F481466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 802 | 358 | 747 | 345 |
Family's Representative Sequence
| Representative Sequence | 3300030745|Ga0316182_1158317|Ga0316182_11583174 |
| Length | 382 |
| Sequence | MPRLVFQRLATPAPRLGTMAGSSPRSRRIPTDDPTDKRMRIPELRHRLRQAGAGPSHEQRILRLWSHALPRSSGRRLPETFFPAALLAELPAIEAELAGLARIAAVHPGADGSERLLVALADGQTVESVLLPRDGVCVSSQVGCAVGCQFCMTGRDGLLRQVGSAEIVAQVALARTRRPVRRVVFMGMGEPAHNLENVMEAIELLGTXXXXGHKNIVFSTVGDPRVFERLLQGRVRPALALSLHTTRAGLRETLLPRAPKLSPEALVDAAERYARTTGYPIQYQWTLLEGVNDGDDEIEGIVELLSGKFGVLNMIPFNAVDGVAFRRPALARCEQIARTLHRRGILTKLRHSAAQDVDGGCGQLRARAAEARVTLVRPNGLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 2 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 3 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 11 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 12 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 13 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 14 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 15 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 16 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 17 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 18 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 19 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 20 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 21 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 22 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 23 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 24 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 25 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 26 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 27 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 28 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 29 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 30 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 31 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 32 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 33 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 34 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 35 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 36 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 37 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 38 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 39 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 40 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 41 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 42 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 43 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 44 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 45 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 46 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 47 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 48 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 49 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 50 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 51 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 52 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 53 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 54 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 55 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 56 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 57 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 62 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 63 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 66 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 178 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 179 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 180 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 181 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 182 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 183 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 184 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 214 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 215 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 216 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 217 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 218 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 219 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 220 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 221 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 331 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 345 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 346 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 350 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.14 |
| Metatranscriptomes | 0 |
| Isolates | 6.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0 |
| Endosphere | 20.95 |
| Nodule | 1.12 |
| Rhizoplane | 3.12 |
| Rhizosphere | 66.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10041523 | 3300001979 | Bacteria | 1385 |
| 2 | JGI24739J22299_10009379 | 3300001989 | Bacteria | 3647 |
| 3 | JGI25152J39213_1000584 | 3300002773 | Bacteria | 19736 |
| 4 | JGI25152J39213_1005680 | 3300002773 | Bacteria | 3572 |
| 5 | JGI25150J39212_1000579 | 3300002774 | Bacteria | 14499 |
| 6 | JGI25159J45721_1000503 | 3300002987 | Bacteria | 17837 |
| 7 | JGI25159J45721_1000632 | 3300002987 | Bacteria | 15620 |
| 8 | JGI25159J45721_1013628 | 3300002987 | Bacteria | 1872 |
| 9 | JGI25151J46595_10000562 | 3300003187 | Bacteria | 33649 |
| 10 | JGI25151J46595_10000695 | 3300003187 | Bacteria | 28309 |
| 11 | JGI25151J46595_10000975 | 3300003187 | Bacteria | 21681 |
| 12 | JGI25151J46595_10035289 | 3300003187 | Bacteria | 1901 |
| 13 | JGI25153J46596_10000825 | 3300003215 | Bacteria | 18921 |
| 14 | JGI25153J46596_10013735 | 3300003215 | Bacteria | 3406 |
| 15 | rootL2_10000049 | 3300003322 | Bacteria | 27745 |
| 16 | rootH1_10021656 | 3300003323 | Bacteria | 17109 |
| 17 | JGI25160J50197_1000554 | 3300003354 | Bacteria | 21181 |
| 18 | JGI25160J50197_1003558 | 3300003354 | Bacteria | 6933 |
| 19 | JGI25161J50226_1000522 | 3300003374 | Bacteria | 16619 |
| 20 | JGI25161J50226_1001566 | 3300003374 | Bacteria | 6701 |
| 21 | Ga0055535_1000200 | 3300003761 | Bacteria | 63747 |
| 22 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 23 | Ga0055526_1000577 | 3300003771 | Bacteria | 28807 |
| 24 | Ga0055526_1003696 | 3300003771 | Bacteria | 9568 |
| 25 | Ga0055526_1005184 | 3300003771 | Bacteria | 7574 |
| 26 | Ga0055537_1000013 | 3300003773 | Bacteria | 133522 |
| 27 | Ga0055537_1000411 | 3300003773 | Bacteria | 28094 |
| 28 | Ga0055524_1000084 | 3300003775 | Bacteria | 119107 |
| 29 | Ga0055524_1000477 | 3300003775 | Bacteria | 31879 |
| 30 | Ga0055524_1000537 | 3300003775 | Bacteria | 28807 |
| 31 | Ga0055524_1003784 | 3300003775 | Bacteria | 7197 |
| 32 | Ga0055524_1008681 | 3300003775 | Bacteria | 4202 |
| 33 | Ga0055536_1000480 | 3300003781 | Bacteria | 27754 |
| 34 | Ga0055536_1000561 | 3300003781 | Bacteria | 25370 |
| 35 | Ga0055536_1000693 | 3300003781 | Bacteria | 22609 |
| 36 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 37 | Ga0055534_1000444 | 3300003784 | Bacteria | 24404 |
| 38 | Ga0055534_1002279 | 3300003784 | Bacteria | 6745 |
| 39 | Ga0055528_1000170 | 3300003790 | Bacteria | 54883 |
| 40 | Ga0055528_1000568 | 3300003790 | Bacteria | 28094 |
| 41 | Ga0055528_1023213 | 3300003790 | Bacteria | 1901 |
| 42 | Ga0055530_10000394 | 3300003791 | Bacteria | 39108 |
| 43 | Ga0055530_10002278 | 3300003791 | Bacteria | 12606 |
| 44 | Ga0055530_10002748 | 3300003791 | Bacteria | 10886 |
| 45 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 46 | Ga0055540_1000290 | 3300003792 | Bacteria | 45060 |
| 47 | Ga0055540_1000682 | 3300003792 | Bacteria | 23520 |
| 48 | Ga0055540_1002424 | 3300003792 | Bacteria | 9858 |
| 49 | Ga0055540_1004177 | 3300003792 | Bacteria | 6655 |
| 50 | Ga0055540_1012200 | 3300003792 | Bacteria | 2715 |
| 51 | Ga0055531_10000637 | 3300003794 | Bacteria | 30246 |
| 52 | Ga0055531_10001075 | 3300003794 | Bacteria | 21448 |
| 53 | Ga0055531_10001095 | 3300003794 | Bacteria | 21238 |
| 54 | Ga0055531_10001898 | 3300003794 | Bacteria | 14631 |
| 55 | Ga0055531_10003664 | 3300003794 | Bacteria | 9686 |
| 56 | Ga0055531_10005446 | 3300003794 | Bacteria | 7450 |
| 57 | Ga0055531_10006167 | 3300003794 | Bacteria | 6854 |
| 58 | Ga0055543_1000371 | 3300004625 | Bacteria | 29718 |
| 59 | Ga0055543_1003773 | 3300004625 | Bacteria | 4324 |
| 60 | Ga0065165_1000074 | 3300005262 | Bacteria | 164454 |
| 61 | Ga0065165_1000418 | 3300005262 | Bacteria | 67473 |
| 62 | Ga0065165_1001855 | 3300005262 | Bacteria | 20561 |
| 63 | Ga0065165_1003015 | 3300005262 | Bacteria | 12716 |
| 64 | Ga0065714_10002682 | 3300005288 | Bacteria | 19332 |
| 65 | Ga0070658_10316065 | 3300005327 | Bacteria | 1333 |
| 66 | Ga0070660_100058524 | 3300005339 | Bacteria | 2987 |
| 67 | Ga0070661_100000994 | 3300005344 | Bacteria | 20120 |
| 68 | Ga0070661_100070232 | 3300005344 | Bacteria | 2575 |
| 69 | Ga0070669_100117385 | 3300005353 | Bacteria | 2026 |
| 70 | Ga0070671_100005353 | 3300005355 | Bacteria | 10233 |
| 71 | Ga0070673_100099988 | 3300005364 | Bacteria | 2387 |
| 72 | Ga0070659_100000929 | 3300005366 | Bacteria | 21500 |
| 73 | Ga0070659_100074216 | 3300005366 | Bacteria | 2709 |
| 74 | Ga0070667_100370776 | 3300005367 | Bacteria | 1299 |
| 75 | Ga0068853_100009767 | 3300005539 | Bacteria | 7743 |
| 76 | Ga0070665_100217466 | 3300005548 | Bacteria | 1911 |
| 77 | Ga0068855_100113939 | 3300005563 | Bacteria | 3101 |
| 78 | Ga0068855_100219783 | 3300005563 | Bacteria | 2131 |
| 79 | Ga0070664_100000282 | 3300005564 | Bacteria | 36692 |
| 80 | Ga0070664_100077177 | 3300005564 | Bacteria | 2864 |
| 81 | Ga0068857_100232304 | 3300005577 | Bacteria | 1687 |
| 82 | Ga0068852_100213822 | 3300005616 | Bacteria | 1830 |
| 83 | Ga0068859_100024836 | 3300005617 | Bacteria | 6015 |
| 84 | Ga0068864_100034340 | 3300005618 | Bacteria | 4314 |
| 85 | Ga0068864_100038556 | 3300005618 | Bacteria | 4082 |
| 86 | Ga0068863_100053479 | 3300005841 | Bacteria | 3828 |
| 87 | Ga0068863_100204934 | 3300005841 | Bacteria | 1898 |
| 88 | Ga0075365_10025066 | 3300006038 | Bacteria | 3772 |
| 89 | Ga0075365_10089268 | 3300006038 | Bacteria | 2098 |
| 90 | Ga0075365_10154889 | 3300006038 | Bacteria | 1595 |
| 91 | Ga0075363_100008339 | 3300006048 | Bacteria | 4820 |
| 92 | Ga0075364_10149602 | 3300006051 | Bacteria | 1573 |
| 93 | Ga0075432_10000963 | 3300006058 | Bacteria | 9117 |
| 94 | Ga0075432_10004926 | 3300006058 | Bacteria | 4549 |
| 95 | Ga0070716_100260856 | 3300006173 | Bacteria | 1185 |
| 96 | Ga0075362_10015373 | 3300006177 | Bacteria | 3111 |
| 97 | Ga0075362_10037162 | 3300006177 | Bacteria | 2133 |
| 98 | Ga0075369_10076086 | 3300006186 | Bacteria | 1483 |
| 99 | Ga0075366_10039747 | 3300006195 | Bacteria | 2780 |
| 100 | Ga0075366_10100413 | 3300006195 | Bacteria | 1736 |
| 101 | Ga0075370_10002087 | 3300006353 | Bacteria | 9100 |
| 102 | Ga0075370_10005084 | 3300006353 | Bacteria | 6484 |
| 103 | Ga0075370_10015441 | 3300006353 | Bacteria | 4089 |
| 104 | Ga0075370_10138398 | 3300006353 | Bacteria | 1423 |
| 105 | Ga0075428_100542574 | 3300006844 | Bacteria | 1243 |
| 106 | Ga0097620_100024836 | 3300006931 | Bacteria | 6015 |
| 107 | Ga0099823_1000304 | 3300006944 | Bacteria | 30054 |
| 108 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 109 | Ga0099826_10000134 | 3300006948 | Bacteria | 31806 |
| 110 | Ga0099826_10041979 | 3300006948 | Bacteria | 3167 |
| 111 | Ga0105244_10014998 | 3300009036 | Bacteria | 4457 |
| 112 | Ga0105244_10040819 | 3300009036 | Bacteria | 2407 |
| 113 | Ga0105240_10357178 | 3300009093 | Bacteria | 1656 |
| 114 | Ga0105245_10227229 | 3300009098 | Bacteria | 1803 |
| 115 | Ga0105243_10000690 | 3300009148 | Bacteria | 32829 |
| 116 | Ga0105242_10023043 | 3300009176 | Bacteria | 4907 |
| 117 | Ga0105248_10001132 | 3300009177 | Bacteria | 29671 |
| 118 | Ga0105248_10187500 | 3300009177 | Bacteria | 2331 |
| 119 | Ga0105239_10025933 | 3300010375 | Bacteria | 6454 |
| 120 | Ga0105239_10163357 | 3300010375 | Bacteria | 2489 |
| 121 | Ga0105239_10480611 | 3300010375 | Bacteria | 1411 |
| 122 | Ga0105246_10034891 | 3300011119 | Bacteria | 3357 |
| 123 | Ga0157319_1000013 | 3300012497 | Bacteria | 154883 |
| 124 | Ga0157373_10076696 | 3300013100 | Bacteria | 2359 |
| 125 | Ga0157373_10142036 | 3300013100 | Bacteria | 1688 |
| 126 | Ga0157371_10001256 | 3300013102 | Bacteria | 26771 |
| 127 | Ga0157369_10011573 | 3300013105 | Bacteria | 10015 |
| 128 | Ga0157375_10678468 | 3300013308 | Bacteria | 1185 |
| 129 | Ga0182008_10000191 | 3300014497 | Bacteria | 48580 |
| 130 | Ga0182008_10006627 | 3300014497 | Bacteria | 6451 |
| 131 | Ga0182006_1002609 | 3300015261 | Bacteria | 9740 |
| 132 | Ga0182006_1018608 | 3300015261 | Bacteria | 2932 |
| 133 | Ga0163161_10000521 | 3300017792 | Bacteria | 31378 |
| 134 | Ga0163161_10010407 | 3300017792 | Bacteria | 6440 |
| 135 | Ga0163161_10021987 | 3300017792 | Bacteria | 4486 |
| 136 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 137 | Ga0213872_10000139 | 3300021361 | Bacteria | 65459 |
| 138 | Ga0213872_10005419 | 3300021361 | Bacteria | 6571 |
| 139 | Ga0213872_10022235 | 3300021361 | Bacteria | 2921 |
| 140 | Ga0209436_102113 | 3300025208 | Bacteria | 6225 |
| 141 | Ga0209436_102781 | 3300025208 | Bacteria | 4994 |
| 142 | Ga0209672_102333 | 3300025228 | Bacteria | 4798 |
| 143 | Ga0209147_100572 | 3300025229 | Bacteria | 20618 |
| 144 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 145 | Ga0207425_1000394 | 3300025245 | Bacteria | 29469 |
| 146 | Ga0207425_1001018 | 3300025245 | Bacteria | 13106 |
