 | Ga0501035_0048543_310_660 | 114 |
| 528 | 3300049822 | Ga0501035_0368131 | Ga0501035_0368131_293_640 | 114 |
| 529 | 3300049822 | Ga0501035_0936218 | Ga0501035_0936218_110_457 | 114 |
| 530 | 3300049823 | Ga0501044_0015755 | Ga0501044_0015755_2223_2573 | 114 |
| 531 | 3300049823 | Ga0501044_0024878 | Ga0501044_0024878_1307_1654 | 114 |
| 532 | 3300049823 | Ga0501044_0027898 | Ga0501044_0027898_106_453 | 114 |
| 533 | 3300049823 | Ga0501044_0129184 | Ga0501044_0129184_972_1319 | 114 |
| 534 | 3300049823 | Ga0501044_0161480 | Ga0501044_0161480_870_1217 | 114 |
| 535 | 3300049823 | Ga0501044_1519932 | Ga0501044_1519932_114_461 | 114 |
| 536 | 3300049824 | Ga0501045_0626636 | Ga0501045_0626636_331_678 | 114 |
| 537 | 3300053080 | Ga0500635_0307042 | Ga0500635_0307042_53_400 | 114 |
| 538 | 3300053103 | Ga0500555_039510 | Ga0500555_039510_584_931 | 114 |
| 539 | 3300053119 | Ga0500595_001661 | Ga0500595_001661_2283_2630 | 114 |
| 540 | 3300053119 | Ga0500595_142011 | Ga0500595_142011_118_465 | 114 |
| 541 | 3300053119 | Ga0500595_163432 | Ga0500595_163432_126_473 | 114 |
| 542 | 3300053136 | Ga0500559_0087609 | Ga0500559_0087609_1042_1389 | 114 |
| 543 | 3300054114 | Ga0501084_0007620 | Ga0501084_0007620_3458_3805 | 114 |
| 544 | 3300060353 | Ga0501082_0006964 | Ga0501082_0006964_5579_5926 | 114 |
| 545 | 3300060353 | Ga0501082_0069701 | Ga0501082_0069701_2060_2410 | 114 |
| 546 | iso_pu_bacteria | 2917554339 | 2917555115 | 114 |
| 547 | 3300009551 | Ga0105238_10000180 | Ga0105238_1000018022 | 115 |
| 548 | 3300025924 | Ga0207694_10137313 | Ga0207694_101373132 | 115 |
| 549 | 3300005336 | Ga0070680_101241173 | Ga0070680_1012411731 | 116 |
| 550 | 3300005343 | Ga0070687_100270438 | Ga0070687_1002704382 | 116 |
| 551 | 3300005436 | Ga0070713_100558156 | Ga0070713_1005581562 | 116 |
| 552 | 3300005441 | Ga0070700_101025593 | Ga0070700_1010255932 | 116 |
| 553 | 3300005535 | Ga0070684_101079606 | Ga0070684_1010796062 | 116 |
| 554 | 3300005539 | Ga0068853_100101796 | Ga0068853_1001017966 | 116 |
| 555 | 3300005547 | Ga0070693_101552370 | Ga0070693_1015523701 | 116 |
| 556 | 3300005563 | Ga0068855_100000385 | Ga0068855_1000003859 | 116 |
| 557 | 3300005616 | Ga0068852_100393106 | Ga0068852_1003931063 | 116 |
| 558 | 3300006177 | Ga0075362_10170480 | Ga0075362_101704802 | 116 |
| 559 | 3300006178 | Ga0075367_10068073 | Ga0075367_100680735 | 116 |
| 560 | 3300006195 | Ga0075366_10016744 | Ga0075366_100167442 | 116 |
| 561 | 3300006237 | Ga0097621_100712378 | Ga0097621_1007123782 | 116 |
| 562 | 3300006844 | Ga0075428_102279109 | Ga0075428_1022791092 | 116 |
| 563 | 3300006846 | Ga0075430_100194948 | Ga0075430_1001949483 | 116 |
| 564 | 3300006846 | Ga0075430_100589606 | Ga0075430_1005896062 | 116 |
| 565 | 3300006847 | Ga0075431_100116845 | Ga0075431_1001168452 | 116 |
| 566 | 3300006880 | Ga0075429_100450246 | Ga0075429_1004502462 | 116 |
| 567 | 3300009093 | Ga0105240_10004696 | Ga0105240_1000469617 | 116 |
| 568 | 3300009094 | Ga0111539_10023579 | Ga0111539_100235799 | 116 |
| 569 | 3300009098 | Ga0105245_10394924 | Ga0105245_103949243 | 116 |
| 570 | 3300009101 | Ga0105247_10056711 | Ga0105247_100567114 | 116 |
| 571 | 3300009174 | Ga0105241_10609598 | Ga0105241_106095982 | 116 |
| 572 | 3300009174 | Ga0105241_10783792 | Ga0105241_107837922 | 116 |
| 573 | 3300009176 | Ga0105242_10546840 | Ga0105242_105468402 | 116 |
| 574 | 3300009177 | Ga0105248_10000005 | Ga0105248_1000000519 | 116 |
| 575 | 3300009177 | Ga0105248_10256549 | Ga0105248_102565492 | 116 |
| 576 | 3300009177 | Ga0105248_10900403 | Ga0105248_109004032 | 116 |
| 577 | 3300009545 | Ga0105237_10158271 | Ga0105237_101582713 | 116 |
| 578 | 3300009545 | Ga0105237_10181890 | Ga0105237_101818905 | 116 |
| 579 | 3300009545 | Ga0105237_12150218 | Ga0105237_121502182 | 116 |
| 580 | 3300009551 | Ga0105238_10055822 | Ga0105238_100558223 | 116 |
| 581 | 3300010375 | Ga0105239_10018317 | Ga0105239_100183172 | 116 |
| 582 | 3300010375 | Ga0105239_10073553 | Ga0105239_100735534 | 116 |
| 583 | 3300011119 | Ga0105246_11855237 | Ga0105246_118552372 | 116 |
| 584 | 3300013105 | Ga0157369_10033188 | Ga0157369_100331885 | 116 |
| 585 | 3300013296 | Ga0157374_10000420 | Ga0157374_1000042031 | 116 |
| 586 | 3300013297 | Ga0157378_10506627 | Ga0157378_105066272 | 116 |
| 587 | 3300013297 | Ga0157378_11303016 | Ga0157378_113030162 | 116 |
| 588 | 3300014325 | Ga0163163_11434683 | Ga0163163_114346832 | 116 |
| 589 | 3300014325 | Ga0163163_12791848 | Ga0163163_127918481 | 116 |
| 590 | 3300014969 | Ga0157376_10917251 | Ga0157376_109172512 | 116 |
| 591 | 3300014969 | Ga0157376_12671508 | Ga0157376_126715081 | 116 |
| 592 | 3300021384 | Ga0213876_10003189 | Ga0213876_1000318919 | 116 |
| 593 | 3300025911 | Ga0207654_10172361 | Ga0207654_101723612 | 116 |
| 594 | 3300025911 | Ga0207654_10724010 | Ga0207654_107240102 | 116 |
| 595 | 3300025911 | Ga0207654_10893363 | Ga0207654_108933632 | 116 |
| 596 | 3300025913 | Ga0207695_10000018 | Ga0207695_1000001845 | 116 |
| 597 | 3300025913 | Ga0207695_10217861 | Ga0207695_102178613 | 116 |
| 598 | 3300025913 | Ga0207695_10950391 | Ga0207695_109503912 | 116 |
| 599 | 3300025914 | Ga0207671_10538073 | Ga0207671_105380732 | 116 |
| 600 | 3300025914 | Ga0207671_11087401 | Ga0207671_110874012 | 116 |
| 601 | 3300025915 | Ga0207693_10266868 | Ga0207693_102668682 | 116 |
| 602 | 3300025917 | Ga0207660_10995112 | Ga0207660_109951122 | 116 |
| 603 | 3300025918 | Ga0207662_10413604 | Ga0207662_104136042 | 116 |
| 604 | 3300025920 | Ga0207649_10486227 | Ga0207649_104862272 | 116 |
| 605 | 3300025924 | Ga0207694_10000010 | Ga0207694_10000010367 | 116 |
| 606 | 3300025927 | Ga0207687_10525782 | Ga0207687_105257821 | 116 |
| 607 | 3300025934 | Ga0207686_10373895 | Ga0207686_103738952 | 116 |
| 608 | 3300025941 | Ga0207711_10000002 | Ga0207711_1000000219 | 116 |
| 609 | 3300025941 | Ga0207711_11036108 | Ga0207711_110361081 | 116 |
| 610 | 3300025949 | Ga0207667_10000388 | Ga0207667_1000038856 | 116 |
| 611 | 3300026041 | Ga0207639_10000867 | Ga0207639_100008676 | 116 |
| 612 | 3300026095 | Ga0207676_12030203 | Ga0207676_120302031 | 116 |
| 613 | 3300026142 | Ga0207698_10042447 | Ga0207698_100424475 | 116 |
| 614 | 3300026142 | Ga0207698_10086858 | Ga0207698_100868582 | 116 |
| 615 | 3300027907 | Ga0207428_11179480 | Ga0207428_111794801 | 116 |
| 616 | 3300028381 | Ga0268264_12447937 | Ga0268264_124479372 | 116 |
| 617 | 3300028558 | Ga0265326_10073781 | Ga0265326_100737812 | 116 |
| 618 | 3300028800 | Ga0265338_10000017 | Ga0265338_10000017294 | 116 |
| 619 | 3300030521 | Ga0307511_10224989 | Ga0307511_102249892 | 116 |
| 620 | 3300030521 | Ga0307511_10265483 | Ga0307511_102654832 | 116 |
| 621 | 3300030760 | Ga0265762_1077471 | Ga0265762_10774712 | 116 |
| 622 | 3300031238 | Ga0265332_10017915 | Ga0265332_100179155 | 116 |
| 623 | 3300031241 | Ga0265325_10000014 | Ga0265325_10000014135 | 116 |
| 624 | 3300031242 | Ga0265329_10025358 | Ga0265329_100253582 | 116 |
| 625 | 3300031249 | Ga0265339_10000256 | Ga0265339_1000025629 | 116 |
| 626 | 3300031344 | Ga0265316_10148087 | Ga0265316_101480874 | 116 |
| 627 | 3300031595 | Ga0265313_10000800 | Ga0265313_1000080017 | 116 |
| 628 | 3300031711 | Ga0265314_10068911 | Ga0265314_100689115 | 116 |
| 629 | 3300031712 | Ga0265342_10021698 | Ga0265342_100216986 | 116 |
| 630 | 3300031730 | Ga0307516_10054857 | Ga0307516_100548572 | 116 |
| 631 | 3300032002 | Ga0307416_102038770 | Ga0307416_1020387702 | 116 |
| 632 | 3300035083 | Ga0373926_0019576 | Ga0373926_0019576_1793_2149 | 116 |
| 633 | 3300035088 | Ga0373940_0006108 | Ga0373940_0006108_845_1201 | 116 |
| 634 | 3300035111 | Ga0373923_0127825 | Ga0373923_0127825_435_791 | 116 |
| 635 | 3300035113 | Ga0373936_0008097 | Ga0373936_0008097_1334_1690 | 116 |
| 636 | 3300035114 | Ga0373939_0021311 | Ga0373939_0021311_267_623 | 116 |
| 637 | 3300035116 | Ga0373945_0006653 | Ga0373945_0006653_3251_3607 | 116 |
| 638 | 3300035119 | Ga0373956_0311788 | Ga0373956_0311788_216_572 | 116 |
| 639 | 3300035120 | Ga0373957_0208961 | Ga0373957_0208961_442_798 | 116 |
| 640 | 3300035170 | Ga0373943_0007235 | Ga0373943_0007235_3387_3743 | 116 |
| 641 | 3300035171 | Ga0373946_0021157 | Ga0373946_0021157_519_875 | 116 |
| 642 | 3300035172 | Ga0373955_0036549 | Ga0373955_0036549_1215_1571 | 116 |
| 643 | 3300035692 | Ga0373935_0003403 | Ga0373935_0003403_7631_7987 | 116 |
| 644 | 3300035695 | Ga0373927_0064151 | Ga0373927_0064151_1025_1381 | 116 |
| 645 | 3300035725 | Ga0373947_0011709 | Ga0373947_0011709_2386_2742 | 116 |
| 646 | 3300036401 | Ga0373937_0775839 | Ga0373937_0775839_314_670 | 116 |
| 647 | 3300037068 | Ga0373925_0002514 | Ga0373925_0002514_9551_9907 | 116 |
| 648 | 3300039437 | Ga0436365_0544722 | Ga0436365_0544722_3969_4325 | 116 |
| 649 | 3300042461 | Ga0439460_0207078 | Ga0439460_0207078_278_637 | 116 |
| 650 | 3300046455 | Ga0495603_0163932 | Ga0495603_0163932_540_896 | 116 |
| 651 | 3300046457 | Ga0495590_0022080 | Ga0495590_0022080_355_711 | 116 |
| 652 | 3300046472 | Ga0495580_0387970 | Ga0495580_0387970_97_453 | 116 |
| 653 | 3300046474 | Ga0495605_0215543 | Ga0495605_0215543_455_811 | 116 |
| 654 | 3300046477 | Ga0495664_0034829 | Ga0495664_0034829_2269_2625 | 116 |
| 655 | 3300046491 | Ga0495584_0628674 | Ga0495584_0628674_23_379 | 116 |
| 656 | 3300046499 | Ga0495594_0209466 | Ga0495594_0209466_101_457 | 116 |
| 657 | 3300046528 | Ga0495642_0031203 | Ga0495642_0031203_1385_1741 | 116 |
| 658 | 3300046529 | Ga0495652_0445585 | Ga0495652_0445585_379_735 | 116 |
| 659 | 3300046530 | Ga0495654_0140206 | Ga0495654_0140206_585_941 | 116 |
| 660 | 3300046543 | Ga0495645_0086993 | Ga0495645_0086993_782_1138 | 116 |
| 661 | 3300046543 | Ga0495645_0219231 | Ga0495645_0219231_103_459 | 116 |
| 662 | 3300046557 | Ga0495622_0005205 | Ga0495622_0005205_2578_2934 | 116 |
| 663 | 3300046557 | Ga0495622_0149869 | Ga0495622_0149869_657_1013 | 116 |
| 664 | 3300046648 | Ga0495611_0052065 | Ga0495611_0052065_1334_1690 | 116 |
| 665 | 3300046683 | Ga0495658_0510622 | Ga0495658_0510622_285_641 | 116 |
| 666 | 3300046694 | Ga0495649_0014806 | Ga0495649_0014806_3689_4045 | 116 |
| 667 | 3300047319 | Ga0495674_0465109 | Ga0495674_0465109_517_873 | 116 |
| 668 | 3300047320 | Ga0495672_0010923 | Ga0495672_0010923_4001_4357 | 116 |
| 669 | 3300047444 | Ga0495675_0062651 | Ga0495675_0062651_1168_1524 | 116 |
| 670 | 3300047469 | Ga0495673_0050671 | Ga0495673_0050671_878_1234 | 116 |
| 671 | 3300048910 | Ga0496107_0510076 | Ga0496107_0510076_323_679 | 116 |
| 672 | 3300048918 | Ga0496115_0089908 | Ga0496115_0089908_235_591 | 116 |
| 673 | 3300049460 | Ga0495682_0005207 | Ga0495682_0005207_5036_5392 | 116 |
| 674 | 3300049572 | Ga0501036_0829619 | Ga0501036_0829619_180_536 | 116 |
| 675 | 3300049573 | Ga0501037_0784376 | Ga0501037_0784376_121_480 | 116 |
| 676 | 3300049574 | Ga0501038_0931781 | Ga0501038_0931781_241_597 | 116 |
| 677 | 3300049576 | Ga0501040_0339923 | Ga0501040_0339923_60_416 | 116 |
| 678 | 3300049576 | Ga0501040_1437391 | Ga0501040_1437391_32_388 | 116 |
| 679 | 3300049579 | Ga0501043_0076142 | Ga0501043_0076142_742_1098 | 116 |
| 680 | 3300049580 | Ga0501046_0397334 | Ga0501046_0397334_318_677 | 116 |
| 681 | 3300049581 | Ga0501047_0079044 | Ga0501047_0079044_2544_2900 | 116 |
| 682 | 3300049586 | Ga0501070_0449010 | Ga0501070_0449010_482_838 | 116 |
| 683 | 3300049587 | Ga0501071_0756795 | Ga0501071_0756795_205_561 | 116 |
| 684 | 3300049588 | Ga0501072_0777805 | Ga0501072_0777805_376_735 | 116 |
| 685 | 3300049588 | Ga0501072_0871679 | Ga0501072_0871679_194_550 | 116 |
| 686 | 3300049589 | Ga0501073_0013850 | Ga0501073_0013850_2170_2526 | 116 |
| 687 | 3300049592 | Ga0501076_0673885 | Ga0501076_0673885_355_711 | 116 |
| 688 | 3300049593 | Ga0501077_0316586 | Ga0501077_0316586_271_627 | 116 |
| 689 | 3300049741 | Ga0501079_1311378 | Ga0501079_1311378_100_456 | 116 |
| 690 | 3300049741 | Ga0501079_1352196 | Ga0501079_1352196_106_462 | 116 |
| 691 | 3300049742 | Ga0501080_0043846 | Ga0501080_0043846_615_971 | 116 |
| 692 | 3300049742 | Ga0501080_0283362 | Ga0501080_0283362_504_860 | 116 |
| 693 | 3300049742 | Ga0501080_0882512 | Ga0501080_0882512_190_546 | 116 |
| 694 | 3300049742 | Ga0501080_1481032 | Ga0501080_1481032_34_393 | 116 |
| 695 | 3300049743 | Ga0501081_0195365 | Ga0501081_0195365_883_1242 | 116 |
| 696 | 3300049823 | Ga0501044_0426141 | Ga0501044_0426141_697_1053 | 116 |
| 697 | 3300049823 | Ga0501044_1016818 | Ga0501044_1016818_231_587 | 116 |
| 698 | 3300049824 | Ga0501045_0128835 | Ga0501045_0128835_840_1199 | 116 |
| 699 | 3300050489 | nmdc:mga03683_193205_c1 | nmdc:mga03683_193205_c1_143_499 | 116 |
| 700 | 3300050493 | nmdc:mga0k408_3076_c1 | nmdc:mga0k408_3076_c1_6698_7054 | 116 |
| 701 | 3300050508 | nmdc:mga09592_641289_c1 | nmdc:mga09592_641289_c1_493_852 | 116 |
| 702 | 3300050509 | nmdc:mga0qj67_1078800_c1 | nmdc:mga0qj67_1078800_c1_190_549 | 116 |
| 703 | 3300050511 | nmdc:mga08y16_19140_c1 | nmdc:mga08y16_19140_c1_2973_3332 | 116 |
| 704 | 3300053080 | Ga0500635_0249855 | Ga0500635_0249855_258_614 | 116 |
| 705 | 3300053090 | Ga0500646_0206960 | Ga0500646_0206960_254_610 | 116 |
| 706 | 3300053119 | Ga0500595_048974 | Ga0500595_048974_933_1289 | 116 |
| 707 | 3300053133 | Ga0500655_006392 | Ga0500655_006392_190_546 | 116 |
| 708 | 3300053137 | Ga0500561_0041694 | Ga0500561_0041694_818_1174 | 116 |
| 709 | 3300053140 | Ga0500573_0339658 | Ga0500573_0339658_67_432 | 116 |
| 710 | 3300053178 | Ga0500637_0075513 | Ga0500637_0075513_378_734 | 116 |
| 711 | 3300054114 | Ga0501084_0000175 | Ga0501084_0000175_41780_42136 | 116 |
| 712 | 3300061734 | Ga0530510_0238077 | Ga0530510_0238077_338_697 | 116 |
| 713 | 3300005563 | Ga0068855_100128921 | Ga0068855_1001289214 | 117 |
| 714 | 3300005981 | Ga0081538_10050589 | Ga0081538_100505895 | 117 |
| 715 | 3300021358 | Ga0213873_10070365 | Ga0213873_100703651 | 117 |
| 716 | 3300021384 | Ga0213876_10164652 | Ga0213876_101646521 | 117 |
| 717 | 3300021388 | Ga0213875_10075279 | Ga0213875_100752793 | 117 |
| 718 | 3300025949 | Ga0207667_10135585 | Ga0207667_101355854 | 117 |
| 719 | 3300037312 | Ga0395899_0001783 | Ga0395899_0001783_1873_2229 | 117 |
| 720 | 3300037312 | Ga0395899_0185656 | Ga0395899_0185656_435_791 | 117 |
| 721 | 3300037418 | Ga0395900_0001968 | Ga0395900_0001968_15692_16048 | 117 |
| 722 | 3300037418 | Ga0395900_0072243 | Ga0395900_0072243_3087_3443 | 117 |
| 723 | 3300037466 | Ga0395898_0001813 | Ga0395898_0001813_7145_7501 | 117 |
| 724 | 3300037466 | Ga0395898_0070051 | Ga0395898_0070051_357_713 | 117 |
| 725 | 3300037471 | Ga0395905_0002986 | Ga0395905_0002986_10672_11028 | 117 |
| 726 | 3300038443 | Ga0395901_0045308 | Ga0395901_0045308_4165_4521 | 117 |
| 727 | 3300039453 | Ga0436362_0133744 | Ga0436362_0133744_418_786 | 117 |
| 728 | 3300045976 | Ga0466967_1086811 | Ga0466967_1086811_173_535 | 117 |
| 729 | 3300049742 | Ga0501080_0164344 | Ga0501080_0164344_563_919 | 117 |
| 730 | 3300002870 | Ga0006763J43179_111127 | Ga0006763J43179_1111271 | 118 |
| 731 | 3300003911 | JGI25405J52794_10062281 | JGI25405J52794_100622812 | 118 |
| 732 | 3300005328 | Ga0070676_10167565 | Ga0070676_101675652 | 118 |
| 733 | 3300005328 | Ga0070676_10786173 | Ga0070676_107861731 | 118 |
| 734 | 3300005366 | Ga0070659_100713145 | Ga0070659_1007131452 | 118 |
| 735 | 3300005439 | Ga0070711_101520668 | Ga0070711_1015206681 | 118 |
| 736 | 3300005456 | Ga0070678_101226755 | Ga0070678_1012267551 | 118 |
| 737 | 3300005530 | Ga0070679_101064763 | Ga0070679_1010647631 | 118 |
| 738 | 3300005535 | Ga0070684_102244406 | Ga0070684_1022444061 | 118 |
| 739 | 3300005544 | Ga0070686_100509331 | Ga0070686_1005093312 | 118 |
| 740 | 3300005546 | Ga0070696_101323023 | Ga0070696_1013230231 | 118 |
| 741 | 3300005618 | Ga0068864_101188756 | Ga0068864_1011887562 | 118 |
| 742 | 3300005840 | Ga0068870_10402606 | Ga0068870_104026061 | 118 |
| 743 | 3300005841 | Ga0068863_102146407 | Ga0068863_1021464072 | 118 |
| 744 | 3300005842 | Ga0068858_101218952 | Ga0068858_1012189522 | 118 |
| 745 | 3300006163 | Ga0070715_11000328 | Ga0070715_110003282 | 118 |
| 746 | 3300006237 | Ga0097621_101431758 | Ga0097621_1014317582 | 118 |
| 747 | 3300006237 | Ga0097621_101529259 | Ga0097621_1015292591 | 118 |
| 748 | 3300009093 | Ga0105240_11355769 | Ga0105240_113557692 | 118 |
| 749 | 3300009093 | Ga0105240_11913085 | Ga0105240_119130851 | 118 |
| 750 | 3300010375 | Ga0105239_10915674 | Ga0105239_109156742 | 118 |
| 751 | 3300013297 | Ga0157378_12383229 | Ga0157378_123832291 | 118 |
| 752 | 3300014326 | Ga0157380_11017165 | Ga0157380_110171652 | 118 |
| 753 | 3300014497 | Ga0182008_10092023 | Ga0182008_100920232 | 118 |
| 754 | 3300025908 | Ga0207643_10477063 | Ga0207643_104770632 | 118 |
| 755 | 3300025921 | Ga0207652_11396082 | Ga0207652_113960822 | 118 |
| 756 | 3300025924 | Ga0207694_10551954 | Ga0207694_105519542 | 118 |
| 757 | 3300026088 | Ga0207641_12472985 | Ga0207641_124729851 | 118 |
| 758 | 3300026095 | Ga0207676_11379686 | Ga0207676_113796862 | 118 |
| 759 | 3300026118 | Ga0207675_100347319 | Ga0207675_1003473193 | 118 |
| 760 | 3300028381 | Ga0268264_11579843 | Ga0268264_115798432 | 118 |
| 761 | 3300028573 | Ga0265334_10284866 | Ga0265334_102848662 | 118 |
| 762 | 3300028800 | Ga0265338_10053558 | Ga0265338_100535582 | 118 |
| 763 | 3300028800 | Ga0265338_10362361 | Ga0265338_103623611 | 118 |
| 764 | 3300028800 | Ga0265338_10533692 | Ga0265338_105336922 | 118 |
| 765 | 3300030760 | Ga0265762_1054893 | Ga0265762_10548932 | 118 |
| 766 | 3300031090 | Ga0265760_10126747 | Ga0265760_101267472 | 118 |
| 767 | 3300031665 | Ga0316575_10204733 | Ga0316575_102047332 | 118 |
| 768 | 3300031711 | Ga0265314_10120743 | Ga0265314_101207434 | 118 |
| 769 | 3300031852 | Ga0307410_10795926 | Ga0307410_107959261 | 118 |
| 770 | 3300032126 | Ga0307415_100533038 | Ga0307415_1005330382 | 118 |
| 771 | 3300032133 | Ga0316583_10103179 | Ga0316583_101031792 | 118 |
| 772 | 3300033524 | Ga0316592_1007387 | Ga0316592_10073874 | 118 |
| 773 | 3300035089 | Ga0373944_0139499 | Ga0373944_0139499_32_394 | 118 |
| 774 | 3300035116 | Ga0373945_0144523 | Ga0373945_0144523_206_568 | 118 |
| 775 | 3300035121 | Ga0373960_0398125 | Ga0373960_0398125_154_516 | 118 |
| 776 | 3300035692 | Ga0373935_0521708 | Ga0373935_0521708_310_672 | 118 |
| 777 | 3300036712 | Ga0316584_0280293 | Ga0316584_0280293_553_915 | 118 |
| 778 | 3300037418 | Ga0395900_1109535 | Ga0395900_1109535_208_570 | 118 |
| 779 | 3300037466 | Ga0395898_0172906 | Ga0395898_0172906_1496_1858 | 118 |
| 780 | 3300037471 | Ga0395905_1104307 | Ga0395905_1104307_317_676 | 118 |
| 781 | 3300037588 | Ga0316581_0171426 | Ga0316581_0171426_60_422 | 118 |
| 782 | 3300037853 | Ga0436364_1442444 | Ga0436364_1442444_736_1098 | 118 |
| 783 | 3300038443 | Ga0395901_0130246 | Ga0395901_0130246_1570_1932 | 118 |
| 784 | 3300038443 | Ga0395901_1984243 | Ga0395901_1984243_16_378 | 118 |
| 785 | 3300044694 | Ga0466963_1048507 | Ga0466963_1048507_98_460 | 118 |
| 786 | 3300045049 | Ga0466959_1083066 | Ga0466959_1083066_33_395 | 118 |
| 787 | 3300046476 | Ga0495662_0405102 | Ga0495662_0405102_213_575 | 118 |
| 788 | 3300046535 | Ga0495586_0907405 | Ga0495586_0907405_28_390 | 118 |
| 789 | 3300046683 | Ga0495658_0303205 | Ga0495658_0303205_213_578 | 118 |
| 790 | 3300049569 | Ga0501032_0145528 | Ga0501032_0145528_715_1077 | 118 |
| 791 | 3300049571 | Ga0501034_0132960 | Ga0501034_0132960_125_487 | 118 |
| 792 | 3300049571 | Ga0501034_1010260 | Ga0501034_1010260_131_493 | 118 |
| 793 | 3300049573 | Ga0501037_0379472 | Ga0501037_0379472_598_960 | 118 |
| 794 | 3300049577 | Ga0501041_0090359 | Ga0501041_0090359_1275_1637 | 118 |
| 795 | 3300049579 | Ga0501043_0286820 | Ga0501043_0286820_171_533 | 118 |
| 796 | 3300049581 | Ga0501047_0016976 | Ga0501047_0016976_6402_6764 | 118 |
| 797 | 3300049582 | Ga0501048_1136496 | Ga0501048_1136496_40_402 | 118 |
| 798 | 3300049586 | Ga0501070_0514861 | Ga0501070_0514861_136_498 | 118 |
| 799 | 3300049590 | Ga0501074_1250547 | Ga0501074_1250547_105_473 | 118 |
| 800 | 3300049741 | Ga0501079_0567026 | Ga0501079_0567026_255_623 | 118 |
| 801 | 3300049742 | Ga0501080_0683144 | Ga0501080_0683144_130_498 | 118 |
| 802 | 3300049822 | Ga0501035_0529788 | Ga0501035_0529788_521_883 | 118 |
| 803 | 3300053730 | Ga0500645_075788 | Ga0500645_075788_406_768 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v9r-assembly2.cif.gz_DS | crystal structure of antibiotic dityromycin bound to 70s ribosome | 0.953 | 3 | 118 |
| 6ddd-assembly1.cif.gz_a | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5 | 0.9523 | 7 | 115 |
| 4w2e-assembly1.cif.gz_S | crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome | 0.9501 | 3 | 118 |
| 6b4v-assembly1.cif.gz_P | antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome | 0.9488 | 3 | 118 |
| 4v9r-assembly2.cif.gz_DS | crystal structure of antibiotic dityromycin bound to 70s ribosome | 0.9448 | 3 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9693 | 24 | 118 | 3.30.420.100 |
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9558 | 26 | 118 | 3.30.420.100 |
| 5zetP01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9517 | 23 | 118 | 3.30.420.100 |
| 4dhcS01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9367 | 15 | 118 | 3.30.420.100 |
| 4pecO00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9287 | 3 | 118 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7DRY4-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9864 | 24 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A6N7M4M4-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9799 | 6 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-D4IMK7-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9788 | 28 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7C4EZ79-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9736 | 6 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2E1VVJ5-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9727 | 7 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar