F481422

General Info

Members Datasets Scaffolds Average Seq Length
801 577 500 205

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0012282|Ga0439462_0012282_1506_2135
Length 181
Sequence MSESIALTRADGSPVFIDTTGQHHPQNGTLFGFWLYLLSDLMIFACLFATYGVLGRSYAAGPSGADLFDLSLVALNTAILLLSSITYGFAMIAMQFAHLIHLGAGPQRSAFLSSFFALVGTHGLHVSFGIIWLVTLMVQVAKYGLTAANQRRLFCLSMFWHFLDVVWIGVFTFVYLMGVLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
12 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2519899620 Rhizobium sp. Pop5 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
26 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
27 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
28 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
29 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
30 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
31 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
32 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
33 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
34 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
35 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
36 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
37 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
38 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
39 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
40 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
41 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
42 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
43 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
44 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
45 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
46 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
47 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
48 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
49 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
50 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
51 2643221557 Ensifer sp. Root558 Isolate Unclassified
52 2643221558 Rhizobium sp. Root149 Isolate Unclassified
53 2643221599 Rhizobium sp. Root708 Isolate Unclassified
54 2643221607 Rhizobium sp. Root73 Isolate Unclassified
55 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
56 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
57 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
58 2643221668 Ensifer sp. Root423 Isolate Unclassified
59 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
60 2643221718 Rhizobium sp. Root268 Isolate Unclassified
61 2643221723 Ensifer sp. Root278 Isolate Unclassified
62 2718217882 Rhizobium sp. N741 Isolate Nodule
63 2718217927 Rhizobium sp. N324 Isolate Nodule
64 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
65 2718218009 Rhizobium sp. N561 Isolate Nodule
66 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
67 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
68 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
69 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
70 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
71 2718218363 Rhizobium sp. N113 Isolate Nodule
72 2718218365 Rhizobium sp. N731 Isolate Nodule
73 2718218366 Rhizobium sp. N621 Isolate Nodule
74 2718218423 Rhizobium sp. N941 Isolate Nodule
75 2721755514 Rhizobium sp. N6212 Isolate Nodule
76 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
77 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
78 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
79 2721755809 Rhizobium sp. N541 Isolate Nodule
80 2721755810 Rhizobium sp. N871 Isolate Nodule
81 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
82 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
83 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
84 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
85 2728369365 Rhizobium sp. N1341 Isolate Nodule
86 2728369397 Rhizobium sp. N1314 Isolate Nodule
87 2738541293 Rhizobium sp. GV031 Isolate Unclassified
88 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
89 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
90 2738543012 Acidovorax sp. CF301 Isolate Unclassified
91 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
92 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
93 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
94 2791355256 Rhizobium sp. M10 Isolate Nodule
95 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
96 2791355260 Rhizobium sp. L9 Isolate Nodule
97 2791355261 Rhizobium sp. J15 Isolate Nodule
98 2791355262 Rhizobium sp. M1 Isolate Nodule
99 2791355264 Rhizobium sp. S9 Isolate Nodule
100 2791355265 Rhizobium sp. H4 Isolate Nodule
101 2791355266 Rhizobium sp. L43 Isolate Nodule
102 2791355267 Rhizobium sp. L18 Isolate Nodule
103 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
104 2802429633 Rhizobium anhuiense J3 Isolate Nodule
105 2802429634 Rhizobium anhuiense S10 Isolate Nodule
106 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
107 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
108 2802429637 Rhizobium anhuiense C15 Isolate Nodule
109 2816332133 Acidovorax radicis 2721A Isolate Unclassified
110 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
111 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
112 2831864461 Roseateles noduli HZ7 Isolate Nodule
113 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
114 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
115 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
116 2838048938 Rhizobium pisi 27/80 Isolate Nodule
117 2838061910 Rhizobium phaseoli L15 Isolate Nodule
118 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
119 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
120 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
121 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
122 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
123 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
124 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
125 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
126 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
127 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
128 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
129 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
130 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
131 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
132 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
133 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
134 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
135 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
136 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
137 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
138 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
139 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
140 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
141 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
142 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
143 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
144 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
145 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
146 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
147 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
148 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
149 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
150 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
151 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
152 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
153 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
154 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
155 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
156 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
157 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
158 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
159 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
160 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
161 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
162 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
163 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
164 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
165 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
166 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
167 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
168 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
169 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
170 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
171 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
172 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
173 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
174 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
175 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
176 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
177 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
178 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
179 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
180 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
181 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
182 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
183 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
184 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
185 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
186 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
187 2842733646 Variovorax sp. R-72446 Isolate Unclassified
188 2842747753 Variovorax sp. R-72060 Isolate Unclassified
189 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
190 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
191 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
192 2849560528 Caulobacter zeae 410 Isolate Unclassified
193 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
194 2851153111 Caulobacter radicis 736 Isolate Unclassified
195 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
196 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
197 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
198 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
199 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
200 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
201 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
202 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
203 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
204 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
205 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
206 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
207 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
208 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
209 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
210 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
211 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
212 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
213 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
214 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
215 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
216 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
217 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
218 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
219 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
220 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
221 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
222 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
223 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
224 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
225 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
226 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
227 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
228 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
229 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
230 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
231 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
232 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
233 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
234 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
235 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
236 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
237 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
238 2933599457 Rhizobium phaseoli M3 Isolate Nodule
239 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
240 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
241 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
242 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
243 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
244 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
245 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
246 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
247 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
248 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
249 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
250 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
251 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
252 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
253 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
254 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
255 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
256 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
257 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
258 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
259 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
260 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
261 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
262 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
263 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
264 2996893221 Rhizobium sp. R635 Isolate Nodule
265 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
266 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
267 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
268 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
269 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
270 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
271 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
272 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
273 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
274 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
275 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
276 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
277 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
278 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
279 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
280 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
281 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
282 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
283 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
284 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
285 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
286 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
287 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
288 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
289 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
290 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
291 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
292 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
293 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
294 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
295 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
296 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
297 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
298 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
299 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
300 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
301 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
302 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
303 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
304 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
305 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
306 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
307 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
308 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
309 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
310 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
311 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
312 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
313 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
314 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
317 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
318 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
319 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
320 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
321 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
322 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
323 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
324 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
325 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
326 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
327 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
328 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
329 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
330 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
331 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
332 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
333 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
334 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
335 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
336 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
337 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
338 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
339 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
340 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
341 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
342 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
343 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
344 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
345 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
346 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
347 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
348 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
349 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
351 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
352 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
353 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
354 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
355 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
356 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
357 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
359 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
361 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
363 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
365 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
366 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
393 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
394 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
396 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
398 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
399 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
400 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
401 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
402 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
403 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
404 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
405 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
406 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
407 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
408 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
409 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
410 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
411 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
412 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
413 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
414 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
415 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
416 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
417 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
418 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
419 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
420 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
421 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
422 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
423 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
424 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
425 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
426 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
427 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
428 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
429 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
430 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
431 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
432 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
433 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
434 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
435 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
436 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
437 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
438 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
439 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
440 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
441 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
442 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
443 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
444 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
445 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
446 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
447 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
448 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
449 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
450 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
451 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
452 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
453 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
454 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
455 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
456 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
457 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
458 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
459 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
460 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
461 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
462 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
463 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
464 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
465 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
470 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
471 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
472 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
473 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
474 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
475 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
476 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
477 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
478 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
479 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
480 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
481 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
500 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
501 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
502 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
503 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
504 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
505 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
506 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
507 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
508 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
509 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
514 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
515 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
516 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
517 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
518 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
519 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
520 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
521 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
522 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
523 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
524 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
525 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
526 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
527 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
528 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
529 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
530 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
531 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
534 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
535 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
536 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
537 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
538 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
539 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
540 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
541 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
542 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
547 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
548 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
549 8005275841 Rhizobium sp. N4311 Isolate Nodule
550 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
551 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
552 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
553 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
554 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
555 8005382845 Rhizobium sp. R634 Isolate Nodule
556 8005395548 Rhizobium sp. R339 Isolate Nodule
557 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
558 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
559 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
560 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
561 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
562 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
563 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
564 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
565 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
566 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
567 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
568 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
569 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
570 8018176218 Rhizobium sp. N122 Isolate Nodule
571 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
572 8024501048 Rhizobium sp. H4 Isolate Nodule
573 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
574 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
575 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
576 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
577 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.55
Metatranscriptomes 0.87
Isolates 37.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 22.6
Nodule 26.22
Rhizoplane 2
Rhizosphere 31.84
Stem 0
Stem Tuber 0
Unclassified 16.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1046040 2162886007 Bacteria 1500
2 SwRhRL2b_contig_3838869 2162886007 Bacteria 1511
3 JGI24741J21665_1000064 3300001915 Bacteria 25832
4 JGI24740J21852_10002340 3300001979 Bacteria 8625
5 JGI24740J21852_10059251 3300001979 Bacteria 1062
6 JGI24739J22299_10009520 3300001989 Bacteria 3620
7 JGI25156J39149_1010422 3300002705 Bacteria 2186
8 JGI25158J39367_1000021 3300002739 Bacteria 39295
9 JGI25157J39369_1000850 3300002741 Bacteria 15042
10 JGI25152J39213_1000418 3300002773 Bacteria 25621
11 JGI25152J39213_1002073 3300002773 Bacteria 7889
12 JGI25152J39213_1002786 3300002773 Bacteria 6323
13 JGI25152J39213_1011150 3300002773 Bacteria 2006
14 JGI25152J39213_1011152 3300002773 Bacteria 2006
15 JGI25150J39212_1000022 3300002774 Bacteria 131963
16 JGI25150J39212_1000218 3300002774 Bacteria 31294
17 JGI25150J39212_1023301 3300002774 Bacteria 921
18 JGI25150J39212_1027816 3300002774 Bacteria 806
19 JGI25159J45721_1000025 3300002987 Bacteria 115802
20 JGI25159J45721_1000423 3300002987 Bacteria 19499
21 JGI25159J45721_1036051 3300002987 Bacteria 752
22 JGI25151J46595_10000023 3300003187 Bacteria 221548
23 JGI25151J46595_10010809 3300003187 Bacteria 4223
24 JGI25165J46597_1000037 3300003214 Bacteria 285722
25 JGI25153J46596_10000093 3300003215 Bacteria 103442
26 JGI25153J46596_10011096 3300003215 Bacteria 4011
27 JGI25153J46596_10014572 3300003215 Bacteria 3258
28 JGI25153J46596_10027257 3300003215 Bacteria 2006
29 JGI25153J46596_10027258 3300003215 Bacteria 2006
30 rootL2_10000310 3300003322 Bacteria 31146
31 rootL2_10084851 3300003322 Bacteria 1387
32 JGI25160J50197_1000065 3300003354 Bacteria 115802
33 JGI25160J50197_1002796 3300003354 Bacteria 7990
34 JGI25160J50197_1012806 3300003354 Bacteria 2890
35 JGI25161J50226_1000025 3300003374 Bacteria 148471
36 JGI25161J50226_1000083 3300003374 Bacteria 77211
37 Ga0055532_1011812 3300003758 Bacteria 1021
38 Ga0055526_1002775 3300003771 Bacteria 11605
39 Ga0055526_1004470 3300003771 Bacteria 8384
40 Ga0055526_1027405 3300003771 Bacteria 1761
41 Ga0055524_1000762 3300003775 Bacteria 21684
42 Ga0055524_1007093 3300003775 Bacteria 4804
43 Ga0055524_1021274 3300003775 Bacteria 2155
44 Ga0055524_1038290 3300003775 Bacteria 1257
45 Ga0055524_1042870 3300003775 Bacteria 1120
46 Ga0055536_1023198 3300003781 Bacteria 1830
47 Ga0055536_1040211 3300003781 Bacteria 1115
48 Ga0055528_1017639 3300003790 Bacteria 2464
49 Ga0055530_10009417 3300003791 Bacteria 3755
50 Ga0055530_10016666 3300003791 Bacteria 2335
51 Ga0055530_10019233 3300003791 Bacteria 2074
52 Ga0055540_1001782 3300003792 Bacteria 12266
53 Ga0055540_1003016 3300003792 Bacteria 8420
54 Ga0055540_1008873 3300003792 Bacteria 3559
55 Ga0055531_10000203 3300003794 Bacteria 65490
56 Ga0055531_10000322 3300003794 Bacteria 47122
57 Ga0055531_10011813 3300003794 Bacteria 4169
58 Ga0055531_10016903 3300003794 Bacteria 3115
59 Ga0058692_1001200 3300003856 Bacteria 9928
60 Ga0055543_1000134 3300004625 Bacteria 61585
61 Ga0055543_1000326 3300004625 Bacteria 32775
62 Ga0065165_1000090 3300005262 Bacteria 150368
63 Ga0065165_1005679 3300005262 Bacteria 6879
64 Ga0070670_100584965 3300005331 Bacteria 998
65 Ga0070682_100430668 3300005337 Bacteria 1005
66 Ga0070661_100337915 3300005344 Bacteria 1179
67 Ga0070669_100011939 3300005353 Bacteria 6163
68 Ga0070669_100071077 3300005353 Bacteria 2574
69 Ga0070669_100402627 3300005353 Bacteria 1120
70 Ga0070671_100044834 3300005355 Bacteria 3674
71 Ga0070671_100540083 3300005355 Bacteria 1005
72 Ga0070674_100128781 3300005356 Bacteria 1884
73 Ga0070673_100137144 3300005364 Bacteria 2060
74 Ga0070663_100006514 3300005455 Bacteria 7031
75 Ga0068853_100018368 3300005539 Bacteria 5787
76 Ga0070665_100054885 3300005548 Bacteria 3995
77 Ga0070665_100183096 3300005548 Bacteria 2095
78 Ga0068855_100259943 3300005563 Bacteria 1934
79 Ga0070664_100039149 3300005564 Bacteria 3993
80 Ga0068854_100699751 3300005578 Bacteria 874
81 Ga0068856_100006903 3300005614 Bacteria 11102
82 Ga0068856_100219009 3300005614 Bacteria 1919
83 Ga0068852_100063844 3300005616 Bacteria 3207
84 Ga0068852_100798937 3300005616 Bacteria 957
85 Ga0068851_10007544 3300005834 Bacteria 4998
86 Ga0068862_100363292 3300005844 Bacteria 1346
87 Ga0081455_10167635 3300005937 Bacteria 1676
88 Ga0075365_10004326 3300006038 Bacteria 7501
89 Ga0075364_10013170 3300006051 Bacteria 5076
90 Ga0075364_10018250 3300006051 Bacteria 4390
91 Ga0075364_10141012 3300006051 Bacteria 1621
92 Ga0075362_10056005 3300006177 Bacteria 1774
93 Ga0075362_10192458 3300006177 Bacteria 991
94 Ga0075367_10158360 3300006178 Bacteria 1408
95 Ga0075367_10184098 3300006178 Bacteria 1302
96 Ga0075369_10001052 3300006186 Bacteria 9232
97 Ga0075369_10035220 3300006186 Bacteria 2127
98 Ga0075366_10018751 3300006195 Bacteria 3997
99 Ga0075370_10013747 3300006353 Bacteria 4308
100 Ga0075370_10014662 3300006353 Bacteria 4185
101 Ga0075370_10022652 3300006353 Bacteria 3452
102 Ga0099823_1000478 3300006944 Bacteria 26702
103 Ga0079104_1000082 3300006946 Bacteria 137722
104 Ga0099826_10000533 3300006948 Bacteria 18821
105 Ga0105251_10004594 3300009011 Bacteria 9333
106 Ga0105251_10064097 3300009011 Bacteria 1723
107 Ga0105244_10200189 3300009036 Bacteria 942
108 Ga0105250_10072174 3300009092 Bacteria 1395
109 Ga0105240_10214657 3300009093 Bacteria 2245
110 Ga0105240_11111067 3300009093 Bacteria 841
111 Ga0105241_10000625 3300009174 Bacteria 26580
112 Ga0105242_11261179 3300009176 Bacteria 761
113 Ga0105248_10325654 3300009177 Bacteria 1731
114 Ga0105237_10049124 3300009545 Bacteria 4242
115 Ga0105237_10077887 3300009545 Bacteria 3305
116 Ga0105249_10528495 3300009553 Bacteria 1228
117 Ga0123341_1085432 3300009765 Bacteria 1188
118 Ga0123342_1013095 3300009766 Bacteria 8416
119 Ga0105239_10370387 3300010375 Bacteria 1619
120 Ga0105239_10526029 3300010375 Bacteria 1346
121 Ga0157319_1000008 3300012497 Bacteria 315600
122 Ga0157373_10049232 3300013100 Bacteria 3003
123 Ga0157371_10059812 3300013102 Bacteria 2701
124 Ga0157370_10045498 3300013104 Bacteria 4210
125 Ga0157370_10066012 3300013104 Bacteria 3423
126 Ga0157370_10353536 3300013104 Bacteria 1354
127 Ga0157369_10011473 3300013105 Bacteria 10062
128 Ga0157369_10089228 3300013105 Bacteria 3292
129 Ga0157369_10643955 3300013105 Bacteria 1093
130 Ga0157374_11124512 3300013296 Bacteria 806
131 Ga0157380_10126356 3300014326 Bacteria 2174
132 Ga0182008_10000625 3300014497 Bacteria 25949
133 Ga0157376_10704159 3300014969 Bacteria 1015
134 Ga0182006_1039453 3300015261 Bacteria 1863
135 Ga0183363_1132 3300015690 Bacteria 18933
136 Ga0163161_10014283 3300017792 Bacteria 5529
137 Ga0209436_100017 3300025208 Bacteria 116238
138 Ga0209436_100087 3300025208 Bacteria 46437
139 Ga0209258_108353 3300025242 Bacteria 1461
140 Ga0207425_1000038 3300025245 Bacteria 221600
141 Ga0207425_1000072 3300025245 Bacteria 115017
142 Ga0207425_1004423 3300025245 Bacteria 4221
143 Ga0207425_1008695 3300025245 Bacteria 2577
144 Ga0207425_1029722 3300025245 Bacteria 1100
145 Ga0207425_1036744 3300025245 Bacteria 948
146 Ga0209646_1005780 3300025246 Bacteria 2128
147 Ga0209026_1000013 3300025250 Bacteria 415633
148 Ga0209759_1000149 3300025256 Bacteria 120932
149 Ga0209129_1000016 3300025258 Bacteria 485491
150 Ga0209129_1000036 3300025258 Bacteria 328331
151 Ga0209129_1001358 3300025258 Bacteria 13795
152 Ga0209129_1004036 3300025258 Bacteria 6001
153 Ga0209129_1004638 3300025258 Bacteria 5260
154 Ga0209129_1011135 3300025258 Bacteria 2174
155 Ga0209233_1000102 3300025261 Bacteria 285774
156 Ga0209565_1000132 3300025263 Bacteria 104716
157 Ga0209565_1013479 3300025263 Bacteria 1912
158 Ga0209673_1006166 3300025273 Bacteria 5868
159 Ga0209673_1021516 3300025273 Bacteria 2253
160 Ga0209673_1023214 3300025273 Bacteria 2119
161 Ga0209673_1024633 3300025273 Bacteria 2017
162 Ga0209673_1052149 3300025273 Bacteria 1075
163 Ga0209673_1069612 3300025273 Bacteria 843
164 Ga0209130_1000001 3300025284 Bacteria 831557
165 Ga0209130_1000079 3300025284 Bacteria 167669
166 Ga0209130_1021845 3300025284 Bacteria 1438
167 Ga0209130_1033398 3300025284 Bacteria 1042
168 Ga0209676_1007320 3300025292 Bacteria 5218
169 Ga0209676_1044823 3300025292 Bacteria 1209
170 Ga0209025_1000108 3300025294 Bacteria 221600
171 Ga0209025_1000177 3300025294 Bacteria 158173
172 Ga0209025_1000469 3300025294 Bacteria 78737
173 Ga0209025_1002058 3300025294 Bacteria 22887
174 Ga0209025_1007023 3300025294 Bacteria 8538
175 Ga0209025_1013293 3300025294 Bacteria 5189
176 Ga0209025_1053533 3300025294 Bacteria 1582
177 Ga0209564_1000008 3300025295 Bacteria 953227
178 Ga0209564_1000132 3300025295 Bacteria 191966
179 Ga0209564_1000551 3300025295 Bacteria 60139
180 Ga0209564_1001535 3300025295 Bacteria 22900
181 Ga0209564_1005534 3300025295 Bacteria 7156
182 Ga0209758_1000009 3300025297 Bacteria 1123483
183 Ga0209758_1000104 3300025297 Bacteria 221600
184 Ga0209758_1001035 3300025297 Bacteria 36412
185 Ga0209758_1001245 3300025297 Bacteria 31687
186 Ga0209758_1016436 3300025297 Bacteria 3758
187 Ga0209050_1000005 3300025298 Bacteria 1557793
188 Ga0209050_1000195 3300025298 Bacteria 136316
189 Ga0209050_1002935 3300025298 Bacteria 13344
190 Ga0209050_1003178 3300025298 Bacteria 12485
191 Ga0209256_1001049 3300025299 Bacteria 32147
192 Ga0209256_1003703 3300025299 Bacteria 10384
193 Ga0209256_1007709 3300025299 Bacteria 5219
194 Ga0209256_1010343 3300025299 Bacteria 3926
195 Ga0209256_1039988 3300025299 Bacteria 1201
196 Ga0207426_1000005 3300025302 Bacteria 1037188
197 Ga0207426_1000167 3300025302 Bacteria 167669
198 Ga0207426_1003048 3300025302 Bacteria 9667
199 Ga0207426_1018980 3300025302 Bacteria 2413
200 Ga0209051_1000244 3300025303 Bacteria 91505
201 Ga0209051_1000414 3300025303 Bacteria 58981
202 Ga0209051_1000960 3300025303 Bacteria 28324
203 Ga0209051_1001577 3300025303 Bacteria 18793
204 Ga0209051_1020084 3300025303 Bacteria 2892
205 Ga0209257_1000017 3300025304 Bacteria 866287
206 Ga0209257_1000144 3300025304 Bacteria 197078
207 Ga0209257_1002056 3300025304 Bacteria 21322
208 Ga0209257_1008974 3300025304 Bacteria 5494
209 Ga0209257_1010894 3300025304 Bacteria 4495
210 Ga0209257_1011219 3300025304 Bacteria 4351
211 Ga0209257_1039143 3300025304 Bacteria 1428
212 Ga0207656_10018949 3300025321 Bacteria 2716
213 Ga0207713_1063826 3300025735 Bacteria 1389
214 Ga0207695_10081735 3300025913 Bacteria 3269
215 Ga0207695_10218637 3300025913 Bacteria 1813
216 Ga0207671_10031678 3300025914 Bacteria 3940
217 Ga0207657_10004548 3300025919 Bacteria 14658
218 Ga0207649_10053537 3300025920 Bacteria 2508
219 Ga0207681_10005851 3300025923 Bacteria 7538
220 Ga0207681_10438974 3300025923 Bacteria 1060
221 Ga0207694_10054991 3300025924 Bacteria 3089
222 Ga0207659_10040742 3300025926 Bacteria 3250
223 Ga0207644_11089726 3300025931 Bacteria 671
224 Ga0207686_10722121 3300025934 Bacteria 793
225 Ga0207669_10197804 3300025937 Bacteria 1456
226 Ga0207711_10225102 3300025941 Bacteria 1717
227 Ga0207679_10052647 3300025945 Bacteria 2986
228 Ga0207667_10033763 3300025949 Bacteria 5498
229 Ga0207667_10569986 3300025949 Bacteria 1144
230 Ga0207651_10015272 3300025960 Bacteria 4458
231 Ga0207712_10356422 3300025961 Bacteria 1217
232 Ga0207668_10247564 3300025972 Bacteria 1446
233 Ga0207640_10795821 3300025981 Bacteria 819
234 Ga0207639_10002789 3300026041 Bacteria 11724
235 Ga0207639_10011254 3300026041 Bacteria 6207
236 Ga0207639_10027766 3300026041 Bacteria 4126
237 Ga0207678_10000235 3300026067 Bacteria 49747
238 Ga0207702_10074100 3300026078 Bacteria 2937
239 Ga0207702_10081048 3300026078 Bacteria 2818
240 Ga0207674_10070129 3300026116 Bacteria 3524
241 Ga0207674_11083226 3300026116 Bacteria 771
242 Ga0207698_10147426 3300026142 Bacteria 2037
243 Ga0207698_10372487 3300026142 Bacteria 1356
244 Ga0209281_1000043 3300027111 Bacteria 341543
245 Ga0209389_1041846 3300027296 Bacteria 3488
246 Ga0209371_1000009 3300027312 Bacteria 963030
247 Ga0209371_1011474 3300027312 Bacteria 2630
248 Ga0209282_1001912 3300027666 Bacteria 11753
249 Ga0268266_10088248 3300028379 Bacteria 2714
250 Ga0268266_10651588 3300028379 Bacteria 1013
251 Ga0268266_11114753 3300028379 Bacteria 763
252 Ga0307515_10023533 3300028794 Bacteria 10787
253 Ga0307515_10055417 3300028794 Bacteria 5793
254 Ga0307515_10101689 3300028794 Bacteria 3466
255 Ga0307515_10338826 3300028794 Bacteria 1157
256 Ga0268256_1000010 3300030500 Bacteria 963034
257 Ga0268256_1016310 3300030500 Bacteria 2135
258 Ga0316181_1111885 3300030744 Bacteria 2714
259 Ga0307408_100003096 3300031548 Bacteria 11457
260 Ga0307405_10086394 3300031731 Bacteria 2064
261 Ga0307405_10359122 3300031731 Bacteria 1126
262 Ga0307410_10052752 3300031852 Bacteria 2748
263 Ga0307406_10165084 3300031901 Bacteria 1596
264 Ga0307414_10379083 3300032004 Bacteria 1222
265 Ga0307411_10002074 3300032005 Bacteria 8623
266 Ga0373958_0008235 3300034819 Bacteria 1683
267 Ga0373940_0046997 3300035088 Bacteria 1202
268 Ga0373939_0000071 3300035114 Bacteria 32243
269 Ga0373960_0000615 3300035121 Bacteria 7289
270 Ga0373961_0025877 3300035241 Bacteria 1599
271 Ga0373962_0055010 3300035242 Bacteria 1155
272 Ga0373931_0000591 3300035691 Bacteria 14952
273 Ga0395900_0327253 3300037418 Bacteria 1511
274 Ga0395898_0110600 3300037466 Bacteria 2633
275 Ga0395898_1029572 3300037466 Bacteria 758
276 Ga0395905_0053525 3300037471 Bacteria 3777
277 Ga0395905_0101077 3300037471 Bacteria 2707
278 Ga0395905_0163015 3300037471 Bacteria 2095
279 Ga0395905_0349493 3300037471 Bacteria 1370
280 Ga0395905_0391955 3300037471 Bacteria 1283
281 Ga0395905_0624689 3300037471 Bacteria 979
282 Ga0395901_0048436 3300038443 Bacteria 4413
283 Ga0436361_0428539 3300039447 Bacteria 2097
284 Ga0439465_0139534 3300041413 Bacteria 860
285 Ga0451835_0808235 3300041492 Bacteria 1126
286 Ga0451837_0256684 3300041494 Bacteria 1453
287 Ga0451855_0228500 3300041511 Bacteria 1675
288 Ga0439449_0086064 3300042007 Bacteria 1160
289 Ga0439462_0012282 3300042015 Bacteria 2187
290 Ga0450898_034874 3300042134 Bacteria 935
291 Ga0466972_0077755 3300044658 Bacteria 1580
292 Ga0466963_0369659 3300044694 Bacteria 1010
293 Ga0466968_0122672 3300044735 Bacteria 1177
294 Ga0451576_0162985 3300045051 Bacteria 2327
295 Ga0466967_1333764 3300045976 Bacteria 715
296 Ga0495627_000363 3300046453 Bacteria 42174
297 Ga0495590_0018238 3300046457 Bacteria 2514
298 Ga0495638_0000021 3300046460 Bacteria 365602
299 Ga0495638_0002018 3300046460 Bacteria 17314
300 Ga0495638_0119057 3300046460 Bacteria 1562
301 Ga0495638_0137808 3300046460 Bacteria 1427
302 Ga0495605_0006188 3300046474 Bacteria 6903
303 Ga0495584_0076721 3300046491 Bacteria 1680
304 Ga0495585_0018239 3300046492 Bacteria 4050
305 Ga0495607_0045477 3300046501 Bacteria 2582
306 Ga0495583_0003016 3300046506 Bacteria 13440
307 Ga0495583_0013674 3300046506 Bacteria 4512
308 Ga0495606_0038253 3300046507 Bacteria 3248
309 Ga0495610_0000072 3300046512 Bacteria 120618
310 Ga0495616_0080367 3300046513 Bacteria 1561
311 Ga0495620_0050277 3300046515 Bacteria 1779
312 Ga0495632_0010389 3300046519 Bacteria 5519
313 Ga0495632_0013002 3300046519 Bacteria 4771
314 Ga0495643_0006542 3300046522 Bacteria 7666
315 Ga0495648_0000071 3300046524 Bacteria 133473
316 Ga0495648_0001207 3300046524 Bacteria 25895
317 Ga0495648_0031456 3300046524 Bacteria 3493
318 Ga0495654_0000305 3300046530 Bacteria 43461
319 Ga0495609_0093554 3300046538 Bacteria 1306
320 Ga0495621_0084288 3300046539 Bacteria 1189
321 Ga0495633_0058461 3300046558 Bacteria 1810
322 Ga0495633_0086162 3300046558 Bacteria 1461
323 Ga0495633_0089905 3300046558 Bacteria 1427
324 Ga0495656_0387398 3300046615 Bacteria 729
325 Ga0495668_0006163 3300046616 Bacteria 7936
326 Ga0495668_0149651 3300046616 Bacteria 1278
327 Ga0495625_0456099 3300046660 Bacteria 789
328 Ga0495635_0082080 3300046663 Bacteria 2206
329 Ga0495588_0074987 3300046674 Bacteria 1762
330 Ga0495670_0011840 3300046691 Bacteria 4294
331 Ga0495671_0000046 3300046692 Bacteria 157975
332 Ga0495649_0003186 3300046694 Bacteria 11216
333 Ga0495649_0092400 3300046694 Bacteria 1612
334 Ga0495660_0057083 3300046810 Bacteria 2107
335 Ga0495604_0001490 3300047317 Bacteria 19310
336 Ga0495683_0000007 3300047323 Bacteria 268546
337 Ga0495673_0000066 3300047469 Bacteria 221478
338 Ga0495681_0000043 3300047470 Bacteria 115514
339 Ga0495681_0163088 3300047470 Bacteria 927
340 Ga0495686_0116556 3300047472 Bacteria 1596
341 Ga0496104_0145409 3300048907 Bacteria 2276
342 Ga0496106_0000221 3300048909 Bacteria 39664
343 Ga0496107_0034220 3300048910 Bacteria 3639
344 Ga0496109_0081727 3300048912 Bacteria 2977
345 Ga0496110_0046668 3300048913 Bacteria 3790
346 Ga0496110_0311728 3300048913 Bacteria 1433
347 Ga0496111_0009028 3300048914 Bacteria 6635
348 Ga0496111_0585395 3300048914 Bacteria 818
349 Ga0496113_0127825 3300048916 Bacteria 1992
350 Ga0496113_0507767 3300048916 Bacteria 968
351 Ga0496116_0002755 3300048919 Bacteria 18052
352 Ga0496116_0006977 3300048919 Bacteria 10121
353 Ga0496116_0040712 3300048919 Bacteria 3196
354 Ga0496116_0042347 3300048919 Bacteria 3114
355 Ga0496116_0062334 3300048919 Bacteria 2408
356 Ga0496117_0005379 3300048920 Bacteria 13482
357 Ga0496117_0019860 3300048920 Bacteria 5500
358 Ga0496117_0086757 3300048920 Bacteria 2032
359 Ga0496117_0091671 3300048920 Bacteria 1954
360 Ga0496117_0105356 3300048920 Bacteria 1772
361 Ga0496117_0237703 3300048920 Bacteria 1002
362 Ga0496118_0027244 3300048921 Bacteria 4842
363 Ga0496118_0062586 3300048921 Bacteria 2745
364 Ga0496118_0070256 3300048921 Bacteria 2529
365 Ga0496118_0080497 3300048921 Bacteria 2292
366 Ga0496118_0131942 3300048921 Bacteria 1602
367 Ga0496118_0157444 3300048921 Bacteria 1410
368 Ga0496119_0263313 3300048922 Bacteria 864
369 Ga0496120_0000435 3300048923 Bacteria 66035
370 Ga0496120_0063014 3300048923 Bacteria 2064
371 Ga0496120_0204840 3300048923 Bacteria 953
372 Ga0496121_0005816 3300048924 Bacteria 15637
373 Ga0496121_0013804 3300048924 Bacteria 8646
374 Ga0496121_0019043 3300048924 Bacteria 6887
375 Ga0496121_0057152 3300048924 Bacteria 3235
376 Ga0496121_0075156 3300048924 Bacteria 2700
377 Ga0496121_0144262 3300048924 Bacteria 1761
378 Ga0496121_0430624 3300048924 Bacteria 856
379 Ga0496122_0000106 3300048925 Bacteria 193672
380 Ga0496122_0000238 3300048925 Bacteria 123588
381 Ga0496122_0000606 3300048925 Bacteria 73602
382 Ga0496122_0008697 3300048925 Bacteria 10873
383 Ga0496122_0009349 3300048925 Bacteria 10350
384 Ga0496122_0010098 3300048925 Bacteria 9799
385 Ga0496122_0020278 3300048925 Bacteria 6017
386 Ga0496122_0026617 3300048925 Bacteria 4978
387 Ga0496122_0028755 3300048925 Bacteria 4705
388 Ga0496122_0048439 3300048925 Bacteria 3267
389 Ga0496122_0115100 3300048925 Bacteria 1753
390 Ga0496122_0176778 3300048925 Bacteria 1278
391 Ga0496123_0000022 3300048926 Bacteria 361832
392 Ga0496123_0000262 3300048926 Bacteria 106366
393 Ga0496123_0000450 3300048926 Bacteria 73652
394 Ga0496123_0026040 3300048926 Bacteria 4394
395 Ga0496123_0206454 3300048926 Bacteria 1002
396 Ga0496124_0000153 3300048927 Bacteria 139859
397 Ga0496124_0002161 3300048927 Bacteria 26367
398 Ga0496124_0011736 3300048927 Bacteria 8738
399 Ga0496124_0017079 3300048927 Bacteria 6861
400 Ga0496124_0050747 3300048927 Bacteria 3533
401 Ga0496124_0108789 3300048927 Bacteria 2235
402 Ga0496124_0143408 3300048927 Bacteria 1882
403 Ga0496124_0231221 3300048927 Bacteria 1382
404 Ga0496124_0279629 3300048927 Bacteria 1217
405 Ga0496124_0303216 3300048927 Bacteria 1152
406 Ga0496125_0003083 3300048928 Bacteria 20804
407 Ga0496125_0006530 3300048928 Bacteria 12574
408 Ga0496125_0027217 3300048928 Bacteria 5187
409 Ga0496125_0131552 3300048928 Bacteria 1760
410 Ga0496125_0157425 3300048928 Bacteria 1549
411 Ga0496125_0176396 3300048928 Bacteria 1429
412 Ga0496126_0009081 3300048929 Bacteria 10625
413 Ga0496126_0023157 3300048929 Bacteria 6021
414 Ga0496126_0041231 3300048929 Bacteria 4274
415 Ga0496126_0196024 3300048929 Bacteria 1708
416 Ga0496126_0419398 3300048929 Bacteria 1082
417 Ga0501322_000536 3300049538 Bacteria 1829
418 Ga0501335_001379 3300049551 Bacteria 1860
419 Ga0501031_0013477 3300049568 Bacteria 5328
420 Ga0501032_0018503 3300049569 Bacteria 4879
421 Ga0501033_0019187 3300049570 Bacteria 5170
422 Ga0501034_0025864 3300049571 Bacteria 5977
423 Ga0501036_0104780 3300049572 Bacteria 2391
424 Ga0501037_0021179 3300049573 Bacteria 4803
425 Ga0501038_0223447 3300049574 Bacteria 1501
426 Ga0501039_0035281 3300049575 Bacteria 3859
427 Ga0501042_0075686 3300049578 Bacteria 2409
428 Ga0501043_0014731 3300049579 Bacteria 6122
429 Ga0501046_0128085 3300049580 Bacteria 1927
430 Ga0501046_0129379 3300049580 Bacteria 1915
431 Ga0501047_0115538 3300049581 Bacteria 2565
432 Ga0501048_0138979 3300049582 Bacteria 1717
433 Ga0501068_0080606 3300049584 Bacteria 1997
434 Ga0501070_0069974 3300049586 Bacteria 2905
435 Ga0501071_0273097 3300049587 Bacteria 1278
436 Ga0501074_0251043 3300049590 Bacteria 1258
437 Ga0501211_004148 3300049658 Bacteria 1482
438 Ga0501223_000004 3300049663 Bacteria 141027
439 Ga0501227_019145 3300049665 Bacteria 1559
440 Ga0501235_002079 3300049669 Bacteria 4300
441 Ga0501238_016729 3300049671 Bacteria 1018
442 Ga0501246_000533 3300049676 Bacteria 2762
443 Ga0501225_0000003 3300049705 Bacteria 141070
444 Ga0501225_0009427 3300049705 Bacteria 2780
445 Ga0501225_0020282 3300049705 Bacteria 1837
446 Ga0501245_033902 3300049708 Bacteria 854
447 Ga0501080_0222342 3300049742 Bacteria 1727
448 Ga0501083_0046580 3300049744 Bacteria 2931
449 Ga0501035_0149495 3300049822 Bacteria 2027
450 Ga0501044_0043203 3300049823 Bacteria 4683
451 Ga0501045_0146975 3300049824 Bacteria 1753
452 nmdc:mga00v17_172932_c1 3300050491 Bacteria 1393
453 nmdc:mga00v17_588_c1 3300050491 Bacteria 20251
454 nmdc:mga00v17_70872_c1 3300050491 Bacteria 2160
455 nmdc:mga0yw44_328923_c1 3300050492 Bacteria 1027
456 nmdc:mga0yw44_48090_c1 3300050492 Bacteria 2571
457 nmdc:mga0k408_61380_c1 3300050493 Bacteria 2185
458 nmdc:mga06z11_64_c1 3300050494 Bacteria 44293
459 nmdc:mga04h51_56_c1 3300050495 Bacteria 35784
460 nmdc:mga07m45_15593_c1 3300050496 Bacteria 4058
461 nmdc:mga07m45_17907_c1 3300050496 Bacteria 3812
462 nmdc:mga07m45_30198_c1 3300050496 Bacteria 3000
463 nmdc:mga0sz30_37484_c1 3300050516 Bacteria 1669
464 nmdc:mga0sz30_57345_c1 3300050516 Bacteria 1660
465 Ga0495601_0324768 3300053077 Bacteria 1002
466 Ga0500578_0073555 3300053086 Bacteria 2177
467 Ga0500643_001812 3300053087 Bacteria 11678
468 Ga0500643_013168 3300053087 Bacteria 2932
469 Ga0500651_0164858 3300053093 Bacteria 1323
470 Ga0500566_0006293 3300053094 Bacteria 7054
471 Ga0500641_0240519 3300053096 Bacteria 762
472 Ga0500569_045282 3300053109 Bacteria 1306
473 Ga0500594_0029356 3300053118 Bacteria 1438
474 Ga0500607_013879 3300053121 Bacteria 4696
475 Ga0500608_085643 3300053122 Bacteria 1480
476 Ga0500618_001236 3300053125 Bacteria 11955
477 Ga0500618_012564 3300053125 Bacteria 2214
478 Ga0500658_0035794 3300053134 Bacteria 1967
479 Ga0500559_0000180 3300053136 Bacteria 50042
480 Ga0500559_0007386 3300053136 Bacteria 4874
481 Ga0500559_0068519 3300053136 Bacteria 1594
482 Ga0500586_019243 3300053145 Bacteria 2120
483 Ga0500604_0131728 3300053151 Bacteria 841
484 Ga0500616_0022506 3300053153 Bacteria 3517
485 Ga0500616_0183750 3300053153 Bacteria 939
486 Ga0500622_0000104 3300053156 Bacteria 85867
487 Ga0500622_0139062 3300053156 Bacteria 1160
488 Ga0500624_000405 3300053157 Bacteria 13383
489 Ga0500627_0049177 3300053158 Bacteria 1834
490 Ga0500627_0095729 3300053158 Bacteria 1331
491 Ga0500636_0000526 3300053177 Bacteria 20787
492 Ga0500636_0019536 3300053177 Bacteria 4009
493 Ga0500636_0021668 3300053177 Bacteria 3804
494 Ga0500637_0030710 3300053178 Bacteria 2992
495 Ga0500567_118430 3300053723 Bacteria 1062
496 Ga0587077_007056 3300059493 Bacteria 1620
497 Ga0587077_038376 3300059493 Bacteria 949
498 Ga0587080_036369 3300059503 Bacteria 880
499 Ga0587068_013114 3300059641 Bacteria 1274
500 Ga0587076_018853 3300059645 Bacteria 1116

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042015 Ga0439462_0012282 Ga0439462_0012282_1506_2135 178
2 3300001979 JGI24740J21852_10059251 JGI24740J21852_100592512 179
3 3300001989 JGI24739J22299_10009520 JGI24739J22299_100095203 179
4 3300003758 Ga0055532_1011812 Ga0055532_10118122 179
5 3300005539 Ga0068853_100018368 Ga0068853_1000183685 179
6 3300046453 Ga0495627_000363 Ga0495627_000363_1447_1989 179
7 3300046524 Ga0495648_0031456 Ga0495648_0031456_1886_2428 179
8 3300046660 Ga0495625_0456099 Ga0495625_0456099_218_760 179
9 3300049572 Ga0501036_0104780 Ga0501036_0104780_1816_2358 179
10 3300050494 nmdc:mga06z11_64_c1 nmdc:mga06z11_64_c1_16384_16926 179
11 3300050495 nmdc:mga04h51_56_c1 nmdc:mga04h51_56_c1_954_1496 179
12 3300050496 nmdc:mga07m45_17907_c1 nmdc:mga07m45_17907_c1_880_1422 179
13 3300039447 Ga0436361_0428539 Ga0436361_0428539_283_855 189
14 3300009011 Ga0105251_10064097 Ga0105251_100640973 194
15 3300009553 Ga0105249_10528495 Ga0105249_105284952 194
16 3300048925 Ga0496122_0009349 Ga0496122_0009349_8884_9486 194
17 3300048927 Ga0496124_0011736 Ga0496124_0011736_680_1282 194
18 3300048928 Ga0496125_0006530 Ga0496125_0006530_2529_3131 194
19 3300053093 Ga0500651_0164858 Ga0500651_0164858_692_1288 195
20 3300048920 Ga0496117_0086757 Ga0496117_0086757_1312_1914 197
21 3300048921 Ga0496118_0157444 Ga0496118_0157444_154_756 197
22 iso_pu_bacteria 2512564014 2512643939 197
23 iso_pu_bacteria 2886848708 2886850675 197
24 3300048916 Ga0496113_0507767 Ga0496113_0507767_351_953 198
25 3300028794 Ga0307515_10101689 Ga0307515_101016891 199
26 3300048923 Ga0496120_0204840 Ga0496120_0204840_306_914 199
27 3300053087 Ga0500643_013168 Ga0500643_013168_967_1578 199
28 3300053157 Ga0500624_000405 Ga0500624_000405_7247_7858 199
29 3300053177 Ga0500636_0021668 Ga0500636_0021668_826_1437 199
30 iso_pu_bacteria 2775507049 2776912369 199
31 3300015261 Ga0182006_1039453 Ga0182006_10394533 200
32 3300037466 Ga0395898_0110600 Ga0395898_0110600_11_613 200
33 3300053094 Ga0500566_0006293 Ga0500566_0006293_935_1546 200
34 3300053136 Ga0500559_0000180 Ga0500559_0000180_48157_48768 200
35 iso_pu_bacteria 2643221558 2643813430 200
36 iso_pu_bacteria 2791355048 2792460709 200
37 iso_pu_bacteria 2843744320 2843747991 200
38 iso_pu_bacteria 2849560528 2849561430 200
39 iso_pu_bacteria 2849573788 2849574677 200
40 iso_pu_bacteria 2851153111 2851153578 200
41 iso_pu_bacteria 2898329390 2898329884 200
42 iso_pu_bacteria 2928972540 2928974748 200
43 iso_pu_bacteria 2929199973 2929205264 200
44 iso_pu_bacteria 2977240413 2977242212 200
45 iso_pu_bacteria 8018150411 8018152300 200
46 iso_pu_bacteria 8055909800 8055913437 200
47 3300001915 JGI24741J21665_1000064 JGI24741J21665_100006419 201
48 3300001979 JGI24740J21852_10002340 JGI24740J21852_100023402 201
49 3300005455 Ga0070663_100006514 Ga0070663_1000065143 201
50 3300005564 Ga0070664_100039149 Ga0070664_1000391492 201
51 3300005614 Ga0068856_100006903 Ga0068856_1000069036 201
52 3300005616 Ga0068852_100798937 Ga0068852_1007989371 201
53 3300005834 Ga0068851_10007544 Ga0068851_100075443 201
54 3300006178 Ga0075367_10184098 Ga0075367_101840982 201
55 3300009093 Ga0105240_10214657 Ga0105240_102146573 201
56 3300009174 Ga0105241_10000625 Ga0105241_1000062515 201
57 3300009545 Ga0105237_10049124 Ga0105237_100491242 201
58 3300010375 Ga0105239_10526029 Ga0105239_105260292 201
59 3300013104 Ga0157370_10066012 Ga0157370_100660124 201
60 3300017792 Ga0163161_10014283 Ga0163161_100142834 201
61 3300025321 Ga0207656_10018949 Ga0207656_100189492 201
62 3300025735 Ga0207713_1063826 Ga0207713_10638262 201
63 3300025913 Ga0207695_10081735 Ga0207695_100817353 201
64 3300025919 Ga0207657_10004548 Ga0207657_100045489 201
65 3300025920 Ga0207649_10053537 Ga0207649_100535372 201
66 3300025945 Ga0207679_10052647 Ga0207679_100526473 201
67 3300025949 Ga0207667_10033763 Ga0207667_100337633 201
68 3300025961 Ga0207712_10356422 Ga0207712_103564222 201
69 3300026041 Ga0207639_10011254 Ga0207639_100112542 201
70 3300026067 Ga0207678_10000235 Ga0207678_1000023540 201
71 3300026078 Ga0207702_10074100 Ga0207702_100741002 201
72 3300026116 Ga0207674_10070129 Ga0207674_100701292 201
73 3300026142 Ga0207698_10147426 Ga0207698_101474262 201
74 3300031731 Ga0307405_10086394 Ga0307405_100863942 201
75 3300031852 Ga0307410_10052752 Ga0307410_100527522 201
76 3300032004 Ga0307414_10379083 Ga0307414_103790832 201
77 3300050493 nmdc:mga0k408_61380_c1 nmdc:mga0k408_61380_c1_793_1401 201
78 3300050496 nmdc:mga07m45_15593_c1 nmdc:mga07m45_15593_c1_2679_3287 201
79 3300053087 Ga0500643_001812 Ga0500643_001812_1013_1639 201
80 iso_pu_bacteria 2508501123 2509116910 201
81 iso_pu_bacteria 2509276033 2509448131 201
82 iso_pu_bacteria 2510065019 2510136795 201
83 iso_pu_bacteria 2510917028 2511184173 201
84 iso_pu_bacteria 2510917030 2511198350 201
85 iso_pu_bacteria 2513237087 2513589886 201
86 iso_pu_bacteria 2513237088 2513598942 201
87 iso_pu_bacteria 2513237093 2513631679 201
88 iso_pu_bacteria 2513237103 2513713373 201
89 iso_pu_bacteria 2513237138 2513866444 201
90 iso_pu_bacteria 2515075009 2515115379 201
91 iso_pu_bacteria 2516653077 2517041621 201
92 iso_pu_bacteria 2516653085 2517080785 201
93 iso_pu_bacteria 2519899620 2520377367 201
94 iso_pu_bacteria 2529292951 2530644877 201
95 iso_pu_bacteria 2534681796 2535519939 201
96 iso_pu_bacteria 2582581294 2585202844 201
97 iso_pu_bacteria 2582581298 2585221715 201
98 iso_pu_bacteria 2582581299 2585228107 201
99 iso_pu_bacteria 2582581304 2585255404 201
100 iso_pu_bacteria 2582581867 2585401211 201
101 iso_pu_bacteria 2585427528 2585539067 201
102 iso_pu_bacteria 2585427529 2585544115 201
103 iso_pu_bacteria 2585427590 2585821640 201
104 iso_pu_bacteria 2585427593 2585837017 201
105 iso_pu_bacteria 2585427594 2585842543 201
106 iso_pu_bacteria 2599185236 2599718665 201
107 iso_pu_bacteria 2599185352 2600193683 201
108 iso_pu_bacteria 2600254933 2600377186 201
109 iso_pu_bacteria 2643221557 2643804983 201
110 iso_pu_bacteria 2643221599 2644006780 201
111 iso_pu_bacteria 2643221634 2644191689 201
112 iso_pu_bacteria 2643221668 2644379013 201
113 iso_pu_bacteria 2643221723 2644673235 201
114 iso_pu_bacteria 2718217927 2719388276 201
115 iso_pu_bacteria 2718217997 2719667897 201
116 iso_pu_bacteria 2718218199 2720494660 201
117 iso_pu_bacteria 2718218232 2720610995 201
118 iso_pu_bacteria 2718218233 2720616163 201
119 iso_pu_bacteria 2718218235 2720629244 201
120 iso_pu_bacteria 2718218269 2720771816 201
121 iso_pu_bacteria 2718218423 2721402899 201
122 iso_pu_bacteria 2721755556 2723029219 201
123 iso_pu_bacteria 2721755684 2723562853 201
124 iso_pu_bacteria 2721755685 2723570843 201
125 iso_pu_bacteria 2721755809 2724035256 201
126 iso_pu_bacteria 2721755819 2724086636 201
127 iso_pu_bacteria 2721755822 2724106794 201
128 iso_pu_bacteria 2721755823 2724107594 201
129 iso_pu_bacteria 2728369352 2730105533 201
130 iso_pu_bacteria 2738541293 2738801763 201
131 iso_pu_bacteria 2738541317 2738945940 201
132 iso_pu_bacteria 2738541333 2739033525 201
133 iso_pu_bacteria 2791355253 2793282734 201
134 iso_pu_bacteria 2791355259 2793314876 201
135 iso_pu_bacteria 2791355261 2793325899 201
136 iso_pu_bacteria 2791355262 2793332905 201
137 iso_pu_bacteria 2791355266 2793357951 201
138 iso_pu_bacteria 2802429605 2805927909 201
139 iso_pu_bacteria 2802429633 2806044980 201
140 iso_pu_bacteria 2802429634 2806053863 201
141 iso_pu_bacteria 2802429635 2806060045 201
142 iso_pu_bacteria 2802429636 2806065901 201
143 iso_pu_bacteria 2802429637 2806075429 201
144 iso_pu_bacteria 2821123053 2821123218 201
145 iso_pu_bacteria 2838016132 2838019313 201
146 iso_pu_bacteria 2838022645 2838024850 201
147 iso_pu_bacteria 2838042994 2838046467 201
148 iso_pu_bacteria 2838048938 2838050379 201
149 iso_pu_bacteria 2838061910 2838063082 201
150 iso_pu_bacteria 2838068647 2838071648 201
151 iso_pu_bacteria 2838668709 2838673713 201
152 iso_pu_bacteria 2838680041 2838684240 201
153 iso_pu_bacteria 2838686498 2838692246 201
154 iso_pu_bacteria 2838694306 2838699730 201
155 iso_pu_bacteria 2838701080 2838705254 201
156 iso_pu_bacteria 2838707686 2838711984 201
157 iso_pu_bacteria 2838729681 2838734335 201
158 iso_pu_bacteria 2838736955 2838739759 201
159 iso_pu_bacteria 2838742623 2838746787 201
160 iso_pu_bacteria 2841840854 2841844117 201
161 iso_pu_bacteria 2841851746 2841853477 201
162 iso_pu_bacteria 2841864319 2841869141 201
163 iso_pu_bacteria 2842077413 2842081706 201
164 iso_pu_bacteria 2842110456 2842114594 201
165 iso_pu_bacteria 2842118031 2842122282 201
166 iso_pu_bacteria 2842140634 2842143838 201
167 iso_pu_bacteria 2842146304 2842150256 201
168 iso_pu_bacteria 2842156927 2842161438 201
169 iso_pu_bacteria 2842163707 2842167357 201
170 iso_pu_bacteria 2842180545 2842185761 201
171 iso_pu_bacteria 2842192696 2842195499 201
172 iso_pu_bacteria 2842198810 2842201936 201
173 iso_pu_bacteria 2842205361 2842210509 201
174 iso_pu_bacteria 2842217011 2842223631 201
175 iso_pu_bacteria 2842229732 2842234067 201
176 iso_pu_bacteria 2842237096 2842241396 201
177 iso_pu_bacteria 2842243621 2842246368 201
178 iso_pu_bacteria 2842250916 2842254942 201
179 iso_pu_bacteria 2842257432 2842260771 201
180 iso_pu_bacteria 2842264693 2842267844 201
181 iso_pu_bacteria 2842271015 2842276061 201
182 iso_pu_bacteria 2842278818 2842283963 201
183 iso_pu_bacteria 2842285085 2842289840 201
184 iso_pu_bacteria 2842291075 2842295362 201
185 iso_pu_bacteria 2842304105 2842308621 201
186 iso_pu_bacteria 2842311132 2842311951 201
187 iso_pu_bacteria 2842317721 2842319261 201
188 iso_pu_bacteria 2842341865 2842343850 201
189 iso_pu_bacteria 2842363717 2842368223 201
190 iso_pu_bacteria 2842370503 2842375905 201
191 iso_pu_bacteria 2842377471 2842381863 201
192 iso_pu_bacteria 2842384541 2842388831 201
193 iso_pu_bacteria 2842395702 2842396710 201
194 iso_pu_bacteria 2842402390 2842407020 201
195 iso_pu_bacteria 2842409023 2842413912 201
196 iso_pu_bacteria 2842415677 2842420554 201
197 iso_pu_bacteria 2842422224 2842425281 201
198 iso_pu_bacteria 2842428310 2842432006 201
199 iso_pu_bacteria 2842434925 2842438119 201
200 iso_pu_bacteria 2842441272 2842443815 201
201 iso_pu_bacteria 2842447887 2842449923 201
202 iso_pu_bacteria 2842462802 2842469168 201
203 iso_pu_bacteria 2842469257 2842472911 201
204 iso_pu_bacteria 2842489311 2842491707 201
205 iso_pu_bacteria 2842495871 2842502073 201
206 iso_pu_bacteria 2844454524 2844461362 201
207 iso_pu_bacteria 2856320880 2856328126 201
208 iso_pu_bacteria 2856364286 2856367279 201
209 iso_pu_bacteria 2857516855 2857522280 201
210 iso_pu_bacteria 2857531043 2857533830 201
211 iso_pu_bacteria 2869285874 2869287562 201
212 iso_pu_bacteria 2871429161 2871431086 201
213 iso_pu_bacteria 2874139085 2874139198 201
214 iso_pu_bacteria 2874146452 2874150358 201
215 iso_pu_bacteria 2874155637 2874157413 201
216 iso_pu_bacteria 2876377896 2876378712 201
217 iso_pu_bacteria 2876413966 2876416509 201
218 iso_pu_bacteria 2878738818 2878740045 201
219 iso_pu_bacteria 2878745973 2878747699 201
220 iso_pu_bacteria 2888337043 2888342398 201
221 iso_pu_bacteria 2888350351 2888352104 201
222 iso_pu_bacteria 2891373044 2891376180 201
223 iso_pu_bacteria 2903492973 2903498815 201
224 iso_pu_bacteria 2906308376 2906310100 201
225 iso_pu_bacteria 2906321335 2906322972 201
226 iso_pu_bacteria 2906354277 2906357699 201
227 iso_pu_bacteria 2913308742 2913310374 201
228 iso_pu_bacteria 2919100787 2919103332 201
229 iso_pu_bacteria 2919709256 2919711054 201
230 iso_pu_bacteria 2920822456 2920826259 201
231 iso_pu_bacteria 2922130491 2922137050 201
232 iso_pu_bacteria 2922185730 2922187438 201
233 iso_pu_bacteria 2923556063 2923556638 201
234 iso_pu_bacteria 2924776078 2924777644 201
235 iso_pu_bacteria 2933570622 2933575248 201
236 iso_pu_bacteria 2933599457 2933602446 201
237 iso_pu_bacteria 2935894831 2935898419 201
238 iso_pu_bacteria 2936375103 2936378144 201
239 iso_pu_bacteria 2937813078 2937815386 201
240 iso_pu_bacteria 2937877337 2937883863 201
241 iso_pu_bacteria 2937972304 2937976613 201
242 iso_pu_bacteria 2938014810 2938021089 201
243 iso_pu_bacteria 2958041894 2958044401 201
244 iso_pu_bacteria 2958064165 2958069723 201
245 iso_pu_bacteria 2958084443 2958091141 201
246 iso_pu_bacteria 2958130278 2958131964 201
247 iso_pu_bacteria 2958179912 2958181767 201
248 iso_pu_bacteria 2961077736 2961079611 201
249 iso_pu_bacteria 2977843712 2977846614 201
250 iso_pu_bacteria 2977971508 2977972628 201
251 iso_pu_bacteria 2979742915 2979744591 201
252 iso_pu_bacteria 2987652177 2987657138 201
253 iso_pu_bacteria 3000865235 3000868079 201
254 iso_pu_bacteria 3005445848 3005451556 201
255 iso_pu_bacteria 3005452660 3005458148 201
256 iso_pu_bacteria 8004387939 8004390298 201
257 iso_pu_bacteria 8004640170 8004642303 201
258 iso_pu_bacteria 8004714634 8004716362 201
259 iso_pu_bacteria 8005275841 8005276991 201
260 iso_pu_bacteria 8005282627 8005287992 201
261 iso_pu_bacteria 8005289223 8005289462 201
262 iso_pu_bacteria 8005376324 8005382154 201
263 iso_pu_bacteria 8005382845 8005388604 201
264 iso_pu_bacteria 8005395548 8005398035 201
265 iso_pu_bacteria 8005430974 8005431310 201
266 iso_pu_bacteria 8005497431 8005503307 201
267 iso_pu_bacteria 8005542996 8005547665 201
268 iso_pu_bacteria 8005556819 8005561971 201
269 iso_pu_bacteria 8005563573 8005567289 201
270 iso_pu_bacteria 8005570704 8005576161 201
271 iso_pu_bacteria 8005619151 8005625448 201
272 iso_pu_bacteria 8005626139 8005630430 201
273 iso_pu_bacteria 8005668836 8005674825 201
274 iso_pu_bacteria 8018163183 8018165760 201
275 iso_pu_bacteria 8018176218 8018182904 201
276 iso_pu_bacteria 8023680758 8023688365 201
277 iso_pu_bacteria 8024501048 8024503965 201
278 iso_pu_bacteria 8054558443 8054558998 201
279 iso_pu_bacteria 8056382006 8056383137 201
280 3300046519 Ga0495632_0010389 Ga0495632_0010389_3215_3841 202
281 3300048919 Ga0496116_0006977 Ga0496116_0006977_2782_3411 202
282 3300048921 Ga0496118_0027244 Ga0496118_0027244_2608_3237 202
283 3300048925 Ga0496122_0028755 Ga0496122_0028755_2772_3401 202
284 3300048927 Ga0496124_0002161 Ga0496124_0002161_3424_4053 202
285 iso_pu_bacteria 2524023210 2524470033 202
286 iso_pu_bacteria 2582581283 2585167188 202
287 iso_pu_bacteria 2602042107 2603858702 202
288 iso_pu_bacteria 2643221607 2644049968 202
289 iso_pu_bacteria 2643221636 2644203077 202
290 iso_pu_bacteria 2643221637 2644209164 202
291 iso_pu_bacteria 2643221686 2644482834 202
292 iso_pu_bacteria 2643221718 2644652638 202
293 iso_pu_bacteria 2831864461 2831869206 202
294 iso_pu_bacteria 2854896431 2854899999 202
295 iso_pu_bacteria 2854916844 2854922551 202
296 iso_pu_bacteria 2885383462 2885386352 202
297 iso_pu_bacteria 2903768456 2903771410 202
298 iso_pu_bacteria 2928521798 2928525832 202
299 iso_pu_bacteria 2954011201 2954012079 202
300 3300005937 Ga0081455_10167635 Ga0081455_101676352 203
301 3300031901 Ga0307406_10165084 Ga0307406_101650842 203
302 3300049551 Ga0501335_001379 Ga0501335_001379_1093_1752 203
303 3300049658 Ga0501211_004148 Ga0501211_004148_573_1232 203
304 3300049669 Ga0501235_002079 Ga0501235_002079_672_1331 203
305 3300049705 Ga0501225_0020282 Ga0501225_0020282_403_1062 203
306 3300049708 Ga0501245_033902 Ga0501245_033902_38_697 203
307 3300053156 Ga0500622_0139062 Ga0500622_0139062_238_861 203
308 iso_pu_bacteria 2509276021 2509385811 203
309 iso_pu_bacteria 2510461076 2510899925 203
310 iso_pu_bacteria 2510461076 2510900521 203
311 iso_pu_bacteria 2513237162 2514021386 203
312 iso_pu_bacteria 2515154116 2515658031 203
313 iso_pu_bacteria 2515154134 2515742231 203
314 iso_pu_bacteria 2585427526 2585524466 203
315 iso_pu_bacteria 2615840624 2616295061 203
316 iso_pu_bacteria 2643221544 2643745646 203
317 iso_pu_bacteria 2718217882 2719183534 203
318 iso_pu_bacteria 2718218009 2719727975 203
319 iso_pu_bacteria 2718218363 2721144836 203
320 iso_pu_bacteria 2718218365 2721155575 203
321 iso_pu_bacteria 2718218366 2721166923 203
322 iso_pu_bacteria 2721755514 2722837901 203
323 iso_pu_bacteria 2721755810 2724042169 203
324 iso_pu_bacteria 2728369365 2730161674 203
325 iso_pu_bacteria 2728369397 2730300682 203
326 iso_pu_bacteria 2791355256 2793296596 203
327 iso_pu_bacteria 2791355260 2793321529 203
328 iso_pu_bacteria 2791355264 2793346008 203
329 iso_pu_bacteria 2791355265 2793355232 203
330 iso_pu_bacteria 2791355267 2793366712 203
331 iso_pu_bacteria 2838675328 2838677638 203
332 iso_pu_bacteria 2838714209 2838716527 203
333 iso_pu_bacteria 2838719591 2838719673 203
334 iso_pu_bacteria 2838724970 2838727278 203
335 iso_pu_bacteria 2841846520 2841846604 203
336 iso_pu_bacteria 2842124991 2842127367 203
337 iso_pu_bacteria 2842130223 2842132531 203
338 iso_pu_bacteria 2842152218 2842152300 203
339 iso_pu_bacteria 2842170452 2842172773 203
340 iso_pu_bacteria 2842175837 2842175919 203
341 iso_pu_bacteria 2842187318 2842189635 203
342 iso_pu_bacteria 2842211629 2842213949 203
343 iso_pu_bacteria 2842224351 2842224433 203
344 iso_pu_bacteria 2893066018 2893067546 203
345 iso_pu_bacteria 2919114240 2919116744 203
346 iso_pu_bacteria 2926754445 2926754754 203
347 iso_pu_bacteria 2933006813 2933006947 203
348 iso_pu_bacteria 2935901341 2935906859 203
349 iso_pu_bacteria 2968117919 2968120274 203
350 iso_pu_bacteria 2996893221 2996896718 203
351 iso_pu_bacteria 3004203850 3004210503 203
352 iso_pu_bacteria 8005301065 8005305206 203
353 iso_pu_bacteria 8005307578 8005313316 203
354 iso_pu_bacteria 8005688590 8005689228 203
355 iso_pu_bacteria 8018127388 8018127746 203
356 iso_pu_bacteria 8056375014 8056375334 203
357 3300003775 Ga0055524_1042870 Ga0055524_10428701 204
358 3300013102 Ga0157371_10059812 Ga0157371_100598124 204
359 3300013104 Ga0157370_10353536 Ga0157370_103535361 204
360 3300013105 Ga0157369_10089228 Ga0157369_100892284 204
361 3300025299 Ga0209256_1003703 Ga0209256_10037035 204
362 3300031548 Ga0307408_100003096 Ga0307408_10000309613 204
363 3300046457 Ga0495590_0018238 Ga0495590_0018238_163_780 204
364 3300046460 Ga0495638_0000021 Ga0495638_0000021_242695_243327 204
365 3300046506 Ga0495583_0003016 Ga0495583_0003016_735_1367 204
366 3300046519 Ga0495632_0013002 Ga0495632_0013002_823_1455 204
367 3300046524 Ga0495648_0000071 Ga0495648_0000071_122276_122908 204
368 3300046558 Ga0495633_0058461 Ga0495633_0058461_514_1146 204
369 3300046558 Ga0495633_0086162 Ga0495633_0086162_99_725 204
370 3300046692 Ga0495671_0000046 Ga0495671_0000046_122264_122896 204
371 3300046810 Ga0495660_0057083 Ga0495660_0057083_879_1496 204
372 3300047469 Ga0495673_0000066 Ga0495673_0000066_98583_99215 204
373 3300048925 Ga0496122_0048439 Ga0496122_0048439_1594_2217 204
374 3300048927 Ga0496124_0143408 Ga0496124_0143408_32_667 204
375 3300059493 Ga0587077_007056 Ga0587077_007056_532_1152 204
376 iso_pu_bacteria 2510917022 2511137224 204
377 iso_pu_bacteria 2511231027 2511388508 204
378 iso_pu_bacteria 2582581307 2585273386 204
379 iso_pu_bacteria 2585427531 2585564083 204
380 iso_pu_bacteria 2585427609 2585909190 204
381 iso_pu_bacteria 2585428125 2587984708 204
382 iso_pu_bacteria 2600255279 2601609579 204
383 iso_pu_bacteria 2600255308 2601746354 204
384 iso_pu_bacteria 2818991439 2819556902 204
385 iso_pu_bacteria 2842733646 2842734940 204
386 iso_pu_bacteria 2842747753 2842748020 204
387 iso_pu_bacteria 2842871566 2842875381 204
388 iso_pu_bacteria 2933594066 2933594150 204
389 iso_pu_bacteria 2979100975 2979104783 204
390 iso_pu_bacteria 2984509177 2984513417 204
391 iso_pu_bacteria 2984518228 2984520215 204
392 iso_pu_bacteria 2984537506 2984539511 204
393 iso_pu_bacteria 2984601300 2984601738 204
394 iso_pu_bacteria 3002141150 3002145568 204
395 3300002705 JGI25156J39149_1010422 JGI25156J39149_10104222 205
396 3300002739 JGI25158J39367_1000021 JGI25158J39367_100002111 205
397 3300002741 JGI25157J39369_1000850 JGI25157J39369_10008502 205
398 3300002773 JGI25152J39213_1000418 JGI25152J39213_100041826 205
399 3300002773 JGI25152J39213_1002073 JGI25152J39213_10020736 205
400 3300002773 JGI25152J39213_1002786 JGI25152J39213_10027866 205
401 3300002773 JGI25152J39213_1011150 JGI25152J39213_10111501 205
402 3300002773 JGI25152J39213_1011152 JGI25152J39213_10111521 205
403 3300002774 JGI25150J39212_1000022 JGI25150J39212_100002274 205
404 3300002774 JGI25150J39212_1000218 JGI25150J39212_100021820 205
405 3300002774 JGI25150J39212_1023301 JGI25150J39212_10233012 205
406 3300002774 JGI25150J39212_1027816 JGI25150J39212_10278162 205
407 3300002987 JGI25159J45721_1000025 JGI25159J45721_100002532 205
408 3300002987 JGI25159J45721_1000423 JGI25159J45721_10004235 205
409 3300002987 JGI25159J45721_1036051 JGI25159J45721_10360511 205
410 3300003187 JGI25151J46595_10000023 JGI25151J46595_1000002369 205
411 3300003187 JGI25151J46595_10010809 JGI25151J46595_100108094 205
412 3300003214 JGI25165J46597_1000037 JGI25165J46597_1000037230 205
413 3300003215 JGI25153J46596_10000093 JGI25153J46596_1000009348 205
414 3300003215 JGI25153J46596_10011096 JGI25153J46596_100110963 205
415 3300003215 JGI25153J46596_10014572 JGI25153J46596_100145722 205
416 3300003215 JGI25153J46596_10027257 JGI25153J46596_100272571 205
417 3300003215 JGI25153J46596_10027258 JGI25153J46596_100272581 205
418 3300003322 rootL2_10084851 rootL2_100848513 205
419 3300003354 JGI25160J50197_1000065 JGI25160J50197_100006531 205
420 3300003354 JGI25160J50197_1002796 JGI25160J50197_10027967 205
421 3300003354 JGI25160J50197_1012806 JGI25160J50197_10128063 205
422 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002542 205
423 3300003374 JGI25161J50226_1000083 JGI25161J50226_10000836 205
424 3300003771 Ga0055526_1002775 Ga0055526_10027754 205
425 3300003771 Ga0055526_1004470 Ga0055526_10044704 205
426 3300003771 Ga0055526_1027405 Ga0055526_10274052 205
427 3300003775 Ga0055524_1021274 Ga0055524_10212742 205
428 3300003775 Ga0055524_1038290 Ga0055524_10382902 205
429 3300003781 Ga0055536_1023198 Ga0055536_10231982 205
430 3300003781 Ga0055536_1040211 Ga0055536_10402112 205
431 3300003790 Ga0055528_1017639 Ga0055528_10176393 205
432 3300003791 Ga0055530_10009417 Ga0055530_100094172 205
433 3300003791 Ga0055530_10019233 Ga0055530_100192332 205
434 3300003792 Ga0055540_1001782 Ga0055540_10017824 205
435 3300003792 Ga0055540_1003016 Ga0055540_10030163 205
436 3300003794 Ga0055531_10016903 Ga0055531_100169032 205
437 3300004625 Ga0055543_1000134 Ga0055543_100013427 205
438 3300004625 Ga0055543_1000326 Ga0055543_10003269 205
439 3300005262 Ga0065165_1000090 Ga0065165_100009084 205
440 3300005262 Ga0065165_1005679 Ga0065165_10056796 205
441 3300005331 Ga0070670_100584965 Ga0070670_1005849652 205
442 3300005344 Ga0070661_100337915 Ga0070661_1003379152 205
443 3300005353 Ga0070669_100402627 Ga0070669_1004026272 205
444 3300005355 Ga0070671_100044834 Ga0070671_1000448343 205
445 3300005548 Ga0070665_100183096 Ga0070665_1001830961 205
446 3300005578 Ga0068854_100699751 Ga0068854_1006997512 205
447 3300005616 Ga0068852_100063844 Ga0068852_1000638444 205
448 3300006038 Ga0075365_10004326 Ga0075365_100043266 205
449 3300006051 Ga0075364_10013170 Ga0075364_100131702 205
450 3300006177 Ga0075362_10056005 Ga0075362_100560052 205
451 3300006186 Ga0075369_10001052 Ga0075369_100010525 205
452 3300006186 Ga0075369_10035220 Ga0075369_100352202 205
453 3300006353 Ga0075370_10013747 Ga0075370_100137472 205
454 3300006353 Ga0075370_10014662 Ga0075370_100146622 205
455 3300006946 Ga0079104_1000082 Ga0079104_100008283 205
456 3300009011 Ga0105251_10004594 Ga0105251_100045948 205
457 3300009036 Ga0105244_10200189 Ga0105244_102001892 205
458 3300009092 Ga0105250_10072174 Ga0105250_100721742 205
459 3300009093 Ga0105240_11111067 Ga0105240_111110672 205
460 3300009545 Ga0105237_10077887 Ga0105237_100778872 205
461 3300009765 Ga0123341_1085432 Ga0123341_10854322 205
462 3300009766 Ga0123342_1013095 Ga0123342_10130952 205
463 3300010375 Ga0105239_10370387 Ga0105239_103703872 205
464 3300013100 Ga0157373_10049232 Ga0157373_100492322 205
465 3300013104 Ga0157370_10045498 Ga0157370_100454984 205
466 3300013105 Ga0157369_10011473 Ga0157369_100114737 205
467 3300013105 Ga0157369_10643955 Ga0157369_106439552 205
468 3300013296 Ga0157374_11124512 Ga0157374_111245122 205
469 3300014969 Ga0157376_10704159 Ga0157376_107041592 205
470 3300015690 Ga0183363_1132 Ga0183363_113219 205
471 3300025208 Ga0209436_100017 Ga0209436_10001797 205
472 3300025208 Ga0209436_100087 Ga0209436_10008715 205
473 3300025245 Ga0207425_1000038 Ga0207425_1000038159 205
474 3300025245 Ga0207425_1000072 Ga0207425_100007264 205
475 3300025245 Ga0207425_1004423 Ga0207425_10044234 205
476 3300025245 Ga0207425_1008695 Ga0207425_10086952 205
477 3300025245 Ga0207425_1036744 Ga0207425_10367442 205
478 3300025246 Ga0209646_1005780 Ga0209646_10057802 205
479 3300025250 Ga0209026_1000013 Ga0209026_100001313 205
480 3300025256 Ga0209759_1000149 Ga0209759_100014953 205
481 3300025258 Ga0209129_1000016 Ga0209129_1000016188 205
482 3300025258 Ga0209129_1000036 Ga0209129_1000036159 205
483 3300025258 Ga0209129_1001358 Ga0209129_10013588 205
484 3300025258 Ga0209129_1004036 Ga0209129_10040362 205
485 3300025258 Ga0209129_1004638 Ga0209129_10046382 205
486 3300025258 Ga0209129_1011135 Ga0209129_10111352 205
487 3300025261 Ga0209233_1000102 Ga0209233_1000102230 205
488 3300025263 Ga0209565_1000132 Ga0209565_10001322 205
489 3300025263 Ga0209565_1013479 Ga0209565_10134792 205
490 3300025273 Ga0209673_1006166 Ga0209673_10061662 205
491 3300025273 Ga0209673_1021516 Ga0209673_10215163 205
492 3300025273 Ga0209673_1024633 Ga0209673_10246332 205
493 3300025273 Ga0209673_1052149 Ga0209673_10521492 205
494 3300025284 Ga0209130_1000001 Ga0209130_1000001115 205
495 3300025284 Ga0209130_1000079 Ga0209130_100007984 205
496 3300025284 Ga0209130_1021845 Ga0209130_10218452 205
497 3300025292 Ga0209676_1007320 Ga0209676_10073202 205
498 3300025292 Ga0209676_1044823 Ga0209676_10448232 205
499 3300025294 Ga0209025_1000108 Ga0209025_1000108159 205
500 3300025294 Ga0209025_1000177 Ga0209025_1000177102 205
501 3300025294 Ga0209025_1000469 Ga0209025_100046963 205
502 3300025294 Ga0209025_1002058 Ga0209025_100205814 205
503 3300025294 Ga0209025_1007023 Ga0209025_10070233 205
504 3300025294 Ga0209025_1013293 Ga0209025_10132933 205
505 3300025294 Ga0209025_1053533 Ga0209025_10535332 205
506 3300025295 Ga0209564_1000132 Ga0209564_100013229 205
507 3300025295 Ga0209564_1000551 Ga0209564_100055164 205
508 3300025295 Ga0209564_1001535 Ga0209564_10015356 205
509 3300025297 Ga0209758_1000009 Ga0209758_1000009700 205
510 3300025297 Ga0209758_1000104 Ga0209758_100010468 205
511 3300025297 Ga0209758_1001035 Ga0209758_100103523 205
512 3300025297 Ga0209758_1001245 Ga0209758_100124522 205
513 3300025297 Ga0209758_1016436 Ga0209758_10164364 205
514 3300025298 Ga0209050_1000005 Ga0209050_1000005469 205
515 3300025298 Ga0209050_1000195 Ga0209050_100019515 205
516 3300025299 Ga0209256_1007709 Ga0209256_10077095 205
517 3300025299 Ga0209256_1010343 Ga0209256_10103433 205
518 3300025299 Ga0209256_1039988 Ga0209256_10399882 205
519 3300025302 Ga0207426_1000005 Ga0207426_1000005720 205
520 3300025302 Ga0207426_1000167 Ga0207426_100016743 205
521 3300025302 Ga0207426_1003048 Ga0207426_10030487 205
522 3300025302 Ga0207426_1018980 Ga0207426_10189804 205
523 3300025303 Ga0209051_1000414 Ga0209051_100041414 205
524 3300025303 Ga0209051_1001577 Ga0209051_100157710 205
525 3300025303 Ga0209051_1020084 Ga0209051_10200842 205
526 3300025304 Ga0209257_1010894 Ga0209257_10108943 205
527 3300025304 Ga0209257_1011219 Ga0209257_10112193 205
528 3300025304 Ga0209257_1039143 Ga0209257_10391433 205
529 3300025914 Ga0207671_10031678 Ga0207671_100316782 205
530 3300025923 Ga0207681_10438974 Ga0207681_104389742 205
531 3300025924 Ga0207694_10054991 Ga0207694_100549914 205
532 3300025949 Ga0207667_10569986 Ga0207667_105699862 205
533 3300025972 Ga0207668_10247564 Ga0207668_102475642 205
534 3300025981 Ga0207640_10795821 Ga0207640_107958211 205
535 3300026041 Ga0207639_10002789 Ga0207639_100027897 205
536 3300026041 Ga0207639_10027766 Ga0207639_100277663 205
537 3300026142 Ga0207698_10372487 Ga0207698_103724872 205
538 3300027111 Ga0209281_1000043 Ga0209281_100004380 205
539 3300028379 Ga0268266_10088248 Ga0268266_100882483 205
540 3300028379 Ga0268266_11114753 Ga0268266_111147532 205
541 3300028794 Ga0307515_10023533 Ga0307515_100235335 205
542 3300037466 Ga0395898_1029572 Ga0395898_1029572_32_658 205
543 3300037471 Ga0395905_0101077 Ga0395905_0101077_1085_1702 205
544 3300037471 Ga0395905_0349493 Ga0395905_0349493_449_1075 205
545 3300037471 Ga0395905_0391955 Ga0395905_0391955_577_1197 205
546 3300038443 Ga0395901_0048436 Ga0395901_0048436_2667_3293 205
547 3300041413 Ga0439465_0139534 Ga0439465_0139534_171_797 205
548 3300041492 Ga0451835_0808235 Ga0451835_0808235_195_821 205
549 3300041494 Ga0451837_0256684 Ga0451837_0256684_158_778 205
550 3300041511 Ga0451855_0228500 Ga0451855_0228500_845_1465 205
551 3300044658 Ga0466972_0077755 Ga0466972_0077755_552_1178 205
552 3300044735 Ga0466968_0122672 Ga0466968_0122672_496_1122 205
553 3300046460 Ga0495638_0002018 Ga0495638_0002018_8934_9563 205
554 3300046460 Ga0495638_0137808 Ga0495638_0137808_410_1039 205
555 3300046474 Ga0495605_0006188 Ga0495605_0006188_5301_5921 205
556 3300046492 Ga0495585_0018239 Ga0495585_0018239_913_1533 205
557 3300046506 Ga0495583_0013674 Ga0495583_0013674_724_1344 205
558 3300046507 Ga0495606_0038253 Ga0495606_0038253_2029_2649 205
559 3300046512 Ga0495610_0000072 Ga0495610_0000072_74591_75235 205
560 3300046515 Ga0495620_0050277 Ga0495620_0050277_85_705 205
561 3300046522 Ga0495643_0006542 Ga0495643_0006542_4778_5398 205
562 3300046524 Ga0495648_0001207 Ga0495648_0001207_22554_23189 205
563 3300046530 Ga0495654_0000305 Ga0495654_0000305_2737_3357 205
564 3300046615 Ga0495656_0387398 Ga0495656_0387398_46_666 205
565 3300046616 Ga0495668_0149651 Ga0495668_0149651_335_964 205
566 3300046663 Ga0495635_0082080 Ga0495635_0082080_53_673 205
567 3300046674 Ga0495588_0074987 Ga0495588_0074987_639_1262 205
568 3300046691 Ga0495670_0011840 Ga0495670_0011840_464_1093 205
569 3300046694 Ga0495649_0092400 Ga0495649_0092400_912_1532 205
570 3300047317 Ga0495604_0001490 Ga0495604_0001490_11995_12615 205
571 3300047470 Ga0495681_0000043 Ga0495681_0000043_83537_84181 205
572 3300047470 Ga0495681_0163088 Ga0495681_0163088_186_806 205
573 3300047472 Ga0495686_0116556 Ga0495686_0116556_582_1226 205
574 3300048909 Ga0496106_0000221 Ga0496106_0000221_38777_39397 205
575 3300048910 Ga0496107_0034220 Ga0496107_0034220_2187_2816 205
576 3300048912 Ga0496109_0081727 Ga0496109_0081727_1549_2193 205
577 3300048913 Ga0496110_0046668 Ga0496110_0046668_2865_3509 205
578 3300048913 Ga0496110_0311728 Ga0496110_0311728_148_768 205
579 3300048914 Ga0496111_0009028 Ga0496111_0009028_808_1428 205
580 3300048914 Ga0496111_0585395 Ga0496111_0585395_131_775 205
581 3300048916 Ga0496113_0127825 Ga0496113_0127825_471_1091 205
582 3300048919 Ga0496116_0040712 Ga0496116_0040712_1690_2310 205
583 3300048919 Ga0496116_0062334 Ga0496116_0062334_1068_1688 205
584 3300048920 Ga0496117_0019860 Ga0496117_0019860_4664_5284 205
585 3300048920 Ga0496117_0105356 Ga0496117_0105356_642_1262 205
586 3300048920 Ga0496117_0237703 Ga0496117_0237703_153_773 205
587 3300048921 Ga0496118_0062586 Ga0496118_0062586_890_1510 205
588 3300048922 Ga0496119_0263313 Ga0496119_0263313_86_715 205
589 3300048923 Ga0496120_0000435 Ga0496120_0000435_1200_1826 205
590 3300048924 Ga0496121_0005816 Ga0496121_0005816_1612_2241 205
591 3300048924 Ga0496121_0013804 Ga0496121_0013804_7130_7750 205
592 3300048924 Ga0496121_0019043 Ga0496121_0019043_597_1217 205
593 3300048924 Ga0496121_0057152 Ga0496121_0057152_876_1496 205
594 3300048924 Ga0496121_0075156 Ga0496121_0075156_1995_2615 205
595 3300048924 Ga0496121_0144262 Ga0496121_0144262_457_1086 205
596 3300048924 Ga0496121_0430624 Ga0496121_0430624_108_734 205
597 3300048925 Ga0496122_0000106 Ga0496122_0000106_32471_33091 205
598 3300048925 Ga0496122_0000606 Ga0496122_0000606_17770_18390 205
599 3300048925 Ga0496122_0008697 Ga0496122_0008697_9615_10235 205
600 3300048925 Ga0496122_0010098 Ga0496122_0010098_948_1568 205
601 3300048925 Ga0496122_0026617 Ga0496122_0026617_1070_1690 205
602 3300048925 Ga0496122_0176778 Ga0496122_0176778_473_1093 205
603 3300048926 Ga0496123_0000022 Ga0496123_0000022_329066_329686 205
604 3300048926 Ga0496123_0000450 Ga0496123_0000450_17820_18440 205
605 3300048926 Ga0496123_0026040 Ga0496123_0026040_2991_3611 205
606 3300048926 Ga0496123_0206454 Ga0496123_0206454_12_632 205
607 3300048927 Ga0496124_0000153 Ga0496124_0000153_121965_122585 205
608 3300048927 Ga0496124_0017079 Ga0496124_0017079_730_1350 205
609 3300048927 Ga0496124_0050747 Ga0496124_0050747_535_1155 205
610 3300048927 Ga0496124_0231221 Ga0496124_0231221_601_1221 205
611 3300048928 Ga0496125_0003083 Ga0496125_0003083_2432_3052 205
612 3300048928 Ga0496125_0027217 Ga0496125_0027217_2916_3536 205
613 3300048928 Ga0496125_0131552 Ga0496125_0131552_112_732 205
614 3300048928 Ga0496125_0176396 Ga0496125_0176396_196_840 205
615 3300048929 Ga0496126_0009081 Ga0496126_0009081_1204_1824 205
616 3300048929 Ga0496126_0023157 Ga0496126_0023157_1440_2069 205
617 3300048929 Ga0496126_0041231 Ga0496126_0041231_2978_3604 205
618 3300048929 Ga0496126_0196024 Ga0496126_0196024_767_1387 205
619 3300048929 Ga0496126_0419398 Ga0496126_0419398_144_773 205
620 3300049568 Ga0501031_0013477 Ga0501031_0013477_2378_3004 205
621 3300049569 Ga0501032_0018503 Ga0501032_0018503_3807_4433 205
622 3300049570 Ga0501033_0019187 Ga0501033_0019187_3765_4391 205
623 3300049571 Ga0501034_0025864 Ga0501034_0025864_1545_2171 205
624 3300049573 Ga0501037_0021179 Ga0501037_0021179_371_997 205
625 3300049574 Ga0501038_0223447 Ga0501038_0223447_133_759 205
626 3300049575 Ga0501039_0035281 Ga0501039_0035281_1451_2077 205
627 3300049578 Ga0501042_0075686 Ga0501042_0075686_743_1369 205
628 3300049579 Ga0501043_0014731 Ga0501043_0014731_1690_2316 205
629 3300049580 Ga0501046_0128085 Ga0501046_0128085_414_1034 205
630 3300049580 Ga0501046_0129379 Ga0501046_0129379_547_1173 205
631 3300049581 Ga0501047_0115538 Ga0501047_0115538_133_759 205
632 3300049582 Ga0501048_0138979 Ga0501048_0138979_719_1345 205
633 3300049584 Ga0501068_0080606 Ga0501068_0080606_742_1368 205
634 3300049586 Ga0501070_0069974 Ga0501070_0069974_565_1191 205
635 3300049587 Ga0501071_0273097 Ga0501071_0273097_70_696 205
636 3300049590 Ga0501074_0251043 Ga0501074_0251043_270_896 205
637 3300049663 Ga0501223_000004 Ga0501223_000004_83619_84263 205
638 3300049676 Ga0501246_000533 Ga0501246_000533_1898_2542 205
639 3300049705 Ga0501225_0000003 Ga0501225_0000003_56580_57224 205
640 3300049705 Ga0501225_0009427 Ga0501225_0009427_1168_1812 205
641 3300049742 Ga0501080_0222342 Ga0501080_0222342_465_1091 205
642 3300049744 Ga0501083_0046580 Ga0501083_0046580_775_1395 205
643 3300049822 Ga0501035_0149495 Ga0501035_0149495_780_1406 205
644 3300049823 Ga0501044_0043203 Ga0501044_0043203_750_1376 205
645 3300049824 Ga0501045_0146975 Ga0501045_0146975_413_1039 205
646 3300050491 nmdc:mga00v17_588_c1 nmdc:mga00v17_588_c1_4661_5281 205
647 3300050492 nmdc:mga0yw44_328923_c1 nmdc:mga0yw44_328923_c1_160_786 205
648 3300050496 nmdc:mga07m45_30198_c1 nmdc:mga07m45_30198_c1_1766_2395 205
649 3300053077 Ga0495601_0324768 Ga0495601_0324768_100_720 205
650 3300053086 Ga0500578_0073555 Ga0500578_0073555_101_721 205
651 3300053109 Ga0500569_045282 Ga0500569_045282_77_697 205
652 3300053118 Ga0500594_0029356 Ga0500594_0029356_31_657 205
653 3300053121 Ga0500607_013879 Ga0500607_013879_788_1417 205
654 3300053122 Ga0500608_085643 Ga0500608_085643_109_729 205
655 3300053125 Ga0500618_001236 Ga0500618_001236_1199_1819 205
656 3300053134 Ga0500658_0035794 Ga0500658_0035794_366_986 205
657 3300053136 Ga0500559_0007386 Ga0500559_0007386_3677_4306 205
658 3300053151 Ga0500604_0131728 Ga0500604_0131728_171_794 205
659 3300053153 Ga0500616_0022506 Ga0500616_0022506_2414_3034 205
660 3300053153 Ga0500616_0183750 Ga0500616_0183750_212_832 205
661 3300053156 Ga0500622_0000104 Ga0500622_0000104_4740_5360 205
662 3300053158 Ga0500627_0049177 Ga0500627_0049177_789_1409 205
663 3300053158 Ga0500627_0095729 Ga0500627_0095729_574_1194 205
664 3300053177 Ga0500636_0000526 Ga0500636_0000526_3371_4000 205
665 3300053178 Ga0500637_0030710 Ga0500637_0030710_605_1234 205
666 3300059503 Ga0587080_036369 Ga0587080_036369_241_861 205
667 iso_pu_bacteria 8054002106 8054007964 205
668 3300003322 rootL2_10000310 rootL2_100003107 206
669 3300003775 Ga0055524_1000762 Ga0055524_10007622 206
670 3300003775 Ga0055524_1007093 Ga0055524_10070932 206
671 3300003791 Ga0055530_10016666 Ga0055530_100166662 206
672 3300003792 Ga0055540_1008873 Ga0055540_10088732 206
673 3300003794 Ga0055531_10000203 Ga0055531_1000020350 206
674 3300003794 Ga0055531_10011813 Ga0055531_100118135 206
675 3300005337 Ga0070682_100430668 Ga0070682_1004306682 206
676 3300005356 Ga0070674_100128781 Ga0070674_1001287813 206
677 3300005548 Ga0070665_100054885 Ga0070665_1000548853 206
678 3300005614 Ga0068856_100219009 Ga0068856_1002190093 206
679 3300006051 Ga0075364_10018250 Ga0075364_100182505 206
680 3300006177 Ga0075362_10192458 Ga0075362_101924582 206
681 3300006178 Ga0075367_10158360 Ga0075367_101583602 206
682 3300006195 Ga0075366_10018751 Ga0075366_100187512 206
683 3300006353 Ga0075370_10022652 Ga0075370_100226525 206
684 3300006944 Ga0099823_1000478 Ga0099823_100047815 206
685 3300009176 Ga0105242_11261179 Ga0105242_112611791 206
686 3300012497 Ga0157319_1000008 Ga0157319_1000008169 206
687 3300025242 Ga0209258_108353 Ga0209258_1083532 206
688 3300025245 Ga0207425_1029722 Ga0207425_10297222 206
689 3300025273 Ga0209673_1023214 Ga0209673_10232142 206
690 3300025284 Ga0209130_1033398 Ga0209130_10333982 206
691 3300025295 Ga0209564_1000008 Ga0209564_1000008569 206
692 3300025295 Ga0209564_1005534 Ga0209564_10055343 206
693 3300025298 Ga0209050_1002935 Ga0209050_10029359 206
694 3300025298 Ga0209050_1003178 Ga0209050_10031786 206
695 3300025299 Ga0209256_1001049 Ga0209256_10010492 206
696 3300025303 Ga0209051_1000960 Ga0209051_100096021 206
697 3300025304 Ga0209257_1000017 Ga0209257_1000017648 206
698 3300025304 Ga0209257_1002056 Ga0209257_10020563 206
699 3300025304 Ga0209257_1008974 Ga0209257_10089742 206
700 3300025913 Ga0207695_10218637 Ga0207695_102186373 206
701 3300025926 Ga0207659_10040742 Ga0207659_100407422 206
702 3300025934 Ga0207686_10722121 Ga0207686_107221211 206
703 3300025937 Ga0207669_10197804 Ga0207669_101978041 206
704 3300026078 Ga0207702_10081048 Ga0207702_100810484 206
705 3300027296 Ga0209389_1041846 Ga0209389_10418462 206
706 3300027312 Ga0209371_1011474 Ga0209371_10114742 206
707 3300028379 Ga0268266_10651588 Ga0268266_106515882 206
708 3300028794 Ga0307515_10338826 Ga0307515_103388262 206
709 3300030500 Ga0268256_1016310 Ga0268256_10163102 206
710 3300030744 Ga0316181_1111885 Ga0316181_11118852 206
711 3300032005 Ga0307411_10002074 Ga0307411_1000207411 206
712 3300034819 Ga0373958_0008235 Ga0373958_0008235_281_904 206
713 3300035088 Ga0373940_0046997 Ga0373940_0046997_297_920 206
714 3300035114 Ga0373939_0000071 Ga0373939_0000071_13674_14297 206
715 3300035121 Ga0373960_0000615 Ga0373960_0000615_6598_7221 206
716 3300035241 Ga0373961_0025877 Ga0373961_0025877_652_1275 206
717 3300035242 Ga0373962_0055010 Ga0373962_0055010_173_796 206
718 3300035691 Ga0373931_0000591 Ga0373931_0000591_6767_7390 206
719 3300037418 Ga0395900_0327253 Ga0395900_0327253_336_962 206
720 3300044694 Ga0466963_0369659 Ga0466963_0369659_245_868 206
721 3300045051 Ga0451576_0162985 Ga0451576_0162985_833_1453 206
722 3300046460 Ga0495638_0119057 Ga0495638_0119057_367_999 206
723 3300046501 Ga0495607_0045477 Ga0495607_0045477_1087_1719 206
724 3300046694 Ga0495649_0003186 Ga0495649_0003186_8923_9555 206
725 3300048919 Ga0496116_0002755 Ga0496116_0002755_16549_17178 206
726 3300048920 Ga0496117_0005379 Ga0496117_0005379_12184_12813 206
727 3300048921 Ga0496118_0070256 Ga0496118_0070256_1630_2259 206
728 3300048925 Ga0496122_0115100 Ga0496122_0115100_518_1147 206
729 3300048927 Ga0496124_0108789 Ga0496124_0108789_755_1384 206
730 3300048927 Ga0496124_0303216 Ga0496124_0303216_76_699 206
731 3300049538 Ga0501322_000536 Ga0501322_000536_601_1224 206
732 3300049665 Ga0501227_019145 Ga0501227_019145_912_1535 206
733 3300050491 nmdc:mga00v17_172932_c1 nmdc:mga00v17_172932_c1_34_657 206
734 3300050491 nmdc:mga00v17_70872_c1 nmdc:mga00v17_70872_c1_61_690 206
735 3300050492 nmdc:mga0yw44_48090_c1 nmdc:mga0yw44_48090_c1_419_1048 206
736 3300050516 nmdc:mga0sz30_57345_c1 nmdc:mga0sz30_57345_c1_621_1250 206
737 3300053136 Ga0500559_0068519 Ga0500559_0068519_606_1235 206
738 3300053145 Ga0500586_019243 Ga0500586_019243_921_1550 206
739 3300053177 Ga0500636_0019536 Ga0500636_0019536_2883_3530 206
740 3300053723 Ga0500567_118430 Ga0500567_118430_275_904 206
741 3300003794 Ga0055531_10000322 Ga0055531_1000032217 207
742 3300003856 Ga0058692_1001200 Ga0058692_10012005 207
743 3300005353 Ga0070669_100011939 Ga0070669_1000119394 207
744 3300005355 Ga0070671_100540083 Ga0070671_1005400831 207
745 3300005364 Ga0070673_100137144 Ga0070673_1001371442 207
746 3300005844 Ga0068862_100363292 Ga0068862_1003632922 207
747 3300006051 Ga0075364_10141012 Ga0075364_101410121 207
748 3300006948 Ga0099826_10000533 Ga0099826_1000053315 207
749 3300009177 Ga0105248_10325654 Ga0105248_103256543 207
750 3300014326 Ga0157380_10126356 Ga0157380_101263563 207
751 3300014497 Ga0182008_10000625 Ga0182008_1000062526 207
752 3300025273 Ga0209673_1069612 Ga0209673_10696122 207
753 3300025303 Ga0209051_1000244 Ga0209051_100024476 207
754 3300025304 Ga0209257_1000144 Ga0209257_1000144103 207
755 3300025923 Ga0207681_10005851 Ga0207681_100058514 207
756 3300025931 Ga0207644_11089726 Ga0207644_110897261 207
757 3300025941 Ga0207711_10225102 Ga0207711_102251023 207
758 3300025960 Ga0207651_10015272 Ga0207651_100152723 207
759 3300026116 Ga0207674_11083226 Ga0207674_110832261 207
760 3300027312 Ga0209371_1000009 Ga0209371_1000009916 207
761 3300027666 Ga0209282_1001912 Ga0209282_10019127 207
762 3300028794 Ga0307515_10055417 Ga0307515_100554175 207
763 3300030500 Ga0268256_1000010 Ga0268256_1000010915 207
764 3300042007 Ga0439449_0086064 Ga0439449_0086064_148_786 207
765 3300042134 Ga0450898_034874 Ga0450898_034874_275_898 207
766 3300045976 Ga0466967_1333764 Ga0466967_1333764_55_678 207
767 3300046539 Ga0495621_0084288 Ga0495621_0084288_259_885 207
768 3300048907 Ga0496104_0145409 Ga0496104_0145409_992_1618 207
769 3300048919 Ga0496116_0042347 Ga0496116_0042347_956_1582 207
770 3300048920 Ga0496117_0091671 Ga0496117_0091671_309_935 207
771 3300048921 Ga0496118_0080497 Ga0496118_0080497_1565_2197 207
772 3300048921 Ga0496118_0131942 Ga0496118_0131942_259_885 207
773 3300048923 Ga0496120_0063014 Ga0496120_0063014_579_1205 207
774 3300048928 Ga0496125_0157425 Ga0496125_0157425_776_1402 207
775 3300050516 nmdc:mga0sz30_37484_c1 nmdc:mga0sz30_37484_c1_336_962 207
776 3300053096 Ga0500641_0240519 Ga0500641_0240519_72_698 207
777 3300053125 Ga0500618_012564 Ga0500618_012564_834_1466 207
778 3300059641 Ga0587068_013114 Ga0587068_013114_257_883 207
779 3300059645 Ga0587076_018853 Ga0587076_018853_235_861 207
780 3300005353 Ga0070669_100071077 Ga0070669_1000710774 208
781 3300005563 Ga0068855_100259943 Ga0068855_1002599432 208
782 3300031731 Ga0307405_10359122 Ga0307405_103591222 208
783 3300037471 Ga0395905_0053525 Ga0395905_0053525_350_985 208
784 3300046491 Ga0495584_0076721 Ga0495584_0076721_766_1401 208
785 3300046513 Ga0495616_0080367 Ga0495616_0080367_862_1497 208
786 3300046538 Ga0495609_0093554 Ga0495609_0093554_22_657 208
787 3300046558 Ga0495633_0089905 Ga0495633_0089905_192_827 208
788 3300046616 Ga0495668_0006163 Ga0495668_0006163_817_1452 208
789 3300047323 Ga0495683_0000007 Ga0495683_0000007_168820_169482 208
790 3300048925 Ga0496122_0000238 Ga0496122_0000238_12529_13170 208
791 3300048926 Ga0496123_0000262 Ga0496123_0000262_3466_4107 208
792 3300048927 Ga0496124_0279629 Ga0496124_0279629_120_761 208
793 3300049671 Ga0501238_016729 Ga0501238_016729_159_797 208
794 3300037471 Ga0395905_0163015 Ga0395905_0163015_954_1631 209
795 3300037471 Ga0395905_0624689 Ga0395905_0624689_199_870 209
796 3300059493 Ga0587077_038376 Ga0587077_038376_68_742 209
797 2162886007 SwRhRL2b_contig_1046040 SwRhRL2b_0866.00002400 210
798 2162886007 SwRhRL2b_contig_3838869 SwRhRL2b_0610.00006260 210
799 3300048925 Ga0496122_0020278 Ga0496122_0020278_3669_4301 210
800 iso_pu_bacteria 2738543012 2739246566 210
801 iso_pu_bacteria 2816332133 2816476129 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

93

179

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8793 46 202
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8728 30 210
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8554 30 210
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8499 29 205
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.829 26 205
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8589 26 210 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8584 29 205 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8505 26 210 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8401 31 205 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8239 29 205 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A2M9TGN6-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9488 61 210 GO:0004129
GO:0005886
GO:0009486
GO:0019646
GO:0020037
AF-X8DTB9-F1-model_v4 Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9432 79 205 GO:0004129
GO:0005886
GO:0019646
AF-A0A6F8XYK9-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.94 68 207 GO:0004129
GO:0005886
GO:0019646
AF-A0A316WCB9-F1-model_v4 Cytochrome o ubiquinol oxidase subunit III 0.9335 59 202 GO:0004129
GO:0005886
GO:0019646
AF-A0A2D9N6L4-F1-model_v4 Nitric oxide reductase 0.9329 70 206 GO:0004129
GO:0005886
GO:0019646

Feature Viewer

pLDDT pTM Quality
77.74 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map