F481466

General Info

Members Datasets Scaffolds Average Seq Length
802 358 747 345

Family's Representative Sequence

Representative Sequence 3300030745|Ga0316182_1158317|Ga0316182_11583174
Length 382
Sequence MPRLVFQRLATPAPRLGTMAGSSPRSRRIPTDDPTDKRMRIPELRHRLRQAGAGPSHEQRILRLWSHALPRSSGRRLPETFFPAALLAELPAIEAELAGLARIAAVHPGADGSERLLVALADGQTVESVLLPRDGVCVSSQVGCAVGCQFCMTGRDGLLRQVGSAEIVAQVALARTRRPVRRVVFMGMGEPAHNLENVMEAIELLGTXXXXGHKNIVFSTVGDPRVFERLLQGRVRPALALSLHTTRAGLRETLLPRAPKLSPEALVDAAERYARTTGYPIQYQWTLLEGVNDGDDEIEGIVELLSGKFGVLNMIPFNAVDGVAFRRPALARCEQIARTLHRRGILTKLRHSAAQDVDGGCGQLRARAAEARVTLVRPNGLS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2547132512 Azospira oryzae 6a3 Isolate Unclassified
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541307 Variovorax sp. GV008 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2842733646 Variovorax sp. R-72446 Isolate Unclassified
25 2842747753 Variovorax sp. R-72060 Isolate Unclassified
26 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
27 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
28 2885198086 Variovorax sp. 679 Isolate Unclassified
29 2885211737 Variovorax sp. 553 Isolate Unclassified
30 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
33 2904456579 Variovorax sp. 2002 Isolate Unclassified
34 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
35 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
36 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
44 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
45 2929520902 Variovorax beijingensis 502 Isolate Unclassified
46 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
47 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
48 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
49 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
50 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
51 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
52 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
53 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
54 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
181 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
182 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
183 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
184 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
217 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
300 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
331 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
332 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
346 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
347 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
348 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
349 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
350 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
353 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
354 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
355 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0
Isolates 6.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 20.95
Nodule 1.12
Rhizoplane 3.12
Rhizosphere 66.83
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10041523 3300001979 Bacteria 1385
2 JGI24739J22299_10009379 3300001989 Bacteria 3647
3 JGI25152J39213_1000584 3300002773 Bacteria 19736
4 JGI25152J39213_1005680 3300002773 Bacteria 3572
5 JGI25150J39212_1000579 3300002774 Bacteria 14499
6 JGI25159J45721_1000503 3300002987 Bacteria 17837
7 JGI25159J45721_1000632 3300002987 Bacteria 15620
8 JGI25159J45721_1013628 3300002987 Bacteria 1872
9 JGI25151J46595_10000562 3300003187 Bacteria 33649
10 JGI25151J46595_10000695 3300003187 Bacteria 28309
11 JGI25151J46595_10000975 3300003187 Bacteria 21681
12 JGI25151J46595_10035289 3300003187 Bacteria 1901
13 JGI25153J46596_10000825 3300003215 Bacteria 18921
14 JGI25153J46596_10013735 3300003215 Bacteria 3406
15 rootL2_10000049 3300003322 Bacteria 27745
16 rootH1_10021656 3300003323 Bacteria 17109
17 JGI25160J50197_1000554 3300003354 Bacteria 21181
18 JGI25160J50197_1003558 3300003354 Bacteria 6933
19 JGI25161J50226_1000522 3300003374 Bacteria 16619
20 JGI25161J50226_1001566 3300003374 Bacteria 6701
21 Ga0055535_1000200 3300003761 Bacteria 63747
22 Ga0055542_1000033 3300003762 Bacteria 233997
23 Ga0055526_1000577 3300003771 Bacteria 28807
24 Ga0055526_1003696 3300003771 Bacteria 9568
25 Ga0055526_1005184 3300003771 Bacteria 7574
26 Ga0055537_1000013 3300003773 Bacteria 133522
27 Ga0055537_1000411 3300003773 Bacteria 28094
28 Ga0055524_1000084 3300003775 Bacteria 119107
29 Ga0055524_1000477 3300003775 Bacteria 31879
30 Ga0055524_1000537 3300003775 Bacteria 28807
31 Ga0055524_1003784 3300003775 Bacteria 7197
32 Ga0055524_1008681 3300003775 Bacteria 4202
33 Ga0055536_1000480 3300003781 Bacteria 27754
34 Ga0055536_1000561 3300003781 Bacteria 25370
35 Ga0055536_1000693 3300003781 Bacteria 22609
36 Ga0055534_1000008 3300003784 Bacteria 211098
37 Ga0055534_1000444 3300003784 Bacteria 24404
38 Ga0055534_1002279 3300003784 Bacteria 6745
39 Ga0055528_1000170 3300003790 Bacteria 54883
40 Ga0055528_1000568 3300003790 Bacteria 28094
41 Ga0055528_1023213 3300003790 Bacteria 1901
42 Ga0055530_10000394 3300003791 Bacteria 39108
43 Ga0055530_10002278 3300003791 Bacteria 12606
44 Ga0055530_10002748 3300003791 Bacteria 10886
45 Ga0055540_1000004 3300003792 Bacteria 395545
46 Ga0055540_1000290 3300003792 Bacteria 45060
47 Ga0055540_1000682 3300003792 Bacteria 23520
48 Ga0055540_1002424 3300003792 Bacteria 9858
49 Ga0055540_1004177 3300003792 Bacteria 6655
50 Ga0055540_1012200 3300003792 Bacteria 2715
51 Ga0055531_10000637 3300003794 Bacteria 30246
52 Ga0055531_10001075 3300003794 Bacteria 21448
53 Ga0055531_10001095 3300003794 Bacteria 21238
54 Ga0055531_10001898 3300003794 Bacteria 14631
55 Ga0055531_10003664 3300003794 Bacteria 9686
56 Ga0055531_10005446 3300003794 Bacteria 7450
57 Ga0055531_10006167 3300003794 Bacteria 6854
58 Ga0055543_1000371 3300004625 Bacteria 29718
59 Ga0055543_1003773 3300004625 Bacteria 4324
60 Ga0065165_1000074 3300005262 Bacteria 164454
61 Ga0065165_1000418 3300005262 Bacteria 67473
62 Ga0065165_1001855 3300005262 Bacteria 20561
63 Ga0065165_1003015 3300005262 Bacteria 12716
64 Ga0065714_10002682 3300005288 Bacteria 19332
65 Ga0070658_10316065 3300005327 Bacteria 1333
66 Ga0070660_100058524 3300005339 Bacteria 2987
67 Ga0070661_100000994 3300005344 Bacteria 20120
68 Ga0070661_100070232 3300005344 Bacteria 2575
69 Ga0070669_100117385 3300005353 Bacteria 2026
70 Ga0070671_100005353 3300005355 Bacteria 10233
71 Ga0070673_100099988 3300005364 Bacteria 2387
72 Ga0070659_100000929 3300005366 Bacteria 21500
73 Ga0070659_100074216 3300005366 Bacteria 2709
74 Ga0070667_100370776 3300005367 Bacteria 1299
75 Ga0068853_100009767 3300005539 Bacteria 7743
76 Ga0070665_100217466 3300005548 Bacteria 1911
77 Ga0068855_100113939 3300005563 Bacteria 3101
78 Ga0068855_100219783 3300005563 Bacteria 2131
79 Ga0070664_100000282 3300005564 Bacteria 36692
80 Ga0070664_100077177 3300005564 Bacteria 2864
81 Ga0068857_100232304 3300005577 Bacteria 1687
82 Ga0068852_100213822 3300005616 Bacteria 1830
83 Ga0068859_100024836 3300005617 Bacteria 6015
84 Ga0068864_100034340 3300005618 Bacteria 4314
85 Ga0068864_100038556 3300005618 Bacteria 4082
86 Ga0068863_100053479 3300005841 Bacteria 3828
87 Ga0068863_100204934 3300005841 Bacteria 1898
88 Ga0075365_10025066 3300006038 Bacteria 3772
89 Ga0075365_10089268 3300006038 Bacteria 2098
90 Ga0075365_10154889 3300006038 Bacteria 1595
91 Ga0075363_100008339 3300006048 Bacteria 4820
92 Ga0075364_10149602 3300006051 Bacteria 1573
93 Ga0075432_10000963 3300006058 Bacteria 9117
94 Ga0075432_10004926 3300006058 Bacteria 4549
95 Ga0070716_100260856 3300006173 Bacteria 1185
96 Ga0075362_10015373 3300006177 Bacteria 3111
97 Ga0075362_10037162 3300006177 Bacteria 2133
98 Ga0075369_10076086 3300006186 Bacteria 1483
99 Ga0075366_10039747 3300006195 Bacteria 2780
100 Ga0075366_10100413 3300006195 Bacteria 1736
101 Ga0075370_10002087 3300006353 Bacteria 9100
102 Ga0075370_10005084 3300006353 Bacteria 6484
103 Ga0075370_10015441 3300006353 Bacteria 4089
104 Ga0075370_10138398 3300006353 Bacteria 1423
105 Ga0075428_100542574 3300006844 Bacteria 1243
106 Ga0097620_100024836 3300006931 Bacteria 6015
107 Ga0099823_1000304 3300006944 Bacteria 30054
108 Ga0079104_1000013 3300006946 Bacteria 349477
109 Ga0099826_10000134 3300006948 Bacteria 31806
110 Ga0099826_10041979 3300006948 Bacteria 3167
111 Ga0105244_10014998 3300009036 Bacteria 4457
112 Ga0105244_10040819 3300009036 Bacteria 2407
113 Ga0105240_10357178 3300009093 Bacteria 1656
114 Ga0105245_10227229 3300009098 Bacteria 1803
115 Ga0105243_10000690 3300009148 Bacteria 32829
116 Ga0105242_10023043 3300009176 Bacteria 4907
117 Ga0105248_10001132 3300009177 Bacteria 29671
118 Ga0105248_10187500 3300009177 Bacteria 2331
119 Ga0105239_10025933 3300010375 Bacteria 6454
120 Ga0105239_10163357 3300010375 Bacteria 2489
121 Ga0105239_10480611 3300010375 Bacteria 1411
122 Ga0105246_10034891 3300011119 Bacteria 3357
123 Ga0157319_1000013 3300012497 Bacteria 154883
124 Ga0157373_10076696 3300013100 Bacteria 2359
125 Ga0157373_10142036 3300013100 Bacteria 1688
126 Ga0157371_10001256 3300013102 Bacteria 26771
127 Ga0157369_10011573 3300013105 Bacteria 10015
128 Ga0157375_10678468 3300013308 Bacteria 1185
129 Ga0182008_10000191 3300014497 Bacteria 48580
130 Ga0182008_10006627 3300014497 Bacteria 6451
131 Ga0182006_1002609 3300015261 Bacteria 9740
132 Ga0182006_1018608 3300015261 Bacteria 2932
133 Ga0163161_10000521 3300017792 Bacteria 31378
134 Ga0163161_10010407 3300017792 Bacteria 6440
135 Ga0163161_10021987 3300017792 Bacteria 4486
136 Ga0213872_10000016 3300021361 Bacteria 180524
137 Ga0213872_10000139 3300021361 Bacteria 65459
138 Ga0213872_10005419 3300021361 Bacteria 6571
139 Ga0213872_10022235 3300021361 Bacteria 2921
140 Ga0209436_102113 3300025208 Bacteria 6225
141 Ga0209436_102781 3300025208 Bacteria 4994
142 Ga0209672_102333 3300025228 Bacteria 4798
143 Ga0209147_100572 3300025229 Bacteria 20618
144 Ga0209258_100089 3300025242 Bacteria 234040
145 Ga0207425_1000394 3300025245 Bacteria 29469
146 Ga0207425_1001018 3300025245 Bacteria 13106
147 Ga0209148_1000097 3300025254 Bacteria 234049
148 Ga0209148_1000360 3300025254 Bacteria 57908
149 Ga0209129_1000033 3300025258 Bacteria 336894
150 Ga0209129_1003556 3300025258 Bacteria 6702
151 Ga0209565_1000042 3300025263 Bacteria 239712
152 Ga0209565_1000164 3300025263 Bacteria 86911
153 Ga0209565_1002085 3300025263 Bacteria 7640
154 Ga0209673_1000071 3300025273 Bacteria 239966
155 Ga0209673_1000185 3300025273 Bacteria 125742
156 Ga0209673_1000344 3300025273 Bacteria 85344
157 Ga0209673_1001164 3300025273 Bacteria 28676
158 Ga0209673_1005732 3300025273 Bacteria 6187
159 Ga0209673_1020994 3300025273 Bacteria 2295
160 Ga0209130_1000663 3300025284 Bacteria 31315
161 Ga0209130_1001446 3300025284 Bacteria 15690
162 Ga0209130_1003566 3300025284 Bacteria 6511
163 Ga0209675_1000041 3300025291 Bacteria 239712
164 Ga0209675_1000550 3300025291 Bacteria 27376
165 Ga0209675_1002413 3300025291 Bacteria 9639
166 Ga0209675_1009852 3300025291 Bacteria 3329
167 Ga0209676_1000179 3300025292 Bacteria 150096
168 Ga0209676_1000254 3300025292 Bacteria 113136
169 Ga0209676_1000478 3300025292 Bacteria 65984
170 Ga0209676_1002371 3300025292 Bacteria 13540
171 Ga0209676_1026546 3300025292 Bacteria 1837
172 Ga0209025_1000029 3300025294 Bacteria 488571
173 Ga0209025_1002083 3300025294 Bacteria 22615
174 Ga0209025_1014574 3300025294 Bacteria 4818
175 Ga0209025_1028185 3300025294 Bacteria 2761
176 Ga0209564_1000003 3300025295 Bacteria 1585848
177 Ga0209564_1000317 3300025295 Bacteria 93914
178 Ga0209564_1000538 3300025295 Bacteria 61260
179 Ga0209758_1000027 3300025297 Bacteria 549650
180 Ga0209758_1004866 3300025297 Bacteria 10826
181 Ga0209050_1000172 3300025298 Bacteria 150096
182 Ga0209050_1001157 3300025298 Bacteria 31547
183 Ga0209050_1001288 3300025298 Bacteria 28503
184 Ga0209050_1005089 3300025298 Bacteria 8476
185 Ga0209050_1005937 3300025298 Bacteria 7434
186 Ga0209050_1022825 3300025298 Bacteria 2227
187 Ga0209256_1000069 3300025299 Bacteria 245640
188 Ga0209256_1000071 3300025299 Bacteria 242618
189 Ga0209256_1000261 3300025299 Bacteria 93914
190 Ga0209256_1000301 3300025299 Bacteria 86690
191 Ga0209256_1001182 3300025299 Bacteria 29349
192 Ga0207426_1000027 3300025302 Bacteria 513176
193 Ga0207426_1000115 3300025302 Bacteria 227423
194 Ga0207426_1026659 3300025302 Bacteria 1932
195 Ga0209051_1000016 3300025303 Bacteria 541891
196 Ga0209051_1000046 3300025303 Bacteria 296424
197 Ga0209051_1000073 3300025303 Bacteria 208874
198 Ga0209051_1000078 3300025303 Bacteria 201965
199 Ga0209051_1000821 3300025303 Bacteria 32111
200 Ga0209051_1000979 3300025303 Bacteria 27790
201 Ga0209051_1001597 3300025303 Bacteria 18535
202 Ga0209257_1000012 3300025304 Bacteria 1111138
203 Ga0209257_1000115 3300025304 Bacteria 230858
204 Ga0209257_1000139 3300025304 Bacteria 202285
205 Ga0209257_1000716 3300025304 Bacteria 50931
206 Ga0209257_1001557 3300025304 Bacteria 26586
207 Ga0209257_1002176 3300025304 Bacteria 20316
208 Ga0209257_1003149 3300025304 Bacteria 14713
209 Ga0209257_1008520 3300025304 Bacteria 5797
210 Ga0209257_1013348 3300025304 Bacteria 3665
211 Ga0207655_1005831 3300025728 Bacteria 8272
212 Ga0207655_1035059 3300025728 Bacteria 2247
213 Ga0207688_10165143 3300025901 Bacteria 1314
214 Ga0207705_10009135 3300025909 Bacteria 7226
215 Ga0207654_10015559 3300025911 Bacteria 3950
216 Ga0207657_10031155 3300025919 Bacteria 4834
217 Ga0207657_10041085 3300025919 Bacteria 4092
218 Ga0207649_10001607 3300025920 Bacteria 13119
219 Ga0207649_10069649 3300025920 Bacteria 2241
220 Ga0207681_10005513 3300025923 Bacteria 7773
221 Ga0207687_10028216 3300025927 Bacteria 3770
222 Ga0207644_10013625 3300025931 Bacteria 5425
223 Ga0207690_10001881 3300025932 Bacteria 12883
224 Ga0207690_10035851 3300025932 Bacteria 3208
225 Ga0207706_10055603 3300025933 Bacteria 3489
226 Ga0207709_10000233 3300025935 Bacteria 70451
227 Ga0207709_10264030 3300025935 Bacteria 1264
228 Ga0207665_10215833 3300025939 Bacteria 1404
229 Ga0207711_10002686 3300025941 Bacteria 15735
230 Ga0207679_10000225 3300025945 Bacteria 44668
231 Ga0207667_10026802 3300025949 Bacteria 6289
232 Ga0207667_10131082 3300025949 Bacteria 2582
233 Ga0207667_10180512 3300025949 Bacteria 2168
234 Ga0207658_10015667 3300025986 Bacteria 5204
235 Ga0207639_10087869 3300026041 Bacteria 2479
236 Ga0207678_10206954 3300026067 Bacteria 1678
237 Ga0207641_10067281 3300026088 Bacteria 3068
238 Ga0207676_10019158 3300026095 Bacteria 4987
239 Ga0207676_10070103 3300026095 Bacteria 2810
240 Ga0207674_10266131 3300026116 Bacteria 1662
241 Ga0207683_10099474 3300026121 Bacteria 2595
242 Ga0209281_1000182 3300027111 Bacteria 145698
243 Ga0209389_1033704 3300027296 Bacteria 4214
244 Ga0209970_1004268 3300027614 Bacteria 2378
245 Ga0209282_1000514 3300027666 Bacteria 18748
246 Ga0268266_10149694 3300028379 Bacteria 2102
247 Ga0307515_10013045 3300028794 Bacteria 15569
248 Ga0307512_10020082 3300030522 Bacteria 6061
249 Ga0316176_1086224 3300030732 Bacteria 1231
250 Ga0314311_1034637 3300030733 Bacteria 15856
251 Ga0316179_1018535 3300030734 Bacteria 1428
252 Ga0316178_1014198 3300030735 Bacteria 4251
253 Ga0316180_1096139 3300030736 Bacteria 3016
254 Ga0316183_1198096 3300030742 Bacteria 4176
255 Ga0316182_1158317 3300030745 Bacteria 3990
256 Ga0316182_1216334 3300030745 Bacteria 2454
257 Ga0265332_10000025 3300031238 Bacteria 197048
258 Ga0265331_10003230 3300031250 Bacteria 10620
259 Ga0265327_10000043 3300031251 Bacteria 285108
260 Ga0265316_10020249 3300031344 Bacteria 5668
261 Ga0307509_10000110 3300031507 Bacteria 117351
262 Ga0307509_10054343 3300031507 Bacteria 4265
263 Ga0307509_10056305 3300031507 Bacteria 4174
264 Ga0307408_100125785 3300031548 Bacteria 1993
265 Ga0307508_10004265 3300031616 Bacteria 14031
266 Ga0307514_10047549 3300031649 Bacteria 3349
267 Ga0307405_10019685 3300031731 Bacteria 3755
268 Ga0307405_10109230 3300031731 Bacteria 1870
269 Ga0307406_10001056 3300031901 Bacteria 15359
270 Ga0307407_10134583 3300031903 Bacteria 1586
271 Ga0307412_10108834 3300031911 Bacteria 1975
272 Ga0307416_100009235 3300032002 Bacteria 6438
273 Ga0307411_10256928 3300032005 Bacteria 1377
274 Ga0307507_10178460 3300033179 Bacteria 1524
275 Ga0307510_10031902 3300033180 Bacteria 5943
276 Ga0395899_0001479 3300037312 Bacteria 19996
277 Ga0395899_0013799 3300037312 Bacteria 6175
278 Ga0395899_0019352 3300037312 Bacteria 5173
279 Ga0395899_0020700 3300037312 Bacteria 4987
280 Ga0395899_0033517 3300037312 Bacteria 3857
281 Ga0395899_0070118 3300037312 Bacteria 2565
282 Ga0395899_0079793 3300037312 Bacteria 2383
283 Ga0395899_0169829 3300037312 Bacteria 1536
284 Ga0395899_0189581 3300037312 Bacteria 1439
285 Ga0395899_0246202 3300037312 Bacteria 1228
286 Ga0395900_0004592 3300037418 Bacteria 14575
287 Ga0395900_0020710 3300037418 Bacteria 6720
288 Ga0395900_0021662 3300037418 Bacteria 6571
289 Ga0395900_0029346 3300037418 Bacteria 5643
290 Ga0395900_0055423 3300037418 Bacteria 4082
291 Ga0395900_0099781 3300037418 Bacteria 2982
292 Ga0395900_0210844 3300037418 Bacteria 1961
293 Ga0395900_0535016 3300037418 Bacteria 1118
294 Ga0395898_0014930 3300037466 Bacteria 7975
295 Ga0395898_0047293 3300037466 Bacteria 4223
296 Ga0395898_0109699 3300037466 Bacteria 2645
297 Ga0395898_0188023 3300037466 Bacteria 1973
298 Ga0395905_0000353 3300037471 Bacteria 65228
299 Ga0395905_0000898 3300037471 Bacteria 38801
300 Ga0395905_0017731 3300037471 Bacteria 6760
301 Ga0395905_0019403 3300037471 Bacteria 6446
302 Ga0395905_0029976 3300037471 Bacteria 5128
303 Ga0395905_0041547 3300037471 Bacteria 4315
304 Ga0395905_0057531 3300037471 Bacteria 3637
305 Ga0395905_0071574 3300037471 Bacteria 3250
306 Ga0395905_0090444 3300037471 Bacteria 2869
307 Ga0395905_0162956 3300037471 Bacteria 2095
308 Ga0395905_0266514 3300037471 Bacteria 1598
309 Ga0395901_0000054 3300038443 Bacteria 160505
310 Ga0395901_0016310 3300038443 Bacteria 7566
311 Ga0395901_0037712 3300038443 Bacteria 4998
312 Ga0395901_0089438 3300038443 Bacteria 3222
313 Ga0395901_0107922 3300038443 Bacteria 2922
314 Ga0395901_0175450 3300038443 Bacteria 2248
315 Ga0395901_0594342 3300038443 Bacteria 1116
316 Ga0436361_0314510 3300039447 Bacteria 1861
317 Ga0436361_0376061 3300039447 Bacteria 200571
318 Ga0436361_0734234 3300039447 Bacteria 30887
319 Ga0436361_1141444 3300039447 Bacteria 7187
320 Ga0439466_0013359 3300041411 Bacteria 3007
321 Ga0439431_0005850 3300041997 Bacteria 2716
322 Ga0439442_001739 3300042002 Bacteria 4266
323 Ga0439442_006899 3300042002 Bacteria 2281
324 Ga0439445_0010307 3300042004 Bacteria 2210
325 Ga0439432_020657 3300042006 Bacteria 2186
326 Ga0439449_0004733 3300042007 Bacteria 5253
327 Ga0439449_0005663 3300042007 Bacteria 4778
328 Ga0439455_0006966 3300042012 Bacteria 2372
329 Ga0439455_0021735 3300042012 Bacteria 1532
330 Ga0439457_004992 3300042014 Bacteria 3395
331 Ga0450923_006691 3300042125 Bacteria 1921
332 Ga0450898_016813 3300042134 Bacteria 1253
333 Ga0450906_006013 3300042145 Bacteria 2469
334 Ga0439446_0049382 3300042156 Bacteria 1254
335 Ga0450908_004485 3300042184 Bacteria 2686
336 Ga0439434_0067509 3300042435 Bacteria 1123
337 Ga0450918_000224 3300042531 Bacteria 13018
338 Ga0466969_0000031 3300044656 Bacteria 86708
339 Ga0466969_0004479 3300044656 Bacteria 7438
340 Ga0466969_0027742 3300044656 Bacteria 2898
341 Ga0453683_0000669 3300044673 Bacteria 36646
342 Ga0466965_0018148 3300044683 Bacteria 3369
343 Ga0466965_0028945 3300044683 Bacteria 2694
344 Ga0466965_0029831 3300044683 Bacteria 2655
345 Ga0466966_0004253 3300044684 Bacteria 9444
346 Ga0466966_0014615 3300044684 Bacteria 5196
347 Ga0466966_0014676 3300044684 Bacteria 5185
348 Ga0466966_0027339 3300044684 Bacteria 3720
349 Ga0466966_0124428 3300044684 Bacteria 1582
350 Ga0466961_0003957 3300044693 Bacteria 9269
351 Ga0466961_0060921 3300044693 Bacteria 2399
352 Ga0466961_0095756 3300044693 Bacteria 1872
353 Ga0466963_0122718 3300044694 Bacteria 1789
354 Ga0466964_0002682 3300044706 Bacteria 6375
355 Ga0466964_0098193 3300044706 Bacteria 1286
356 Ga0466968_0006640 3300044735 Bacteria 4368
357 Ga0466970_0013325 3300044765 Bacteria 4215
358 Ga0466970_0031498 3300044765 Bacteria 2801
359 Ga0466970_0051171 3300044765 Bacteria 2204
360 Ga0466957_0000064 3300044842 Bacteria 40442
361 Ga0466957_0003927 3300044842 Bacteria 8220
362 Ga0466957_0065756 3300044842 Bacteria 2234
363 Ga0466960_0074756 3300044901 Bacteria 1694
364 Ga0466960_0101778 3300044901 Bacteria 1480
365 Ga0466959_0005277 3300045049 Bacteria 8827
366 Ga0466959_0014081 3300045049 Bacteria 5806
367 Ga0466959_0015320 3300045049 Bacteria 5583
368 Ga0466959_0022312 3300045049 Bacteria 4679
369 Ga0466959_0029051 3300045049 Bacteria 4095
370 Ga0466959_0032400 3300045049 Bacteria 3869
371 Ga0451576_0000168 3300045051 Bacteria 165624
372 Ga0451576_0004343 3300045051 Bacteria 18500
373 Ga0451576_0394068 3300045051 Bacteria 1452
374 Ga0451576_0686019 3300045051 Bacteria 1076
375 Ga0466958_0045245 3300045836 Bacteria 2654
376 Ga0466967_0187315 3300045976 Bacteria 1954
377 Ga0466967_0217474 3300045976 Bacteria 1814
378 Ga0495617_000057 3300046452 Bacteria 100673
379 Ga0495617_001077 3300046452 Bacteria 12438
380 Ga0495627_000841 3300046453 Bacteria 22056
381 Ga0495627_010702 3300046453 Bacteria 3322
382 Ga0495590_0003167 3300046457 Bacteria 6727
383 Ga0495638_0002966 3300046460 Bacteria 13544
384 Ga0495638_0034660 3300046460 Bacteria 3223
385 Ga0495638_0067281 3300046460 Bacteria 2200
386 Ga0495638_0074153 3300046460 Bacteria 2076
387 Ga0495650_0000140 3300046471 Bacteria 169317
388 Ga0495650_0006922 3300046471 Bacteria 6942
389 Ga0495650_0039164 3300046471 Bacteria 2047
390 Ga0495580_0009953 3300046472 Bacteria 7439
391 Ga0495582_0014476 3300046473 Bacteria 4334
392 Ga0495605_0000465 3300046474 Bacteria 36212
393 Ga0495605_0001736 3300046474 Bacteria 13967
394 Ga0495605_0005479 3300046474 Bacteria 7393
395 Ga0495605_0014595 3300046474 Bacteria 4296
396 Ga0495605_0015651 3300046474 Bacteria 4121
397 Ga0495605_0017006 3300046474 Bacteria 3928
398 Ga0495605_0029038 3300046474 Bacteria 2850
399 Ga0495605_0062292 3300046474 Bacteria 1782
400 Ga0495605_0076511 3300046474 Bacteria 1571
401 Ga0495639_0006419 3300046475 Bacteria 5059
402 Ga0495584_0000006 3300046491 Bacteria 301775
403 Ga0495584_0007725 3300046491 Bacteria 5598
404 Ga0495584_0008112 3300046491 Bacteria 5457
405 Ga0495584_0012387 3300046491 Bacteria 4352
406 Ga0495584_0014210 3300046491 Bacteria 4058
407 Ga0495584_0016047 3300046491 Bacteria 3822
408 Ga0495584_0029557 3300046491 Bacteria 2778
409 Ga0495584_0061528 3300046491 Bacteria 1887
410 Ga0495584_0090365 3300046491 Bacteria 1544
411 Ga0495585_0000193 3300046492 Bacteria 63937
412 Ga0495585_0000282 3300046492 Bacteria 50936
413 Ga0495585_0000926 3300046492 Bacteria 24849
414 Ga0495585_0002351 3300046492 Bacteria 13579
415 Ga0495585_0004871 3300046492 Bacteria 8606
416 Ga0495585_0006493 3300046492 Bacteria 7247
417 Ga0495585_0011039 3300046492 Bacteria 5363
418 Ga0495585_0019813 3300046492 Bacteria 3874
419 Ga0495585_0020463 3300046492 Bacteria 3806
420 Ga0495585_0021634 3300046492 Bacteria 3692
421 Ga0495585_0024833 3300046492 Bacteria 3435
422 Ga0495585_0029200 3300046492 Bacteria 3140
423 Ga0495585_0058942 3300046492 Bacteria 2117
424 Ga0495594_0013415 3300046499 Bacteria 4279
425 Ga0495596_0001122 3300046500 Bacteria 15822
426 Ga0495596_0003235 3300046500 Bacteria 8338
427 Ga0495596_0003685 3300046500 Bacteria 7661
428 Ga0495596_0007860 3300046500 Bacteria 4779
429 Ga0495596_0010438 3300046500 Bacteria 4045
430 Ga0495596_0011291 3300046500 Bacteria 3857
431 Ga0495596_0012493 3300046500 Bacteria 3635
432 Ga0495596_0027903 3300046500 Bacteria 2267
433 Ga0495596_0029821 3300046500 Bacteria 2185
434 Ga0495607_0012631 3300046501 Bacteria 5565
435 Ga0495607_0017265 3300046501 Bacteria 4636
436 Ga0495607_0021954 3300046501 Bacteria 4014
437 Ga0495607_0032355 3300046501 Bacteria 3192
438 Ga0495607_0034379 3300046501 Bacteria 3075
439 Ga0495607_0178963 3300046501 Bacteria 1064
440 Ga0495583_0000525 3300046506 Bacteria 54370
441 Ga0495583_0000608 3300046506 Bacteria 48449
442 Ga0495583_0004346 3300046506 Bacteria 10215
443 Ga0495583_0005683 3300046506 Bacteria 8384
444 Ga0495583_0016629 3300046506 Bacteria 3945
445 Ga0495583_0036930 3300046506 Bacteria 2320
446 Ga0495606_0008641 3300046507 Bacteria 8796
447 Ga0495606_0022396 3300046507 Bacteria 4604
448 Ga0495606_0027256 3300046507 Bacteria 4056
449 Ga0495606_0052561 3300046507 Bacteria 2648
450 Ga0495616_0000343 3300046513 Bacteria 36983
451 Ga0495616_0002034 3300046513 Bacteria 13597
452 Ga0495616_0003579 3300046513 Bacteria 9932
453 Ga0495616_0017562 3300046513 Bacteria 3945
454 Ga0495616_0018017 3300046513 Bacteria 3888
455 Ga0495616_0036740 3300046513 Bacteria 2526
456 Ga0495616_0056871 3300046513 Bacteria 1930
457 Ga0495616_0086084 3300046513 Bacteria 1495
458 Ga0495620_0030896 3300046515 Bacteria 2460
459 Ga0495630_0142285 3300046517 Bacteria 1824
460 Ga0495631_0000119 3300046518 Bacteria 52691
461 Ga0495631_0003698 3300046518 Bacteria 8343
462 Ga0495631_0004600 3300046518 Bacteria 7307
463 Ga0495631_0004822 3300046518 Bacteria 7108
464 Ga0495631_0010952 3300046518 Bacteria 4476
465 Ga0495631_0012016 3300046518 Bacteria 4243
466 Ga0495631_0025814 3300046518 Bacteria 2702
467 Ga0495631_0027836 3300046518 Bacteria 2582
468 Ga0495631_0030483 3300046518 Bacteria 2446
469 Ga0495632_0000062 3300046519 Bacteria 118205
470 Ga0495632_0000235 3300046519 Bacteria 55317
471 Ga0495632_0003209 3300046519 Bacteria 11766
472 Ga0495632_0025453 3300046519 Bacteria 3129
473 Ga0495643_0000648 3300046522 Bacteria 41187
474 Ga0495643_0011322 3300046522 Bacteria 5437
475 Ga0495643_0019644 3300046522 Bacteria 3905
476 Ga0495643_0021646 3300046522 Bacteria 3684
477 Ga0495643_0027441 3300046522 Bacteria 3199
478 Ga0495644_0001274 3300046523 Bacteria 10320
479 Ga0495644_0010772 3300046523 Bacteria 3523
480 Ga0495644_0020982 3300046523 Bacteria 2492
481 Ga0495644_0078111 3300046523 Bacteria 1247
482 Ga0495648_0000109 3300046524 Bacteria 101519
483 Ga0495648_0002349 3300046524 Bacteria 17563
484 Ga0495648_0015644 3300046524 Bacteria 5497
485 Ga0495648_0018169 3300046524 Bacteria 4995
486 Ga0495648_0018893 3300046524 Bacteria 4863
487 Ga0495663_0001540 3300046525 Bacteria 7228
488 Ga0495663_0002877 3300046525 Bacteria 5090
489 Ga0495663_0036426 3300046525 Bacteria 1481
490 Ga0495666_0002144 3300046526 Bacteria 9800
491 Ga0495666_0004957 3300046526 Bacteria 6741
492 Ga0495666_0032517 3300046526 Bacteria 2552
493 Ga0495666_0066774 3300046526 Bacteria 1714
494 Ga0495666_0074991 3300046526 Bacteria 1604
495 Ga0495642_0000196 3300046528 Bacteria 35510
496 Ga0495642_0002554 3300046528 Bacteria 7359
497 Ga0495642_0006606 3300046528 Bacteria 4452
498 Ga0495642_0052497 3300046528 Bacteria 1679
499 Ga0495642_0058291 3300046528 Bacteria 1598
500 Ga0495642_0109773 3300046528 Bacteria 1179
501 Ga0495652_0029162 3300046529 Bacteria 4848
502 Ga0495654_0024043 3300046530 Bacteria 3150
503 Ga0495654_0095866 3300046530 Bacteria 1371
504 Ga0495665_0015420 3300046531 Bacteria 4114
505 Ga0495665_0051900 3300046531 Bacteria 2171
506 Ga0495586_0019226 3300046535 Bacteria 3633
507 Ga0495586_0076307 3300046535 Bacteria 1836
508 Ga0495587_0124757 3300046536 Bacteria 1473
509 Ga0495609_0000009 3300046538 Bacteria 354860
510 Ga0495609_0004785 3300046538 Bacteria 7309
511 Ga0495609_0010220 3300046538 Bacteria 4510
512 Ga0495609_0011383 3300046538 Bacteria 4239
513 Ga0495609_0033096 3300046538 Bacteria 2347
514 Ga0495609_0033275 3300046538 Bacteria 2340
515 Ga0495609_0038987 3300046538 Bacteria 2140
516 Ga0495597_0003348 3300046542 Bacteria 9436
517 Ga0495597_0005411 3300046542 Bacteria 6761
518 Ga0495597_0007036 3300046542 Bacteria 5764
519 Ga0495597_0008429 3300046542 Bacteria 5168
520 Ga0495597_0008932 3300046542 Bacteria 4997
521 Ga0495597_0015920 3300046542 Bacteria 3556
522 Ga0495597_0017557 3300046542 Bacteria 3365
523 Ga0495622_0011636 3300046557 Bacteria 4066
524 Ga0495622_0063771 3300046557 Bacteria 1704
525 Ga0495633_0011966 3300046558 Bacteria 4638
526 Ga0495633_0017863 3300046558 Bacteria 3613
527 Ga0495633_0020810 3300046558 Bacteria 3293
528 Ga0495633_0070199 3300046558 Bacteria 1635
529 Ga0495633_0076102 3300046558 Bacteria 1563
530 Ga0495656_0000766 3300046615 Bacteria 10354
531 Ga0495656_0001204 3300046615 Bacteria 8426
532 Ga0495656_0030305 3300046615 Bacteria 2185
533 Ga0495668_0000805 3300046616 Bacteria 36034
534 Ga0495668_0002669 3300046616 Bacteria 14315
535 Ga0495668_0007275 3300046616 Bacteria 7100
536 Ga0495668_0009502 3300046616 Bacteria 5967
537 Ga0495668_0011356 3300046616 Bacteria 5338
538 Ga0495668_0015154 3300046616 Bacteria 4507
539 Ga0495668_0020397 3300046616 Bacteria 3813
540 Ga0495668_0113702 3300046616 Bacteria 1480
541 Ga0495634_0016338 3300046642 Bacteria 5308
542 Ga0495634_0062064 3300046642 Bacteria 2483
543 Ga0495611_0000861 3300046648 Bacteria 16634
544 Ga0495611_0005058 3300046648 Bacteria 5653
545 Ga0495611_0010726 3300046648 Bacteria 3880
546 Ga0495611_0018839 3300046648 Bacteria 2961
547 Ga0495611_0041367 3300046648 Bacteria 2055
548 Ga0495611_0055812 3300046648 Bacteria 1787
549 Ga0495611_0095000 3300046648 Bacteria 1379
550 Ga0495625_0000262 3300046660 Bacteria 81925
551 Ga0495625_0024004 3300046660 Bacteria 4649
552 Ga0495625_0067375 3300046660 Bacteria 2519
553 Ga0495625_0105592 3300046660 Bacteria 1929
554 Ga0495661_0000775 3300046665 Bacteria 30575
555 Ga0495661_0001167 3300046665 Bacteria 22911
556 Ga0495661_0002320 3300046665 Bacteria 14679
557 Ga0495661_0004592 3300046665 Bacteria 9939
558 Ga0495661_0009476 3300046665 Bacteria 6683
559 Ga0495661_0009659 3300046665 Bacteria 6609
560 Ga0495661_0015253 3300046665 Bacteria 5129
561 Ga0495661_0019139 3300046665 Bacteria 4492
562 Ga0495661_0067026 3300046665 Bacteria 2110
563 Ga0495661_0069328 3300046665 Bacteria 2066
564 Ga0495661_0074083 3300046665 Bacteria 1982
565 Ga0495661_0112997 3300046665 Bacteria 1511
566 Ga0495661_0119254 3300046665 Bacteria 1459
567 Ga0495588_0000077 3300046674 Bacteria 215338
568 Ga0495588_0046208 3300046674 Bacteria 2233
569 Ga0495588_0092289 3300046674 Bacteria 1586
570 Ga0495669_0000217 3300046684 Bacteria 34603
571 Ga0495669_0011043 3300046684 Bacteria 3825
572 Ga0495669_0035981 3300046684 Bacteria 2187
573 Ga0495669_0047393 3300046684 Bacteria 1919
574 Ga0495613_0047420 3300046689 Bacteria 3174
575 Ga0495624_0006044 3300046690 Bacteria 8634
576 Ga0495670_0000391 3300046691 Bacteria 20872
577 Ga0495670_0006577 3300046691 Bacteria 5714
578 Ga0495670_0007426 3300046691 Bacteria 5380
579 Ga0495670_0019960 3300046691 Bacteria 3302
580 Ga0495670_0070970 3300046691 Bacteria 1763
581 Ga0495670_0082168 3300046691 Bacteria 1642
582 Ga0495670_0102092 3300046691 Bacteria 1477
583 Ga0495671_0003370 3300046692 Bacteria 9842
584 Ga0495671_0003518 3300046692 Bacteria 9589
585 Ga0495671_0007487 3300046692 Bacteria 6216
586 Ga0495671_0017183 3300046692 Bacteria 3851
587 Ga0495671_0042124 3300046692 Bacteria 2296
588 Ga0495649_0004293 3300046694 Bacteria 9357
589 Ga0495649_0046746 3300046694 Bacteria 2356
590 Ga0495589_0000037 3300046794 Bacteria 150603
591 Ga0495589_0001177 3300046794 Bacteria 15597
592 Ga0495589_0001412 3300046794 Bacteria 13925
593 Ga0495589_0063178 3300046794 Bacteria 1816
594 Ga0495600_0027955 3300046809 Bacteria 3647
595 Ga0495660_0000178 3300046810 Bacteria 68956
596 Ga0495660_0009961 3300046810 Bacteria 5531
597 Ga0495660_0015655 3300046810 Bacteria 4379
598 Ga0495660_0017308 3300046810 Bacteria 4150
599 Ga0495660_0019036 3300046810 Bacteria 3942
600 Ga0495660_0023786 3300046810 Bacteria 3493
601 Ga0495660_0087773 3300046810 Bacteria 1621
602 Ga0495581_0017959 3300047315 Bacteria 4110
603 Ga0495604_0007219 3300047317 Bacteria 8802
604 Ga0495604_0012788 3300047317 Bacteria 6683
605 Ga0495636_0002507 3300047318 Bacteria 7045
606 Ga0495674_0003699 3300047319 Bacteria 14870
607 Ga0495672_0000005 3300047320 Bacteria 593294
608 Ga0495672_0002152 3300047320 Bacteria 18417
609 Ga0495672_0017552 3300047320 Bacteria 4784
610 Ga0495676_0000342 3300047321 Bacteria 38031
611 Ga0495676_0048580 3300047321 Bacteria 3420
612 Ga0495683_0000144 3300047323 Bacteria 69959
613 Ga0495683_0011537 3300047323 Bacteria 4647
614 Ga0495683_0016553 3300047323 Bacteria 3828
615 Ga0495683_0028210 3300047323 Bacteria 2870
616 Ga0495683_0071135 3300047323 Bacteria 1707
617 Ga0495687_000002 3300047443 Bacteria 1085770
618 Ga0495687_000024 3300047443 Bacteria 316676
619 Ga0495687_001539 3300047443 Bacteria 20979
620 Ga0495687_005014 3300047443 Bacteria 8641
621 Ga0495687_010447 3300047443 Bacteria 5092
622 Ga0495675_0011947 3300047444 Bacteria 5457
623 Ga0495675_0044687 3300047444 Bacteria 2822
624 Ga0495677_0000011 3300047445 Bacteria 149837
625 Ga0495677_0001586 3300047445 Bacteria 9165
626 Ga0495677_0002960 3300047445 Bacteria 6606
627 Ga0495677_0005197 3300047445 Bacteria 4952
628 Ga0495677_0008497 3300047445 Bacteria 3813
629 Ga0495677_0017429 3300047445 Bacteria 2604
630 Ga0495677_0032515 3300047445 Bacteria 1900
631 Ga0495677_0034663 3300047445 Bacteria 1841
632 Ga0495679_012327 3300047446 Bacteria 3259
633 Ga0495679_022161 3300047446 Bacteria 2179
634 Ga0495685_027644 3300047447 Bacteria 1951
635 Ga0495685_046341 3300047447 Bacteria 1479
636 Ga0495681_0004144 3300047470 Bacteria 9951
637 Ga0495681_0013252 3300047470 Bacteria 4796
638 Ga0495681_0024658 3300047470 Bacteria 3161
639 Ga0495681_0027197 3300047470 Bacteria 2963
640 Ga0495681_0033046 3300047470 Bacteria 2596
641 Ga0495686_0003442 3300047472 Bacteria 13716
642 Ga0495593_0020397 3300047673 Bacteria 3712
643 Ga0495602_0108137 3300048088 Bacteria 2264
644 Ga0495614_0003763 3300048089 Bacteria 6814
645 Ga0495615_0000720 3300048090 Bacteria 4632
646 Ga0495626_0000004 3300048091 Bacteria 356599
647 Ga0495626_0000016 3300048091 Bacteria 232214
648 Ga0495626_0002550 3300048091 Bacteria 12494
649 Ga0495626_0008080 3300048091 Bacteria 5805
650 Ga0495626_0011585 3300048091 Bacteria 4661
651 Ga0495626_0012782 3300048091 Bacteria 4385
652 Ga0495626_0022006 3300048091 Bacteria 3153
653 Ga0495626_0029165 3300048091 Bacteria 2672
654 Ga0495626_0031004 3300048091 Bacteria 2576
655 Ga0495626_0031428 3300048091 Bacteria 2555
656 Ga0495626_0050406 3300048091 Bacteria 1923
657 Ga0495626_0055222 3300048091 Bacteria 1821
658 Ga0495626_0063149 3300048091 Bacteria 1680
659 Ga0495626_0063151 3300048091 Bacteria 1680
660 Ga0495626_0063955 3300048091 Bacteria 1667
661 Ga0496101_0020528 3300048904 Bacteria 4524
662 Ga0496102_0000340 3300048905 Bacteria 57233
663 Ga0496102_0003156 3300048905 Bacteria 13978
664 Ga0496102_0009970 3300048905 Bacteria 8168
665 Ga0496102_0059573 3300048905 Bacteria 3491
666 Ga0496102_0083292 3300048905 Bacteria 2951
667 Ga0496102_0219586 3300048905 Bacteria 1792
668 Ga0496104_0011196 3300048907 Bacteria 8027
669 Ga0496104_0087770 3300048907 Bacteria 2971
670 Ga0496105_0006554 3300048908 Bacteria 8956
671 Ga0496105_0089227 3300048908 Bacteria 2547
672 Ga0496107_0019561 3300048910 Bacteria 4777
673 Ga0496109_0013420 3300048912 Bacteria 7106
674 Ga0496109_0034130 3300048912 Bacteria 4580
675 Ga0496110_0000019 3300048913 Bacteria 79137
676 Ga0496110_0033634 3300048913 Bacteria 4436
677 Ga0496112_0037642 3300048915 Bacteria 4721
678 Ga0496113_0001035 3300048916 Bacteria 14988
679 Ga0496114_0001006 3300048917 Bacteria 21131
680 Ga0496115_0010294 3300048918 Bacteria 6981
681 Ga0496115_0049958 3300048918 Bacteria 3349
682 Ga0496115_0106296 3300048918 Bacteria 2304
683 Ga0496116_0013225 3300048919 Bacteria 6673
684 Ga0496117_0016278 3300048920 Bacteria 6282
685 Ga0496117_0020552 3300048920 Bacteria 5377
686 Ga0496117_0039011 3300048920 Bacteria 3511
687 Ga0496118_0010315 3300048921 Bacteria 9265
688 Ga0496118_0017574 3300048921 Bacteria 6501
689 Ga0496121_0006225 3300048924 Bacteria 14952
690 Ga0496121_0063420 3300048924 Bacteria 3019
691 Ga0496122_0000039 3300048925 Bacteria 295352
692 Ga0496122_0000835 3300048925 Bacteria 58311
693 Ga0496122_0016510 3300048925 Bacteria 6978
694 Ga0496123_0000026 3300048926 Bacteria 318040
695 Ga0496123_0001003 3300048926 Bacteria 43216
696 Ga0496124_0006172 3300048927 Bacteria 13137
697 Ga0496124_0018645 3300048927 Bacteria 6492
698 Ga0496124_0020169 3300048927 Bacteria 6171
699 Ga0496124_0023676 3300048927 Bacteria 5601
700 Ga0496124_0037480 3300048927 Bacteria 4216
701 Ga0496124_0123045 3300048927 Bacteria 2070
702 Ga0496125_0001280 3300048928 Bacteria 37321
703 Ga0496125_0046039 3300048928 Bacteria 3664
704 Ga0496125_0150588 3300048928 Bacteria 1599
705 Ga0495678_002343 3300049459 Bacteria 13026
706 Ga0495678_005272 3300049459 Bacteria 7183
707 Ga0495678_005885 3300049459 Bacteria 6638
708 Ga0495678_007348 3300049459 Bacteria 5722
709 Ga0495678_010969 3300049459 Bacteria 4363
710 Ga0495682_0001115 3300049460 Bacteria 15630
711 Ga0495682_0002861 3300049460 Bacteria 7943
712 Ga0495682_0011284 3300049460 Bacteria 3438
713 Ga0495682_0042380 3300049460 Bacteria 1668
714 Ga0501046_0027412 3300049580 Bacteria 4647
715 Ga0501222_002961 3300049662 Bacteria 2342
716 Ga0501249_023155 3300049679 Bacteria 1362
717 Ga0501252_000327 3300049682 Bacteria 3415
718 Ga0501262_000019 3300049759 Bacteria 23083
719 Ga0501035_0000965 3300049822 Bacteria 30391
720 Ga0501044_0053829 3300049823 Bacteria 4139
721 nmdc:mga03683_3138_c1 3300050489 Bacteria 5269
722 nmdc:mga03683_83793_c1 3300050489 Bacteria 1381
723 nmdc:mga03n38_26716_c1 3300050490 Bacteria 2387
724 nmdc:mga0yw44_3634_c1 3300050492 Bacteria 6891
725 nmdc:mga0yw44_82186_c1 3300050492 Bacteria 2021
726 nmdc:mga0k408_183820_c1 3300050493 Bacteria 1247
727 nmdc:mga07m45_24274_c1 3300050496 Bacteria 3320
728 nmdc:mga07m45_65905_c1 3300050496 Bacteria 2057
729 nmdc:mga09592_231455_c1 3300050508 Bacteria 1601
730 nmdc:mga0qj67_186122_c1 3300050509 Bacteria 1687
731 Ga0500644_0009212 3300053088 Bacteria 2634
732 Ga0500651_0000059 3300053093 Bacteria 71552
733 Ga0500569_003152 3300053109 Bacteria 3335
734 Ga0500571_000277 3300053110 Bacteria 19921
735 Ga0500593_004378 3300053117 Bacteria 5460
736 Ga0500607_001683 3300053121 Bacteria 19314
737 Ga0500655_000057 3300053133 Bacteria 30496
738 Ga0500658_0000216 3300053134 Bacteria 27442
739 Ga0500658_0011335 3300053134 Bacteria 3283
740 Ga0500568_0001730 3300053139 Bacteria 13535
741 Ga0500574_006222 3300053141 Bacteria 2385
742 Ga0500619_000026 3300053154 Bacteria 48851
743 Ga0500627_0001913 3300053158 Bacteria 5978
744 Ga0500634_0012153 3300053161 Bacteria 4474
745 Ga0500636_0047379 3300053177 Bacteria 2532
746 Ga0466962_0007392 3300061719 Bacteria 5269
747 Ga0466962_0110180 3300061719 Bacteria 1325

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0067026 Ga0495661_0067026_17_916 295
2 3300031507 Ga0307509_10000110 Ga0307509_1000011064 311
3 3300048091 Ga0495626_0055222 Ga0495626_0055222_739_1692 311
4 3300046500 Ga0495596_0010438 Ga0495596_0010438_3010_3984 314
5 3300048905 Ga0496102_0083292 Ga0496102_0083292_1116_2150 315
6 3300006051 Ga0075364_10149602 Ga0075364_101496022 319
7 3300044683 Ga0466965_0028945 Ga0466965_0028945_47_1072 320
8 3300046528 Ga0495642_0052497 Ga0495642_0052497_20_1003 320
9 3300046501 Ga0495607_0178963 Ga0495607_0178963_68_1045 321
10 iso_pu_bacteria 2842733646 2842736536 321
11 3300003784 Ga0055534_1002279 Ga0055534_10022795 323
12 3300025284 Ga0209130_1003566 Ga0209130_10035666 323
13 3300025291 Ga0209675_1009852 Ga0209675_10098522 323
14 3300025304 Ga0209257_1008520 Ga0209257_10085207 323
15 3300046660 Ga0495625_0000262 Ga0495625_0000262_9351_10376 323
16 3300006353 Ga0075370_10005084 Ga0075370_100050845 324
17 3300006948 Ga0099826_10000134 Ga0099826_1000013421 324
18 3300048925 Ga0496122_0000039 Ga0496122_0000039_161953_162999 324
19 3300048926 Ga0496123_0000026 Ga0496123_0000026_162049_163095 324
20 3300006038 Ga0075365_10025066 Ga0075365_100250664 325
21 3300006048 Ga0075363_100008339 Ga0075363_1000083394 325
22 3300006058 Ga0075432_10000963 Ga0075432_100009634 325
23 3300006177 Ga0075362_10015373 Ga0075362_100153733 325
24 3300006195 Ga0075366_10039747 Ga0075366_100397472 325
25 3300025273 Ga0209673_1001164 Ga0209673_10011647 325
26 3300046616 Ga0495668_0015154 Ga0495668_0015154_34_1035 325
27 3300046648 Ga0495611_0055812 Ga0495611_0055812_656_1657 325
28 3300046692 Ga0495671_0003518 Ga0495671_0003518_3461_4483 325
29 3300050490 nmdc:mga03n38_26716_c1 nmdc:mga03n38_26716_c1_1304_2329 325
30 3300050492 nmdc:mga0yw44_3634_c1 nmdc:mga0yw44_3634_c1_1068_2093 325
31 3300050493 nmdc:mga0k408_183820_c1 nmdc:mga0k408_183820_c1_183_1208 325
32 3300053109 Ga0500569_003152 Ga0500569_003152_52_1074 325
33 3300053117 Ga0500593_004378 Ga0500593_004378_4050_5072 325
34 3300053158 Ga0500627_0001913 Ga0500627_0001913_2997_4019 325
35 3300003773 Ga0055537_1000013 Ga0055537_100001378 326
36 3300003784 Ga0055534_1000008 Ga0055534_1000008122 326
37 3300003790 Ga0055528_1000170 Ga0055528_100017032 326
38 3300005288 Ga0065714_10002682 Ga0065714_1000268218 326
39 3300006058 Ga0075432_10004926 Ga0075432_100049265 326
40 3300006948 Ga0099826_10041979 Ga0099826_100419794 326
41 3300011119 Ga0105246_10034891 Ga0105246_100348914 326
42 3300017792 Ga0163161_10010407 Ga0163161_100104073 326
43 3300025263 Ga0209565_1000042 Ga0209565_1000042121 326
44 3300025273 Ga0209673_1000071 Ga0209673_1000071107 326
45 3300025291 Ga0209675_1000041 Ga0209675_1000041106 326
46 3300025292 Ga0209676_1026546 Ga0209676_10265462 326
47 3300025298 Ga0209050_1022825 Ga0209050_10228252 326
48 3300027666 Ga0209282_1000514 Ga0209282_100051413 326
49 3300031903 Ga0307407_10134583 Ga0307407_101345832 326
50 3300041411 Ga0439466_0013359 Ga0439466_0013359_1968_2993 326
51 3300042145 Ga0450906_006013 Ga0450906_006013_23_1048 326
52 3300046515 Ga0495620_0030896 Ga0495620_0030896_674_1702 326
53 3300005364 Ga0070673_100099988 Ga0070673_1000999882 328
54 3300017792 Ga0163161_10021987 Ga0163161_100219876 328
55 3300025986 Ga0207658_10015667 Ga0207658_100156674 328
56 3300026121 Ga0207683_10099474 Ga0207683_100994741 328
57 3300042007 Ga0439449_0004733 Ga0439449_0004733_1266_2300 328
58 3300046474 Ga0495605_0062292 Ga0495605_0062292_590_1654 328
59 3300046501 Ga0495607_0034379 Ga0495607_0034379_1857_2921 328
60 3300046616 Ga0495668_0113702 Ga0495668_0113702_76_1200 328
61 3300048904 Ga0496101_0020528 Ga0496101_0020528_1954_2958 328
62 3300048905 Ga0496102_0009970 Ga0496102_0009970_5309_6313 328
63 3300048907 Ga0496104_0011196 Ga0496104_0011196_6322_7326 328
64 3300048908 Ga0496105_0006554 Ga0496105_0006554_5533_6537 328
65 3300044656 Ga0466969_0000031 Ga0466969_0000031_75256_76311 329
66 3300044765 Ga0466970_0031498 Ga0466970_0031498_1530_2585 329
67 3300046674 Ga0495588_0046208 Ga0495588_0046208_854_1888 329
68 3300053121 Ga0500607_001683 Ga0500607_001683_5401_6435 329
69 3300053161 Ga0500634_0012153 Ga0500634_0012153_1712_2746 329
70 iso_pu_bacteria 2510065053 2510282116 329
71 iso_pu_bacteria 2510065055 2510291725 329
72 iso_pu_bacteria 2510065058 2510310264 329
73 iso_pu_bacteria 2738541277 2738721201 329
74 iso_pu_bacteria 2738543019 2739280400 329
75 iso_pu_bacteria 2773857672 2774132480 329
76 iso_pu_bacteria 2917832318 2917835891 329
77 iso_pu_bacteria 2919125081 2919125729 329
78 iso_pu_bacteria 2974298342 2974300091 329
79 iso_pu_bacteria 2984499530 2984502471 329
80 iso_pu_bacteria 2984504281 2984508916 329
81 iso_pu_bacteria 2990196909 2990199307 329
82 iso_pu_bacteria 8016728285 8016728786 329
83 3300003323 rootH1_10021656 rootH1_100216568 330
84 3300003781 Ga0055536_1000693 Ga0055536_100069323 330
85 3300003792 Ga0055540_1004177 Ga0055540_10041778 330
86 3300009148 Ga0105243_10000690 Ga0105243_1000069015 330
87 3300025292 Ga0209676_1000478 Ga0209676_100047832 330
88 3300025303 Ga0209051_1000821 Ga0209051_100082133 330
89 3300025304 Ga0209257_1013348 Ga0209257_10133482 330
90 3300025935 Ga0207709_10000233 Ga0207709_1000023341 330
91 3300031731 Ga0307405_10019685 Ga0307405_100196852 330
92 3300045051 Ga0451576_0000168 Ga0451576_0000168_125045_126049 330
93 3300045051 Ga0451576_0686019 Ga0451576_0686019_27_1034 330
94 3300046491 Ga0495584_0012387 Ga0495584_0012387_130_1167 330
95 3300046492 Ga0495585_0024833 Ga0495585_0024833_387_1424 330
96 3300046506 Ga0495583_0000525 Ga0495583_0000525_11936_12973 330
97 3300046513 Ga0495616_0086084 Ga0495616_0086084_299_1336 330
98 3300046558 Ga0495633_0020810 Ga0495633_0020810_788_1825 330
99 3300047323 Ga0495683_0000144 Ga0495683_0000144_26767_27804 330
100 3300049580 Ga0501046_0027412 Ga0501046_0027412_2757_3755 330
101 3300050508 nmdc:mga09592_231455_c1 nmdc:mga09592_231455_c1_519_1589 330
102 iso_pu_bacteria 2929520902 2929524359 330
103 iso_pu_bacteria 2954767861 2954768158 330
104 3300025920 Ga0207649_10069649 Ga0207649_100696492 331
105 3300044673 Ga0453683_0000669 Ga0453683_0000669_30871_31899 331
106 3300045051 Ga0451576_0004343 Ga0451576_0004343_9171_10199 331
107 iso_pu_bacteria 2842747753 2842748983 331
108 3300005355 Ga0070671_100005353 Ga0070671_1000053533 332
109 3300005618 Ga0068864_100034340 Ga0068864_1000343402 332
110 3300005841 Ga0068863_100204934 Ga0068863_1002049342 332
111 3300009177 Ga0105248_10001132 Ga0105248_1000113214 332
112 3300010375 Ga0105239_10163357 Ga0105239_101633571 332
113 3300025931 Ga0207644_10013625 Ga0207644_100136253 332
114 3300025941 Ga0207711_10002686 Ga0207711_100026865 332
115 3300026095 Ga0207676_10070103 Ga0207676_100701033 332
116 3300046471 Ga0495650_0039164 Ga0495650_0039164_403_1413 332
117 3300048912 Ga0496109_0034130 Ga0496109_0034130_2906_3967 332
118 3300048915 Ga0496112_0037642 Ga0496112_0037642_1593_2654 332
119 3300048916 Ga0496113_0001035 Ga0496113_0001035_6226_7287 332
120 iso_pu_bacteria 2643221628 2644160145 332
121 3300009036 Ga0105244_10040819 Ga0105244_100408191 333
122 3300013100 Ga0157373_10076696 Ga0157373_100766961 333
123 3300013102 Ga0157371_10001256 Ga0157371_100012563 333
124 3300013105 Ga0157369_10011573 Ga0157369_100115737 333
125 3300025728 Ga0207655_1035059 Ga0207655_10350593 333
126 3300026067 Ga0207678_10206954 Ga0207678_102069542 333
127 3300031507 Ga0307509_10056305 Ga0307509_100563052 333
128 3300046460 Ga0495638_0034660 Ga0495638_0034660_504_1523 333
129 3300046471 Ga0495650_0000140 Ga0495650_0000140_26576_27586 333
130 3300046471 Ga0495650_0006922 Ga0495650_0006922_4494_5504 333
131 3300047323 Ga0495683_0011537 Ga0495683_0011537_2398_3408 333
132 3300049459 Ga0495678_002343 Ga0495678_002343_11560_12570 333
133 3300050509 nmdc:mga0qj67_186122_c1 nmdc:mga0qj67_186122_c1_250_1308 333
134 iso_pu_bacteria 2643221644 2644245371 333
135 iso_pu_bacteria 2945972063 2945972413 333
136 3300021361 Ga0213872_10000139 Ga0213872_100001398 334
137 3300030745 Ga0316182_1158317 Ga0316182_11583174 334
138 3300037471 Ga0395905_0090444 Ga0395905_0090444_585_1601 334
139 3300039447 Ga0436361_0734234 Ga0436361_0734234_13446_14498 334
140 3300046474 Ga0495605_0014595 Ga0495605_0014595_29_1045 334
141 3300046506 Ga0495583_0000608 Ga0495583_0000608_30797_31822 334
142 3300046506 Ga0495583_0005683 Ga0495583_0005683_531_1553 334
143 3300046506 Ga0495583_0016629 Ga0495583_0016629_641_1657 334
144 3300046513 Ga0495616_0000343 Ga0495616_0000343_9542_10573 334
145 3300046518 Ga0495631_0003698 Ga0495631_0003698_3230_4246 334
146 3300046522 Ga0495643_0000648 Ga0495643_0000648_6615_7637 334
147 3300046524 Ga0495648_0015644 Ga0495648_0015644_3456_4472 334
148 3300046525 Ga0495663_0002877 Ga0495663_0002877_3737_4762 334
149 3300046530 Ga0495654_0024043 Ga0495654_0024043_282_1298 334
150 3300046542 Ga0495597_0015920 Ga0495597_0015920_745_1761 334
151 3300046616 Ga0495668_0002669 Ga0495668_0002669_5458_6474 334
152 3300046660 Ga0495625_0024004 Ga0495625_0024004_3048_4064 334
153 3300046692 Ga0495671_0017183 Ga0495671_0017183_2091_3107 334
154 3300046810 Ga0495660_0087773 Ga0495660_0087773_311_1327 334
155 3300047443 Ga0495687_000002 Ga0495687_000002_920835_921851 334
156 3300047444 Ga0495675_0011947 Ga0495675_0011947_45_1061 334
157 3300047446 Ga0495679_012327 Ga0495679_012327_334_1350 334
158 3300047447 Ga0495685_027644 Ga0495685_027644_632_1648 334
159 3300047470 Ga0495681_0033046 Ga0495681_0033046_1406_2422 334
160 3300048090 Ga0495615_0000720 Ga0495615_0000720_3284_4309 334
161 3300048091 Ga0495626_0002550 Ga0495626_0002550_4919_5950 334
162 3300048908 Ga0496105_0089227 Ga0496105_0089227_67_1086 334
163 3300048913 Ga0496110_0033634 Ga0496110_0033634_2972_4024 334
164 3300048918 Ga0496115_0010294 Ga0496115_0010294_400_1428 334
165 3300049459 Ga0495678_005885 Ga0495678_005885_5171_6187 334
166 iso_pu_bacteria 2547132512 2548847779 334
167 iso_pu_bacteria 2904541872 2904545456 334
168 iso_pu_bacteria 2929160207 2929168095 334
169 3300005353 Ga0070669_100117385 Ga0070669_1001173852 335
170 3300025923 Ga0207681_10005513 Ga0207681_100055137 335
171 3300032002 Ga0307416_100009235 Ga0307416_1000092354 335
172 3300044656 Ga0466969_0027742 Ga0466969_0027742_580_1599 335
173 3300044684 Ga0466966_0004253 Ga0466966_0004253_6730_7749 335
174 3300044765 Ga0466970_0013325 Ga0466970_0013325_658_1692 335
175 3300045049 Ga0466959_0015320 Ga0466959_0015320_2191_3225 335
176 3300046492 Ga0495585_0029200 Ga0495585_0029200_843_1862 335
177 3300046500 Ga0495596_0003685 Ga0495596_0003685_1605_2624 335
178 3300046518 Ga0495631_0027836 Ga0495631_0027836_96_1115 335
179 3300046648 Ga0495611_0041367 Ga0495611_0041367_41_1060 335
180 3300046684 Ga0495669_0000217 Ga0495669_0000217_917_1936 335
181 3300046689 Ga0495613_0047420 Ga0495613_0047420_488_1507 335
182 3300046691 Ga0495670_0102092 Ga0495670_0102092_413_1432 335
183 3300047320 Ga0495672_0000005 Ga0495672_0000005_438428_439468 335
184 3300048088 Ga0495602_0108137 Ga0495602_0108137_736_1773 335
185 3300048089 Ga0495614_0003763 Ga0495614_0003763_3736_4755 335
186 3300048091 Ga0495626_0000004 Ga0495626_0000004_339416_340435 335
187 3300048091 Ga0495626_0031004 Ga0495626_0031004_753_1772 335
188 3300048918 Ga0496115_0049958 Ga0496115_0049958_770_1801 335
189 3300048927 Ga0496124_0023676 Ga0496124_0023676_819_1865 335
190 3300049682 Ga0501252_000327 Ga0501252_000327_1974_2990 335
191 iso_pu_bacteria 2513020051 2513227505 335
192 iso_pu_bacteria 2643221658 2644329513 335
193 iso_pu_bacteria 2643221672 2644398269 335
194 3300005262 Ga0065165_1003015 Ga0065165_10030152 336
195 3300014497 Ga0182008_10000191 Ga0182008_100001915 336
196 3300021361 Ga0213872_10000016 Ga0213872_10000016153 336
197 3300037312 Ga0395899_0001479 Ga0395899_0001479_6674_7708 336
198 3300037312 Ga0395899_0019352 Ga0395899_0019352_530_1546 336
199 3300037312 Ga0395899_0189581 Ga0395899_0189581_280_1314 336
200 3300037418 Ga0395900_0021662 Ga0395900_0021662_736_1770 336
201 3300037418 Ga0395900_0029346 Ga0395900_0029346_3874_4890 336
202 3300037466 Ga0395898_0109699 Ga0395898_0109699_744_1760 336
203 3300037471 Ga0395905_0029976 Ga0395905_0029976_2348_3364 336
204 3300037471 Ga0395905_0041547 Ga0395905_0041547_971_2005 336
205 3300038443 Ga0395901_0016310 Ga0395901_0016310_853_1869 336
206 3300039447 Ga0436361_0376061 Ga0436361_0376061_184365_185408 336
207 3300044706 Ga0466964_0098193 Ga0466964_0098193_76_1092 336
208 3300046452 Ga0495617_000057 Ga0495617_000057_72064_73086 336
209 3300046453 Ga0495627_000841 Ga0495627_000841_19330_20352 336
210 3300046453 Ga0495627_010702 Ga0495627_010702_568_1599 336
211 3300046457 Ga0495590_0003167 Ga0495590_0003167_1056_2087 336
212 3300046460 Ga0495638_0002966 Ga0495638_0002966_4378_5412 336
213 3300046460 Ga0495638_0067281 Ga0495638_0067281_341_1363 336
214 3300046474 Ga0495605_0000465 Ga0495605_0000465_1811_2833 336
215 3300046474 Ga0495605_0015651 Ga0495605_0015651_1139_2161 336
216 3300046474 Ga0495605_0017006 Ga0495605_0017006_1054_2076 336
217 3300046474 Ga0495605_0029038 Ga0495605_0029038_511_1545 336
218 3300046491 Ga0495584_0007725 Ga0495584_0007725_3474_4496 336
219 3300046491 Ga0495584_0029557 Ga0495584_0029557_723_1745 336
220 3300046492 Ga0495585_0002351 Ga0495585_0002351_9592_10614 336
221 3300046492 Ga0495585_0021634 Ga0495585_0021634_2007_3029 336
222 3300046500 Ga0495596_0001122 Ga0495596_0001122_1402_2436 336
223 3300046500 Ga0495596_0007860 Ga0495596_0007860_1983_3005 336
224 3300046500 Ga0495596_0012493 Ga0495596_0012493_1624_2658 336
225 3300046500 Ga0495596_0027903 Ga0495596_0027903_436_1467 336
226 3300046500 Ga0495596_0029821 Ga0495596_0029821_474_1496 336
227 3300046506 Ga0495583_0036930 Ga0495583_0036930_493_1524 336
228 3300046507 Ga0495606_0008641 Ga0495606_0008641_6670_7704 336
229 3300046507 Ga0495606_0027256 Ga0495606_0027256_3024_4046 336
230 3300046507 Ga0495606_0052561 Ga0495606_0052561_27_1049 336
231 3300046513 Ga0495616_0002034 Ga0495616_0002034_9295_10317 336
232 3300046513 Ga0495616_0018017 Ga0495616_0018017_1988_3010 336
233 3300046513 Ga0495616_0036740 Ga0495616_0036740_1036_2070 336
234 3300046513 Ga0495616_0056871 Ga0495616_0056871_225_1247 336
235 3300046518 Ga0495631_0004600 Ga0495631_0004600_1808_2842 336
236 3300046518 Ga0495631_0010952 Ga0495631_0010952_1976_2998 336
237 3300046518 Ga0495631_0012016 Ga0495631_0012016_130_1161 336
238 3300046518 Ga0495631_0025814 Ga0495631_0025814_516_1538 336
239 3300046519 Ga0495632_0025453 Ga0495632_0025453_2072_3094 336
240 3300046522 Ga0495643_0019644 Ga0495643_0019644_1449_2471 336
241 3300046522 Ga0495643_0027441 Ga0495643_0027441_459_1493 336
242 3300046523 Ga0495644_0020982 Ga0495644_0020982_903_1925 336
243 3300046524 Ga0495648_0002349 Ga0495648_0002349_13504_14526 336
244 3300046524 Ga0495648_0018893 Ga0495648_0018893_1895_2917 336
245 3300046525 Ga0495663_0036426 Ga0495663_0036426_306_1337 336
246 3300046526 Ga0495666_0032517 Ga0495666_0032517_1485_2507 336
247 3300046528 Ga0495642_0006606 Ga0495642_0006606_1368_2390 336
248 3300046528 Ga0495642_0058291 Ga0495642_0058291_117_1148 336
249 3300046530 Ga0495654_0095866 Ga0495654_0095866_23_1045 336
250 3300046535 Ga0495586_0076307 Ga0495586_0076307_47_1069 336
251 3300046538 Ga0495609_0010220 Ga0495609_0010220_2077_3108 336
252 3300046538 Ga0495609_0011383 Ga0495609_0011383_2735_3769 336
253 3300046538 Ga0495609_0038987 Ga0495609_0038987_264_1286 336
254 3300046542 Ga0495597_0005411 Ga0495597_0005411_4184_5215 336
255 3300046542 Ga0495597_0007036 Ga0495597_0007036_839_1873 336
256 3300046542 Ga0495597_0008932 Ga0495597_0008932_1983_3017 336
257 3300046542 Ga0495597_0017557 Ga0495597_0017557_2166_3188 336
258 3300046557 Ga0495622_0011636 Ga0495622_0011636_1122_2147 336
259 3300046558 Ga0495633_0076102 Ga0495633_0076102_317_1351 336
260 3300046615 Ga0495656_0030305 Ga0495656_0030305_561_1583 336
261 3300046616 Ga0495668_0000805 Ga0495668_0000805_29329_30360 336
262 3300046616 Ga0495668_0009502 Ga0495668_0009502_280_1314 336
263 3300046616 Ga0495668_0011356 Ga0495668_0011356_2924_3946 336
264 3300046648 Ga0495611_0000861 Ga0495611_0000861_8527_9549 336
265 3300046648 Ga0495611_0018839 Ga0495611_0018839_1539_2561 336
266 3300046648 Ga0495611_0095000 Ga0495611_0095000_268_1302 336
267 3300046660 Ga0495625_0067375 Ga0495625_0067375_1290_2312 336
268 3300046665 Ga0495661_0001167 Ga0495661_0001167_16593_17618 336
269 3300046665 Ga0495661_0015253 Ga0495661_0015253_3458_4492 336
270 3300046665 Ga0495661_0112997 Ga0495661_0112997_40_1074 336
271 3300046665 Ga0495661_0119254 Ga0495661_0119254_416_1438 336
272 3300046684 Ga0495669_0011043 Ga0495669_0011043_1172_2206 336
273 3300046684 Ga0495669_0035981 Ga0495669_0035981_1077_2099 336
274 3300046691 Ga0495670_0082168 Ga0495670_0082168_262_1293 336
275 3300046692 Ga0495671_0003370 Ga0495671_0003370_7915_8937 336
276 3300046692 Ga0495671_0007487 Ga0495671_0007487_3440_4462 336
277 3300046694 Ga0495649_0046746 Ga0495649_0046746_301_1332 336
278 3300046794 Ga0495589_0001177 Ga0495589_0001177_10930_11964 336
279 3300046810 Ga0495660_0015655 Ga0495660_0015655_1350_2372 336
280 3300046810 Ga0495660_0023786 Ga0495660_0023786_2060_3082 336
281 3300047317 Ga0495604_0012788 Ga0495604_0012788_4226_5248 336
282 3300047320 Ga0495672_0002152 Ga0495672_0002152_15884_16936 336
283 3300047321 Ga0495676_0000342 Ga0495676_0000342_8151_9176 336
284 3300047323 Ga0495683_0071135 Ga0495683_0071135_305_1336 336
285 3300047443 Ga0495687_010447 Ga0495687_010447_1174_2196 336
286 3300047445 Ga0495677_0002960 Ga0495677_0002960_1770_2804 336
287 3300047445 Ga0495677_0034663 Ga0495677_0034663_631_1653 336
288 3300047446 Ga0495679_022161 Ga0495679_022161_978_2000 336
289 3300047447 Ga0495685_046341 Ga0495685_046341_336_1358 336
290 3300047470 Ga0495681_0004144 Ga0495681_0004144_8576_9607 336
291 3300047470 Ga0495681_0027197 Ga0495681_0027197_345_1376 336
292 3300047472 Ga0495686_0003442 Ga0495686_0003442_8223_9254 336
293 3300047673 Ga0495593_0020397 Ga0495593_0020397_1043_2071 336
294 3300048091 Ga0495626_0011585 Ga0495626_0011585_265_1299 336
295 3300048091 Ga0495626_0022006 Ga0495626_0022006_289_1323 336
296 3300048091 Ga0495626_0063149 Ga0495626_0063149_359_1381 336
297 3300048091 Ga0495626_0063151 Ga0495626_0063151_473_1495 336
298 3300048905 Ga0496102_0003156 Ga0496102_0003156_4135_5163 336
299 3300048913 Ga0496110_0000019 Ga0496110_0000019_45720_46751 336
300 3300048925 Ga0496122_0000835 Ga0496122_0000835_34527_35555 336
301 3300048926 Ga0496123_0001003 Ga0496123_0001003_16309_17337 336
302 3300048927 Ga0496124_0006172 Ga0496124_0006172_3312_4364 336
303 3300048928 Ga0496125_0001280 Ga0496125_0001280_33935_34963 336
304 3300049459 Ga0495678_005272 Ga0495678_005272_4986_6017 336
305 3300049460 Ga0495682_0001115 Ga0495682_0001115_11397_12428 336
306 3300049460 Ga0495682_0002861 Ga0495682_0002861_4528_5562 336
307 3300049460 Ga0495682_0011284 Ga0495682_0011284_1085_2107 336
308 3300049460 Ga0495682_0042380 Ga0495682_0042380_18_1049 336
309 3300053093 Ga0500651_0000059 Ga0500651_0000059_55968_56996 336
310 3300053110 Ga0500571_000277 Ga0500571_000277_16200_17228 336
311 3300053133 Ga0500655_000057 Ga0500655_000057_5891_6919 336
312 3300053134 Ga0500658_0000216 Ga0500658_0000216_14790_15818 336
313 3300053141 Ga0500574_006222 Ga0500574_006222_195_1223 336
314 3300053177 Ga0500636_0047379 Ga0500636_0047379_821_1849 336
315 iso_pu_bacteria 2599185214 2599624327 336
316 iso_pu_bacteria 2599185226 2599672339 336
317 iso_pu_bacteria 2599185227 2599681577 336
318 iso_pu_bacteria 2599185229 2599693591 336
319 iso_pu_bacteria 2818991446 2819596665 336
320 iso_pu_bacteria 2842677519 2842678532 336
321 iso_pu_bacteria 2885192300 2885193763 336
322 iso_pu_bacteria 2885198086 2885199396 336
323 iso_pu_bacteria 2885211737 2885213047 336
324 iso_pu_bacteria 2899924645 2899931385 336
325 iso_pu_bacteria 2928037797 2928037842 336
326 iso_pu_bacteria 2928044640 2928046552 336
327 iso_pu_bacteria 2928051484 2928054252 336
328 iso_pu_bacteria 2928064002 2928066000 336
329 iso_pu_bacteria 2928070936 2928076934 336
330 iso_pu_bacteria 2928084124 2928087237 336
331 iso_pu_bacteria 2945909444 2945909782 336
332 iso_pu_bacteria 2945945610 2945945868 336
333 iso_pu_bacteria 2945984333 2945988245 336
334 3300003775 Ga0055524_1000084 Ga0055524_100008453 337
335 3300003791 Ga0055530_10002278 Ga0055530_100022785 337
336 3300003792 Ga0055540_1000004 Ga0055540_1000004225 337
337 3300003794 Ga0055531_10001095 Ga0055531_1000109516 337
338 3300003794 Ga0055531_10003664 Ga0055531_100036647 337
339 3300005327 Ga0070658_10316065 Ga0070658_103160651 337
340 3300005339 Ga0070660_100058524 Ga0070660_1000585244 337
341 3300005344 Ga0070661_100000994 Ga0070661_10000099412 337
342 3300005366 Ga0070659_100000929 Ga0070659_1000009298 337
343 3300005366 Ga0070659_100074216 Ga0070659_1000742163 337
344 3300005563 Ga0068855_100113939 Ga0068855_1001139393 337
345 3300005564 Ga0070664_100000282 Ga0070664_10000028226 337
346 3300005616 Ga0068852_100213822 Ga0068852_1002138222 337
347 3300006038 Ga0075365_10089268 Ga0075365_100892684 337
348 3300006173 Ga0070716_100260856 Ga0070716_1002608561 337
349 3300006177 Ga0075362_10037162 Ga0075362_100371621 337
350 3300006195 Ga0075366_10100413 Ga0075366_101004132 337
351 3300006353 Ga0075370_10138398 Ga0075370_101383982 337
352 3300006946 Ga0079104_1000013 Ga0079104_1000013245 337
353 3300009093 Ga0105240_10357178 Ga0105240_103571782 337
354 3300009176 Ga0105242_10023043 Ga0105242_100230432 337
355 3300010375 Ga0105239_10480611 Ga0105239_104806111 337
356 3300025254 Ga0209148_1000360 Ga0209148_10003606 337
357 3300025298 Ga0209050_1001157 Ga0209050_100115723 337
358 3300025298 Ga0209050_1005089 Ga0209050_10050895 337
359 3300025299 Ga0209256_1000071 Ga0209256_100007153 337
360 3300025303 Ga0209051_1000016 Ga0209051_1000016318 337
361 3300025303 Ga0209051_1000078 Ga0209051_1000078147 337
362 3300025304 Ga0209257_1000012 Ga0209257_1000012406 337
363 3300025304 Ga0209257_1000115 Ga0209257_100011527 337
364 3300025901 Ga0207688_10165143 Ga0207688_101651432 337
365 3300025909 Ga0207705_10009135 Ga0207705_100091353 337
366 3300025911 Ga0207654_10015559 Ga0207654_100155594 337
367 3300025919 Ga0207657_10031155 Ga0207657_100311553 337
368 3300025919 Ga0207657_10041085 Ga0207657_100410853 337
369 3300025920 Ga0207649_10001607 Ga0207649_100016077 337
370 3300025932 Ga0207690_10001881 Ga0207690_100018814 337
371 3300025932 Ga0207690_10035851 Ga0207690_100358513 337
372 3300025935 Ga0207709_10264030 Ga0207709_102640302 337
373 3300025945 Ga0207679_10000225 Ga0207679_1000022547 337
374 3300025949 Ga0207667_10026802 Ga0207667_100268026 337
375 3300027111 Ga0209281_1000182 Ga0209281_1000182111 337
376 3300031250 Ga0265331_10003230 Ga0265331_100032309 337
377 3300031251 Ga0265327_10000043 Ga0265327_10000043250 337
378 3300037312 Ga0395899_0020700 Ga0395899_0020700_3556_4587 337
379 3300037312 Ga0395899_0070118 Ga0395899_0070118_463_1494 337
380 3300037312 Ga0395899_0079793 Ga0395899_0079793_771_1802 337
381 3300037312 Ga0395899_0169829 Ga0395899_0169829_360_1391 337
382 3300037418 Ga0395900_0004592 Ga0395900_0004592_3626_4657 337
383 3300037418 Ga0395900_0099781 Ga0395900_0099781_1132_2163 337
384 3300037418 Ga0395900_0210844 Ga0395900_0210844_78_1109 337
385 3300037466 Ga0395898_0188023 Ga0395898_0188023_331_1362 337
386 3300037471 Ga0395905_0017731 Ga0395905_0017731_962_2017 337
387 3300037471 Ga0395905_0019403 Ga0395905_0019403_3498_4523 337
388 3300037471 Ga0395905_0057531 Ga0395905_0057531_2346_3377 337
389 3300038443 Ga0395901_0000054 Ga0395901_0000054_56460_57491 337
390 3300038443 Ga0395901_0037712 Ga0395901_0037712_1344_2375 337
391 3300038443 Ga0395901_0089438 Ga0395901_0089438_1751_2782 337
392 3300038443 Ga0395901_0107922 Ga0395901_0107922_1502_2533 337
393 3300038443 Ga0395901_0175450 Ga0395901_0175450_319_1350 337
394 3300042531 Ga0450918_000224 Ga0450918_000224_317_1351 337
395 3300044683 Ga0466965_0029831 Ga0466965_0029831_1358_2389 337
396 3300044684 Ga0466966_0014615 Ga0466966_0014615_3253_4284 337
397 3300044693 Ga0466961_0060921 Ga0466961_0060921_1029_2060 337
398 3300044693 Ga0466961_0095756 Ga0466961_0095756_573_1604 337
399 3300044842 Ga0466957_0000064 Ga0466957_0000064_29469_30500 337
400 3300044842 Ga0466957_0065756 Ga0466957_0065756_44_1072 337
401 3300045049 Ga0466959_0014081 Ga0466959_0014081_2495_3526 337
402 3300045049 Ga0466959_0032400 Ga0466959_0032400_544_1575 337
403 3300045836 Ga0466958_0045245 Ga0466958_0045245_1507_2538 337
404 3300046452 Ga0495617_001077 Ga0495617_001077_4036_5073 337
405 3300046472 Ga0495580_0009953 Ga0495580_0009953_6063_7109 337
406 3300046473 Ga0495582_0014476 Ga0495582_0014476_2810_3856 337
407 3300046475 Ga0495639_0006419 Ga0495639_0006419_2177_3202 337
408 3300046491 Ga0495584_0000006 Ga0495584_0000006_153421_154458 337
409 3300046491 Ga0495584_0016047 Ga0495584_0016047_2648_3679 337
410 3300046491 Ga0495584_0090365 Ga0495584_0090365_130_1167 337
411 3300046492 Ga0495585_0000193 Ga0495585_0000193_60386_61423 337
412 3300046492 Ga0495585_0019813 Ga0495585_0019813_365_1420 337
413 3300046492 Ga0495585_0058942 Ga0495585_0058942_688_1725 337
414 3300046501 Ga0495607_0021954 Ga0495607_0021954_2888_3919 337
415 3300046513 Ga0495616_0017562 Ga0495616_0017562_1343_2380 337
416 3300046517 Ga0495630_0142285 Ga0495630_0142285_361_1407 337
417 3300046519 Ga0495632_0003209 Ga0495632_0003209_4308_5342 337
418 3300046522 Ga0495643_0011322 Ga0495643_0011322_646_1680 337
419 3300046523 Ga0495644_0078111 Ga0495644_0078111_93_1130 337
420 3300046524 Ga0495648_0000109 Ga0495648_0000109_25204_26241 337
421 3300046526 Ga0495666_0004957 Ga0495666_0004957_1528_2574 337
422 3300046526 Ga0495666_0074991 Ga0495666_0074991_223_1269 337
423 3300046528 Ga0495642_0002554 Ga0495642_0002554_4154_5191 337
424 3300046529 Ga0495652_0029162 Ga0495652_0029162_2794_3840 337
425 3300046531 Ga0495665_0015420 Ga0495665_0015420_2684_3730 337
426 3300046536 Ga0495587_0124757 Ga0495587_0124757_161_1207 337
427 3300046538 Ga0495609_0000009 Ga0495609_0000009_207622_208653 337
428 3300046542 Ga0495597_0003348 Ga0495597_0003348_566_1597 337
429 3300046558 Ga0495633_0011966 Ga0495633_0011966_3167_4222 337
430 3300046558 Ga0495633_0017863 Ga0495633_0017863_1394_2431 337
431 3300046642 Ga0495634_0016338 Ga0495634_0016338_3791_4837 337
432 3300046665 Ga0495661_0000775 Ga0495661_0000775_155_1186 337
433 3300046665 Ga0495661_0002320 Ga0495661_0002320_11496_12530 337
434 3300046665 Ga0495661_0004592 Ga0495661_0004592_4376_5431 337
435 3300046691 Ga0495670_0000391 Ga0495670_0000391_10583_11620 337
436 3300046691 Ga0495670_0006577 Ga0495670_0006577_4115_5170 337
437 3300046794 Ga0495589_0000037 Ga0495589_0000037_146210_147241 337
438 3300047317 Ga0495604_0007219 Ga0495604_0007219_4078_5124 337
439 3300047319 Ga0495674_0003699 Ga0495674_0003699_7617_8654 337
440 3300047321 Ga0495676_0048580 Ga0495676_0048580_921_1958 337
441 3300047323 Ga0495683_0016553 Ga0495683_0016553_2403_3440 337
442 3300047443 Ga0495687_000024 Ga0495687_000024_294673_295704 337
443 3300047445 Ga0495677_0000011 Ga0495677_0000011_2597_3628 337
444 3300047445 Ga0495677_0005197 Ga0495677_0005197_493_1527 337
445 3300047470 Ga0495681_0013252 Ga0495681_0013252_518_1573 337
446 3300048907 Ga0496104_0087770 Ga0496104_0087770_1495_2514 337
447 3300048910 Ga0496107_0019561 Ga0496107_0019561_180_1211 337
448 3300048917 Ga0496114_0001006 Ga0496114_0001006_485_1528 337
449 3300049822 Ga0501035_0000965 Ga0501035_0000965_1666_2697 337
450 3300049823 Ga0501044_0053829 Ga0501044_0053829_1871_2902 337
451 3300050492 nmdc:mga0yw44_82186_c1 nmdc:mga0yw44_82186_c1_331_1356 337
452 iso_pu_bacteria 2643221683 2644465349 337
453 iso_pu_bacteria 2846033681 2846033912 337
454 iso_pu_bacteria 2928115317 2928115760 337
455 3300003187 JGI25151J46595_10000695 JGI25151J46595_1000069510 338
456 3300005563 Ga0068855_100219783 Ga0068855_1002197833 338
457 3300021361 Ga0213872_10005419 Ga0213872_100054192 338
458 3300025294 Ga0209025_1000029 Ga0209025_1000029295 338
459 3300025949 Ga0207667_10180512 Ga0207667_101805123 338
460 3300031238 Ga0265332_10000025 Ga0265332_10000025112 338
461 3300031548 Ga0307408_100125785 Ga0307408_1001257853 338
462 3300037312 Ga0395899_0033517 Ga0395899_0033517_2389_3435 338
463 3300037418 Ga0395900_0055423 Ga0395900_0055423_776_1822 338
464 3300037418 Ga0395900_0535016 Ga0395900_0535016_10_1041 338
465 3300037466 Ga0395898_0047293 Ga0395898_0047293_1923_2969 338
466 3300037471 Ga0395905_0266514 Ga0395905_0266514_536_1582 338
467 3300038443 Ga0395901_0594342 Ga0395901_0594342_54_1100 338
468 3300039447 Ga0436361_1141444 Ga0436361_1141444_5520_6566 338
469 3300041997 Ga0439431_0005850 Ga0439431_0005850_351_1385 338
470 3300044684 Ga0466966_0124428 Ga0466966_0124428_327_1361 338
471 3300046499 Ga0495594_0013415 Ga0495594_0013415_409_1461 338
472 3300046506 Ga0495583_0004346 Ga0495583_0004346_5957_6997 338
473 3300046518 Ga0495631_0030483 Ga0495631_0030483_787_1827 338
474 3300046523 Ga0495644_0010772 Ga0495644_0010772_2455_3495 338
475 3300046526 Ga0495666_0002144 Ga0495666_0002144_958_2010 338
476 3300046557 Ga0495622_0063771 Ga0495622_0063771_316_1368 338
477 3300046665 Ga0495661_0019139 Ga0495661_0019139_673_1764 338
478 3300046665 Ga0495661_0069328 Ga0495661_0069328_867_1901 338
479 3300046674 Ga0495588_0000077 Ga0495588_0000077_127842_128876 338
480 3300046690 Ga0495624_0006044 Ga0495624_0006044_6881_7933 338
481 3300046794 Ga0495589_0063178 Ga0495589_0063178_526_1566 338
482 3300046810 Ga0495660_0017308 Ga0495660_0017308_2677_3717 338
483 3300047315 Ga0495581_0017959 Ga0495581_0017959_2666_3718 338
484 3300047445 Ga0495677_0017429 Ga0495677_0017429_315_1352 338
485 3300047470 Ga0495681_0024658 Ga0495681_0024658_889_1929 338
486 3300048091 Ga0495626_0029165 Ga0495626_0029165_127_1167 338
487 3300048912 Ga0496109_0013420 Ga0496109_0013420_5948_6988 338
488 3300049459 Ga0495678_010969 Ga0495678_010969_112_1152 338
489 3300050496 nmdc:mga07m45_24274_c1 nmdc:mga07m45_24274_c1_281_1327 338
490 iso_pu_bacteria 2738541307 2738881130 338
491 iso_pu_bacteria 2831265667 2831267864 338
492 iso_pu_bacteria 2831864461 2831868089 338
493 iso_pu_bacteria 2838054893 2838060194 338
494 iso_pu_bacteria 2886848708 2886849883 338
495 iso_pu_bacteria 2904449895 2904455283 338
496 iso_pu_bacteria 2904456579 2904461316 338
497 3300003781 Ga0055536_1000480 Ga0055536_10004802 339
498 3300003791 Ga0055530_10002748 Ga0055530_100027482 339
499 3300003792 Ga0055540_1000290 Ga0055540_100029015 339
500 3300003794 Ga0055531_10000637 Ga0055531_1000063719 339
501 3300005262 Ga0065165_1000074 Ga0065165_1000074124 339
502 3300005344 Ga0070661_100070232 Ga0070661_1000702322 339
503 3300005548 Ga0070665_100217466 Ga0070665_1002174662 339
504 3300005564 Ga0070664_100077177 Ga0070664_1000771772 339
505 3300005617 Ga0068859_100024836 Ga0068859_1000248365 339
506 3300005618 Ga0068864_100038556 Ga0068864_1000385565 339
507 3300005841 Ga0068863_100053479 Ga0068863_1000534792 339
508 3300006931 Ga0097620_100024836 Ga0097620_1000248365 339
509 3300009036 Ga0105244_10014998 Ga0105244_100149982 339
510 3300009098 Ga0105245_10227229 Ga0105245_102272292 339
511 3300009177 Ga0105248_10187500 Ga0105248_101875002 339
512 3300013308 Ga0157375_10678468 Ga0157375_106784681 339
513 3300014497 Ga0182008_10006627 Ga0182008_100066273 339
514 3300015261 Ga0182006_1018608 Ga0182006_10186084 339
515 3300021361 Ga0213872_10022235 Ga0213872_100222352 339
516 3300025292 Ga0209676_1000254 Ga0209676_100025499 339
517 3300025298 Ga0209050_1001288 Ga0209050_100128818 339
518 3300025303 Ga0209051_1000073 Ga0209051_1000073189 339
519 3300025304 Ga0209257_1000139 Ga0209257_100013976 339
520 3300025728 Ga0207655_1005831 Ga0207655_10058314 339
521 3300025927 Ga0207687_10028216 Ga0207687_100282164 339
522 3300026041 Ga0207639_10087869 Ga0207639_100878692 339
523 3300026088 Ga0207641_10067281 Ga0207641_100672814 339
524 3300026095 Ga0207676_10019158 Ga0207676_100191585 339
525 3300028379 Ga0268266_10149694 Ga0268266_101496942 339
526 3300031344 Ga0265316_10020249 Ga0265316_100202496 339
527 3300037471 Ga0395905_0000898 Ga0395905_0000898_31256_32290 339
528 3300039447 Ga0436361_0314510 Ga0436361_0314510_676_1713 339
529 3300042012 Ga0439455_0006966 Ga0439455_0006966_87_1124 339
530 3300042012 Ga0439455_0021735 Ga0439455_0021735_199_1236 339
531 3300044693 Ga0466961_0003957 Ga0466961_0003957_6758_7819 339
532 3300044706 Ga0466964_0002682 Ga0466964_0002682_4226_5263 339
533 3300044735 Ga0466968_0006640 Ga0466968_0006640_2129_3166 339
534 3300044765 Ga0466970_0051171 Ga0466970_0051171_1052_2089 339
535 3300044901 Ga0466960_0074756 Ga0466960_0074756_410_1447 339
536 3300045051 Ga0451576_0394068 Ga0451576_0394068_10_1062 339
537 3300045976 Ga0466967_0187315 Ga0466967_0187315_159_1196 339
538 3300046474 Ga0495605_0001736 Ga0495605_0001736_9351_10388 339
539 3300046474 Ga0495605_0005479 Ga0495605_0005479_2913_3959 339
540 3300046492 Ga0495585_0000926 Ga0495585_0000926_9299_10342 339
541 3300046501 Ga0495607_0012631 Ga0495607_0012631_1607_2644 339
542 3300046501 Ga0495607_0017265 Ga0495607_0017265_2176_3213 339
543 3300046519 Ga0495632_0000062 Ga0495632_0000062_2120_3166 339
544 3300046524 Ga0495648_0018169 Ga0495648_0018169_1401_2438 339
545 3300046616 Ga0495668_0020397 Ga0495668_0020397_1031_2080 339
546 3300046665 Ga0495661_0009659 Ga0495661_0009659_2754_3791 339
547 3300046665 Ga0495661_0074083 Ga0495661_0074083_542_1579 339
548 3300046794 Ga0495589_0001412 Ga0495589_0001412_9163_10200 339
549 3300046810 Ga0495660_0000178 Ga0495660_0000178_14967_16004 339
550 3300046810 Ga0495660_0019036 Ga0495660_0019036_1613_2650 339
551 3300047320 Ga0495672_0017552 Ga0495672_0017552_983_2020 339
552 3300047323 Ga0495683_0028210 Ga0495683_0028210_1171_2208 339
553 3300047443 Ga0495687_005014 Ga0495687_005014_4040_5077 339
554 3300047445 Ga0495677_0001586 Ga0495677_0001586_2819_3856 339
555 3300048091 Ga0495626_0000016 Ga0495626_0000016_67844_68881 339
556 3300048091 Ga0495626_0063955 Ga0495626_0063955_169_1215 339
557 3300048905 Ga0496102_0000340 Ga0496102_0000340_8245_9276 339
558 3300048905 Ga0496102_0219586 Ga0496102_0219586_161_1195 339
559 3300048920 Ga0496117_0016278 Ga0496117_0016278_2101_3135 339
560 3300048921 Ga0496118_0017574 Ga0496118_0017574_2523_3557 339
561 3300048927 Ga0496124_0123045 Ga0496124_0123045_169_1203 339
562 3300003761 Ga0055535_1000200 Ga0055535_100020050 340
563 3300003762 Ga0055542_1000033 Ga0055542_1000033237 340
564 3300005367 Ga0070667_100370776 Ga0070667_1003707762 340
565 3300005577 Ga0068857_100232304 Ga0068857_1002323042 340
566 3300010375 Ga0105239_10025933 Ga0105239_100259336 340
567 3300017792 Ga0163161_10000521 Ga0163161_100005217 340
568 3300025228 Ga0209672_102333 Ga0209672_1023332 340
569 3300025229 Ga0209147_100572 Ga0209147_10057218 340
570 3300025242 Ga0209258_100089 Ga0209258_100089237 340
571 3300025254 Ga0209148_1000097 Ga0209148_1000097237 340
572 3300025302 Ga0207426_1026659 Ga0207426_10266592 340
573 3300025933 Ga0207706_10055603 Ga0207706_100556033 340
574 3300025939 Ga0207665_10215833 Ga0207665_102158333 340
575 3300025949 Ga0207667_10131082 Ga0207667_101310822 340
576 3300026116 Ga0207674_10266131 Ga0207674_102661312 340
577 3300027614 Ga0209970_1004268 Ga0209970_10042682 340
578 3300028794 Ga0307515_10013045 Ga0307515_100130453 340
579 3300030522 Ga0307512_10020082 Ga0307512_100200826 340
580 3300030732 Ga0316176_1086224 Ga0316176_10862241 340
581 3300030733 Ga0314311_1034637 Ga0314311_103463713 340
582 3300030734 Ga0316179_1018535 Ga0316179_10185352 340
583 3300030735 Ga0316178_1014198 Ga0316178_10141984 340
584 3300030736 Ga0316180_1096139 Ga0316180_10961394 340
585 3300030742 Ga0316183_1198096 Ga0316183_11980966 340
586 3300030745 Ga0316182_1216334 Ga0316182_12163343 340
587 3300031507 Ga0307509_10054343 Ga0307509_100543432 340
588 3300031616 Ga0307508_10004265 Ga0307508_100042654 340
589 3300031649 Ga0307514_10047549 Ga0307514_100475492 340
590 3300031731 Ga0307405_10109230 Ga0307405_101092302 340
591 3300031911 Ga0307412_10108834 Ga0307412_101088342 340
592 3300032005 Ga0307411_10256928 Ga0307411_102569281 340
593 3300033179 Ga0307507_10178460 Ga0307507_101784602 340
594 3300037312 Ga0395899_0013799 Ga0395899_0013799_2583_3641 340
595 3300037466 Ga0395898_0014930 Ga0395898_0014930_4476_5534 340
596 3300042002 Ga0439442_001739 Ga0439442_001739_634_1668 340
597 3300042004 Ga0439445_0010307 Ga0439445_0010307_934_1968 340
598 3300042006 Ga0439432_020657 Ga0439432_020657_937_1971 340
599 3300042007 Ga0439449_0005663 Ga0439449_0005663_1243_2277 340
600 3300042014 Ga0439457_004992 Ga0439457_004992_1656_2690 340
601 3300042134 Ga0450898_016813 Ga0450898_016813_76_1113 340
602 3300042156 Ga0439446_0049382 Ga0439446_0049382_176_1210 340
603 3300042435 Ga0439434_0067509 Ga0439434_0067509_11_1045 340
604 3300044901 Ga0466960_0101778 Ga0466960_0101778_292_1329 340
605 3300046491 Ga0495584_0008112 Ga0495584_0008112_3917_4966 340
606 3300046492 Ga0495585_0006493 Ga0495585_0006493_4705_5751 340
607 3300046492 Ga0495585_0020463 Ga0495585_0020463_2632_3678 340
608 3300046507 Ga0495606_0022396 Ga0495606_0022396_1516_2565 340
609 3300046513 Ga0495616_0003579 Ga0495616_0003579_695_1732 340
610 3300046518 Ga0495631_0000119 Ga0495631_0000119_33037_34074 340
611 3300046525 Ga0495663_0001540 Ga0495663_0001540_873_1922 340
612 3300046528 Ga0495642_0109773 Ga0495642_0109773_13_1068 340
613 3300046542 Ga0495597_0008429 Ga0495597_0008429_522_1568 340
614 3300046615 Ga0495656_0000766 Ga0495656_0000766_9222_10271 340
615 3300046615 Ga0495656_0001204 Ga0495656_0001204_6560_7594 340
616 3300046660 Ga0495625_0105592 Ga0495625_0105592_460_1497 340
617 3300046691 Ga0495670_0070970 Ga0495670_0070970_679_1713 340
618 3300047443 Ga0495687_001539 Ga0495687_001539_16035_17084 340
619 3300047445 Ga0495677_0008497 Ga0495677_0008497_2357_3406 340
620 3300048924 Ga0496121_0006225 Ga0496121_0006225_10146_11183 340
621 3300048927 Ga0496124_0018645 Ga0496124_0018645_3916_4956 340
622 3300049662 Ga0501222_002961 Ga0501222_002961_655_1707 340
623 3300049679 Ga0501249_023155 Ga0501249_023155_189_1265 340
624 3300053088 Ga0500644_0009212 Ga0500644_0009212_1401_2447 340
625 3300053134 Ga0500658_0011335 Ga0500658_0011335_1449_2486 340
626 3300053139 Ga0500568_0001730 Ga0500568_0001730_1051_2088 340
627 3300003187 JGI25151J46595_10000562 JGI25151J46595_1000056228 341
628 3300003322 rootL2_10000049 rootL2_1000004930 341
629 3300003771 Ga0055526_1003696 Ga0055526_10036968 341
630 3300003775 Ga0055524_1000477 Ga0055524_100047721 341
631 3300003775 Ga0055524_1008681 Ga0055524_10086813 341
632 3300003794 Ga0055531_10005446 Ga0055531_100054462 341
633 3300003794 Ga0055531_10006167 Ga0055531_100061673 341
634 3300005262 Ga0065165_1000418 Ga0065165_100041867 341
635 3300006353 Ga0075370_10002087 Ga0075370_100020873 341
636 3300006844 Ga0075428_100542574 Ga0075428_1005425741 341
637 3300006944 Ga0099823_1000304 Ga0099823_100030426 341
638 3300012497 Ga0157319_1000013 Ga0157319_100001387 341
639 3300025273 Ga0209673_1005732 Ga0209673_10057324 341
640 3300025273 Ga0209673_1020994 Ga0209673_10209942 341
641 3300025294 Ga0209025_1028185 Ga0209025_10281852 341
642 3300025295 Ga0209564_1000003 Ga0209564_1000003298 341
643 3300025298 Ga0209050_1005937 Ga0209050_10059375 341
644 3300025299 Ga0209256_1000301 Ga0209256_100030125 341
645 3300025299 Ga0209256_1001182 Ga0209256_100118228 341
646 3300025303 Ga0209051_1001597 Ga0209051_10015972 341
647 3300025304 Ga0209257_1001557 Ga0209257_100155729 341
648 3300025304 Ga0209257_1003149 Ga0209257_100314915 341
649 3300027296 Ga0209389_1033704 Ga0209389_10337042 341
650 3300033180 Ga0307510_10031902 Ga0307510_100319023 341
651 3300037312 Ga0395899_0246202 Ga0395899_0246202_119_1162 341
652 3300037418 Ga0395900_0020710 Ga0395900_0020710_1354_2397 341
653 3300037471 Ga0395905_0071574 Ga0395905_0071574_99_1160 341
654 3300037471 Ga0395905_0162956 Ga0395905_0162956_809_1870 341
655 3300042002 Ga0439442_006899 Ga0439442_006899_759_1820 341
656 3300042125 Ga0450923_006691 Ga0450923_006691_828_1889 341
657 3300042184 Ga0450908_004485 Ga0450908_004485_159_1220 341
658 3300044684 Ga0466966_0027339 Ga0466966_0027339_1587_2630 341
659 3300044694 Ga0466963_0122718 Ga0466963_0122718_41_1096 341
660 3300045049 Ga0466959_0022312 Ga0466959_0022312_524_1597 341
661 3300045049 Ga0466959_0029051 Ga0466959_0029051_235_1278 341
662 3300045976 Ga0466967_0217474 Ga0466967_0217474_703_1746 341
663 3300046460 Ga0495638_0074153 Ga0495638_0074153_663_1712 341
664 3300046474 Ga0495605_0076511 Ga0495605_0076511_317_1366 341
665 3300046491 Ga0495584_0014210 Ga0495584_0014210_1589_2638 341
666 3300046491 Ga0495584_0061528 Ga0495584_0061528_592_1641 341
667 3300046492 Ga0495585_0000282 Ga0495585_0000282_32517_33566 341
668 3300046492 Ga0495585_0004871 Ga0495585_0004871_1792_2844 341
669 3300046492 Ga0495585_0011039 Ga0495585_0011039_1727_2776 341
670 3300046500 Ga0495596_0003235 Ga0495596_0003235_3603_4652 341
671 3300046500 Ga0495596_0011291 Ga0495596_0011291_2375_3424 341
672 3300046501 Ga0495607_0032355 Ga0495607_0032355_1697_2746 341
673 3300046518 Ga0495631_0004822 Ga0495631_0004822_1766_2815 341
674 3300046519 Ga0495632_0000235 Ga0495632_0000235_50872_51921 341
675 3300046522 Ga0495643_0021646 Ga0495643_0021646_720_1802 341
676 3300046523 Ga0495644_0001274 Ga0495644_0001274_8337_9386 341
677 3300046526 Ga0495666_0066774 Ga0495666_0066774_458_1510 341
678 3300046528 Ga0495642_0000196 Ga0495642_0000196_7032_8081 341
679 3300046531 Ga0495665_0051900 Ga0495665_0051900_138_1187 341
680 3300046535 Ga0495586_0019226 Ga0495586_0019226_455_1513 341
681 3300046538 Ga0495609_0004785 Ga0495609_0004785_5726_6775 341
682 3300046538 Ga0495609_0033096 Ga0495609_0033096_182_1231 341
683 3300046538 Ga0495609_0033275 Ga0495609_0033275_717_1766 341
684 3300046558 Ga0495633_0070199 Ga0495633_0070199_184_1233 341
685 3300046616 Ga0495668_0007275 Ga0495668_0007275_6005_7063 341
686 3300046642 Ga0495634_0062064 Ga0495634_0062064_49_1110 341
687 3300046648 Ga0495611_0005058 Ga0495611_0005058_61_1110 341
688 3300046648 Ga0495611_0010726 Ga0495611_0010726_2766_3815 341
689 3300046665 Ga0495661_0009476 Ga0495661_0009476_5312_6364 341
690 3300046674 Ga0495588_0092289 Ga0495588_0092289_58_1107 341
691 3300046684 Ga0495669_0047393 Ga0495669_0047393_264_1313 341
692 3300046691 Ga0495670_0007426 Ga0495670_0007426_2657_3709 341
693 3300046691 Ga0495670_0019960 Ga0495670_0019960_1830_2879 341
694 3300046692 Ga0495671_0042124 Ga0495671_0042124_735_1784 341
695 3300046694 Ga0495649_0004293 Ga0495649_0004293_1577_2659 341
696 3300046809 Ga0495600_0027955 Ga0495600_0027955_784_1845 341
697 3300046810 Ga0495660_0009961 Ga0495660_0009961_3058_4107 341
698 3300047318 Ga0495636_0002507 Ga0495636_0002507_3837_4886 341
699 3300047444 Ga0495675_0044687 Ga0495675_0044687_1385_2461 341
700 3300047445 Ga0495677_0032515 Ga0495677_0032515_124_1173 341
701 3300048091 Ga0495626_0008080 Ga0495626_0008080_100_1149 341
702 3300048091 Ga0495626_0012782 Ga0495626_0012782_2287_3369 341
703 3300048091 Ga0495626_0031428 Ga0495626_0031428_1157_2206 341
704 3300048091 Ga0495626_0050406 Ga0495626_0050406_602_1651 341
705 3300048905 Ga0496102_0059573 Ga0496102_0059573_1443_2486 341
706 3300048918 Ga0496115_0106296 Ga0496115_0106296_58_1107 341
707 3300048919 Ga0496116_0013225 Ga0496116_0013225_3912_4976 341
708 3300048920 Ga0496117_0039011 Ga0496117_0039011_1509_2573 341
709 3300048924 Ga0496121_0063420 Ga0496121_0063420_23_1087 341
710 3300048925 Ga0496122_0016510 Ga0496122_0016510_3716_4759 341
711 3300048927 Ga0496124_0020169 Ga0496124_0020169_1341_2414 341
712 3300048927 Ga0496124_0037480 Ga0496124_0037480_2621_3664 341
713 3300048928 Ga0496125_0150588 Ga0496125_0150588_254_1297 341
714 3300049459 Ga0495678_007348 Ga0495678_007348_3507_4556 341
715 3300049759 Ga0501262_000019 Ga0501262_000019_13959_15038 341
716 3300053154 Ga0500619_000026 Ga0500619_000026_32137_33183 341
717 3300061719 Ga0466962_0110180 Ga0466962_0110180_157_1200 341
718 3300001979 JGI24740J21852_10041523 JGI24740J21852_100415231 342
719 3300001989 JGI24739J22299_10009379 JGI24739J22299_100093792 342
720 3300002773 JGI25152J39213_1000584 JGI25152J39213_100058413 342
721 3300002773 JGI25152J39213_1005680 JGI25152J39213_10056802 342
722 3300002774 JGI25150J39212_1000579 JGI25150J39212_100057913 342
723 3300002987 JGI25159J45721_1000503 JGI25159J45721_100050317 342
724 3300002987 JGI25159J45721_1000632 JGI25159J45721_100063214 342
725 3300002987 JGI25159J45721_1013628 JGI25159J45721_10136282 342
726 3300003187 JGI25151J46595_10000975 JGI25151J46595_1000097513 342
727 3300003187 JGI25151J46595_10035289 JGI25151J46595_100352892 342
728 3300003215 JGI25153J46596_10000825 JGI25153J46596_1000082513 342
729 3300003215 JGI25153J46596_10013735 JGI25153J46596_100137352 342
730 3300003354 JGI25160J50197_1000554 JGI25160J50197_10005544 342
731 3300003354 JGI25160J50197_1003558 JGI25160J50197_10035582 342
732 3300003374 JGI25161J50226_1000522 JGI25161J50226_100052210 342
733 3300003374 JGI25161J50226_1001566 JGI25161J50226_10015664 342
734 3300003771 Ga0055526_1000577 Ga0055526_100057720 342
735 3300003771 Ga0055526_1005184 Ga0055526_100518412 342
736 3300003773 Ga0055537_1000411 Ga0055537_100041113 342
737 3300003775 Ga0055524_1000537 Ga0055524_100053720 342
738 3300003775 Ga0055524_1003784 Ga0055524_10037843 342
739 3300003781 Ga0055536_1000561 Ga0055536_100056120 342
740 3300003784 Ga0055534_1000444 Ga0055534_100044414 342
741 3300003790 Ga0055528_1000568 Ga0055528_100056813 342
742 3300003790 Ga0055528_1023213 Ga0055528_10232132 342
743 3300003791 Ga0055530_10000394 Ga0055530_100003948 342
744 3300003792 Ga0055540_1000682 Ga0055540_100068220 342
745 3300003792 Ga0055540_1002424 Ga0055540_10024244 342
746 3300003792 Ga0055540_1012200 Ga0055540_10122001 342
747 3300003794 Ga0055531_10001075 Ga0055531_100010755 342
748 3300003794 Ga0055531_10001898 Ga0055531_1000189811 342
749 3300004625 Ga0055543_1000371 Ga0055543_100037120 342
750 3300004625 Ga0055543_1003773 Ga0055543_10037735 342
751 3300005262 Ga0065165_1001855 Ga0065165_100185514 342
752 3300005539 Ga0068853_100009767 Ga0068853_1000097672 342
753 3300006038 Ga0075365_10154889 Ga0075365_101548892 342
754 3300006186 Ga0075369_10076086 Ga0075369_100760862 342
755 3300006353 Ga0075370_10015441 Ga0075370_100154413 342
756 3300013100 Ga0157373_10142036 Ga0157373_101420362 342
757 3300015261 Ga0182006_1002609 Ga0182006_100260910 342
758 3300025208 Ga0209436_102113 Ga0209436_1021134 342
759 3300025208 Ga0209436_102781 Ga0209436_1027815 342
760 3300025245 Ga0207425_1000394 Ga0207425_100039413 342
761 3300025245 Ga0207425_1001018 Ga0207425_100101812 342
762 3300025258 Ga0209129_1000033 Ga0209129_1000033101 342
763 3300025258 Ga0209129_1003556 Ga0209129_10035563 342
764 3300025263 Ga0209565_1000164 Ga0209565_100016451 342
765 3300025263 Ga0209565_1002085 Ga0209565_10020856 342
766 3300025273 Ga0209673_1000185 Ga0209673_100018545 342
767 3300025273 Ga0209673_1000344 Ga0209673_100034452 342
768 3300025284 Ga0209130_1000663 Ga0209130_100066320 342
769 3300025284 Ga0209130_1001446 Ga0209130_10014463 342
770 3300025291 Ga0209675_1000550 Ga0209675_100055017 342
771 3300025291 Ga0209675_1002413 Ga0209675_10024138 342
772 3300025292 Ga0209676_1000179 Ga0209676_100017924 342
773 3300025292 Ga0209676_1002371 Ga0209676_100237110 342
774 3300025294 Ga0209025_1002083 Ga0209025_100208311 342
775 3300025294 Ga0209025_1014574 Ga0209025_10145741 342
776 3300025295 Ga0209564_1000317 Ga0209564_100031762 342
777 3300025295 Ga0209564_1000538 Ga0209564_100053845 342
778 3300025297 Ga0209758_1000027 Ga0209758_1000027101 342
779 3300025297 Ga0209758_1004866 Ga0209758_100486612 342
780 3300025298 Ga0209050_1000172 Ga0209050_1000172127 342
781 3300025299 Ga0209256_1000069 Ga0209256_100006966 342
782 3300025299 Ga0209256_1000261 Ga0209256_100026162 342
783 3300025302 Ga0207426_1000027 Ga0207426_100002761 342
784 3300025302 Ga0207426_1000115 Ga0207426_1000115119 342
785 3300025303 Ga0209051_1000046 Ga0209051_1000046127 342
786 3300025303 Ga0209051_1000979 Ga0209051_100097928 342
787 3300025304 Ga0209257_1000716 Ga0209257_100071622 342
788 3300025304 Ga0209257_1002176 Ga0209257_100217611 342
789 3300031901 Ga0307406_10001056 Ga0307406_100010564 342
790 3300037471 Ga0395905_0000353 Ga0395905_0000353_25757_26812 342
791 3300044656 Ga0466969_0004479 Ga0466969_0004479_4713_5801 342
792 3300044683 Ga0466965_0018148 Ga0466965_0018148_452_1540 342
793 3300044684 Ga0466966_0014676 Ga0466966_0014676_2489_3577 342
794 3300044842 Ga0466957_0003927 Ga0466957_0003927_3470_4558 342
795 3300045049 Ga0466959_0005277 Ga0466959_0005277_1047_2135 342
796 3300048920 Ga0496117_0020552 Ga0496117_0020552_2044_3102 342
797 3300048921 Ga0496118_0010315 Ga0496118_0010315_4471_5529 342
798 3300048928 Ga0496125_0046039 Ga0496125_0046039_2361_3419 342
799 3300050489 nmdc:mga03683_3138_c1 nmdc:mga03683_3138_c1_662_1717 342
800 3300050489 nmdc:mga03683_83793_c1 nmdc:mga03683_83793_c1_152_1216 342
801 3300050496 nmdc:mga07m45_65905_c1 nmdc:mga07m45_65905_c1_788_1828 342
802 3300061719 Ga0466962_0007392 Ga0466962_0007392_3718_4806 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

138

305

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.8394 1 314
3rfa-assembly1.cif.gz_B x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.8319 1 340
6fz6-assembly2.cif.gz_B crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus 0.8318 1 327
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.8312 1 310
3rfa-assembly1.cif.gz_B x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.8297 1 340
ID Description Score Start End Superfamily
af_Q54J76_110_396_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 64 329 3.20.20.70
af_F4IVY6_128_412_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9235 64 325 3.20.20.70
af_A0A1D6MYU6_82_194_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9231 97 199 3.20.20.70
af_A0A1D6G3V2_170_411_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.915 102 325 3.20.20.70
6fz6B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9116 63 327 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A109D0J5-F1-model_v4 deleted 0.9968 1 246
AF-A0A109D0J5-F1-model_v4 deleted 0.9928 1 246
AF-A0A370FJC7-F1-model_v4 23S rRNA (Adenine2503-C2)-methyltransferase 0.988 1 329 GO:0005737
GO:0008173
GO:0030488
GO:0046872
GO:0051539
GO:0070475
AF-A0A6L5CA67-F1-model_v4 deleted 0.9873 1 309
AF-A0A1G8EU35-F1-model_v4 23S rRNA (Adenine2503-C2)-methyltransferase 0.9862 1 332 GO:0005737
GO:0008173
GO:0030488
GO:0046872
GO:0051539
GO:0070475

Feature Viewer

pLDDT pTM Quality
89.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map