| 147 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 148 | Ga0209148_1000360 | 3300025254 | Bacteria | 57908 |
| 149 | Ga0209129_1000033 | 3300025258 | Bacteria | 336894 |
| 150 | Ga0209129_1003556 | 3300025258 | Bacteria | 6702 |
| 151 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 152 | Ga0209565_1000164 | 3300025263 | Bacteria | 86911 |
| 153 | Ga0209565_1002085 | 3300025263 | Bacteria | 7640 |
| 154 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 155 | Ga0209673_1000185 | 3300025273 | Bacteria | 125742 |
| 156 | Ga0209673_1000344 | 3300025273 | Bacteria | 85344 |
| 157 | Ga0209673_1001164 | 3300025273 | Bacteria | 28676 |
| 158 | Ga0209673_1005732 | 3300025273 | Bacteria | 6187 |
| 159 | Ga0209673_1020994 | 3300025273 | Bacteria | 2295 |
| 160 | Ga0209130_1000663 | 3300025284 | Bacteria | 31315 |
| 161 | Ga0209130_1001446 | 3300025284 | Bacteria | 15690 |
| 162 | Ga0209130_1003566 | 3300025284 | Bacteria | 6511 |
| 163 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 164 | Ga0209675_1000550 | 3300025291 | Bacteria | 27376 |
| 165 | Ga0209675_1002413 | 3300025291 | Bacteria | 9639 |
| 166 | Ga0209675_1009852 | 3300025291 | Bacteria | 3329 |
| 167 | Ga0209676_1000179 | 3300025292 | Bacteria | 150096 |
| 168 | Ga0209676_1000254 | 3300025292 | Bacteria | 113136 |
| 169 | Ga0209676_1000478 | 3300025292 | Bacteria | 65984 |
| 170 | Ga0209676_1002371 | 3300025292 | Bacteria | 13540 |
| 171 | Ga0209676_1026546 | 3300025292 | Bacteria | 1837 |
| 172 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 173 | Ga0209025_1002083 | 3300025294 | Bacteria | 22615 |
| 174 | Ga0209025_1014574 | 3300025294 | Bacteria | 4818 |
| 175 | Ga0209025_1028185 | 3300025294 | Bacteria | 2761 |
| 176 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 177 | Ga0209564_1000317 | 3300025295 | Bacteria | 93914 |
| 178 | Ga0209564_1000538 | 3300025295 | Bacteria | 61260 |
| 179 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 180 | Ga0209758_1004866 | 3300025297 | Bacteria | 10826 |
| 181 | Ga0209050_1000172 | 3300025298 | Bacteria | 150096 |
| 182 | Ga0209050_1001157 | 3300025298 | Bacteria | 31547 |
| 183 | Ga0209050_1001288 | 3300025298 | Bacteria | 28503 |
| 184 | Ga0209050_1005089 | 3300025298 | Bacteria | 8476 |
| 185 | Ga0209050_1005937 | 3300025298 | Bacteria | 7434 |
| 186 | Ga0209050_1022825 | 3300025298 | Bacteria | 2227 |
| 187 | Ga0209256_1000069 | 3300025299 | Bacteria | 245640 |
| 188 | Ga0209256_1000071 | 3300025299 | Bacteria | 242618 |
| 189 | Ga0209256_1000261 | 3300025299 | Bacteria | 93914 |
| 190 | Ga0209256_1000301 | 3300025299 | Bacteria | 86690 |
| 191 | Ga0209256_1001182 | 3300025299 | Bacteria | 29349 |
| 192 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 193 | Ga0207426_1000115 | 3300025302 | Bacteria | 227423 |
| 194 | Ga0207426_1026659 | 3300025302 | Bacteria | 1932 |
| 195 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 196 | Ga0209051_1000046 | 3300025303 | Bacteria | 296424 |
| 197 | Ga0209051_1000073 | 3300025303 | Bacteria | 208874 |
| 198 | Ga0209051_1000078 | 3300025303 | Bacteria | 201965 |
| 199 | Ga0209051_1000821 | 3300025303 | Bacteria | 32111 |
| 200 | Ga0209051_1000979 | 3300025303 | Bacteria | 27790 |
| 201 | Ga0209051_1001597 | 3300025303 | Bacteria | 18535 |
| 202 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 203 | Ga0209257_1000115 | 3300025304 | Bacteria | 230858 |
| 204 | Ga0209257_1000139 | 3300025304 | Bacteria | 202285 |
| 205 | Ga0209257_1000716 | 3300025304 | Bacteria | 50931 |
| 206 | Ga0209257_1001557 | 3300025304 | Bacteria | 26586 |
| 207 | Ga0209257_1002176 | 3300025304 | Bacteria | 20316 |
| 208 | Ga0209257_1003149 | 3300025304 | Bacteria | 14713 |
| 209 | Ga0209257_1008520 | 3300025304 | Bacteria | 5797 |
| 210 | Ga0209257_1013348 | 3300025304 | Bacteria | 3665 |
| 211 | Ga0207655_1005831 | 3300025728 | Bacteria | 8272 |
| 212 | Ga0207655_1035059 | 3300025728 | Bacteria | 2247 |
| 213 | Ga0207688_10165143 | 3300025901 | Bacteria | 1314 |
| 214 | Ga0207705_10009135 | 3300025909 | Bacteria | 7226 |
| 215 | Ga0207654_10015559 | 3300025911 | Bacteria | 3950 |
| 216 | Ga0207657_10031155 | 3300025919 | Bacteria | 4834 |
| 217 | Ga0207657_10041085 | 3300025919 | Bacteria | 4092 |
| 218 | Ga0207649_10001607 | 3300025920 | Bacteria | 13119 |
| 219 | Ga0207649_10069649 | 3300025920 | Bacteria | 2241 |
| 220 | Ga0207681_10005513 | 3300025923 | Bacteria | 7773 |
| 221 | Ga0207687_10028216 | 3300025927 | Bacteria | 3770 |
| 222 | Ga0207644_10013625 | 3300025931 | Bacteria | 5425 |
| 223 | Ga0207690_10001881 | 3300025932 | Bacteria | 12883 |
| 224 | Ga0207690_10035851 | 3300025932 | Bacteria | 3208 |
| 225 | Ga0207706_10055603 | 3300025933 | Bacteria | 3489 |
| 226 | Ga0207709_10000233 | 3300025935 | Bacteria | 70451 |
| 227 | Ga0207709_10264030 | 3300025935 | Bacteria | 1264 |
| 228 | Ga0207665_10215833 | 3300025939 | Bacteria | 1404 |
| 229 | Ga0207711_10002686 | 3300025941 | Bacteria | 15735 |
| 230 | Ga0207679_10000225 | 3300025945 | Bacteria | 44668 |
| 231 | Ga0207667_10026802 | 3300025949 | Bacteria | 6289 |
| 232 | Ga0207667_10131082 | 3300025949 | Bacteria | 2582 |
| 233 | Ga0207667_10180512 | 3300025949 | Bacteria | 2168 |
| 234 | Ga0207658_10015667 | 3300025986 | Bacteria | 5204 |
| 235 | Ga0207639_10087869 | 3300026041 | Bacteria | 2479 |
| 236 | Ga0207678_10206954 | 3300026067 | Bacteria | 1678 |
| 237 | Ga0207641_10067281 | 3300026088 | Bacteria | 3068 |
| 238 | Ga0207676_10019158 | 3300026095 | Bacteria | 4987 |
| 239 | Ga0207676_10070103 | 3300026095 | Bacteria | 2810 |
| 240 | Ga0207674_10266131 | 3300026116 | Bacteria | 1662 |
| 241 | Ga0207683_10099474 | 3300026121 | Bacteria | 2595 |
| 242 | Ga0209281_1000182 | 3300027111 | Bacteria | 145698 |
| 243 | Ga0209389_1033704 | 3300027296 | Bacteria | 4214 |
| 244 | Ga0209970_1004268 | 3300027614 | Bacteria | 2378 |
| 245 | Ga0209282_1000514 | 3300027666 | Bacteria | 18748 |
| 246 | Ga0268266_10149694 | 3300028379 | Bacteria | 2102 |
| 247 | Ga0307515_10013045 | 3300028794 | Bacteria | 15569 |
| 248 | Ga0307512_10020082 | 3300030522 | Bacteria | 6061 |
| 249 | Ga0316176_1086224 | 3300030732 | Bacteria | 1231 |
| 250 | Ga0314311_1034637 | 3300030733 | Bacteria | 15856 |
| 251 | Ga0316179_1018535 | 3300030734 | Bacteria | 1428 |
| 252 | Ga0316178_1014198 | 3300030735 | Bacteria | 4251 |
| 253 | Ga0316180_1096139 | 3300030736 | Bacteria | 3016 |
| 254 | Ga0316183_1198096 | 3300030742 | Bacteria | 4176 |
| 255 | Ga0316182_1158317 | 3300030745 | Bacteria | 3990 |
| 256 | Ga0316182_1216334 | 3300030745 | Bacteria | 2454 |
| 257 | Ga0265332_10000025 | 3300031238 | Bacteria | 197048 |
| 258 | Ga0265331_10003230 | 3300031250 | Bacteria | 10620 |
| 259 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 260 | Ga0265316_10020249 | 3300031344 | Bacteria | 5668 |
| 261 | Ga0307509_10000110 | 3300031507 | Bacteria | 117351 |
| 262 | Ga0307509_10054343 | 3300031507 | Bacteria | 4265 |
| 263 | Ga0307509_10056305 | 3300031507 | Bacteria | 4174 |
| 264 | Ga0307408_100125785 | 3300031548 | Bacteria | 1993 |
| 265 | Ga0307508_10004265 | 3300031616 | Bacteria | 14031 |
| 266 | Ga0307514_10047549 | 3300031649 | Bacteria | 3349 |
| 267 | Ga0307405_10019685 | 3300031731 | Bacteria | 3755 |
| 268 | Ga0307405_10109230 | 3300031731 | Bacteria | 1870 |
| 269 | Ga0307406_10001056 | 3300031901 | Bacteria | 15359 |
| 270 | Ga0307407_10134583 | 3300031903 | Bacteria | 1586 |
| 271 | Ga0307412_10108834 | 3300031911 | Bacteria | 1975 |
| 272 | Ga0307416_100009235 | 3300032002 | Bacteria | 6438 |
| 273 | Ga0307411_10256928 | 3300032005 | Bacteria | 1377 |
| 274 | Ga0307507_10178460 | 3300033179 | Bacteria | 1524 |
| 275 | Ga0307510_10031902 | 3300033180 | Bacteria | 5943 |
| 276 | Ga0395899_0001479 | 3300037312 | Bacteria | 19996 |
| 277 | Ga0395899_0013799 | 3300037312 | Bacteria | 6175 |
| 278 | Ga0395899_0019352 | 3300037312 | Bacteria | 5173 |
| 279 | Ga0395899_0020700 | 3300037312 | Bacteria | 4987 |
| 280 | Ga0395899_0033517 | 3300037312 | Bacteria | 3857 |
| 281 | Ga0395899_0070118 | 3300037312 | Bacteria | 2565 |
| 282 | Ga0395899_0079793 | 3300037312 | Bacteria | 2383 |
| 283 | Ga0395899_0169829 | 3300037312 | Bacteria | 1536 |
| 284 | Ga0395899_0189581 | 3300037312 | Bacteria | 1439 |
| 285 | Ga0395899_0246202 | 3300037312 | Bacteria | 1228 |
| 286 | Ga0395900_0004592 | 3300037418 | Bacteria | 14575 |
| 287 | Ga0395900_0020710 | 3300037418 | Bacteria | 6720 |
| 288 | Ga0395900_0021662 | 3300037418 | Bacteria | 6571 |
| 289 | Ga0395900_0029346 | 3300037418 | Bacteria | 5643 |
| 290 | Ga0395900_0055423 | 3300037418 | Bacteria | 4082 |
| 291 | Ga0395900_0099781 | 3300037418 | Bacteria | 2982 |
| 292 | Ga0395900_0210844 | 3300037418 | Bacteria | 1961 |
| 293 | Ga0395900_0535016 | 3300037418 | Bacteria | 1118 |
| 294 | Ga0395898_0014930 | 3300037466 | Bacteria | 7975 |
| 295 | Ga0395898_0047293 | 3300037466 | Bacteria | 4223 |
| 296 | Ga0395898_0109699 | 3300037466 | Bacteria | 2645 |
| 297 | Ga0395898_0188023 | 3300037466 | Bacteria | 1973 |
| 298 | Ga0395905_0000353 | 3300037471 | Bacteria | 65228 |
| 299 | Ga0395905_0000898 | 3300037471 | Bacteria | 38801 |
| 300 | Ga0395905_0017731 | 3300037471 | Bacteria | 6760 |
| 301 | Ga0395905_0019403 | 3300037471 | Bacteria | 6446 |
| 302 | Ga0395905_0029976 | 3300037471 | Bacteria | 5128 |
| 303 | Ga0395905_0041547 | 3300037471 | Bacteria | 4315 |
| 304 | Ga0395905_0057531 | 3300037471 | Bacteria | 3637 |
| 305 | Ga0395905_0071574 | 3300037471 | Bacteria | 3250 |
| 306 | Ga0395905_0090444 | 3300037471 | Bacteria | 2869 |
| 307 | Ga0395905_0162956 | 3300037471 | Bacteria | 2095 |
| 308 | Ga0395905_0266514 | 3300037471 | Bacteria | 1598 |
| 309 | Ga0395901_0000054 | 3300038443 | Bacteria | 160505 |
| 310 | Ga0395901_0016310 | 3300038443 | Bacteria | 7566 |
| 311 | Ga0395901_0037712 | 3300038443 | Bacteria | 4998 |
| 312 | Ga0395901_0089438 | 3300038443 | Bacteria | 3222 |
| 313 | Ga0395901_0107922 | 3300038443 | Bacteria | 2922 |
| 314 | Ga0395901_0175450 | 3300038443 | Bacteria | 2248 |
| 315 | Ga0395901_0594342 | 3300038443 | Bacteria | 1116 |
| 316 | Ga0436361_0314510 | 3300039447 | Bacteria | 1861 |
| 317 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 318 | Ga0436361_0734234 | 3300039447 | Bacteria | 30887 |
| 319 | Ga0436361_1141444 | 3300039447 | Bacteria | 7187 |
| 320 | Ga0439466_0013359 | 3300041411 | Bacteria | 3007 |
| 321 | Ga0439431_0005850 | 3300041997 | Bacteria | 2716 |
| 322 | Ga0439442_001739 | 3300042002 | Bacteria | 4266 |
| 323 | Ga0439442_006899 | 3300042002 | Bacteria | 2281 |
| 324 | Ga0439445_0010307 | 3300042004 | Bacteria | 2210 |
| 325 | Ga0439432_020657 | 3300042006 | Bacteria | 2186 |
| 326 | Ga0439449_0004733 | 3300042007 | Bacteria | 5253 |
| 327 | Ga0439449_0005663 | 3300042007 | Bacteria | 4778 |
| 328 | Ga0439455_0006966 | 3300042012 | Bacteria | 2372 |
| 329 | Ga0439455_0021735 | 3300042012 | Bacteria | 1532 |
| 330 | Ga0439457_004992 | 3300042014 | Bacteria | 3395 |
| 331 | Ga0450923_006691 | 3300042125 | Bacteria | 1921 |
| 332 | Ga0450898_016813 | 3300042134 | Bacteria | 1253 |
| 333 | Ga0450906_006013 | 3300042145 | Bacteria | 2469 |
| 334 | Ga0439446_0049382 | 3300042156 | Bacteria | 1254 |
| 335 | Ga0450908_004485 | 3300042184 | Bacteria | 2686 |
| 336 | Ga0439434_0067509 | 3300042435 | Bacteria | 1123 |
| 337 | Ga0450918_000224 | 3300042531 | Bacteria | 13018 |
| 338 | Ga0466969_0000031 | 3300044656 | Bacteria | 86708 |
| 339 | Ga0466969_0004479 | 3300044656 | Bacteria | 7438 |
| 340 | Ga0466969_0027742 | 3300044656 | Bacteria | 2898 |
| 341 | Ga0453683_0000669 | 3300044673 | Bacteria | 36646 |
| 342 | Ga0466965_0018148 | 3300044683 | Bacteria | 3369 |
| 343 | Ga0466965_0028945 | 3300044683 | Bacteria | 2694 |
| 344 | Ga0466965_0029831 | 3300044683 | Bacteria | 2655 |
| 345 | Ga0466966_0004253 | 3300044684 | Bacteria | 9444 |
| 346 | Ga0466966_0014615 | 3300044684 | Bacteria | 5196 |
| 347 | Ga0466966_0014676 | 3300044684 | Bacteria | 5185 |
| 348 | Ga0466966_0027339 | 3300044684 | Bacteria | 3720 |
| 349 | Ga0466966_0124428 | 3300044684 | Bacteria | 1582 |
| 350 | Ga0466961_0003957 | 3300044693 | Bacteria | 9269 |
| 351 | Ga0466961_0060921 | 3300044693 | Bacteria | 2399 |
| 352 | Ga0466961_0095756 | 3300044693 | Bacteria | 1872 |
| 353 | Ga0466963_0122718 | 3300044694 | Bacteria | 1789 |
| 354 | Ga0466964_0002682 | 3300044706 | Bacteria | 6375 |
| 355 | Ga0466964_0098193 | 3300044706 | Bacteria | 1286 |
| 356 | Ga0466968_0006640 | 3300044735 | Bacteria | 4368 |
| 357 | Ga0466970_0013325 | 3300044765 | Bacteria | 4215 |
| 358 | Ga0466970_0031498 | 3300044765 | Bacteria | 2801 |
| 359 | Ga0466970_0051171 | 3300044765 | Bacteria | 2204 |
| 360 | Ga0466957_0000064 | 3300044842 | Bacteria | 40442 |
| 361 | Ga0466957_0003927 | 3300044842 | Bacteria | 8220 |
| 362 | Ga0466957_0065756 | 3300044842 | Bacteria | 2234 |
| 363 | Ga0466960_0074756 | 3300044901 | Bacteria | 1694 |
| 364 | Ga0466960_0101778 | 3300044901 | Bacteria | 1480 |
| 365 | Ga0466959_0005277 | 3300045049 | Bacteria | 8827 |
| 366 | Ga0466959_0014081 | 3300045049 | Bacteria | 5806 |
| 367 | Ga0466959_0015320 | 3300045049 | Bacteria | 5583 |
| 368 | Ga0466959_0022312 | 3300045049 | Bacteria | 4679 |
| 369 | Ga0466959_0029051 | 3300045049 | Bacteria | 4095 |
| 370 | Ga0466959_0032400 | 3300045049 | Bacteria | 3869 |
| 371 | Ga0451576_0000168 | 3300045051 | Bacteria | 165624 |
| 372 | Ga0451576_0004343 | 3300045051 | Bacteria | 18500 |
| 373 | Ga0451576_0394068 | 3300045051 | Bacteria | 1452 |
| 374 | Ga0451576_0686019 | 3300045051 | Bacteria | 1076 |
| 375 | Ga0466958_0045245 | 3300045836 | Bacteria | 2654 |
| 376 | Ga0466967_0187315 | 3300045976 | Bacteria | 1954 |
| 377 | Ga0466967_0217474 | 3300045976 | Bacteria | 1814 |
| 378 | Ga0495617_000057 | 3300046452 | Bacteria | 100673 |
| 379 | Ga0495617_001077 | 3300046452 | Bacteria | 12438 |
| 380 | Ga0495627_000841 | 3300046453 | Bacteria | 22056 |
| 381 | Ga0495627_010702 | 3300046453 | Bacteria | 3322 |
| 382 | Ga0495590_0003167 | 3300046457 | Bacteria | 6727 |
| 383 | Ga0495638_0002966 | 3300046460 | Bacteria | 13544 |
| 384 | Ga0495638_0034660 | 3300046460 | Bacteria | 3223 |
| 385 | Ga0495638_0067281 | 3300046460 | Bacteria | 2200 |
| 386 | Ga0495638_0074153 | 3300046460 | Bacteria | 2076 |
| 387 | Ga0495650_0000140 | 3300046471 | Bacteria | 169317 |
| 388 | Ga0495650_0006922 | 3300046471 | Bacteria | 6942 |
| 389 | Ga0495650_0039164 | 3300046471 | Bacteria | 2047 |
| 390 | Ga0495580_0009953 | 3300046472 | Bacteria | 7439 |
| 391 | Ga0495582_0014476 | 3300046473 | Bacteria | 4334 |
| 392 | Ga0495605_0000465 | 3300046474 | Bacteria | 36212 |
| 393 | Ga0495605_0001736 | 3300046474 | Bacteria | 13967 |
| 394 | Ga0495605_0005479 | 3300046474 | Bacteria | 7393 |
| 395 | Ga0495605_0014595 | 3300046474 | Bacteria | 4296 |
| 396 | Ga0495605_0015651 | 3300046474 | Bacteria | 4121 |
| 397 | Ga0495605_0017006 | 3300046474 | Bacteria | 3928 |
| 398 | Ga0495605_0029038 | 3300046474 | Bacteria | 2850 |
| 399 | Ga0495605_0062292 | 3300046474 | Bacteria | 1782 |
| 400 | Ga0495605_0076511 | 3300046474 | Bacteria | 1571 |
| 401 | Ga0495639_0006419 | 3300046475 | Bacteria | 5059 |
| 402 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 403 | Ga0495584_0007725 | 3300046491 | Bacteria | 5598 |
| 404 | Ga0495584_0008112 | 3300046491 | Bacteria | 5457 |
| 405 | Ga0495584_0012387 | 3300046491 | Bacteria | 4352 |
| 406 | Ga0495584_0014210 | 3300046491 | Bacteria | 4058 |
| 407 | Ga0495584_0016047 | 3300046491 | Bacteria | 3822 |
| 408 | Ga0495584_0029557 | 3300046491 | Bacteria | 2778 |
| 409 | Ga0495584_0061528 | 3300046491 | Bacteria | 1887 |
| 410 | Ga0495584_0090365 | 3300046491 | Bacteria | 1544 |
| 411 | Ga0495585_0000193 | 3300046492 | Bacteria | 63937 |
| 412 | Ga0495585_0000282 | 3300046492 | Bacteria | 50936 |
| 413 | Ga0495585_0000926 | 3300046492 | Bacteria | 24849 |
| 414 | Ga0495585_0002351 | 3300046492 | Bacteria | 13579 |
| 415 | Ga0495585_0004871 | 3300046492 | Bacteria | 8606 |
| 416 | Ga0495585_0006493 | 3300046492 | Bacteria | 7247 |
| 417 | Ga0495585_0011039 | 3300046492 | Bacteria | 5363 |
| 418 | Ga0495585_0019813 | 3300046492 | Bacteria | 3874 |
| 419 | Ga0495585_0020463 | 3300046492 | Bacteria | 3806 |
| 420 | Ga0495585_0021634 | 3300046492 | Bacteria | 3692 |
| 421 | Ga0495585_0024833 | 3300046492 | Bacteria | 3435 |
| 422 | Ga0495585_0029200 | 3300046492 | Bacteria | 3140 |
| 423 | Ga0495585_0058942 | 3300046492 | Bacteria | 2117 |
| 424 | Ga0495594_0013415 | 3300046499 | Bacteria | 4279 |
| 425 | Ga0495596_0001122 | 3300046500 | Bacteria | 15822 |
| 426 | Ga0495596_0003235 | 3300046500 | Bacteria | 8338 |
| 427 | Ga0495596_0003685 | 3300046500 | Bacteria | 7661 |
| 428 | Ga0495596_0007860 | 3300046500 | Bacteria | 4779 |
| 429 | Ga0495596_0010438 | 3300046500 | Bacteria | 4045 |
| 430 | Ga0495596_0011291 | 3300046500 | Bacteria | 3857 |
| 431 | Ga0495596_0012493 | 3300046500 | Bacteria | 3635 |
| 432 | Ga0495596_0027903 | 3300046500 | Bacteria | 2267 |
| 433 | Ga0495596_0029821 | 3300046500 | Bacteria | 2185 |
| 434 | Ga0495607_0012631 | 3300046501 | Bacteria | 5565 |
| 435 | Ga0495607_0017265 | 3300046501 | Bacteria | 4636 |
| 436 | Ga0495607_0021954 | 3300046501 | Bacteria | 4014 |
| 437 | Ga0495607_0032355 | 3300046501 | Bacteria | 3192 |
| 438 | Ga0495607_0034379 | 3300046501 | Bacteria | 3075 |
| 439 | Ga0495607_0178963 | 3300046501 | Bacteria | 1064 |
| 440 | Ga0495583_0000525 | 3300046506 | Bacteria | 54370 |
| 441 | Ga0495583_0000608 | 3300046506 | Bacteria | 48449 |
| 442 | Ga0495583_0004346 | 3300046506 | Bacteria | 10215 |
| 443 | Ga0495583_0005683 | 3300046506 | Bacteria | 8384 |
| 444 | Ga0495583_0016629 | 3300046506 | Bacteria | 3945 |
| 445 | Ga0495583_0036930 | 3300046506 | Bacteria | 2320 |
| 446 | Ga0495606_0008641 | 3300046507 | Bacteria | 8796 |
| 447 | Ga0495606_0022396 | 3300046507 | Bacteria | 4604 |
| 448 | Ga0495606_0027256 | 3300046507 | Bacteria | 4056 |
| 449 | Ga0495606_0052561 | 3300046507 | Bacteria | 2648 |
| 450 | Ga0495616_0000343 | 3300046513 | Bacteria | 36983 |
| 451 | Ga0495616_0002034 | 3300046513 | Bacteria | 13597 |
| 452 | Ga0495616_0003579 | 3300046513 | Bacteria | 9932 |
| 453 | Ga0495616_0017562 | 3300046513 | Bacteria | 3945 |
| 454 | Ga0495616_0018017 | 3300046513 | Bacteria | 3888 |
| 455 | Ga0495616_0036740 | 3300046513 | Bacteria | 2526 |
| 456 | Ga0495616_0056871 | 3300046513 | Bacteria | 1930 |
| 457 | Ga0495616_0086084 | 3300046513 | Bacteria | 1495 |
| 458 | Ga0495620_0030896 | 3300046515 | Bacteria | 2460 |
| 459 | Ga0495630_0142285 | 3300046517 | Bacteria | 1824 |
| 460 | Ga0495631_0000119 | 3300046518 | Bacteria | 52691 |
| 461 | Ga0495631_0003698 | 3300046518 | Bacteria | 8343 |
| 462 | Ga0495631_0004600 | 3300046518 | Bacteria | 7307 |
| 463 | Ga0495631_0004822 | 3300046518 | Bacteria | 7108 |
| 464 | Ga0495631_0010952 | 3300046518 | Bacteria | 4476 |
| 465 | Ga0495631_0012016 | 3300046518 | Bacteria | 4243 |
| 466 | Ga0495631_0025814 | 3300046518 | Bacteria | 2702 |
| 467 | Ga0495631_0027836 | 3300046518 | Bacteria | 2582 |
| 468 | Ga0495631_0030483 | 3300046518 | Bacteria | 2446 |
| 469 | Ga0495632_0000062 | 3300046519 | Bacteria | 118205 |
| 470 | Ga0495632_0000235 | 3300046519 | Bacteria | 55317 |
| 471 | Ga0495632_0003209 | 3300046519 | Bacteria | 11766 |
| 472 | Ga0495632_0025453 | 3300046519 | Bacteria | 3129 |
| 473 | Ga0495643_0000648 | 3300046522 | Bacteria | 41187 |
| 474 | Ga0495643_0011322 | 3300046522 | Bacteria | 5437 |
| 475 | Ga0495643_0019644 | 3300046522 | Bacteria | 3905 |
| 476 | Ga0495643_0021646 | 3300046522 | Bacteria | 3684 |
| 477 | Ga0495643_0027441 | 3300046522 | Bacteria | 3199 |
| 478 | Ga0495644_0001274 | 3300046523 | Bacteria | 10320 |
| 479 | Ga0495644_0010772 | 3300046523 | Bacteria | 3523 |
| 480 | Ga0495644_0020982 | 3300046523 | Bacteria | 2492 |
| 481 | Ga0495644_0078111 | 3300046523 | Bacteria | 1247 |
| 482 | Ga0495648_0000109 | 3300046524 | Bacteria | 101519 |
| 483 | Ga0495648_0002349 | 3300046524 | Bacteria | 17563 |
| 484 | Ga0495648_0015644 | 3300046524 | Bacteria | 5497 |
| 485 | Ga0495648_0018169 | 3300046524 | Bacteria | 4995 |
| 486 | Ga0495648_0018893 | 3300046524 | Bacteria | 4863 |
| 487 | Ga0495663_0001540 | 3300046525 | Bacteria | 7228 |
| 488 | Ga0495663_0002877 | 3300046525 | Bacteria | 5090 |
| 489 | Ga0495663_0036426 | 3300046525 | Bacteria | 1481 |
| 490 | Ga0495666_0002144 | 3300046526 | Bacteria | 9800 |
| 491 | Ga0495666_0004957 | 3300046526 | Bacteria | 6741 |
| 492 | Ga0495666_0032517 | 3300046526 | Bacteria | 2552 |
| 493 | Ga0495666_0066774 | 3300046526 | Bacteria | 1714 |
| 494 | Ga0495666_0074991 | 3300046526 | Bacteria | 1604 |
| 495 | Ga0495642_0000196 | 3300046528 | Bacteria | 35510 |
| 496 | Ga0495642_0002554 | 3300046528 | Bacteria | 7359 |
| 497 | Ga0495642_0006606 | 3300046528 | Bacteria | 4452 |
| 498 | Ga0495642_0052497 | 3300046528 | Bacteria | 1679 |
| 499 | Ga0495642_0058291 | 3300046528 | Bacteria | 1598 |
| 500 | Ga0495642_0109773 | 3300046528 | Bacteria | 1179 |
| 501 | Ga0495652_0029162 | 3300046529 | Bacteria | 4848 |
| 502 | Ga0495654_0024043 | 3300046530 | Bacteria | 3150 |
| 503 | Ga0495654_0095866 | 3300046530 | Bacteria | 1371 |
| 504 | Ga0495665_0015420 | 3300046531 | Bacteria | 4114 |
| 505 | Ga0495665_0051900 | 3300046531 | Bacteria | 2171 |
| 506 | Ga0495586_0019226 | 3300046535 | Bacteria | 3633 |
| 507 | Ga0495586_0076307 | 3300046535 | Bacteria | 1836 |
| 508 | Ga0495587_0124757 | 3300046536 | Bacteria | 1473 |
| 509 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 510 | Ga0495609_0004785 | 3300046538 | Bacteria | 7309 |
| 511 | Ga0495609_0010220 | 3300046538 | Bacteria | 4510 |
| 512 | Ga0495609_0011383 | 3300046538 | Bacteria | 4239 |
| 513 | Ga0495609_0033096 | 3300046538 | Bacteria | 2347 |
| 514 | Ga0495609_0033275 | 3300046538 | Bacteria | 2340 |
| 515 | Ga0495609_0038987 | 3300046538 | Bacteria | 2140 |
| 516 | Ga0495597_0003348 | 3300046542 | Bacteria | 9436 |
| 517 | Ga0495597_0005411 | 3300046542 | Bacteria | 6761 |
| 518 | Ga0495597_0007036 | 3300046542 | Bacteria | 5764 |
| 519 | Ga0495597_0008429 | 3300046542 | Bacteria | 5168 |
| 520 | Ga0495597_0008932 | 3300046542 | Bacteria | 4997 |
| 521 | Ga0495597_0015920 | 3300046542 | Bacteria | 3556 |
| 522 | Ga0495597_0017557 | 3300046542 | Bacteria | 3365 |
| 523 | Ga0495622_0011636 | 3300046557 | Bacteria | 4066 |
| 524 | Ga0495622_0063771 | 3300046557 | Bacteria | 1704 |
| 525 | Ga0495633_0011966 | 3300046558 | Bacteria | 4638 |
| 526 | Ga0495633_0017863 | 3300046558 | Bacteria | 3613 |
| 527 | Ga0495633_0020810 | 3300046558 | Bacteria | 3293 |
| 528 | Ga0495633_0070199 | 3300046558 | Bacteria | 1635 |
| 529 | Ga0495633_0076102 | 3300046558 | Bacteria | 1563 |
| 530 | Ga0495656_0000766 | 3300046615 | Bacteria | 10354 |
| 531 | Ga0495656_0001204 | 3300046615 | Bacteria | 8426 |
| 532 | Ga0495656_0030305 | 3300046615 | Bacteria | 2185 |
| 533 | Ga0495668_0000805 | 3300046616 | Bacteria | 36034 |
| 534 | Ga0495668_0002669 | 3300046616 | Bacteria | 14315 |
| 535 | Ga0495668_0007275 | 3300046616 | Bacteria | 7100 |
| 536 | Ga0495668_0009502 | 3300046616 | Bacteria | 5967 |
| 537 | Ga0495668_0011356 | 3300046616 | Bacteria | 5338 |
| 538 | Ga0495668_0015154 | 3300046616 | Bacteria | 4507 |
| 539 | Ga0495668_0020397 | 3300046616 | Bacteria | 3813 |
| 540 | Ga0495668_0113702 | 3300046616 | Bacteria | 1480 |
| 541 | Ga0495634_0016338 | 3300046642 | Bacteria | 5308 |
| 542 | Ga0495634_0062064 | 3300046642 | Bacteria | 2483 |
| 543 | Ga0495611_0000861 | 3300046648 | Bacteria | 16634 |
| 544 | Ga0495611_0005058 | 3300046648 | Bacteria | 5653 |
| 545 | Ga0495611_0010726 | 3300046648 | Bacteria | 3880 |
| 546 | Ga0495611_0018839 | 3300046648 | Bacteria | 2961 |
| 547 | Ga0495611_0041367 | 3300046648 | Bacteria | 2055 |
| 548 | Ga0495611_0055812 | 3300046648 | Bacteria | 1787 |
| 549 | Ga0495611_0095000 | 3300046648 | Bacteria | 1379 |
| 550 | Ga0495625_0000262 | 3300046660 | Bacteria | 81925 |
| 551 | Ga0495625_0024004 | 3300046660 | Bacteria | 4649 |
| 552 | Ga0495625_0067375 | 3300046660 | Bacteria | 2519 |
| 553 | Ga0495625_0105592 | 3300046660 | Bacteria | 1929 |
| 554 | Ga0495661_0000775 | 3300046665 | Bacteria | 30575 |
| 555 | Ga0495661_0001167 | 3300046665 | Bacteria | 22911 |
| 556 | Ga0495661_0002320 | 3300046665 | Bacteria | 14679 |
| 557 | Ga0495661_0004592 | 3300046665 | Bacteria | 9939 |
| 558 | Ga0495661_0009476 | 3300046665 | Bacteria | 6683 |
| 559 | Ga0495661_0009659 | 3300046665 | Bacteria | 6609 |
| 560 | Ga0495661_0015253 | 3300046665 | Bacteria | 5129 |
| 561 | Ga0495661_0019139 | 3300046665 | Bacteria | 4492 |
| 562 | Ga0495661_0067026 | 3300046665 | Bacteria | 2110 |
| 563 | Ga0495661_0069328 | 3300046665 | Bacteria | 2066 |
| 564 | Ga0495661_0074083 | 3300046665 | Bacteria | 1982 |
| 565 | Ga0495661_0112997 | 3300046665 | Bacteria | 1511 |
| 566 | Ga0495661_0119254 | 3300046665 | Bacteria | 1459 |
| 567 | Ga0495588_0000077 | 3300046674 | Bacteria | 215338 |
| 568 | Ga0495588_0046208 | 3300046674 | Bacteria | 2233 |
| 569 | Ga0495588_0092289 | 3300046674 | Bacteria | 1586 |
| 570 | Ga0495669_0000217 | 3300046684 | Bacteria | 34603 |
| 571 | Ga0495669_0011043 | 3300046684 | Bacteria | 3825 |
| 572 | Ga0495669_0035981 | 3300046684 | Bacteria | 2187 |
| 573 | Ga0495669_0047393 | 3300046684 | Bacteria | 1919 |
| 574 | Ga0495613_0047420 | 3300046689 | Bacteria | 3174 |
| 575 | Ga0495624_0006044 | 3300046690 | Bacteria | 8634 |
| 576 | Ga0495670_0000391 | 3300046691 | Bacteria | 20872 |
| 577 | Ga0495670_0006577 | 3300046691 | Bacteria | 5714 |
| 578 | Ga0495670_0007426 | 3300046691 | Bacteria | 5380 |
| 579 | Ga0495670_0019960 | 3300046691 | Bacteria | 3302 |
| 580 | Ga0495670_0070970 | 3300046691 | Bacteria | 1763 |
| 581 | Ga0495670_0082168 | 3300046691 | Bacteria | 1642 |
| 582 | Ga0495670_0102092 | 3300046691 | Bacteria | 1477 |
| 583 | Ga0495671_0003370 | 3300046692 | Bacteria | 9842 |
| 584 | Ga0495671_0003518 | 3300046692 | Bacteria | 9589 |
| 585 | Ga0495671_0007487 | 3300046692 | Bacteria | 6216 |
| 586 | Ga0495671_0017183 | 3300046692 | Bacteria | 3851 |
| 587 | Ga0495671_0042124 | 3300046692 | Bacteria | 2296 |
| 588 | Ga0495649_0004293 | 3300046694 | Bacteria | 9357 |
| 589 | Ga0495649_0046746 | 3300046694 | Bacteria | 2356 |
| 590 | Ga0495589_0000037 | 3300046794 | Bacteria | 150603 |
| 591 | Ga0495589_0001177 | 3300046794 | Bacteria | 15597 |
| 592 | Ga0495589_0001412 | 3300046794 | Bacteria | 13925 |
| 593 | Ga0495589_0063178 | 3300046794 | Bacteria | 1816 |
| 594 | Ga0495600_0027955 | 3300046809 | Bacteria | 3647 |
| 595 | Ga0495660_0000178 | 3300046810 | Bacteria | 68956 |
| 596 | Ga0495660_0009961 | 3300046810 | Bacteria | 5531 |
| 597 | Ga0495660_0015655 | 3300046810 | Bacteria | 4379 |
| 598 | Ga0495660_0017308 | 3300046810 | Bacteria | 4150 |
| 599 | Ga0495660_0019036 | 3300046810 | Bacteria | 3942 |
| 600 | Ga0495660_0023786 | 3300046810 | Bacteria | 3493 |
| 601 | Ga0495660_0087773 | 3300046810 | Bacteria | 1621 |
| 602 | Ga0495581_0017959 | 3300047315 | Bacteria | 4110 |
| 603 | Ga0495604_0007219 | 3300047317 | Bacteria | 8802 |
| 604 | Ga0495604_0012788 | 3300047317 | Bacteria | 6683 |
| 605 | Ga0495636_0002507 | 3300047318 | Bacteria | 7045 |
| 606 | Ga0495674_0003699 | 3300047319 | Bacteria | 14870 |
| 607 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 608 | Ga0495672_0002152 | 3300047320 | Bacteria | 18417 |
| 609 | Ga0495672_0017552 | 3300047320 | Bacteria | 4784 |
| 610 | Ga0495676_0000342 | 3300047321 | Bacteria | 38031 |
| 611 | Ga0495676_0048580 | 3300047321 | Bacteria | 3420 |
| 612 | Ga0495683_0000144 | 3300047323 | Bacteria | 69959 |
| 613 | Ga0495683_0011537 | 3300047323 | Bacteria | 4647 |
| 614 | Ga0495683_0016553 | 3300047323 | Bacteria | 3828 |
| 615 | Ga0495683_0028210 | 3300047323 | Bacteria | 2870 |
| 616 | Ga0495683_0071135 | 3300047323 | Bacteria | 1707 |
| 617 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 618 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 619 | Ga0495687_001539 | 3300047443 | Bacteria | 20979 |
| 620 | Ga0495687_005014 | 3300047443 | Bacteria | 8641 |
| 621 | Ga0495687_010447 | 3300047443 | Bacteria | 5092 |
| 622 | Ga0495675_0011947 | 3300047444 | Bacteria | 5457 |
| 623 | Ga0495675_0044687 | 3300047444 | Bacteria | 2822 |
| 624 | Ga0495677_0000011 | 3300047445 | Bacteria | 149837 |
| 625 | Ga0495677_0001586 | 3300047445 | Bacteria | 9165 |
| 626 | Ga0495677_0002960 | 3300047445 | Bacteria | 6606 |
| 627 | Ga0495677_0005197 | 3300047445 | Bacteria | 4952 |
| 628 | Ga0495677_0008497 | 3300047445 | Bacteria | 3813 |
| 629 | Ga0495677_0017429 | 3300047445 | Bacteria | 2604 |
| 630 | Ga0495677_0032515 | 3300047445 | Bacteria | 1900 |
| 631 | Ga0495677_0034663 | 3300047445 | Bacteria | 1841 |
| 632 | Ga0495679_012327 | 3300047446 | Bacteria | 3259 |
| 633 | Ga0495679_022161 | 3300047446 | Bacteria | 2179 |
| 634 | Ga0495685_027644 | 3300047447 | Bacteria | 1951 |
| 635 | Ga0495685_046341 | 3300047447 | Bacteria | 1479 |
| 636 | Ga0495681_0004144 | 3300047470 | Bacteria | 9951 |
| 637 | Ga0495681_0013252 | 3300047470 | Bacteria | 4796 |
| 638 | Ga0495681_0024658 | 3300047470 | Bacteria | 3161 |
| 639 | Ga0495681_0027197 | 3300047470 | Bacteria | 2963 |
| 640 | Ga0495681_0033046 | 3300047470 | Bacteria | 2596 |
| 641 | Ga0495686_0003442 | 3300047472 | Bacteria | 13716 |
| 642 | Ga0495593_0020397 | 3300047673 | Bacteria | 3712 |
| 643 | Ga0495602_0108137 | 3300048088 | Bacteria | 2264 |
| 644 | Ga0495614_0003763 | 3300048089 | Bacteria | 6814 |
| 645 | Ga0495615_0000720 | 3300048090 | Bacteria | 4632 |
| 646 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 647 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 648 | Ga0495626_0002550 | 3300048091 | Bacteria | 12494 |
| 649 | Ga0495626_0008080 | 3300048091 | Bacteria | 5805 |
| 650 | Ga0495626_0011585 | 3300048091 | Bacteria | 4661 |
| 651 | Ga0495626_0012782 | 3300048091 | Bacteria | 4385 |
| 652 | Ga0495626_0022006 | 3300048091 | Bacteria | 3153 |
| 653 | Ga0495626_0029165 | 3300048091 | Bacteria | 2672 |
| 654 | Ga0495626_0031004 | 3300048091 | Bacteria | 2576 |
| 655 | Ga0495626_0031428 | 3300048091 | Bacteria | 2555 |
| 656 | Ga0495626_0050406 | 3300048091 | Bacteria | 1923 |
| 657 | Ga0495626_0055222 | 3300048091 | Bacteria | 1821 |
| 658 | Ga0495626_0063149 | 3300048091 | Bacteria | 1680 |
| 659 | Ga0495626_0063151 | 3300048091 | Bacteria | 1680 |
| 660 | Ga0495626_0063955 | 3300048091 | Bacteria | 1667 |
| 661 | Ga0496101_0020528 | 3300048904 | Bacteria | 4524 |
| 662 | Ga0496102_0000340 | 3300048905 | Bacteria | 57233 |
| 663 | Ga0496102_0003156 | 3300048905 | Bacteria | 13978 |
| 664 | Ga0496102_0009970 | 3300048905 | Bacteria | 8168 |
| 665 | Ga0496102_0059573 | 3300048905 | Bacteria | 3491 |
| 666 | Ga0496102_0083292 | 3300048905 | Bacteria | 2951 |
| 667 | Ga0496102_0219586 | 3300048905 | Bacteria | 1792 |
| 668 | Ga0496104_0011196 | 3300048907 | Bacteria | 8027 |
| 669 | Ga0496104_0087770 | 3300048907 | Bacteria | 2971 |
| 670 | Ga0496105_0006554 | 3300048908 | Bacteria | 8956 |
| 671 | Ga0496105_0089227 | 3300048908 | Bacteria | 2547 |
| 672 | Ga0496107_0019561 | 3300048910 | Bacteria | 4777 |
| 673 | Ga0496109_0013420 | 3300048912 | Bacteria | 7106 |
| 674 | Ga0496109_0034130 | 3300048912 | Bacteria | 4580 |
| 675 | Ga0496110_0000019 | 3300048913 | Bacteria | 79137 |
| 676 | Ga0496110_0033634 | 3300048913 | Bacteria | 4436 |
| 677 | Ga0496112_0037642 | 3300048915 | Bacteria | 4721 |
| 678 | Ga0496113_0001035 | 3300048916 | Bacteria | 14988 |
| 679 | Ga0496114_0001006 | 3300048917 | Bacteria | 21131 |
| 680 | Ga0496115_0010294 | 3300048918 | Bacteria | 6981 |
| 681 | Ga0496115_0049958 | 3300048918 | Bacteria | 3349 |
| 682 | Ga0496115_0106296 | 3300048918 | Bacteria | 2304 |
| 683 | Ga0496116_0013225 | 3300048919 | Bacteria | 6673 |
| 684 | Ga0496117_0016278 | 3300048920 | Bacteria | 6282 |
| 685 | Ga0496117_0020552 | 3300048920 | Bacteria | 5377 |
| 686 | Ga0496117_0039011 | 3300048920 | Bacteria | 3511 |
| 687 | Ga0496118_0010315 | 3300048921 | Bacteria | 9265 |
| 688 | Ga0496118_0017574 | 3300048921 | Bacteria | 6501 |
| 689 | Ga0496121_0006225 | 3300048924 | Bacteria | 14952 |
| 690 | Ga0496121_0063420 | 3300048924 | Bacteria | 3019 |
| 691 | Ga0496122_0000039 | 3300048925 | Bacteria | 295352 |
| 692 | Ga0496122_0000835 | 3300048925 | Bacteria | 58311 |
| 693 | Ga0496122_0016510 | 3300048925 | Bacteria | 6978 |
| 694 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 695 | Ga0496123_0001003 | 3300048926 | Bacteria | 43216 |
| 696 | Ga0496124_0006172 | 3300048927 | Bacteria | 13137 |
| 697 | Ga0496124_0018645 | 3300048927 | Bacteria | 6492 |
| 698 | Ga0496124_0020169 | 3300048927 | Bacteria | 6171 |
| 699 | Ga0496124_0023676 | 3300048927 | Bacteria | 5601 |
| 700 | Ga0496124_0037480 | 3300048927 | Bacteria | 4216 |
| 701 | Ga0496124_0123045 | 3300048927 | Bacteria | 2070 |
| 702 | Ga0496125_0001280 | 3300048928 | Bacteria | 37321 |
| 703 | Ga0496125_0046039 | 3300048928 | Bacteria | 3664 |
| 704 | Ga0496125_0150588 | 3300048928 | Bacteria | 1599 |
| 705 | Ga0495678_002343 | 3300049459 | Bacteria | 13026 |
| 706 | Ga0495678_005272 | 3300049459 | Bacteria | 7183 |
| 707 | Ga0495678_005885 | 3300049459 | Bacteria | 6638 |
| 708 | Ga0495678_007348 | 3300049459 | Bacteria | 5722 |
| 709 | Ga0495678_010969 | 3300049459 | Bacteria | 4363 |
| 710 | Ga0495682_0001115 | 3300049460 | Bacteria | 15630 |
| 711 | Ga0495682_0002861 | 3300049460 | Bacteria | 7943 |
| 712 | Ga0495682_0011284 | 3300049460 | Bacteria | 3438 |
| 713 | Ga0495682_0042380 | 3300049460 | Bacteria | 1668 |
| 714 | Ga0501046_0027412 | 3300049580 | Bacteria | 4647 |
| 715 | Ga0501222_002961 | 3300049662 | Bacteria | 2342 |
| 716 | Ga0501249_023155 | 3300049679 | Bacteria | 1362 |
| 717 | Ga0501252_000327 | 3300049682 | Bacteria | 3415 |
| 718 | Ga0501262_000019 | 3300049759 | Bacteria | 23083 |
| 719 | Ga0501035_0000965 | 3300049822 | Bacteria | 30391 |
| 720 | Ga0501044_0053829 | 3300049823 | Bacteria | 4139 |
| 721 | nmdc:mga03683_3138_c1 | 3300050489 | Bacteria | 5269 |
| 722 | nmdc:mga03683_83793_c1 | 3300050489 | Bacteria | 1381 |
| 723 | nmdc:mga03n38_26716_c1 | 3300050490 | Bacteria | 2387 |
| 724 | nmdc:mga0yw44_3634_c1 | 3300050492 | Bacteria | 6891 |
| 725 | nmdc:mga0yw44_82186_c1 | 3300050492 | Bacteria | 2021 |
| 726 | nmdc:mga0k408_183820_c1 | 3300050493 | Bacteria | 1247 |
| 727 | nmdc:mga07m45_24274_c1 | 3300050496 | Bacteria | 3320 |
| 728 | nmdc:mga07m45_65905_c1 | 3300050496 | Bacteria | 2057 |
| 729 | nmdc:mga09592_231455_c1 | 3300050508 | Bacteria | 1601 |
| 730 | nmdc:mga0qj67_186122_c1 | 3300050509 | Bacteria | 1687 |
| 731 | Ga0500644_0009212 | 3300053088 | Bacteria | 2634 |
| 732 | Ga0500651_0000059 | 3300053093 | Bacteria | 71552 |
| 733 | Ga0500569_003152 | 3300053109 | Bacteria | 3335 |
| 734 | Ga0500571_000277 | 3300053110 | Bacteria | 19921 |
| 735 | Ga0500593_004378 | 3300053117 | Bacteria | 5460 |
| 736 | Ga0500607_001683 | 3300053121 | Bacteria | 19314 |
| 737 | Ga0500655_000057 | 3300053133 | Bacteria | 30496 |
| 738 | Ga0500658_0000216 | 3300053134 | Bacteria | 27442 |
| 739 | Ga0500658_0011335 | 3300053134 | Bacteria | 3283 |
| 740 | Ga0500568_0001730 | 3300053139 | Bacteria | 13535 |
| 741 | Ga0500574_006222 | 3300053141 | Bacteria | 2385 |
| 742 | Ga0500619_000026 | 3300053154 | Bacteria | 48851 |
| 743 | Ga0500627_0001913 | 3300053158 | Bacteria | 5978 |
| 744 | Ga0500634_0012153 | 3300053161 | Bacteria | 4474 |
| 745 | Ga0500636_0047379 | 3300053177 | Bacteria | 2532 |
| 746 | Ga0466962_0007392 | 3300061719 | Bacteria | 5269 |
| 747 | Ga0466962_0110180 | 3300061719 | Bacteria | 1325 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046665 | Ga0495661_0067026 | Ga0495661_0067026_17_916 | 295 |
| 2 | 3300031507 | Ga0307509_10000110 | Ga0307509_1000011064 | 311 |
| 3 | 3300048091 | Ga0495626_0055222 | Ga0495626_0055222_739_1692 | 311 |
| 4 | 3300046500 | Ga0495596_0010438 | Ga0495596_0010438_3010_3984 | 314 |
| 5 | 3300048905 | Ga0496102_0083292 | Ga0496102_0083292_1116_2150 | 315 |
| 6 | 3300006051 | Ga0075364_10149602 | Ga0075364_101496022 | 319 |
| 7 | 3300044683 | Ga0466965_0028945 | Ga0466965_0028945_47_1072 | 320 |
| 8 | 3300046528 | Ga0495642_0052497 | Ga0495642_0052497_20_1003 | 320 |
| 9 | 3300046501 | Ga0495607_0178963 | Ga0495607_0178963_68_1045 | 321 |
| 10 | iso_pu_bacteria | 2842733646 | 2842736536 | 321 |
| 11 | 3300003784 | Ga0055534_1002279 | Ga0055534_10022795 | 323 |
| 12 | 3300025284 | Ga0209130_1003566 | Ga0209130_10035666 | 323 |
| 13 | 3300025291 | Ga0209675_1009852 | Ga0209675_10098522 | 323 |
| 14 | 3300025304 | Ga0209257_1008520 | Ga0209257_10085207 | 323 |
| 15 | 3300046660 | Ga0495625_0000262 | Ga0495625_0000262_9351_10376 | 323 |
| 16 | 3300006353 | Ga0075370_10005084 | Ga0075370_100050845 | 324 |
| 17 | 3300006948 | Ga0099826_10000134 | Ga0099826_1000013421 | 324 |
| 18 | 3300048925 | Ga0496122_0000039 | Ga0496122_0000039_161953_162999 | 324 |
| 19 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_162049_163095 | 324 |
| 20 | 3300006038 | Ga0075365_10025066 | Ga0075365_100250664 | 325 |
| 21 | 3300006048 | Ga0075363_100008339 | Ga0075363_1000083394 | 325 |
| 22 | 3300006058 | Ga0075432_10000963 | Ga0075432_100009634 | 325 |
| 23 | 3300006177 | Ga0075362_10015373 | Ga0075362_100153733 | 325 |
| 24 | 3300006195 | Ga0075366_10039747 | Ga0075366_100397472 | 325 |
| 25 | 3300025273 | Ga0209673_1001164 | Ga0209673_10011647 | 325 |
| 26 | 3300046616 | Ga0495668_0015154 | Ga0495668_0015154_34_1035 | 325 |
| 27 | 3300046648 | Ga0495611_0055812 | Ga0495611_0055812_656_1657 | 325 |
| 28 | 3300046692 | Ga0495671_0003518 | Ga0495671_0003518_3461_4483 | 325 |
| 29 | 3300050490 | nmdc:mga03n38_26716_c1 | nmdc:mga03n38_26716_c1_1304_2329 | 325 |
| 30 | 3300050492 | nmdc:mga0yw44_3634_c1 | nmdc:mga0yw44_3634_c1_1068_2093 | 325 |
| 31 | 3300050493 | nmdc:mga0k408_183820_c1 | nmdc:mga0k408_183820_c1_183_1208 | 325 |
| 32 | 3300053109 | Ga0500569_003152 | Ga0500569_003152_52_1074 | 325 |
| 33 | 3300053117 | Ga0500593_004378 | Ga0500593_004378_4050_5072 | 325 |
| 34 | 3300053158 | Ga0500627_0001913 | Ga0500627_0001913_2997_4019 | 325 |
| 35 | 3300003773 | Ga0055537_1000013 | Ga0055537_100001378 | 326 |
| 36 | 3300003784 | Ga0055534_1000008 | Ga0055534_1000008122 | 326 |
| 37 | 3300003790 | Ga0055528_1000170 | Ga0055528_100017032 | 326 |
| 38 | 3300005288 | Ga0065714_10002682 | Ga0065714_1000268218 | 326 |
| 39 | 3300006058 | Ga0075432_10004926 | Ga0075432_100049265 | 326 |
| 40 | 3300006948 | Ga0099826_10041979 | Ga0099826_100419794 | 326 |
| 41 | 3300011119 | Ga0105246_10034891 | Ga0105246_100348914 | 326 |
| 42 | 3300017792 | Ga0163161_10010407 | Ga0163161_100104073 | 326 |
| 43 | 3300025263 | Ga0209565_1000042 | Ga0209565_1000042121 | 326 |
| 44 | 3300025273 | Ga0209673_1000071 | Ga0209673_1000071107 | 326 |
| 45 | 3300025291 | Ga0209675_1000041 | Ga0209675_1000041106 | 326 |
| 46 | 3300025292 | Ga0209676_1026546 | Ga0209676_10265462 | 326 |
| 47 | 3300025298 | Ga0209050_1022825 | Ga0209050_10228252 | 326 |
| 48 | 3300027666 | Ga0209282_1000514 | Ga0209282_100051413 | 326 |
| 49 | 3300031903 | Ga0307407_10134583 | Ga0307407_101345832 | 326 |
| 50 | 3300041411 | Ga0439466_0013359 | Ga0439466_0013359_1968_2993 | 326 |
| 51 | 3300042145 | Ga0450906_006013 | Ga0450906_006013_23_1048 | 326 |
| 52 | 3300046515 | Ga0495620_0030896 | Ga0495620_0030896_674_1702 | 326 |
| 53 | 3300005364 | Ga0070673_100099988 | Ga0070673_1000999882 | 328 |
| 54 | 3300017792 | Ga0163161_10021987 | Ga0163161_100219876 | 328 |
| 55 | 3300025986 | Ga0207658_10015667 | Ga0207658_100156674 | 328 |
| 56 | 3300026121 | Ga0207683_10099474 | Ga0207683_100994741 | 328 |
| 57 | 3300042007 | Ga0439449_0004733 | Ga0439449_0004733_1266_2300 | 328 |
| 58 | 3300046474 | Ga0495605_0062292 | Ga0495605_0062292_590_1654 | 328 |
| 59 | 3300046501 | Ga0495607_0034379 | Ga0495607_0034379_1857_2921 | 328 |
| 60 | 3300046616 | Ga0495668_0113702 | Ga0495668_0113702_76_1200 | 328 |
| 61 | 3300048904 | Ga0496101_0020528 | Ga0496101_0020528_1954_2958 | 328 |
| 62 | 3300048905 | Ga0496102_0009970 | Ga0496102_0009970_5309_6313 | 328 |
| 63 | 3300048907 | Ga0496104_0011196 | Ga0496104_0011196_6322_7326 | 328 |
| 64 | 3300048908 | Ga0496105_0006554 | Ga0496105_0006554_5533_6537 | 328 |
| 65 | 3300044656 | Ga0466969_0000031 | Ga0466969_0000031_75256_76311 | 329 |
| 66 | 3300044765 | Ga0466970_0031498 | Ga0466970_0031498_1530_2585 | 329 |
| 67 | 3300046674 | Ga0495588_0046208 | Ga0495588_0046208_854_1888 | 329 |
| 68 | 3300053121 | Ga0500607_001683 | Ga0500607_001683_5401_6435 | 329 |
| 69 | 3300053161 | Ga0500634_0012153 | Ga0500634_0012153_1712_2746 | 329 |
| 70 | iso_pu_bacteria | 2510065053 | 2510282116 | 329 |
| 71 | iso_pu_bacteria | 2510065055 | 2510291725 | 329 |
| 72 | iso_pu_bacteria | 2510065058 | 2510310264 | 329 |
| 73 | iso_pu_bacteria | 2738541277 | 2738721201 | 329 |
| 74 | iso_pu_bacteria | 2738543019 | 2739280400 | 329 |
| 75 | iso_pu_bacteria | 2773857672 | 2774132480 | 329 |
| 76 | iso_pu_bacteria | 2917832318 | 2917835891 | 329 |
| 77 | iso_pu_bacteria | 2919125081 | 2919125729 | 329 |
| 78 | iso_pu_bacteria | 2974298342 | 2974300091 | 329 |
| 79 | iso_pu_bacteria | 2984499530 | 2984502471 | 329 |
| 80 | iso_pu_bacteria | 2984504281 | 2984508916 | 329 |
| 81 | iso_pu_bacteria | 2990196909 | 2990199307 | 329 |
| 82 | iso_pu_bacteria | 8016728285 | 8016728786 | 329 |
| 83 | 3300003323 | rootH1_10021656 | rootH1_100216568 | 330 |
| 84 | 3300003781 | Ga0055536_1000693 | Ga0055536_100069323 | 330 |
| 85 | 3300003792 | Ga0055540_1004177 | Ga0055540_10041778 | 330 |
| 86 | 3300009148 | Ga0105243_10000690 | Ga0105243_1000069015 | 330 |
| 87 | 3300025292 | Ga0209676_1000478 | Ga0209676_100047832 | 330 |
| 88 | 3300025303 | Ga0209051_1000821 | Ga0209051_100082133 | 330 |
| 89 | 3300025304 | Ga0209257_1013348 | Ga0209257_10133482 | 330 |
| 90 | 3300025935 | Ga0207709_10000233 | Ga0207709_1000023341 | 330 |
| 91 | 3300031731 | Ga0307405_10019685 | Ga0307405_100196852 | 330 |
| 92 | 3300045051 | Ga0451576_0000168 | Ga0451576_0000168_125045_126049 | 330 |
| 93 | 3300045051 | Ga0451576_0686019 | Ga0451576_0686019_27_1034 | 330 |
| 94 | 3300046491 | Ga0495584_0012387 | Ga0495584_0012387_130_1167 | 330 |
| 95 | 3300046492 | Ga0495585_0024833 | Ga0495585_0024833_387_1424 | 330 |
| 96 | 3300046506 | Ga0495583_0000525 | Ga0495583_0000525_11936_12973 | 330 |
| 97 | 3300046513 | Ga0495616_0086084 | Ga0495616_0086084_299_1336 | 330 |
| 98 | 3300046558 | Ga0495633_0020810 | Ga0495633_0020810_788_1825 | 330 |
| 99 | 3300047323 | Ga0495683_0000144 | Ga0495683_0000144_26767_27804 | 330 |
| 100 | 3300049580 | Ga0501046_0027412 | Ga0501046_0027412_2757_3755 | 330 |
| 101 | 3300050508 | nmdc:mga09592_231455_c1 | nmdc:mga09592_231455_c1_519_1589 | 330 |
| 102 | iso_pu_bacteria | 2929520902 | 2929524359 | 330 |
| 103 | iso_pu_bacteria | 2954767861 | 2954768158 | 330 |
| 104 | 3300025920 | Ga0207649_10069649 | Ga0207649_100696492 | 331 |
| 105 | 3300044673 | Ga0453683_0000669 | Ga0453683_0000669_30871_31899 | 331 |
| 106 | 3300045051 | Ga0451576_0004343 | Ga0451576_0004343_9171_10199 | 331 |
| 107 | iso_pu_bacteria | 2842747753 | 2842748983 | 331 |
| 108 | 3300005355 | Ga0070671_100005353 | Ga0070671_1000053533 | 332 |
| 109 | 3300005618 | Ga0068864_100034340 | Ga0068864_1000343402 | 332 |
| 110 | 3300005841 | Ga0068863_100204934 | Ga0068863_1002049342 | 332 |
| 111 | 3300009177 | Ga0105248_10001132 | Ga0105248_1000113214 | 332 |
| 112 | 3300010375 | Ga0105239_10163357 | Ga0105239_101633571 | 332 |
| 113 | 3300025931 | Ga0207644_10013625 | Ga0207644_100136253 | 332 |
| 114 | 3300025941 | Ga0207711_10002686 | Ga0207711_100026865 | 332 |
| 115 | 3300026095 | Ga0207676_10070103 | Ga0207676_100701033 | 332 |
| 116 | 3300046471 | Ga0495650_0039164 | Ga0495650_0039164_403_1413 | 332 |
| 117 | 3300048912 | Ga0496109_0034130 | Ga0496109_0034130_2906_3967 | 332 |
| 118 | 3300048915 | Ga0496112_0037642 | Ga0496112_0037642_1593_2654 | 332 |
| 119 | 3300048916 | Ga0496113_0001035 | Ga0496113_0001035_6226_7287 | 332 |
| 120 | iso_pu_bacteria | 2643221628 | 2644160145 | 332 |
| 121 | 3300009036 | Ga0105244_10040819 | Ga0105244_100408191 | 333 |
| 122 | 3300013100 | Ga0157373_10076696 | Ga0157373_100766961 | 333 |
| 123 | 3300013102 | Ga0157371_10001256 | Ga0157371_100012563 | 333 |
| 124 | 3300013105 | Ga0157369_10011573 | Ga0157369_100115737 | 333 |
| 125 | 3300025728 | Ga0207655_1035059 | Ga0207655_10350593 | 333 |
| 126 | 3300026067 | Ga0207678_10206954 | Ga0207678_102069542 | 333 |
| 127 | 3300031507 | Ga0307509_10056305 | Ga0307509_100563052 | 333 |
| 128 | 3300046460 | Ga0495638_0034660 | Ga0495638_0034660_504_1523 | 333 |
| 129 | 3300046471 | Ga0495650_0000140 | Ga0495650_0000140_26576_27586 | 333 |
| 130 | 3300046471 | Ga0495650_0006922 | Ga0495650_0006922_4494_5504 | 333 |
| 131 | 3300047323 | Ga0495683_0011537 | Ga0495683_0011537_2398_3408 | 333 |
| 132 | 3300049459 | Ga0495678_002343 | Ga0495678_002343_11560_12570 | 333 |
| 133 | 3300050509 | nmdc:mga0qj67_186122_c1 | nmdc:mga0qj67_186122_c1_250_1308 | 333 |
| 134 | iso_pu_bacteria | 2643221644 | 2644245371 | 333 |
| 135 | iso_pu_bacteria | 2945972063 | 2945972413 | 333 |
| 136 | 3300021361 | Ga0213872_10000139 | Ga0213872_100001398 | 334 |
| 137 | 3300030745 | Ga0316182_1158317 | Ga0316182_11583174 | 334 |
| 138 | 3300037471 | Ga0395905_0090444 | Ga0395905_0090444_585_1601 | 334 |
| 139 | 3300039447 | Ga0436361_0734234 | Ga0436361_0734234_13446_14498 | 334 |
| 140 | 3300046474 | Ga0495605_0014595 | Ga0495605_0014595_29_1045 | 334 |
| 141 | 3300046506 | Ga0495583_0000608 | Ga0495583_0000608_30797_31822 | 334 |
| 142 | 3300046506 | Ga0495583_0005683 | Ga0495583_0005683_531_1553 | 334 |
| 143 | 3300046506 | Ga0495583_0016629 | Ga0495583_0016629_641_1657 | 334 |
| 144 | 3300046513 | Ga0495616_0000343 | Ga0495616_0000343_9542_10573 | 334 |
| 145 | 3300046518 | Ga0495631_0003698 | Ga0495631_0003698_3230_4246 | 334 |
| 146 | 3300046522 | Ga0495643_0000648 | Ga0495643_0000648_6615_7637 | 334 |
| 147 | 3300046524 | Ga0495648_0015644 | Ga0495648_0015644_3456_4472 | 334 |
| 148 | 3300046525 | Ga0495663_0002877 | Ga0495663_0002877_3737_4762 | 334 |
| 149 | 3300046530 | Ga0495654_0024043 | Ga0495654_0024043_282_1298 | 334 |
| 150 | 3300046542 | Ga0495597_0015920 | Ga0495597_0015920_745_1761 | 334 |
| 151 | 3300046616 | Ga0495668_0002669 | Ga0495668_0002669_5458_6474 | 334 |
| 152 | 3300046660 | Ga0495625_0024004 | Ga0495625_0024004_3048_4064 | 334 |
| 153 | 3300046692 | Ga0495671_0017183 | Ga0495671_0017183_2091_3107 | 334 |
| 154 | 3300046810 | Ga0495660_0087773 | Ga0495660_0087773_311_1327 | 334 |
| 155 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_920835_921851 | 334 |
| 156 | 3300047444 | Ga0495675_0011947 | Ga0495675_0011947_45_1061 | 334 |
| 157 | 3300047446 | Ga0495679_012327 | Ga0495679_012327_334_1350 | 334 |
| 158 | 3300047447 | Ga0495685_027644 | Ga0495685_027644_632_1648 | 334 |
| 159 | 3300047470 | Ga0495681_0033046 | Ga0495681_0033046_1406_2422 | 334 |
| 160 | 3300048090 | Ga0495615_0000720 | Ga0495615_0000720_3284_4309 | 334 |
| 161 | 3300048091 | Ga0495626_0002550 | Ga0495626_0002550_4919_5950 | 334 |
| 162 | 3300048908 | Ga0496105_0089227 | Ga0496105_0089227_67_1086 | 334 |
| 163 | 3300048913 | Ga0496110_0033634 | Ga0496110_0033634_2972_4024 | 334 |
| 164 | 3300048918 | Ga0496115_0010294 | Ga0496115_0010294_400_1428 | 334 |
| 165 | 3300049459 | Ga0495678_005885 | Ga0495678_005885_5171_6187 | 334 |
| 166 | iso_pu_bacteria | 2547132512 | 2548847779 | 334 |
| 167 | iso_pu_bacteria | 2904541872 | 2904545456 | 334 |
| 168 | iso_pu_bacteria | 2929160207 | 2929168095 | 334 |
| 169 | 3300005353 | Ga0070669_100117385 | Ga0070669_1001173852 | 335 |
| 170 | 3300025923 | Ga0207681_10005513 | Ga0207681_100055137 | 335 |
| 171 | 3300032002 | Ga0307416_100009235 | Ga0307416_1000092354 | 335 |
| 172 | 3300044656 | Ga0466969_0027742 | Ga0466969_0027742_580_1599 | 335 |
| 173 | 3300044684 | Ga0466966_0004253 | Ga0466966_0004253_6730_7749 | 335 |
| 174 | 3300044765 | Ga0466970_0013325 | Ga0466970_0013325_658_1692 | 335 |
| 175 | 3300045049 | Ga0466959_0015320 | Ga0466959_0015320_2191_3225 | 335 |
| 176 | 3300046492 | Ga0495585_0029200 | Ga0495585_0029200_843_1862 | 335 |
| 177 | 3300046500 | Ga0495596_0003685 | Ga0495596_0003685_1605_2624 | 335 |
| 178 | 3300046518 | Ga0495631_0027836 | Ga0495631_0027836_96_1115 | 335 |
| 179 | 3300046648 | Ga0495611_0041367 | Ga0495611_0041367_41_1060 | 335 |
| 180 | 3300046684 | Ga0495669_0000217 | Ga0495669_0000217_917_1936 | 335 |
| 181 | 3300046689 | Ga0495613_0047420 | Ga0495613_0047420_488_1507 | 335 |
| 182 | 3300046691 | Ga0495670_0102092 | Ga0495670_0102092_413_1432 | 335 |
| 183 | 3300047320 | Ga0495672_0000005 | Ga0495672_0000005_438428_439468 | 335 |
| 184 | 3300048088 | Ga0495602_0108137 | Ga0495602_0108137_736_1773 | 335 |
| 185 | 3300048089 | Ga0495614_0003763 | Ga0495614_0003763_3736_4755 | 335 |
| 186 | 3300048091 | Ga0495626_0000004 | Ga0495626_0000004_339416_340435 | 335 |
| 187 | 3300048091 | Ga0495626_0031004 | Ga0495626_0031004_753_1772 | 335 |
| 188 | 3300048918 | Ga0496115_0049958 | Ga0496115_0049958_770_1801 | 335 |
| 189 | 3300048927 | Ga0496124_0023676 | Ga0496124_0023676_819_1865 | 335 |
| 190 | 3300049682 | Ga0501252_000327 | Ga0501252_000327_1974_2990 | 335 |
| 191 | iso_pu_bacteria | 2513020051 | 2513227505 | 335 |
| 192 | iso_pu_bacteria | 2643221658 | 2644329513 | 335 |
| 193 | iso_pu_bacteria | 2643221672 | 2644398269 | 335 |
| 194 | 3300005262 | Ga0065165_1003015 | Ga0065165_10030152 | 336 |
| 195 | 3300014497 | Ga0182008_10000191 | Ga0182008_100001915 | 336 |
| 196 | 3300021361 | Ga0213872_10000016 | Ga0213872_10000016153 | 336 |
| 197 | 3300037312 | Ga0395899_0001479 | Ga0395899_0001479_6674_7708 | 336 |
| 198 | 3300037312 | Ga0395899_0019352 | Ga0395899_0019352_530_1546 | 336 |
| 199 | 3300037312 | Ga0395899_0189581 | Ga0395899_0189581_280_1314 | 336 |
| 200 | 3300037418 | Ga0395900_0021662 | Ga0395900_0021662_736_1770 | 336 |
| 201 | 3300037418 | Ga0395900_0029346 | Ga0395900_0029346_3874_4890 | 336 |
| 202 | 3300037466 | Ga0395898_0109699 | Ga0395898_0109699_744_1760 | 336 |
| 203 | 3300037471 | Ga0395905_0029976 | Ga0395905_0029976_2348_3364 | 336 |
| 204 | 3300037471 | Ga0395905_0041547 | Ga0395905_0041547_971_2005 | 336 |
| 205 | 3300038443 | Ga0395901_0016310 | Ga0395901_0016310_853_1869 | 336 |
| 206 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_184365_185408 | 336 |
| 207 | 3300044706 | Ga0466964_0098193 | Ga0466964_0098193_76_1092 | 336 |
| 208 | 3300046452 | Ga0495617_000057 | Ga0495617_000057_72064_73086 | 336 |
| 209 | 3300046453 | Ga0495627_000841 | Ga0495627_000841_19330_20352 | 336 |
| 210 | 3300046453 | Ga0495627_010702 | Ga0495627_010702_568_1599 | 336 |
| 211 | 3300046457 | Ga0495590_0003167 | Ga0495590_0003167_1056_2087 | 336 |
| 212 | 3300046460 | Ga0495638_0002966 | Ga0495638_0002966_4378_5412 | 336 |
| 213 | 3300046460 | Ga0495638_0067281 | Ga0495638_0067281_341_1363 | 336 |
| 214 | 3300046474 | Ga0495605_0000465 | Ga0495605_0000465_1811_2833 | 336 |
| 215 | 3300046474 | Ga0495605_0015651 | Ga0495605_0015651_1139_2161 | 336 |
| 216 | 3300046474 | Ga0495605_0017006 | Ga0495605_0017006_1054_2076 | 336 |
| 217 | 3300046474 | Ga0495605_0029038 | Ga0495605_0029038_511_1545 | 336 |
| 218 | 3300046491 | Ga0495584_0007725 | Ga0495584_0007725_3474_4496 | 336 |
| 219 | 3300046491 | Ga0495584_0029557 | Ga0495584_0029557_723_1745 | 336 |
| 220 | 3300046492 | Ga0495585_0002351 | Ga0495585_0002351_9592_10614 | 336 |
| 221 | 3300046492 | Ga0495585_0021634 | Ga0495585_0021634_2007_3029 | 336 |
| 222 | 3300046500 | Ga0495596_0001122 | Ga0495596_0001122_1402_2436 | 336 |
| 223 | 3300046500 | Ga0495596_0007860 | Ga0495596_0007860_1983_3005 | 336 |
| 224 | 3300046500 | Ga0495596_0012493 | Ga0495596_0012493_1624_2658 | 336 |
| 225 | 3300046500 | Ga0495596_0027903 | Ga0495596_0027903_436_1467 | 336 |
| 226 | 3300046500 | Ga0495596_0029821 | Ga0495596_0029821_474_1496 | 336 |
| 227 | 3300046506 | Ga0495583_0036930 | Ga0495583_0036930_493_1524 | 336 |
| 228 | 3300046507 | Ga0495606_0008641 | Ga0495606_0008641_6670_7704 | 336 |
| 229 | 3300046507 | Ga0495606_0027256 | Ga0495606_0027256_3024_4046 | 336 |
| 230 | 3300046507 | Ga0495606_0052561 | Ga0495606_0052561_27_1049 | 336 |
| 231 | 3300046513 | Ga0495616_0002034 | Ga0495616_0002034_9295_10317 | 336 |
| 232 | 3300046513 | Ga0495616_0018017 | Ga0495616_0018017_1988_3010 | 336 |
| 233 | 3300046513 | Ga0495616_0036740 | Ga0495616_0036740_1036_2070 | 336 |
| 234 | 3300046513 | Ga0495616_0056871 | Ga0495616_0056871_225_1247 | 336 |
| 235 | 3300046518 | Ga0495631_0004600 | Ga0495631_0004600_1808_2842 | 336 |
| 236 | 3300046518 | Ga0495631_0010952 | Ga0495631_0010952_1976_2998 | 336 |
| 237 | 3300046518 | Ga0495631_0012016 | Ga0495631_0012016_130_1161 | 336 |
| 238 | 3300046518 | Ga0495631_0025814 | Ga0495631_0025814_516_1538 | 336 |
| 239 | 3300046519 | Ga0495632_0025453 | Ga0495632_0025453_2072_3094 | 336 |
| 240 | 3300046522 | Ga0495643_0019644 | Ga0495643_0019644_1449_2471 | 336 |
| 241 | 3300046522 | Ga0495643_0027441 | Ga0495643_0027441_459_1493 | 336 |
| 242 | 3300046523 | Ga0495644_0020982 | Ga0495644_0020982_903_1925 | 336 |
| 243 | 3300046524 | Ga0495648_0002349 | Ga0495648_0002349_13504_14526 | 336 |
| 244 | 3300046524 | Ga0495648_0018893 | Ga0495648_0018893_1895_2917 | 336 |
| 245 | 3300046525 | Ga0495663_0036426 | Ga0495663_0036426_306_1337 | 336 |
| 246 | 3300046526 | Ga0495666_0032517 | Ga0495666_0032517_1485_2507 | 336 |
| 247 | 3300046528 | Ga0495642_0006606 | Ga0495642_0006606_1368_2390 | 336 |
| 248 | 3300046528 | Ga0495642_0058291 | Ga0495642_0058291_117_1148 | 336 |
| 249 | 3300046530 | Ga0495654_0095866 | Ga0495654_0095866_23_1045 | 336 |
| 250 | 3300046535 | Ga0495586_0076307 | Ga0495586_0076307_47_1069 | 336 |
| 251 | 3300046538 | Ga0495609_0010220 | Ga0495609_0010220_2077_3108 | 336 |
| 252 | 3300046538 | Ga0495609_0011383 | Ga0495609_0011383_2735_3769 | 336 |
| 253 | 3300046538 | Ga0495609_0038987 | Ga0495609_0038987_264_1286 | 336 |
| 254 | 3300046542 | Ga0495597_0005411 | Ga0495597_0005411_4184_5215 | 336 |
| 255 | 3300046542 | Ga0495597_0007036 | Ga0495597_0007036_839_1873 | 336 |
| 256 | 3300046542 | Ga0495597_0008932 | Ga0495597_0008932_1983_3017 | 336 |
| 257 | 3300046542 | Ga0495597_0017557 | Ga0495597_0017557_2166_3188 | 336 |
| 258 | 3300046557 | Ga0495622_0011636 | Ga0495622_0011636_1122_2147 | 336 |
| 259 | 3300046558 | Ga0495633_0076102 | Ga0495633_0076102_317_1351 | 336 |
| 260 | 3300046615 | Ga0495656_0030305 | Ga0495656_0030305_561_1583 | 336 |
| 261 | 3300046616 | Ga0495668_0000805 | Ga0495668_0000805_29329_30360 | 336 |
| 262 | 3300046616 | Ga0495668_0009502 | Ga0495668_0009502_280_1314 | 336 |
| 263 | 3300046616 | Ga0495668_0011356 | Ga0495668_0011356_2924_3946 | 336 |
| 264 | 3300046648 | Ga0495611_0000861 | Ga0495611_0000861_8527_9549 | 336 |
| 265 | 3300046648 | Ga0495611_0018839 | Ga0495611_0018839_1539_2561 | 336 |
| 266 | 3300046648 | Ga0495611_0095000 | Ga0495611_0095000_268_1302 | 336 |
| 267 | 3300046660 | Ga0495625_0067375 | Ga0495625_0067375_1290_2312 | 336 |
| 268 | 3300046665 | Ga0495661_0001167 | Ga0495661_0001167_16593_17618 | 336 |
| 269 | 3300046665 | Ga0495661_0015253 | Ga0495661_0015253_3458_4492 | 336 |
| 270 | 3300046665 | Ga0495661_0112997 | Ga0495661_0112997_40_1074 | 336 |
| 271 | 3300046665 | Ga0495661_0119254 | Ga0495661_0119254_416_1438 | 336 |
| 272 | 3300046684 | Ga0495669_0011043 | Ga0495669_0011043_1172_2206 | 336 |
| 273 | 3300046684 | Ga0495669_0035981 | Ga0495669_0035981_1077_2099 | 336 |
| 274 | 3300046691 | Ga0495670_0082168 | Ga0495670_0082168_262_1293 | 336 |
| 275 | 3300046692 | Ga0495671_0003370 | Ga0495671_0003370_7915_8937 | 336 |
| 276 | 3300046692 | Ga0495671_0007487 | Ga0495671_0007487_3440_4462 | 336 |
| 277 | 3300046694 | Ga0495649_0046746 | Ga0495649_0046746_301_1332 | 336 |
| 278 | 3300046794 | Ga0495589_0001177 | Ga0495589_0001177_10930_11964 | 336 |
| 279 | 3300046810 | Ga0495660_0015655 | Ga0495660_0015655_1350_2372 | 336 |
| 280 | 3300046810 | Ga0495660_0023786 | Ga0495660_0023786_2060_3082 | 336 |
| 281 | 3300047317 | Ga0495604_0012788 | Ga0495604_0012788_4226_5248 | 336 |
| 282 | 3300047320 | Ga0495672_0002152 | Ga0495672_0002152_15884_16936 | 336 |
| 283 | 3300047321 | Ga0495676_0000342 | Ga0495676_0000342_8151_9176 | 336 |
| 284 | 3300047323 | Ga0495683_0071135 | Ga0495683_0071135_305_1336 | 336 |
| 285 | 3300047443 | Ga0495687_010447 | Ga0495687_010447_1174_2196 | 336 |
| 286 | 3300047445 | Ga0495677_0002960 | Ga0495677_0002960_1770_2804 | 336 |
| 287 | 3300047445 | Ga0495677_0034663 | Ga0495677_0034663_631_1653 | 336 |
| 288 | 3300047446 | Ga0495679_022161 | Ga0495679_022161_978_2000 | 336 |
| 289 | 3300047447 | Ga0495685_046341 | Ga0495685_046341_336_1358 | 336 |
| 290 | 3300047470 | Ga0495681_0004144 | Ga0495681_0004144_8576_9607 | 336 |
| 291 | 3300047470 | Ga0495681_0027197 | Ga0495681_0027197_345_1376 | 336 |
| 292 | 3300047472 | Ga0495686_0003442 | Ga0495686_0003442_8223_9254 | 336 |
| 293 | 3300047673 | Ga0495593_0020397 | Ga0495593_0020397_1043_2071 | 336 |
| 294 | 3300048091 | Ga0495626_0011585 | Ga0495626_0011585_265_1299 | 336 |
| 295 | 3300048091 | Ga0495626_0022006 | Ga0495626_0022006_289_1323 | 336 |
| 296 | 3300048091 | Ga0495626_0063149 | Ga0495626_0063149_359_1381 | 336 |
| 297 | 3300048091 | Ga0495626_0063151 | Ga0495626_0063151_473_1495 | 336 |
| 298 | 3300048905 | Ga0496102_0003156 | Ga0496102_0003156_4135_5163 | 336 |
| 299 | 3300048913 | Ga0496110_0000019 | Ga0496110_0000019_45720_46751 | 336 |
| 300 | 3300048925 | Ga0496122_0000835 | Ga0496122_0000835_34527_35555 | 336 |
| 301 | 3300048926 | Ga0496123_0001003 | Ga0496123_0001003_16309_17337 | 336 |
| 302 | 3300048927 | Ga0496124_0006172 | Ga0496124_0006172_3312_4364 | 336 |
| 303 | 3300048928 | Ga0496125_0001280 | Ga0496125_0001280_33935_34963 | 336 |
| 304 | 3300049459 | Ga0495678_005272 | Ga0495678_005272_4986_6017 | 336 |
| 305 | 3300049460 | Ga0495682_0001115 | Ga0495682_0001115_11397_12428 | 336 |
| 306 | 3300049460 | Ga0495682_0002861 | Ga0495682_0002861_4528_5562 | 336 |
| 307 | 3300049460 | Ga0495682_0011284 | Ga0495682_0011284_1085_2107 | 336 |
| 308 | 3300049460 | Ga0495682_0042380 | Ga0495682_0042380_18_1049 | 336 |
| 309 | 3300053093 | Ga0500651_0000059 | Ga0500651_0000059_55968_56996 | 336 |
| 310 | 3300053110 | Ga0500571_000277 | Ga0500571_000277_16200_17228 | 336 |
| 311 | 3300053133 | Ga0500655_000057 | Ga0500655_000057_5891_6919 | 336 |
| 312 | 3300053134 | Ga0500658_0000216 | Ga0500658_0000216_14790_15818 | 336 |
| 313 | 3300053141 | Ga0500574_006222 | Ga0500574_006222_195_1223 | 336 |
| 314 | 3300053177 | Ga0500636_0047379 | Ga0500636_0047379_821_1849 | 336 |
| 315 | iso_pu_bacteria | 2599185214 | 2599624327 | 336 |
| 316 | iso_pu_bacteria | 2599185226 | 2599672339 | 336 |
| 317 | iso_pu_bacteria | 2599185227 | 2599681577 | 336 |
| 318 | iso_pu_bacteria | 2599185229 | 2599693591 | 336 |
| 319 | iso_pu_bacteria | 2818991446 | 2819596665 | 336 |
| 320 | iso_pu_bacteria | 2842677519 | 2842678532 | 336 |
| 321 | iso_pu_bacteria | 2885192300 | 2885193763 | 336 |
| 322 | iso_pu_bacteria | 2885198086 | 2885199396 | 336 |
| 323 | iso_pu_bacteria | 2885211737 | 2885213047 | 336 |
| 324 | iso_pu_bacteria | 2899924645 | 2899931385 | 336 |
| 325 | iso_pu_bacteria | 2928037797 | 2928037842 | 336 |
| 326 | iso_pu_bacteria | 2928044640 | 2928046552 | 336 |
| 327 | iso_pu_bacteria | 2928051484 | 2928054252 | 336 |
| 328 | iso_pu_bacteria | 2928064002 | 2928066000 | 336 |
| 329 | iso_pu_bacteria | 2928070936 | 2928076934 | 336 |
| 330 | iso_pu_bacteria | 2928084124 | 2928087237 | 336 |
| 331 | iso_pu_bacteria | 2945909444 | 2945909782 | 336 |
| 332 | iso_pu_bacteria | 2945945610 | 2945945868 | 336 |
| 333 | iso_pu_bacteria | 2945984333 | 2945988245 | 336 |
| 334 | 3300003775 | Ga0055524_1000084 | Ga0055524_100008453 | 337 |
| 335 | 3300003791 | Ga0055530_10002278 | Ga0055530_100022785 | 337 |
| 336 | 3300003792 | Ga0055540_1000004 | Ga0055540_1000004225 | 337 |
| 337 | 3300003794 | Ga0055531_10001095 | Ga0055531_1000109516 | 337 |
| 338 | 3300003794 | Ga0055531_10003664 | Ga0055531_100036647 | 337 |
| 339 | 3300005327 | Ga0070658_10316065 | Ga0070658_103160651 | 337 |
| 340 | 3300005339 | Ga0070660_100058524 | Ga0070660_1000585244 | 337 |
| 341 | 3300005344 | Ga0070661_100000994 | Ga0070661_10000099412 | 337 |
| 342 | 3300005366 | Ga0070659_100000929 | Ga0070659_1000009298 | 337 |
| 343 | 3300005366 | Ga0070659_100074216 | Ga0070659_1000742163 | 337 |
| 344 | 3300005563 | Ga0068855_100113939 | Ga0068855_1001139393 | 337 |
| 345 | 3300005564 | Ga0070664_100000282 | Ga0070664_10000028226 | 337 |
| 346 | 3300005616 | Ga0068852_100213822 | Ga0068852_1002138222 | 337 |
| 347 | 3300006038 | Ga0075365_10089268 | Ga0075365_100892684 | 337 |
| 348 | 3300006173 | Ga0070716_100260856 | Ga0070716_1002608561 | 337 |
| 349 | 3300006177 | Ga0075362_10037162 | Ga0075362_100371621 | 337 |
| 350 | 3300006195 | Ga0075366_10100413 | Ga0075366_101004132 | 337 |
| 351 | 3300006353 | Ga0075370_10138398 | Ga0075370_101383982 | 337 |
| 352 | 3300006946 | Ga0079104_1000013 | Ga0079104_1000013245 | 337 |
| 353 | 3300009093 | Ga0105240_10357178 | Ga0105240_103571782 | 337 |
| 354 | 3300009176 | Ga0105242_10023043 | Ga0105242_100230432 | 337 |
| 355 | 3300010375 | Ga0105239_10480611 | Ga0105239_104806111 | 337 |
| 356 | 3300025254 | Ga0209148_1000360 | Ga0209148_10003606 | 337 |
| 357 | 3300025298 | Ga0209050_1001157 | Ga0209050_100115723 | 337 |
| 358 | 3300025298 | Ga0209050_1005089 | Ga0209050_10050895 | 337 |
| 359 | 3300025299 | Ga0209256_1000071 | Ga0209256_100007153 | 337 |
| 360 | 3300025303 | Ga0209051_1000016 | Ga0209051_1000016318 | 337 |
| 361 | 3300025303 | Ga0209051_1000078 | Ga0209051_1000078147 | 337 |
| 362 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012406 | 337 |
| 363 | 3300025304 | Ga0209257_1000115 | Ga0209257_100011527 | 337 |
| 364 | 3300025901 | Ga0207688_10165143 | Ga0207688_101651432 | 337 |
| 365 | 3300025909 | Ga0207705_10009135 | Ga0207705_100091353 | 337 |
| 366 | 3300025911 | Ga0207654_10015559 | Ga0207654_100155594 | 337 |
| 367 | 3300025919 | Ga0207657_10031155 | Ga0207657_100311553 | 337 |
| 368 | 3300025919 | Ga0207657_10041085 | Ga0207657_100410853 | 337 |
| 369 | 3300025920 | Ga0207649_10001607 | Ga0207649_100016077 | 337 |
| 370 | 3300025932 | Ga0207690_10001881 | Ga0207690_100018814 | 337 |
| 371 | 3300025932 | Ga0207690_10035851 | Ga0207690_100358513 | 337 |
| 372 | 3300025935 | Ga0207709_10264030 | Ga0207709_102640302 | 337 |
| 373 | 3300025945 | Ga0207679_10000225 | Ga0207679_1000022547 | 337 |
| 374 | 3300025949 | Ga0207667_10026802 | Ga0207667_100268026 | 337 |
| 375 | 3300027111 | Ga0209281_1000182 | Ga0209281_1000182111 | 337 |
| 376 | 3300031250 | Ga0265331_10003230 | Ga0265331_100032309 | 337 |
| 377 | 3300031251 | Ga0265327_10000043 | Ga0265327_10000043250 | 337 |
| 378 | 3300037312 | Ga0395899_0020700 | Ga0395899_0020700_3556_4587 | 337 |
| 379 | 3300037312 | Ga0395899_0070118 | Ga0395899_0070118_463_1494 | 337 |
| 380 | 3300037312 | Ga0395899_0079793 | Ga0395899_0079793_771_1802 | 337 |
| 381 | 3300037312 | Ga0395899_0169829 | Ga0395899_0169829_360_1391 | 337 |
| 382 | 3300037418 | Ga0395900_0004592 | Ga0395900_0004592_3626_4657 | 337 |
| 383 | 3300037418 | Ga0395900_0099781 | Ga0395900_0099781_1132_2163 | 337 |
| 384 | 3300037418 | Ga0395900_0210844 | Ga0395900_0210844_78_1109 | 337 |
| 385 | 3300037466 | Ga0395898_0188023 | Ga0395898_0188023_331_1362 | 337 |
| 386 | 3300037471 | Ga0395905_0017731 | Ga0395905_0017731_962_2017 | 337 |
| 387 | 3300037471 | Ga0395905_0019403 | Ga0395905_0019403_3498_4523 | 337 |
| 388 | 3300037471 | Ga0395905_0057531 | Ga0395905_0057531_2346_3377 | 337 |
| 389 | 3300038443 | Ga0395901_0000054 | Ga0395901_0000054_56460_57491 | 337 |
| 390 | 3300038443 | Ga0395901_0037712 | Ga0395901_0037712_1344_2375 | 337 |
| 391 | 3300038443 | Ga0395901_0089438 | Ga0395901_0089438_1751_2782 | 337 |
| 392 | 3300038443 | Ga0395901_0107922 | Ga0395901_0107922_1502_2533 | 337 |
| 393 | 3300038443 | Ga0395901_0175450 | Ga0395901_0175450_319_1350 | 337 |
| 394 | 3300042531 | Ga0450918_000224 | Ga0450918_000224_317_1351 | 337 |
| 395 | 3300044683 | Ga0466965_0029831 | Ga0466965_0029831_1358_2389 | 337 |
| 396 | 3300044684 | Ga0466966_0014615 | Ga0466966_0014615_3253_4284 | 337 |
| 397 | 3300044693 | Ga0466961_0060921 | Ga0466961_0060921_1029_2060 | 337 |
| 398 | 3300044693 | Ga0466961_0095756 | Ga0466961_0095756_573_1604 | 337 |
| 399 | 3300044842 | Ga0466957_0000064 | Ga0466957_0000064_29469_30500 | 337 |
| 400 | 3300044842 | Ga0466957_0065756 | Ga0466957_0065756_44_1072 | 337 |
| 401 | 3300045049 | Ga0466959_0014081 | Ga0466959_0014081_2495_3526 | 337 |
| 402 | 3300045049 | Ga0466959_0032400 | Ga0466959_0032400_544_1575 | 337 |
| 403 | 3300045836 | Ga0466958_0045245 | Ga0466958_0045245_1507_2538 | 337 |
| 404 | 3300046452 | Ga0495617_001077 | Ga0495617_001077_4036_5073 | 337 |
| 405 | 3300046472 | Ga0495580_0009953 | Ga0495580_0009953_6063_7109 | 337 |
| 406 | 3300046473 | Ga0495582_0014476 | Ga0495582_0014476_2810_3856 | 337 |
| 407 | 3300046475 | Ga0495639_0006419 | Ga0495639_0006419_2177_3202 | 337 |
| 408 | 3300046491 | Ga0495584_0000006 | Ga0495584_0000006_153421_154458 | 337 |
| 409 | 3300046491 | Ga0495584_0016047 | Ga0495584_0016047_2648_3679 | 337 |
| 410 | 3300046491 | Ga0495584_0090365 | Ga0495584_0090365_130_1167 | 337 |
| 411 | 3300046492 | Ga0495585_0000193 | Ga0495585_0000193_60386_61423 | 337 |
| 412 | 3300046492 | Ga0495585_0019813 | Ga0495585_0019813_365_1420 | 337 |
| 413 | 3300046492 | Ga0495585_0058942 | Ga0495585_0058942_688_1725 | 337 |
| 414 | 3300046501 | Ga0495607_0021954 | Ga0495607_0021954_2888_3919 | 337 |
| 415 | 3300046513 | Ga0495616_0017562 | Ga0495616_0017562_1343_2380 | 337 |
| 416 | 3300046517 | Ga0495630_0142285 | Ga0495630_0142285_361_1407 | 337 |
| 417 | 3300046519 | Ga0495632_0003209 | Ga0495632_0003209_4308_5342 | 337 |
| 418 | 3300046522 | Ga0495643_0011322 | Ga0495643_0011322_646_1680 | 337 |
| 419 | 3300046523 | Ga0495644_0078111 | Ga0495644_0078111_93_1130 | 337 |
| 420 | 3300046524 | Ga0495648_0000109 | Ga0495648_0000109_25204_26241 | 337 |
| 421 | 3300046526 | Ga0495666_0004957 | Ga0495666_0004957_1528_2574 | 337 |
| 422 | 3300046526 | Ga0495666_0074991 | Ga0495666_0074991_223_1269 | 337 |
| 423 | 3300046528 | Ga0495642_0002554 | Ga0495642_0002554_4154_5191 | 337 |
| 424 | 3300046529 | Ga0495652_0029162 | Ga0495652_0029162_2794_3840 | 337 |
| 425 | 3300046531 | Ga0495665_0015420 | Ga0495665_0015420_2684_3730 | 337 |
| 426 | 3300046536 | Ga0495587_0124757 | Ga0495587_0124757_161_1207 | 337 |
| 427 | 3300046538 | Ga0495609_0000009 | Ga0495609_0000009_207622_208653 | 337 |
| 428 | 3300046542 | Ga0495597_0003348 | Ga0495597_0003348_566_1597 | 337 |
| 429 | 3300046558 | Ga0495633_0011966 | Ga0495633_0011966_3167_4222 | 337 |
| 430 | 3300046558 | Ga0495633_0017863 | Ga0495633_0017863_1394_2431 | 337 |
| 431 | 3300046642 | Ga0495634_0016338 | Ga0495634_0016338_3791_4837 | 337 |
| 432 | 3300046665 | Ga0495661_0000775 | Ga0495661_0000775_155_1186 | 337 |
| 433 | 3300046665 | Ga0495661_0002320 | Ga0495661_0002320_11496_12530 | 337 |
| 434 | 3300046665 | Ga0495661_0004592 | Ga0495661_0004592_4376_5431 | 337 |
| 435 | 3300046691 | Ga0495670_0000391 | Ga0495670_0000391_10583_11620 | 337 |
| 436 | 3300046691 | Ga0495670_0006577 | Ga0495670_0006577_4115_5170 | 337 |
| 437 | 3300046794 | Ga0495589_0000037 | Ga0495589_0000037_146210_147241 | 337 |
| 438 | 3300047317 | Ga0495604_0007219 | Ga0495604_0007219_4078_5124 | 337 |
| 439 | 3300047319 | Ga0495674_0003699 | Ga0495674_0003699_7617_8654 | 337 |
| 440 | 3300047321 | Ga0495676_0048580 | Ga0495676_0048580_921_1958 | 337 |
| 441 | 3300047323 | Ga0495683_0016553 | Ga0495683_0016553_2403_3440 | 337 |
| 442 | 3300047443 | Ga0495687_000024 | Ga0495687_000024_294673_295704 | 337 |
| 443 | 3300047445 | Ga0495677_0000011 | Ga0495677_0000011_2597_3628 | 337 |
| 444 | 3300047445 | Ga0495677_0005197 | Ga0495677_0005197_493_1527 | 337 |
| 445 | 3300047470 | Ga0495681_0013252 | Ga0495681_0013252_518_1573 | 337 |
| 446 | 3300048907 | Ga0496104_0087770 | Ga0496104_0087770_1495_2514 | 337 |
| 447 | 3300048910 | Ga0496107_0019561 | Ga0496107_0019561_180_1211 | 337 |
| 448 | 3300048917 | Ga0496114_0001006 | Ga0496114_0001006_485_1528 | 337 |
| 449 | 3300049822 | Ga0501035_0000965 | Ga0501035_0000965_1666_2697 | 337 |
| 450 | 3300049823 | Ga0501044_0053829 | Ga0501044_0053829_1871_2902 | 337 |
| 451 | 3300050492 | nmdc:mga0yw44_82186_c1 | nmdc:mga0yw44_82186_c1_331_1356 | 337 |
| 452 | iso_pu_bacteria | 2643221683 | 2644465349 | 337 |
| 453 | iso_pu_bacteria | 2846033681 | 2846033912 | 337 |
| 454 | iso_pu_bacteria | 2928115317 | 2928115760 | 337 |
| 455 | 3300003187 | JGI25151J46595_10000695 | JGI25151J46595_1000069510 | 338 |
| 456 | 3300005563 | Ga0068855_100219783 | Ga0068855_1002197833 | 338 |
| 457 | 3300021361 | Ga0213872_10005419 | Ga0213872_100054192 | 338 |
| 458 | 3300025294 | Ga0209025_1000029 | Ga0209025_1000029295 | 338 |
| 459 | 3300025949 | Ga0207667_10180512 | Ga0207667_101805123 | 338 |
| 460 | 3300031238 | Ga0265332_10000025 | Ga0265332_10000025112 | 338 |
| 461 | 3300031548 | Ga0307408_100125785 | Ga0307408_1001257853 | 338 |
| 462 | 3300037312 | Ga0395899_0033517 | Ga0395899_0033517_2389_3435 | 338 |
| 463 | 3300037418 | Ga0395900_0055423 | Ga0395900_0055423_776_1822 | 338 |
| 464 | 3300037418 | Ga0395900_0535016 | Ga0395900_0535016_10_1041 | 338 |
| 465 | 3300037466 | Ga0395898_0047293 | Ga0395898_0047293_1923_2969 | 338 |
| 466 | 3300037471 | Ga0395905_0266514 | Ga0395905_0266514_536_1582 | 338 |
| 467 | 3300038443 | Ga0395901_0594342 | Ga0395901_0594342_54_1100 | 338 |
| 468 | 3300039447 | Ga0436361_1141444 | Ga0436361_1141444_5520_6566 | 338 |
| 469 | 3300041997 | Ga0439431_0005850 | Ga0439431_0005850_351_1385 | 338 |
| 470 | 3300044684 | Ga0466966_0124428 | Ga0466966_0124428_327_1361 | 338 |
| 471 | 3300046499 | Ga0495594_0013415 | Ga0495594_0013415_409_1461 | 338 |
| 472 | 3300046506 | Ga0495583_0004346 | Ga0495583_0004346_5957_6997 | 338 |
| 473 | 3300046518 | Ga0495631_0030483 | Ga0495631_0030483_787_1827 | 338 |
| 474 | 3300046523 | Ga0495644_0010772 | Ga0495644_0010772_2455_3495 | 338 |
| 475 | 3300046526 | Ga0495666_0002144 | Ga0495666_0002144_958_2010 | 338 |
| 476 | 3300046557 | Ga0495622_0063771 | Ga0495622_0063771_316_1368 | 338 |
| 477 | 3300046665 | Ga0495661_0019139 | Ga0495661_0019139_673_1764 | 338 |
| 478 | 3300046665 | Ga0495661_0069328 | Ga0495661_0069328_867_1901 | 338 |
| 479 | 3300046674 | Ga0495588_0000077 | Ga0495588_0000077_127842_128876 | 338 |
| 480 | 3300046690 | Ga0495624_0006044 | Ga0495624_0006044_6881_7933 | 338 |
| 481 | 3300046794 | Ga0495589_0063178 | Ga0495589_0063178_526_1566 | 338 |
| 482 | 3300046810 | Ga0495660_0017308 | Ga0495660_0017308_2677_3717 | 338 |
| 483 | 3300047315 | Ga0495581_0017959 | Ga0495581_0017959_2666_3718 | 338 |
| 484 | 3300047445 | Ga0495677_0017429 | Ga0495677_0017429_315_1352 | 338 |
| 485 | 3300047470 | Ga0495681_0024658 | Ga0495681_0024658_889_1929 | 338 |
| 486 | 3300048091 | Ga0495626_0029165 | Ga0495626_0029165_127_1167 | 338 |
| 487 | 3300048912 | Ga0496109_0013420 | Ga0496109_0013420_5948_6988 | 338 |
| 488 | 3300049459 | Ga0495678_010969 | Ga0495678_010969_112_1152 | 338 |
| 489 | 3300050496 | nmdc:mga07m45_24274_c1 | nmdc:mga07m45_24274_c1_281_1327 | 338 |
| 490 | iso_pu_bacteria | 2738541307 | 2738881130 | 338 |
| 491 | iso_pu_bacteria | 2831265667 | 2831267864 | 338 |
| 492 | iso_pu_bacteria | 2831864461 | 2831868089 | 338 |
| 493 | iso_pu_bacteria | 2838054893 | 2838060194 | 338 |
| 494 | iso_pu_bacteria | 2886848708 | 2886849883 | 338 |
| 495 | iso_pu_bacteria | 2904449895 | 2904455283 | 338 |
| 496 | iso_pu_bacteria | 2904456579 | 2904461316 | 338 |
| 497 | 3300003781 | Ga0055536_1000480 | Ga0055536_10004802 | 339 |
| 498 | 3300003791 | Ga0055530_10002748 | Ga0055530_100027482 | 339 |
| 499 | 3300003792 | Ga0055540_1000290 | Ga0055540_100029015 | 339 |
| 500 | 3300003794 | Ga0055531_10000637 | Ga0055531_1000063719 | 339 |
| 501 | 3300005262 | Ga0065165_1000074 | Ga0065165_1000074124 | 339 |
| 502 | 3300005344 | Ga0070661_100070232 | Ga0070661_1000702322 | 339 |
| 503 | 3300005548 | Ga0070665_100217466 | Ga0070665_1002174662 | 339 |
| 504 | 3300005564 | Ga0070664_100077177 | Ga0070664_1000771772 | 339 |
| 505 | 3300005617 | Ga0068859_100024836 | Ga0068859_1000248365 | 339 |
| 506 | 3300005618 | Ga0068864_100038556 | Ga0068864_1000385565 | 339 |
| 507 | 3300005841 | Ga0068863_100053479 | Ga0068863_1000534792 | 339 |
| 508 | 3300006931 | Ga0097620_100024836 | Ga0097620_1000248365 | 339 |
| 509 | 3300009036 | Ga0105244_10014998 | Ga0105244_100149982 | 339 |
| 510 | 3300009098 | Ga0105245_10227229 | Ga0105245_102272292 | 339 |
| 511 | 3300009177 | Ga0105248_10187500 | Ga0105248_101875002 | 339 |
| 512 | 3300013308 | Ga0157375_10678468 | Ga0157375_106784681 | 339 |
| 513 | 3300014497 | Ga0182008_10006627 | Ga0182008_100066273 | 339 |
| 514 | 3300015261 | Ga0182006_1018608 | Ga0182006_10186084 | 339 |
| 515 | 3300021361 | Ga0213872_10022235 | Ga0213872_100222352 | 339 |
| 516 | 3300025292 | Ga0209676_1000254 | Ga0209676_100025499 | 339 |
| 517 | 3300025298 | Ga0209050_1001288 | Ga0209050_100128818 | 339 |
| 518 | 3300025303 | Ga0209051_1000073 | Ga0209051_1000073189 | 339 |
| 519 | 3300025304 | Ga0209257_1000139 | Ga0209257_100013976 | 339 |
| 520 | 3300025728 | Ga0207655_1005831 | Ga0207655_10058314 | 339 |
| 521 | 3300025927 | Ga0207687_10028216 | Ga0207687_100282164 | 339 |
| 522 | 3300026041 | Ga0207639_10087869 | Ga0207639_100878692 | 339 |
| 523 | 3300026088 | Ga0207641_10067281 | Ga0207641_100672814 | 339 |
| 524 | 3300026095 | Ga0207676_10019158 | Ga0207676_100191585 | 339 |
| 525 | 3300028379 | Ga0268266_10149694 | Ga0268266_101496942 | 339 |
| 526 | 3300031344 | Ga0265316_10020249 | Ga0265316_100202496 | 339 |
| 527 | 3300037471 | Ga0395905_0000898 | Ga0395905_0000898_31256_32290 | 339 |
| 528 | 3300039447 | Ga0436361_0314510 | Ga0436361_0314510_676_1713 | 339 |
| 529 | 3300042012 | Ga0439455_0006966 | Ga0439455_0006966_87_1124 | 339 |
| 530 | 3300042012 | Ga0439455_0021735 | Ga0439455_0021735_199_1236 | 339 |
| 531 | 3300044693 | Ga0466961_0003957 | Ga0466961_0003957_6758_7819 | 339 |
| 532 | 3300044706 | Ga0466964_0002682 | Ga0466964_0002682_4226_5263 | 339 |
| 533 | 3300044735 | Ga0466968_0006640 | Ga0466968_0006640_2129_3166 | 339 |
| 534 | 3300044765 | Ga0466970_0051171 | Ga0466970_0051171_1052_2089 | 339 |
| 535 | 3300044901 | Ga0466960_0074756 | Ga0466960_0074756_410_1447 | 339 |
| 536 | 3300045051 | Ga0451576_0394068 | Ga0451576_0394068_10_1062 | 339 |
| 537 | 3300045976 | Ga0466967_0187315 | Ga0466967_0187315_159_1196 | 339 |
| 538 | 3300046474 | Ga0495605_0001736 | Ga0495605_0001736_9351_10388 | 339 |
| 539 | 3300046474 | Ga0495605_0005479 | Ga0495605_0005479_2913_3959 | 339 |
| 540 | 3300046492 | Ga0495585_0000926 | Ga0495585_0000926_9299_10342 | 339 |
| 541 | 3300046501 | Ga0495607_0012631 | Ga0495607_0012631_1607_2644 | 339 |
| 542 | 3300046501 | Ga0495607_0017265 | Ga0495607_0017265_2176_3213 | 339 |
| 543 | 3300046519 | Ga0495632_0000062 | Ga0495632_0000062_2120_3166 | 339 |
| 544 | 3300046524 | Ga0495648_0018169 | Ga0495648_0018169_1401_2438 | 339 |
| 545 | 3300046616 | Ga0495668_0020397 | Ga0495668_0020397_1031_2080 | 339 |
| 546 | 3300046665 | Ga0495661_0009659 | Ga0495661_0009659_2754_3791 | 339 |
| 547 | 3300046665 | Ga0495661_0074083 | Ga0495661_0074083_542_1579 | 339 |
| 548 | 3300046794 | Ga0495589_0001412 | Ga0495589_0001412_9163_10200 | 339 |
| 549 | 3300046810 | Ga0495660_0000178 | Ga0495660_0000178_14967_16004 | 339 |
| 550 | 3300046810 | Ga0495660_0019036 | Ga0495660_0019036_1613_2650 | 339 |
| 551 | 3300047320 | Ga0495672_0017552 | Ga0495672_0017552_983_2020 | 339 |
| 552 | 3300047323 | Ga0495683_0028210 | Ga0495683_0028210_1171_2208 | 339 |
| 553 | 3300047443 | Ga0495687_005014 | Ga0495687_005014_4040_5077 | 339 |
| 554 | 3300047445 | Ga0495677_0001586 | Ga0495677_0001586_2819_3856 | 339 |
| 555 | 3300048091 | Ga0495626_0000016 | Ga0495626_0000016_67844_68881 | 339 |
| 556 | 3300048091 | Ga0495626_0063955 | Ga0495626_0063955_169_1215 | 339 |
| 557 | 3300048905 | Ga0496102_0000340 | Ga0496102_0000340_8245_9276 | 339 |
| 558 | 3300048905 | Ga0496102_0219586 | Ga0496102_0219586_161_1195 | 339 |
| 559 | 3300048920 | Ga0496117_0016278 | Ga0496117_0016278_2101_3135 | 339 |
| 560 | 3300048921 | Ga0496118_0017574 | Ga0496118_0017574_2523_3557 | 339 |
| 561 | 3300048927 | Ga0496124_0123045 | Ga0496124_0123045_169_1203 | 339 |
| 562 | 3300003761 | Ga0055535_1000200 | Ga0055535_100020050 | 340 |
| 563 | 3300003762 | Ga0055542_1000033 | Ga0055542_1000033237 | 340 |
| 564 | 3300005367 | Ga0070667_100370776 | Ga0070667_1003707762 | 340 |
| 565 | 3300005577 | Ga0068857_100232304 | Ga0068857_1002323042 | 340 |
| 566 | 3300010375 | Ga0105239_10025933 | Ga0105239_100259336 | 340 |
| 567 | 3300017792 | Ga0163161_10000521 | Ga0163161_100005217 | 340 |
| 568 | 3300025228 | Ga0209672_102333 | Ga0209672_1023332 | 340 |
| 569 | 3300025229 | Ga0209147_100572 | Ga0209147_10057218 | 340 |
| 570 | 3300025242 | Ga0209258_100089 | Ga0209258_100089237 | 340 |
| 571 | 3300025254 | Ga0209148_1000097 | Ga0209148_1000097237 | 340 |
| 572 | 3300025302 | Ga0207426_1026659 | Ga0207426_10266592 | 340 |
| 573 | 3300025933 | Ga0207706_10055603 | Ga0207706_100556033 | 340 |
| 574 | 3300025939 | Ga0207665_10215833 | Ga0207665_102158333 | 340 |
| 575 | 3300025949 | Ga0207667_10131082 | Ga0207667_101310822 | 340 |
| 576 | 3300026116 | Ga0207674_10266131 | Ga0207674_102661312 | 340 |
| 577 | 3300027614 | Ga0209970_1004268 | Ga0209970_10042682 | 340 |
| 578 | 3300028794 | Ga0307515_10013045 | Ga0307515_100130453 | 340 |
| 579 | 3300030522 | Ga0307512_10020082 | Ga0307512_100200826 | 340 |
| 580 | 3300030732 | Ga0316176_1086224 | Ga0316176_10862241 | 340 |
| 581 | 3300030733 | Ga0314311_1034637 | Ga0314311_103463713 | 340 |
| 582 | 3300030734 | Ga0316179_1018535 | Ga0316179_10185352 | 340 |
| 583 | 3300030735 | Ga0316178_1014198 | Ga0316178_10141984 | 340 |
| 584 | 3300030736 | Ga0316180_1096139 | Ga0316180_10961394 | 340 |
| 585 | 3300030742 | Ga0316183_1198096 | Ga0316183_11980966 | 340 |
| 586 | 3300030745 | Ga0316182_1216334 | Ga0316182_12163343 | 340 |
| 587 | 3300031507 | Ga0307509_10054343 | Ga0307509_100543432 | 340 |
| 588 | 3300031616 | Ga0307508_10004265 | Ga0307508_100042654 | 340 |
| 589 | 3300031649 | Ga0307514_10047549 | Ga0307514_100475492 | 340 |
| 590 | 3300031731 | Ga0307405_10109230 | Ga0307405_101092302 | 340 |
| 591 | 3300031911 | Ga0307412_10108834 | Ga0307412_101088342 | 340 |
| 592 | 3300032005 | Ga0307411_10256928 | Ga0307411_102569281 | 340 |
| 593 | 3300033179 | Ga0307507_10178460 | Ga0307507_101784602 | 340 |
| 594 | 3300037312 | Ga0395899_0013799 | Ga0395899_0013799_2583_3641 | 340 |
| 595 | 3300037466 | Ga0395898_0014930 | Ga0395898_0014930_4476_5534 | 340 |
| 596 | 3300042002 | Ga0439442_001739 | Ga0439442_001739_634_1668 | 340 |
| 597 | 3300042004 | Ga0439445_0010307 | Ga0439445_0010307_934_1968 | 340 |
| 598 | 3300042006 | Ga0439432_020657 | Ga0439432_020657_937_1971 | 340 |
| 599 | 3300042007 | Ga0439449_0005663 | Ga0439449_0005663_1243_2277 | 340 |
| 600 | 3300042014 | Ga0439457_004992 | Ga0439457_004992_1656_2690 | 340 |
| 601 | 3300042134 | Ga0450898_016813 | Ga0450898_016813_76_1113 | 340 |
| 602 | 3300042156 | Ga0439446_0049382 | Ga0439446_0049382_176_1210 | 340 |
| 603 | 3300042435 | Ga0439434_0067509 | Ga0439434_0067509_11_1045 | 340 |
| 604 | 3300044901 | Ga0466960_0101778 | Ga0466960_0101778_292_1329 | 340 |
| 605 | 3300046491 | Ga0495584_0008112 | Ga0495584_0008112_3917_4966 | 340 |
| 606 | 3300046492 | Ga0495585_0006493 | Ga0495585_0006493_4705_5751 | 340 |
| 607 | 3300046492 | Ga0495585_0020463 | Ga0495585_0020463_2632_3678 | 340 |
| 608 | 3300046507 | Ga0495606_0022396 | Ga0495606_0022396_1516_2565 | 340 |
| 609 | 3300046513 | Ga0495616_0003579 | Ga0495616_0003579_695_1732 | 340 |
| 610 | 3300046518 | Ga0495631_0000119 | Ga0495631_0000119_33037_34074 | 340 |
| 611 | 3300046525 | Ga0495663_0001540 | Ga0495663_0001540_873_1922 | 340 |
| 612 | 3300046528 | Ga0495642_0109773 | Ga0495642_0109773_13_1068 | 340 |
| 613 | 3300046542 | Ga0495597_0008429 | Ga0495597_0008429_522_1568 | 340 |
| 614 | 3300046615 | Ga0495656_0000766 | Ga0495656_0000766_9222_10271 | 340 |
| 615 | 3300046615 | Ga0495656_0001204 | Ga0495656_0001204_6560_7594 | 340 |
| 616 | 3300046660 | Ga0495625_0105592 | Ga0495625_0105592_460_1497 | 340 |
| 617 | 3300046691 | Ga0495670_0070970 | Ga0495670_0070970_679_1713 | 340 |
| 618 | 3300047443 | Ga0495687_001539 | Ga0495687_001539_16035_17084 | 340 |
| 619 | 3300047445 | Ga0495677_0008497 | Ga0495677_0008497_2357_3406 | 340 |
| 620 | 3300048924 | Ga0496121_0006225 | Ga0496121_0006225_10146_11183 | 340 |
| 621 | 3300048927 | Ga0496124_0018645 | Ga0496124_0018645_3916_4956 | 340 |
| 622 | 3300049662 | Ga0501222_002961 | Ga0501222_002961_655_1707 | 340 |
| 623 | 3300049679 | Ga0501249_023155 | Ga0501249_023155_189_1265 | 340 |
| 624 | 3300053088 | Ga0500644_0009212 | Ga0500644_0009212_1401_2447 | 340 |
| 625 | 3300053134 | Ga0500658_0011335 | Ga0500658_0011335_1449_2486 | 340 |
| 626 | 3300053139 | Ga0500568_0001730 | Ga0500568_0001730_1051_2088 | 340 |
| 627 | 3300003187 | JGI25151J46595_10000562 | JGI25151J46595_1000056228 | 341 |
| 628 | 3300003322 | rootL2_10000049 | rootL2_1000004930 | 341 |
| 629 | 3300003771 | Ga0055526_1003696 | Ga0055526_10036968 | 341 |
| 630 | 3300003775 | Ga0055524_1000477 | Ga0055524_100047721 | 341 |
| 631 | 3300003775 | Ga0055524_1008681 | Ga0055524_10086813 | 341 |
| 632 | 3300003794 | Ga0055531_10005446 | Ga0055531_100054462 | 341 |
| 633 | 3300003794 | Ga0055531_10006167 | Ga0055531_100061673 | 341 |
| 634 | 3300005262 | Ga0065165_1000418 | Ga0065165_100041867 | 341 |
| 635 | 3300006353 | Ga0075370_10002087 | Ga0075370_100020873 | 341 |
| 636 | 3300006844 | Ga0075428_100542574 | Ga0075428_1005425741 | 341 |
| 637 | 3300006944 | Ga0099823_1000304 | Ga0099823_100030426 | 341 |
| 638 | 3300012497 | Ga0157319_1000013 | Ga0157319_100001387 | 341 |
| 639 | 3300025273 | Ga0209673_1005732 | Ga0209673_10057324 | 341 |
| 640 | 3300025273 | Ga0209673_1020994 | Ga0209673_10209942 | 341 |
| 641 | 3300025294 | Ga0209025_1028185 | Ga0209025_10281852 | 341 |
| 642 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003298 | 341 |
| 643 | 3300025298 | Ga0209050_1005937 | Ga0209050_10059375 | 341 |
| 644 | 3300025299 | Ga0209256_1000301 | Ga0209256_100030125 | 341 |
| 645 | 3300025299 | Ga0209256_1001182 | Ga0209256_100118228 | 341 |
| 646 | 3300025303 | Ga0209051_1001597 | Ga0209051_10015972 | 341 |
| 647 | 3300025304 | Ga0209257_1001557 | Ga0209257_100155729 | 341 |
| 648 | 3300025304 | Ga0209257_1003149 | Ga0209257_100314915 | 341 |
| 649 | 3300027296 | Ga0209389_1033704 | Ga0209389_10337042 | 341 |
| 650 | 3300033180 | Ga0307510_10031902 | Ga0307510_100319023 | 341 |
| 651 | 3300037312 | Ga0395899_0246202 | Ga0395899_0246202_119_1162 | 341 |
| 652 | 3300037418 | Ga0395900_0020710 | Ga0395900_0020710_1354_2397 | 341 |
| 653 | 3300037471 | Ga0395905_0071574 | Ga0395905_0071574_99_1160 | 341 |
| 654 | 3300037471 | Ga0395905_0162956 | Ga0395905_0162956_809_1870 | 341 |
| 655 | 3300042002 | Ga0439442_006899 | Ga0439442_006899_759_1820 | 341 |
| 656 | 3300042125 | Ga0450923_006691 | Ga0450923_006691_828_1889 | 341 |
| 657 | 3300042184 | Ga0450908_004485 | Ga0450908_004485_159_1220 | 341 |
| 658 | 3300044684 | Ga0466966_0027339 | Ga0466966_0027339_1587_2630 | 341 |
| 659 | 3300044694 | Ga0466963_0122718 | Ga0466963_0122718_41_1096 | 341 |
| 660 | 3300045049 | Ga0466959_0022312 | Ga0466959_0022312_524_1597 | 341 |
| 661 | 3300045049 | Ga0466959_0029051 | Ga0466959_0029051_235_1278 | 341 |
| 662 | 3300045976 | Ga0466967_0217474 | Ga0466967_0217474_703_1746 | 341 |
| 663 | 3300046460 | Ga0495638_0074153 | Ga0495638_0074153_663_1712 | 341 |
| 664 | 3300046474 | Ga0495605_0076511 | Ga0495605_0076511_317_1366 | 341 |
| 665 | 3300046491 | Ga0495584_0014210 | Ga0495584_0014210_1589_2638 | 341 |
| 666 | 3300046491 | Ga0495584_0061528 | Ga0495584_0061528_592_1641 | 341 |
| 667 | 3300046492 | Ga0495585_0000282 | Ga0495585_0000282_32517_33566 | 341 |
| 668 | 3300046492 | Ga0495585_0004871 | Ga0495585_0004871_1792_2844 | 341 |
| 669 | 3300046492 | Ga0495585_0011039 | Ga0495585_0011039_1727_2776 | 341 |
| 670 | 3300046500 | Ga0495596_0003235 | Ga0495596_0003235_3603_4652 | 341 |
| 671 | 3300046500 | Ga0495596_0011291 | Ga0495596_0011291_2375_3424 | 341 |
| 672 | 3300046501 | Ga0495607_0032355 | Ga0495607_0032355_1697_2746 | 341 |
| 673 | 3300046518 | Ga0495631_0004822 | Ga0495631_0004822_1766_2815 | 341 |
| 674 | 3300046519 | Ga0495632_0000235 | Ga0495632_0000235_50872_51921 | 341 |
| 675 | 3300046522 | Ga0495643_0021646 | Ga0495643_0021646_720_1802 | 341 |
| 676 | 3300046523 | Ga0495644_0001274 | Ga0495644_0001274_8337_9386 | 341 |
| 677 | 3300046526 | Ga0495666_0066774 | Ga0495666_0066774_458_1510 | 341 |
| 678 | 3300046528 | Ga0495642_0000196 | Ga0495642_0000196_7032_8081 | 341 |
| 679 | 3300046531 | Ga0495665_0051900 | Ga0495665_0051900_138_1187 | 341 |
| 680 | 3300046535 | Ga0495586_0019226 | Ga0495586_0019226_455_1513 | 341 |
| 681 | 3300046538 | Ga0495609_0004785 | Ga0495609_0004785_5726_6775 | 341 |
| 682 | 3300046538 | Ga0495609_0033096 | Ga0495609_0033096_182_1231 | 341 |
| 683 | 3300046538 | Ga0495609_0033275 | Ga0495609_0033275_717_1766 | 341 |
| 684 | 3300046558 | Ga0495633_0070199 | Ga0495633_0070199_184_1233 | 341 |
| 685 | 3300046616 | Ga0495668_0007275 | Ga0495668_0007275_6005_7063 | 341 |
| 686 | 3300046642 | Ga0495634_0062064 | Ga0495634_0062064_49_1110 | 341 |
| 687 | 3300046648 | Ga0495611_0005058 | Ga0495611_0005058_61_1110 | 341 |
| 688 | 3300046648 | Ga0495611_0010726 | Ga0495611_0010726_2766_3815 | 341 |
| 689 | 3300046665 | Ga0495661_0009476 | Ga0495661_0009476_5312_6364 | 341 |
| 690 | 3300046674 | Ga0495588_0092289 | Ga0495588_0092289_58_1107 | 341 |
| 691 | 3300046684 | Ga0495669_0047393 | Ga0495669_0047393_264_1313 | 341 |
| 692 | 3300046691 | Ga0495670_0007426 | Ga0495670_0007426_2657_3709 | 341 |
| 693 | 3300046691 | Ga0495670_0019960 | Ga0495670_0019960_1830_2879 | 341 |
| 694 | 3300046692 | Ga0495671_0042124 | Ga0495671_0042124_735_1784 | 341 |
| 695 | 3300046694 | Ga0495649_0004293 | Ga0495649_0004293_1577_2659 | 341 |
| 696 | 3300046809 | Ga0495600_0027955 | Ga0495600_0027955_784_1845 | 341 |
| 697 | 3300046810 | Ga0495660_0009961 | Ga0495660_0009961_3058_4107 | 341 |
| 698 | 3300047318 | Ga0495636_0002507 | Ga0495636_0002507_3837_4886 | 341 |
| 699 | 3300047444 | Ga0495675_0044687 | Ga0495675_0044687_1385_2461 | 341 |
| 700 | 3300047445 | Ga0495677_0032515 | Ga0495677_0032515_124_1173 | 341 |
| 701 | 3300048091 | Ga0495626_0008080 | Ga0495626_0008080_100_1149 | 341 |
| 702 | 3300048091 | Ga0495626_0012782 | Ga0495626_0012782_2287_3369 | 341 |
| 703 | 3300048091 | Ga0495626_0031428 | Ga0495626_0031428_1157_2206 | 341 |
| 704 | 3300048091 | Ga0495626_0050406 | Ga0495626_0050406_602_1651 | 341 |
| 705 | 3300048905 | Ga0496102_0059573 | Ga0496102_0059573_1443_2486 | 341 |
| 706 | 3300048918 | Ga0496115_0106296 | Ga0496115_0106296_58_1107 | 341 |
| 707 | 3300048919 | Ga0496116_0013225 | Ga0496116_0013225_3912_4976 | 341 |
| 708 | 3300048920 | Ga0496117_0039011 | Ga0496117_0039011_1509_2573 | 341 |
| 709 | 3300048924 | Ga0496121_0063420 | Ga0496121_0063420_23_1087 | 341 |
| 710 | 3300048925 | Ga0496122_0016510 | Ga0496122_0016510_3716_4759 | 341 |
| 711 | 3300048927 | Ga0496124_0020169 | Ga0496124_0020169_1341_2414 | 341 |
| 712 | 3300048927 | Ga0496124_0037480 | Ga0496124_0037480_2621_3664 | 341 |
| 713 | 3300048928 | Ga0496125_0150588 | Ga0496125_0150588_254_1297 | 341 |
| 714 | 3300049459 | Ga0495678_007348 | Ga0495678_007348_3507_4556 | 341 |
| 715 | 3300049759 | Ga0501262_000019 | Ga0501262_000019_13959_15038 | 341 |
| 716 | 3300053154 | Ga0500619_000026 | Ga0500619_000026_32137_33183 | 341 |
| 717 | 3300061719 | Ga0466962_0110180 | Ga0466962_0110180_157_1200 | 341 |
| 718 | 3300001979 | JGI24740J21852_10041523 | JGI24740J21852_100415231 | 342 |
| 719 | 3300001989 | JGI24739J22299_10009379 | JGI24739J22299_100093792 | 342 |
| 720 | 3300002773 | JGI25152J39213_1000584 | JGI25152J39213_100058413 | 342 |
| 721 | 3300002773 | JGI25152J39213_1005680 | JGI25152J39213_10056802 | 342 |
| 722 | 3300002774 | JGI25150J39212_1000579 | JGI25150J39212_100057913 | 342 |
| 723 | 3300002987 | JGI25159J45721_1000503 | JGI25159J45721_100050317 | 342 |
| 724 | 3300002987 | JGI25159J45721_1000632 | JGI25159J45721_100063214 | 342 |
| 725 | 3300002987 | JGI25159J45721_1013628 | JGI25159J45721_10136282 | 342 |
| 726 | 3300003187 | JGI25151J46595_10000975 | JGI25151J46595_1000097513 | 342 |
| 727 | 3300003187 | JGI25151J46595_10035289 | JGI25151J46595_100352892 | 342 |
| 728 | 3300003215 | JGI25153J46596_10000825 | JGI25153J46596_1000082513 | 342 |
| 729 | 3300003215 | JGI25153J46596_10013735 | JGI25153J46596_100137352 | 342 |
| 730 | 3300003354 | JGI25160J50197_1000554 | JGI25160J50197_10005544 | 342 |
| 731 | 3300003354 | JGI25160J50197_1003558 | JGI25160J50197_10035582 | 342 |
| 732 | 3300003374 | JGI25161J50226_1000522 | JGI25161J50226_100052210 | 342 |
| 733 | 3300003374 | JGI25161J50226_1001566 | JGI25161J50226_10015664 | 342 |
| 734 | 3300003771 | Ga0055526_1000577 | Ga0055526_100057720 | 342 |
| 735 | 3300003771 | Ga0055526_1005184 | Ga0055526_100518412 | 342 |
| 736 | 3300003773 | Ga0055537_1000411 | Ga0055537_100041113 | 342 |
| 737 | 3300003775 | Ga0055524_1000537 | Ga0055524_100053720 | 342 |
| 738 | 3300003775 | Ga0055524_1003784 | Ga0055524_10037843 | 342 |
| 739 | 3300003781 | Ga0055536_1000561 | Ga0055536_100056120 | 342 |
| 740 | 3300003784 | Ga0055534_1000444 | Ga0055534_100044414 | 342 |
| 741 | 3300003790 | Ga0055528_1000568 | Ga0055528_100056813 | 342 |
| 742 | 3300003790 | Ga0055528_1023213 | Ga0055528_10232132 | 342 |
| 743 | 3300003791 | Ga0055530_10000394 | Ga0055530_100003948 | 342 |
| 744 | 3300003792 | Ga0055540_1000682 | Ga0055540_100068220 | 342 |
| 745 | 3300003792 | Ga0055540_1002424 | Ga0055540_10024244 | 342 |
| 746 | 3300003792 | Ga0055540_1012200 | Ga0055540_10122001 | 342 |
| 747 | 3300003794 | Ga0055531_10001075 | Ga0055531_100010755 | 342 |
| 748 | 3300003794 | Ga0055531_10001898 | Ga0055531_1000189811 | 342 |
| 749 | 3300004625 | Ga0055543_1000371 | Ga0055543_100037120 | 342 |
| 750 | 3300004625 | Ga0055543_1003773 | Ga0055543_10037735 | 342 |
| 751 | 3300005262 | Ga0065165_1001855 | Ga0065165_100185514 | 342 |
| 752 | 3300005539 | Ga0068853_100009767 | Ga0068853_1000097672 | 342 |
| 753 | 3300006038 | Ga0075365_10154889 | Ga0075365_101548892 | 342 |
| 754 | 3300006186 | Ga0075369_10076086 | Ga0075369_100760862 | 342 |
| 755 | 3300006353 | Ga0075370_10015441 | Ga0075370_100154413 | 342 |
| 756 | 3300013100 | Ga0157373_10142036 | Ga0157373_101420362 | 342 |
| 757 | 3300015261 | Ga0182006_1002609 | Ga0182006_100260910 | 342 |
| 758 | 3300025208 | Ga0209436_102113 | Ga0209436_1021134 | 342 |
| 759 | 3300025208 | Ga0209436_102781 | Ga0209436_1027815 | 342 |
| 760 | 3300025245 | Ga0207425_1000394 | Ga0207425_100039413 | 342 |
| 761 | 3300025245 | Ga0207425_1001018 | Ga0207425_100101812 | 342 |
| 762 | 3300025258 | Ga0209129_1000033 | Ga0209129_1000033101 | 342 |
| 763 | 3300025258 | Ga0209129_1003556 | Ga0209129_10035563 | 342 |
| 764 | 3300025263 | Ga0209565_1000164 | Ga0209565_100016451 | 342 |
| 765 | 3300025263 | Ga0209565_1002085 | Ga0209565_10020856 | 342 |
| 766 | 3300025273 | Ga0209673_1000185 | Ga0209673_100018545 | 342 |
| 767 | 3300025273 | Ga0209673_1000344 | Ga0209673_100034452 | 342 |
| 768 | 3300025284 | Ga0209130_1000663 | Ga0209130_100066320 | 342 |
| 769 | 3300025284 | Ga0209130_1001446 | Ga0209130_10014463 | 342 |
| 770 | 3300025291 | Ga0209675_1000550 | Ga0209675_100055017 | 342 |
| 771 | 3300025291 | Ga0209675_1002413 | Ga0209675_10024138 | 342 |
| 772 | 3300025292 | Ga0209676_1000179 | Ga0209676_100017924 | 342 |
| 773 | 3300025292 | Ga0209676_1002371 | Ga0209676_100237110 | 342 |
| 774 | 3300025294 | Ga0209025_1002083 | Ga0209025_100208311 | 342 |
| 775 | 3300025294 | Ga0209025_1014574 | Ga0209025_10145741 | 342 |
| 776 | 3300025295 | Ga0209564_1000317 | Ga0209564_100031762 | 342 |
| 777 | 3300025295 | Ga0209564_1000538 | Ga0209564_100053845 | 342 |
| 778 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027101 | 342 |
| 779 | 3300025297 | Ga0209758_1004866 | Ga0209758_100486612 | 342 |
| 780 | 3300025298 | Ga0209050_1000172 | Ga0209050_1000172127 | 342 |
| 781 | 3300025299 | Ga0209256_1000069 | Ga0209256_100006966 | 342 |
| 782 | 3300025299 | Ga0209256_1000261 | Ga0209256_100026162 | 342 |
| 783 | 3300025302 | Ga0207426_1000027 | Ga0207426_100002761 | 342 |
| 784 | 3300025302 | Ga0207426_1000115 | Ga0207426_1000115119 | 342 |
| 785 | 3300025303 | Ga0209051_1000046 | Ga0209051_1000046127 | 342 |
| 786 | 3300025303 | Ga0209051_1000979 | Ga0209051_100097928 | 342 |
| 787 | 3300025304 | Ga0209257_1000716 | Ga0209257_100071622 | 342 |
| 788 | 3300025304 | Ga0209257_1002176 | Ga0209257_100217611 | 342 |
| 789 | 3300031901 | Ga0307406_10001056 | Ga0307406_100010564 | 342 |
| 790 | 3300037471 | Ga0395905_0000353 | Ga0395905_0000353_25757_26812 | 342 |
| 791 | 3300044656 | Ga0466969_0004479 | Ga0466969_0004479_4713_5801 | 342 |
| 792 | 3300044683 | Ga0466965_0018148 | Ga0466965_0018148_452_1540 | 342 |
| 793 | 3300044684 | Ga0466966_0014676 | Ga0466966_0014676_2489_3577 | 342 |
| 794 | 3300044842 | Ga0466957_0003927 | Ga0466957_0003927_3470_4558 | 342 |
| 795 | 3300045049 | Ga0466959_0005277 | Ga0466959_0005277_1047_2135 | 342 |
| 796 | 3300048920 | Ga0496117_0020552 | Ga0496117_0020552_2044_3102 | 342 |
| 797 | 3300048921 | Ga0496118_0010315 | Ga0496118_0010315_4471_5529 | 342 |
| 798 | 3300048928 | Ga0496125_0046039 | Ga0496125_0046039_2361_3419 | 342 |
| 799 | 3300050489 | nmdc:mga03683_3138_c1 | nmdc:mga03683_3138_c1_662_1717 | 342 |
| 800 | 3300050489 | nmdc:mga03683_83793_c1 | nmdc:mga03683_83793_c1_152_1216 | 342 |
| 801 | 3300050496 | nmdc:mga07m45_65905_c1 | nmdc:mga07m45_65905_c1_788_1828 | 342 |
| 802 | 3300061719 | Ga0466962_0007392 | Ga0466962_0007392_3718_4806 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rfa-assembly2.cif.gz_A | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.8394 | 1 | 314 |
| 3rfa-assembly1.cif.gz_B | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.8319 | 1 | 340 |
| 6fz6-assembly2.cif.gz_B | crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus | 0.8318 | 1 | 327 |
| 4pl1-assembly2.cif.gz_A | x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine | 0.8312 | 1 | 310 |
| 3rfa-assembly1.cif.gz_B | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.8297 | 1 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54J76_110_396_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9309 | 64 | 329 | 3.20.20.70 |
| af_F4IVY6_128_412_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9235 | 64 | 325 | 3.20.20.70 |
| af_A0A1D6MYU6_82_194_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9231 | 97 | 199 | 3.20.20.70 |
| af_A0A1D6G3V2_170_411_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.915 | 102 | 325 | 3.20.20.70 |
| 6fz6B02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9116 | 63 | 327 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A109D0J5-F1-model_v4 | deleted | 0.9968 | 1 | 246 |
|
| AF-A0A109D0J5-F1-model_v4 | deleted | 0.9928 | 1 | 246 |
|
| AF-A0A370FJC7-F1-model_v4 | 23S rRNA (Adenine2503-C2)-methyltransferase | 0.988 | 1 | 329 |
GO:0005737
GO:0008173 GO:0030488 GO:0046872 GO:0051539 GO:0070475 |
| AF-A0A6L5CA67-F1-model_v4 | deleted | 0.9873 | 1 | 309 |
|
| AF-A0A1G8EU35-F1-model_v4 | 23S rRNA (Adenine2503-C2)-methyltransferase | 0.9862 | 1 | 332 |
GO:0005737
GO:0008173 GO:0030488 GO:0046872 GO:0051539 GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar