F481422
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 801 | 577 | 500 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300042015|Ga0439462_0012282|Ga0439462_0012282_1506_2135 |
| Length | 181 |
| Sequence | MSESIALTRADGSPVFIDTTGQHHPQNGTLFGFWLYLLSDLMIFACLFATYGVLGRSYAAGPSGADLFDLSLVALNTAILLLSSITYGFAMIAMQFAHLIHLGAGPQRSAFLSSFFALVGTHGLHVSFGIIWLVTLMVQVAKYGLTAANQRRLFCLSMFWHFLDVVWIGVFTFVYLMGVLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 11 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 12 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 15 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 16 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 17 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 18 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 19 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 20 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 21 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 22 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 23 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 24 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 25 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 26 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 27 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 28 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 29 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 30 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 31 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 32 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 33 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 34 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 35 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 36 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 37 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 38 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 39 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 40 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 41 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 42 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 43 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 44 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 45 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 46 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 47 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 48 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 49 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 50 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 51 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 52 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 53 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 54 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 55 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 56 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 57 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 58 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 59 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 60 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 61 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 62 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 63 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 64 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 65 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 66 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 67 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 68 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 69 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 70 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 71 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 72 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 73 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 74 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 75 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 76 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 77 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 78 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 79 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 80 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 81 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 82 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 83 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 84 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 85 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 86 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 87 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 88 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 89 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 90 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 91 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 92 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 93 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 94 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 95 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 96 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 97 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 98 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 99 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 100 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 101 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 102 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 103 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 104 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 105 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 106 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 107 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 108 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 109 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 110 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 111 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 112 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 113 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 114 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 115 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 116 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 117 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 118 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 119 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 120 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 121 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 122 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 123 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 124 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 125 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 126 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 127 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 128 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 129 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 130 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 131 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 132 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 133 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 134 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 135 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 136 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 137 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 138 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 139 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 140 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 141 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 142 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 143 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 144 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 145 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 146 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 147 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 148 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 149 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 150 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 151 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 152 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 153 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 154 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 155 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 156 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 157 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 158 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 159 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 160 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 161 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 162 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 163 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 164 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 165 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 166 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 167 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 168 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 169 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 170 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 171 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 172 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 173 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 174 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 175 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 176 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 177 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 178 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 179 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 180 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 181 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 182 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 183 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 184 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 185 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 186 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 187 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 188 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 189 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 190 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 191 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 192 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 193 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 194 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 195 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 196 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 197 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 198 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 199 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 200 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 201 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 202 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 203 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 204 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 205 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 206 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 207 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 208 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 209 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 210 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 211 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 212 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 213 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 214 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 215 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 216 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 217 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 218 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 219 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 220 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 221 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 222 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 223 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 224 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 225 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 226 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 227 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 228 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 229 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 230 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 231 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 232 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 233 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 234 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 235 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 236 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 237 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 238 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 239 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 240 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 241 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 242 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 243 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 244 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 245 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 246 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 247 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 248 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 249 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 250 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 251 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 252 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 253 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 254 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 255 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 256 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 257 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 258 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 259 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 260 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 261 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 262 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 263 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 264 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 265 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 266 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 267 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 268 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 269 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 270 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 271 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 272 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 273 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 274 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 275 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 276 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 277 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 278 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 279 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 280 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 281 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 282 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 283 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 284 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 285 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 286 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 287 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 288 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 289 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 290 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 291 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 292 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 293 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 294 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 295 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 296 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 298 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 301 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 305 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 307 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 309 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 310 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 311 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 312 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 313 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 314 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 315 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 316 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 317 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 318 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 319 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 320 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 321 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 322 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 323 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 324 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 334 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 335 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 337 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 344 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 346 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 347 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 351 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 352 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 353 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 354 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 355 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 357 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 362 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 365 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 393 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 394 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 396 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 398 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 399 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 400 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 401 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 402 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 403 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 404 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 405 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 406 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 407 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 408 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 409 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 410 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 411 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 412 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 413 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 414 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 415 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 416 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 417 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 418 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 419 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 420 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 421 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 422 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 423 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 424 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 425 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 426 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 427 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 428 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 429 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 430 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 464 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 465 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 466 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 468 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 469 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 470 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 471 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 472 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 473 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 474 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 475 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 476 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 477 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 478 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 479 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 480 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 481 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 501 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 502 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 503 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 504 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 505 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 506 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 507 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 508 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 514 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 515 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 516 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 517 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 518 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 519 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 520 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 522 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 523 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 524 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 525 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 526 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 527 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 528 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 529 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 530 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 533 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 534 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 536 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 537 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 538 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 539 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 541 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 542 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 547 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 548 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 549 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 550 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 551 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 552 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 553 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 554 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 555 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 556 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 557 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 558 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 559 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 560 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 561 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 562 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 563 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 564 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 565 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 566 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 567 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 568 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 569 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 570 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 571 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 572 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 573 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 574 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 575 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 576 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 577 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 61.55 |
| Metatranscriptomes | 0.87 |
| Isolates | 37.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 22.6 |
| Nodule | 26.22 |
| Rhizoplane | 2 |
| Rhizosphere | 31.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1046040 | 2162886007 | Bacteria | 1500 |
| 2 | SwRhRL2b_contig_3838869 | 2162886007 | Bacteria | 1511 |
| 3 | JGI24741J21665_1000064 | 3300001915 | Bacteria | 25832 |
| 4 | JGI24740J21852_10002340 | 3300001979 | Bacteria | 8625 |
| 5 | JGI24740J21852_10059251 | 3300001979 | Bacteria | 1062 |
| 6 | JGI24739J22299_10009520 | 3300001989 | Bacteria | 3620 |
| 7 | JGI25156J39149_1010422 | 3300002705 | Bacteria | 2186 |
| 8 | JGI25158J39367_1000021 | 3300002739 | Bacteria | 39295 |
| 9 | JGI25157J39369_1000850 | 3300002741 | Bacteria | 15042 |
| 10 | JGI25152J39213_1000418 | 3300002773 | Bacteria | 25621 |
| 11 | JGI25152J39213_1002073 | 3300002773 | Bacteria | 7889 |
| 12 | JGI25152J39213_1002786 | 3300002773 | Bacteria | 6323 |
| 13 | JGI25152J39213_1011150 | 3300002773 | Bacteria | 2006 |
| 14 | JGI25152J39213_1011152 | 3300002773 | Bacteria | 2006 |
| 15 | JGI25150J39212_1000022 | 3300002774 | Bacteria | 131963 |
| 16 | JGI25150J39212_1000218 | 3300002774 | Bacteria | 31294 |
| 17 | JGI25150J39212_1023301 | 3300002774 | Bacteria | 921 |
| 18 | JGI25150J39212_1027816 | 3300002774 | Bacteria | 806 |
| 19 | JGI25159J45721_1000025 | 3300002987 | Bacteria | 115802 |
| 20 | JGI25159J45721_1000423 | 3300002987 | Bacteria | 19499 |
| 21 | JGI25159J45721_1036051 | 3300002987 | Bacteria | 752 |
| 22 | JGI25151J46595_10000023 | 3300003187 | Bacteria | 221548 |
| 23 | JGI25151J46595_10010809 | 3300003187 | Bacteria | 4223 |
| 24 | JGI25165J46597_1000037 | 3300003214 | Bacteria | 285722 |
| 25 | JGI25153J46596_10000093 | 3300003215 | Bacteria | 103442 |
| 26 | JGI25153J46596_10011096 | 3300003215 | Bacteria | 4011 |
| 27 | JGI25153J46596_10014572 | 3300003215 | Bacteria | 3258 |
| 28 | JGI25153J46596_10027257 | 3300003215 | Bacteria | 2006 |
| 29 | JGI25153J46596_10027258 | 3300003215 | Bacteria | 2006 |
| 30 | rootL2_10000310 | 3300003322 | Bacteria | 31146 |
| 31 | rootL2_10084851 | 3300003322 | Bacteria | 1387 |
| 32 | JGI25160J50197_1000065 | 3300003354 | Bacteria | 115802 |
| 33 | JGI25160J50197_1002796 | 3300003354 | Bacteria | 7990 |
| 34 | JGI25160J50197_1012806 | 3300003354 | Bacteria | 2890 |
| 35 | JGI25161J50226_1000025 | 3300003374 | Bacteria | 148471 |
| 36 | JGI25161J50226_1000083 | 3300003374 | Bacteria | 77211 |
| 37 | Ga0055532_1011812 | 3300003758 | Bacteria | 1021 |
| 38 | Ga0055526_1002775 | 3300003771 | Bacteria | 11605 |
| 39 | Ga0055526_1004470 | 3300003771 | Bacteria | 8384 |
| 40 | Ga0055526_1027405 | 3300003771 | Bacteria | 1761 |
| 41 | Ga0055524_1000762 | 3300003775 | Bacteria | 21684 |
| 42 | Ga0055524_1007093 | 3300003775 | Bacteria | 4804 |
| 43 | Ga0055524_1021274 | 3300003775 | Bacteria | 2155 |
| 44 | Ga0055524_1038290 | 3300003775 | Bacteria | 1257 |
| 45 | Ga0055524_1042870 | 3300003775 | Bacteria | 1120 |
| 46 | Ga0055536_1023198 | 3300003781 | Bacteria | 1830 |
| 47 | Ga0055536_1040211 | 3300003781 | Bacteria | 1115 |
| 48 | Ga0055528_1017639 | 3300003790 | Bacteria | 2464 |
| 49 | Ga0055530_10009417 | 3300003791 | Bacteria | 3755 |
| 50 | Ga0055530_10016666 | 3300003791 | Bacteria | 2335 |
| 51 | Ga0055530_10019233 | 3300003791 | Bacteria | 2074 |
| 52 | Ga0055540_1001782 | 3300003792 | Bacteria | 12266 |
| 53 | Ga0055540_1003016 | 3300003792 | Bacteria | 8420 |
| 54 | Ga0055540_1008873 | 3300003792 | Bacteria | 3559 |
| 55 | Ga0055531_10000203 | 3300003794 | Bacteria | 65490 |
| 56 | Ga0055531_10000322 | 3300003794 | Bacteria | 47122 |
| 57 | Ga0055531_10011813 | 3300003794 | Bacteria | 4169 |
| 58 | Ga0055531_10016903 | 3300003794 | Bacteria | 3115 |
| 59 | Ga0058692_1001200 | 3300003856 | Bacteria | 9928 |
| 60 | Ga0055543_1000134 | 3300004625 | Bacteria | 61585 |
| 61 | Ga0055543_1000326 | 3300004625 | Bacteria | 32775 |
| 62 | Ga0065165_1000090 | 3300005262 | Bacteria | 150368 |
| 63 | Ga0065165_1005679 | 3300005262 | Bacteria | 6879 |
| 64 | Ga0070670_100584965 | 3300005331 | Bacteria | 998 |
| 65 | Ga0070682_100430668 | 3300005337 | Bacteria | 1005 |
| 66 | Ga0070661_100337915 | 3300005344 | Bacteria | 1179 |
| 67 | Ga0070669_100011939 | 3300005353 | Bacteria | 6163 |
| 68 | Ga0070669_100071077 | 3300005353 | Bacteria | 2574 |
| 69 | Ga0070669_100402627 | 3300005353 | Bacteria | 1120 |
| 70 | Ga0070671_100044834 | 3300005355 | Bacteria | 3674 |
| 71 | Ga0070671_100540083 | 3300005355 | Bacteria | 1005 |
| 72 | Ga0070674_100128781 | 3300005356 | Bacteria | 1884 |
| 73 | Ga0070673_100137144 | 3300005364 | Bacteria | 2060 |
| 74 | Ga0070663_100006514 | 3300005455 | Bacteria | 7031 |
| 75 | Ga0068853_100018368 | 3300005539 | Bacteria | 5787 |
| 76 | Ga0070665_100054885 | 3300005548 | Bacteria | 3995 |
| 77 | Ga0070665_100183096 | 3300005548 | Bacteria | 2095 |
| 78 | Ga0068855_100259943 | 3300005563 | Bacteria | 1934 |
| 79 | Ga0070664_100039149 | 3300005564 | Bacteria | 3993 |
| 80 | Ga0068854_100699751 | 3300005578 | Bacteria | 874 |
| 81 | Ga0068856_100006903 | 3300005614 | Bacteria | 11102 |
| 82 | Ga0068856_100219009 | 3300005614 | Bacteria | 1919 |
| 83 | Ga0068852_100063844 | 3300005616 | Bacteria | 3207 |
| 84 | Ga0068852_100798937 | 3300005616 | Bacteria | 957 |
| 85 | Ga0068851_10007544 | 3300005834 | Bacteria | 4998 |
| 86 | Ga0068862_100363292 | 3300005844 | Bacteria | 1346 |
| 87 | Ga0081455_10167635 | 3300005937 | Bacteria | 1676 |
| 88 | Ga0075365_10004326 | 3300006038 | Bacteria | 7501 |
| 89 | Ga0075364_10013170 | 3300006051 | Bacteria | 5076 |
| 90 | Ga0075364_10018250 | 3300006051 | Bacteria | 4390 |
| 91 | Ga0075364_10141012 | 3300006051 | Bacteria | 1621 |
| 92 | Ga0075362_10056005 | 3300006177 | Bacteria | 1774 |
| 93 | Ga0075362_10192458 | 3300006177 | Bacteria | 991 |
| 94 | Ga0075367_10158360 | 3300006178 | Bacteria | 1408 |
| 95 | Ga0075367_10184098 | 3300006178 | Bacteria | 1302 |
| 96 | Ga0075369_10001052 | 3300006186 | Bacteria | 9232 |
| 97 | Ga0075369_10035220 | 3300006186 | Bacteria | 2127 |
| 98 | Ga0075366_10018751 | 3300006195 | Bacteria | 3997 |
| 99 | Ga0075370_10013747 | 3300006353 | Bacteria | 4308 |
| 100 | Ga0075370_10014662 | 3300006353 | Bacteria | 4185 |
| 101 | Ga0075370_10022652 | 3300006353 | Bacteria | 3452 |
| 102 | Ga0099823_1000478 | 3300006944 | Bacteria | 26702 |
| 103 | Ga0079104_1000082 | 3300006946 | Bacteria | 137722 |
| 104 | Ga0099826_10000533 | 3300006948 | Bacteria | 18821 |
| 105 | Ga0105251_10004594 | 3300009011 | Bacteria | 9333 |
| 106 | Ga0105251_10064097 | 3300009011 | Bacteria | 1723 |
| 107 | Ga0105244_10200189 | 3300009036 | Bacteria | 942 |
| 108 | Ga0105250_10072174 | 3300009092 | Bacteria | 1395 |
| 109 | Ga0105240_10214657 | 3300009093 | Bacteria | 2245 |
| 110 | Ga0105240_11111067 | 3300009093 | Bacteria | 841 |
| 111 | Ga0105241_10000625 | 3300009174 | Bacteria | 26580 |
| 112 | Ga0105242_11261179 | 3300009176 | Bacteria | 761 |
| 113 | Ga0105248_10325654 | 3300009177 | Bacteria | 1731 |
| 114 | Ga0105237_10049124 | 3300009545 | Bacteria | 4242 |
| 115 | Ga0105237_10077887 | 3300009545 | Bacteria | 3305 |
| 116 | Ga0105249_10528495 | 3300009553 | Bacteria | 1228 |
| 117 | Ga0123341_1085432 | 3300009765 | Bacteria | 1188 |
| 118 | Ga0123342_1013095 | 3300009766 | Bacteria | 8416 |
| 119 | Ga0105239_10370387 | 3300010375 | Bacteria | 1619 |
| 120 | Ga0105239_10526029 | 3300010375 | Bacteria | 1346 |
| 121 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 122 | Ga0157373_10049232 | 3300013100 | Bacteria | 3003 |
| 123 | Ga0157371_10059812 | 3300013102 | Bacteria | 2701 |
| 124 | Ga0157370_10045498 | 3300013104 | Bacteria | 4210 |
| 125 | Ga0157370_10066012 | 3300013104 | Bacteria | 3423 |
| 126 | Ga0157370_10353536 | 3300013104 | Bacteria | 1354 |
| 127 | Ga0157369_10011473 | 3300013105 | Bacteria | 10062 |
| 128 | Ga0157369_10089228 | 3300013105 | Bacteria | 3292 |
| 129 | Ga0157369_10643955 | 3300013105 | Bacteria | 1093 |
| 130 | Ga0157374_11124512 | 3300013296 | Bacteria | 806 |
| 131 | Ga0157380_10126356 | 3300014326 | Bacteria | 2174 |
| 132 | Ga0182008_10000625 | 3300014497 | Bacteria | 25949 |
| 133 | Ga0157376_10704159 | 3300014969 | Bacteria | 1015 |
| 134 | Ga0182006_1039453 | 3300015261 | Bacteria | 1863 |
| 135 | Ga0183363_1132 | 3300015690 | Bacteria | 18933 |
| 136 | Ga0163161_10014283 | 3300017792 | Bacteria | 5529 |
| 137 | Ga0209436_100017 | 3300025208 | Bacteria | 116238 |
| 138 | Ga0209436_100087 | 3300025208 | Bacteria | 46437 |
| 139 | Ga0209258_108353 | 3300025242 | Bacteria | 1461 |
| 140 | Ga0207425_1000038 | 3300025245 | Bacteria | 221600 |
| 141 | Ga0207425_1000072 | 3300025245 | Bacteria | 115017 |
| 142 | Ga0207425_1004423 | 3300025245 | Bacteria | 4221 |
| 143 | Ga0207425_1008695 | 3300025245 | Bacteria | 2577 |
| 144 | Ga0207425_1029722 | 3300025245 | Bacteria | 1100 |
| 145 | Ga0207425_1036744 | 3300025245 | Bacteria | 948 |
| 146 | Ga0209646_1005780 | 3300025246 | Bacteria | 2128 |
| 147 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 148 | Ga0209759_1000149 | 3300025256 | Bacteria | 120932 |
| 149 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 150 | Ga0209129_1000036 | 3300025258 | Bacteria | 328331 |
| 151 | Ga0209129_1001358 | 3300025258 | Bacteria | 13795 |
| 152 | Ga0209129_1004036 | 3300025258 | Bacteria | 6001 |
| 153 | Ga0209129_1004638 | 3300025258 | Bacteria | 5260 |
| 154 | Ga0209129_1011135 | 3300025258 | Bacteria | 2174 |
| 155 | Ga0209233_1000102 | 3300025261 | Bacteria | 285774 |
| 156 | Ga0209565_1000132 | 3300025263 | Bacteria | 104716 |
| 157 | Ga0209565_1013479 | 3300025263 | Bacteria | 1912 |
| 158 | Ga0209673_1006166 | 3300025273 | Bacteria | 5868 |
| 159 | Ga0209673_1021516 | 3300025273 | Bacteria | 2253 |
| 160 | Ga0209673_1023214 | 3300025273 | Bacteria | 2119 |
| 161 | Ga0209673_1024633 | 3300025273 | Bacteria | 2017 |
| 162 | Ga0209673_1052149 | 3300025273 | Bacteria | 1075 |
| 163 | Ga0209673_1069612 | 3300025273 | Bacteria | 843 |
| 164 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 165 | Ga0209130_1000079 | 3300025284 | Bacteria | 167669 |
| 166 | Ga0209130_1021845 | 3300025284 | Bacteria | 1438 |
| 167 | Ga0209130_1033398 | 3300025284 | Bacteria | 1042 |
| 168 | Ga0209676_1007320 | 3300025292 | Bacteria | 5218 |
| 169 | Ga0209676_1044823 | 3300025292 | Bacteria | 1209 |
| 170 | Ga0209025_1000108 | 3300025294 | Bacteria | 221600 |
| 171 | Ga0209025_1000177 | 3300025294 | Bacteria | 158173 |
| 172 | Ga0209025_1000469 | 3300025294 | Bacteria | 78737 |
| 173 | Ga0209025_1002058 | 3300025294 | Bacteria | 22887 |
| 174 | Ga0209025_1007023 | 3300025294 | Bacteria | 8538 |
| 175 | Ga0209025_1013293 | 3300025294 | Bacteria | 5189 |
| 176 | Ga0209025_1053533 | 3300025294 | Bacteria | 1582 |
| 177 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 178 | Ga0209564_1000132 | 3300025295 | Bacteria | 191966 |
| 179 | Ga0209564_1000551 | 3300025295 | Bacteria | 60139 |
| 180 | Ga0209564_1001535 | 3300025295 | Bacteria | 22900 |
| 181 | Ga0209564_1005534 | 3300025295 | Bacteria | 7156 |
| 182 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 183 | Ga0209758_1000104 | 3300025297 | Bacteria | 221600 |
| 184 | Ga0209758_1001035 | 3300025297 | Bacteria | 36412 |
| 185 | Ga0209758_1001245 | 3300025297 | Bacteria | 31687 |
| 186 | Ga0209758_1016436 | 3300025297 | Bacteria | 3758 |
| 187 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 188 | Ga0209050_1000195 | 3300025298 | Bacteria | 136316 |
| 189 | Ga0209050_1002935 | 3300025298 | Bacteria | 13344 |
| 190 | Ga0209050_1003178 | 3300025298 | Bacteria | 12485 |
| 191 | Ga0209256_1001049 | 3300025299 | Bacteria | 32147 |
| 192 | Ga0209256_1003703 | 3300025299 | Bacteria | 10384 |
| 193 | Ga0209256_1007709 | 3300025299 | Bacteria | 5219 |
| 194 | Ga0209256_1010343 | 3300025299 | Bacteria | 3926 |
| 195 | Ga0209256_1039988 | 3300025299 | Bacteria | 1201 |
| 196 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 197 | Ga0207426_1000167 | 3300025302 | Bacteria | 167669 |
| 198 | Ga0207426_1003048 | 3300025302 | Bacteria | 9667 |
| 199 | Ga0207426_1018980 | 3300025302 | Bacteria | 2413 |
| 200 | Ga0209051_1000244 | 3300025303 | Bacteria | 91505 |
| 201 | Ga0209051_1000414 | 3300025303 | Bacteria | 58981 |
| 202 | Ga0209051_1000960 | 3300025303 | Bacteria | 28324 |
| 203 | Ga0209051_1001577 | 3300025303 | Bacteria | 18793 |
| 204 | Ga0209051_1020084 | 3300025303 | Bacteria | 2892 |
| 205 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 206 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 207 | Ga0209257_1002056 | 3300025304 | Bacteria | 21322 |
| 208 | Ga0209257_1008974 | 3300025304 | Bacteria | 5494 |
| 209 | Ga0209257_1010894 | 3300025304 | Bacteria | 4495 |
| 210 | Ga0209257_1011219 | 3300025304 | Bacteria | 4351 |
| 211 | Ga0209257_1039143 | 3300025304 | Bacteria | 1428 |
| 212 | Ga0207656_10018949 | 3300025321 | Bacteria | 2716 |
| 213 | Ga0207713_1063826 | 3300025735 | Bacteria | 1389 |
| 214 | Ga0207695_10081735 | 3300025913 | Bacteria | 3269 |
| 215 | Ga0207695_10218637 | 3300025913 | Bacteria | 1813 |
| 216 | Ga0207671_10031678 | 3300025914 | Bacteria | 3940 |
| 217 | Ga0207657_10004548 | 3300025919 | Bacteria | 14658 |
| 218 | Ga0207649_10053537 | 3300025920 | Bacteria | 2508 |
| 219 | Ga0207681_10005851 | 3300025923 | Bacteria | 7538 |
| 220 | Ga0207681_10438974 | 3300025923 | Bacteria | 1060 |
| 221 | Ga0207694_10054991 | 3300025924 | Bacteria | 3089 |
| 222 | Ga0207659_10040742 | 3300025926 | Bacteria | 3250 |
| 223 | Ga0207644_11089726 | 3300025931 | Bacteria | 671 |
| 224 | Ga0207686_10722121 | 3300025934 | Bacteria | 793 |
| 225 | Ga0207669_10197804 | 3300025937 | Bacteria | 1456 |
| 226 | Ga0207711_10225102 | 3300025941 | Bacteria | 1717 |
| 227 | Ga0207679_10052647 | 3300025945 | Bacteria | 2986 |
| 228 | Ga0207667_10033763 | 3300025949 | Bacteria | 5498 |
| 229 | Ga0207667_10569986 | 3300025949 | Bacteria | 1144 |
| 230 | Ga0207651_10015272 | 3300025960 | Bacteria | 4458 |
| 231 | Ga0207712_10356422 | 3300025961 | Bacteria | 1217 |
| 232 | Ga0207668_10247564 | 3300025972 | Bacteria | 1446 |
| 233 | Ga0207640_10795821 | 3300025981 | Bacteria | 819 |
| 234 | Ga0207639_10002789 | 3300026041 | Bacteria | 11724 |
| 235 | Ga0207639_10011254 | 3300026041 | Bacteria | 6207 |
| 236 | Ga0207639_10027766 | 3300026041 | Bacteria | 4126 |
| 237 | Ga0207678_10000235 | 3300026067 | Bacteria | 49747 |
| 238 | Ga0207702_10074100 | 3300026078 | Bacteria | 2937 |
| 239 | Ga0207702_10081048 | 3300026078 | Bacteria | 2818 |
| 240 | Ga0207674_10070129 | 3300026116 | Bacteria | 3524 |
| 241 | Ga0207674_11083226 | 3300026116 | Bacteria | 771 |
| 242 | Ga0207698_10147426 | 3300026142 | Bacteria | 2037 |
| 243 | Ga0207698_10372487 | 3300026142 | Bacteria | 1356 |
| 244 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 245 | Ga0209389_1041846 | 3300027296 | Bacteria | 3488 |
| 246 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 247 | Ga0209371_1011474 | 3300027312 | Bacteria | 2630 |
| 248 | Ga0209282_1001912 | 3300027666 | Bacteria | 11753 |
| 249 | Ga0268266_10088248 | 3300028379 | Bacteria | 2714 |
| 250 | Ga0268266_10651588 | 3300028379 | Bacteria | 1013 |
| 251 | Ga0268266_11114753 | 3300028379 | Bacteria | 763 |
| 252 | Ga0307515_10023533 | 3300028794 | Bacteria | 10787 |
| 253 | Ga0307515_10055417 | 3300028794 | Bacteria | 5793 |
| 254 | Ga0307515_10101689 | 3300028794 | Bacteria | 3466 |
| 255 | Ga0307515_10338826 | 3300028794 | Bacteria | 1157 |
| 256 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 257 | Ga0268256_1016310 | 3300030500 | Bacteria | 2135 |
| 258 | Ga0316181_1111885 | 3300030744 | Bacteria | 2714 |
| 259 | Ga0307408_100003096 | 3300031548 | Bacteria | 11457 |
| 260 | Ga0307405_10086394 | 3300031731 | Bacteria | 2064 |
| 261 | Ga0307405_10359122 | 3300031731 | Bacteria | 1126 |
| 262 | Ga0307410_10052752 | 3300031852 | Bacteria | 2748 |
| 263 | Ga0307406_10165084 | 3300031901 | Bacteria | 1596 |
| 264 | Ga0307414_10379083 | 3300032004 | Bacteria | 1222 |
| 265 | Ga0307411_10002074 | 3300032005 | Bacteria | 8623 |
| 266 | Ga0373958_0008235 | 3300034819 | Bacteria | 1683 |
| 267 | Ga0373940_0046997 | 3300035088 | Bacteria | 1202 |
| 268 | Ga0373939_0000071 | 3300035114 | Bacteria | 32243 |
| 269 | Ga0373960_0000615 | 3300035121 | Bacteria | 7289 |
| 270 | Ga0373961_0025877 | 3300035241 | Bacteria | 1599 |
| 271 | Ga0373962_0055010 | 3300035242 | Bacteria | 1155 |
| 272 | Ga0373931_0000591 | 3300035691 | Bacteria | 14952 |
| 273 | Ga0395900_0327253 | 3300037418 | Bacteria | 1511 |
| 274 | Ga0395898_0110600 | 3300037466 | Bacteria | 2633 |
| 275 | Ga0395898_1029572 | 3300037466 | Bacteria | 758 |
| 276 | Ga0395905_0053525 | 3300037471 | Bacteria | 3777 |
| 277 | Ga0395905_0101077 | 3300037471 | Bacteria | 2707 |
| 278 | Ga0395905_0163015 | 3300037471 | Bacteria | 2095 |
| 279 | Ga0395905_0349493 | 3300037471 | Bacteria | 1370 |
| 280 | Ga0395905_0391955 | 3300037471 | Bacteria | 1283 |
| 281 | Ga0395905_0624689 | 3300037471 | Bacteria | 979 |
| 282 | Ga0395901_0048436 | 3300038443 | Bacteria | 4413 |
| 283 | Ga0436361_0428539 | 3300039447 | Bacteria | 2097 |
| 284 | Ga0439465_0139534 | 3300041413 | Bacteria | 860 |
| 285 | Ga0451835_0808235 | 3300041492 | Bacteria | 1126 |
| 286 | Ga0451837_0256684 | 3300041494 | Bacteria | 1453 |
| 287 | Ga0451855_0228500 | 3300041511 | Bacteria | 1675 |
| 288 | Ga0439449_0086064 | 3300042007 | Bacteria | 1160 |
| 289 | Ga0439462_0012282 | 3300042015 | Bacteria | 2187 |
| 290 | Ga0450898_034874 | 3300042134 | Bacteria | 935 |
| 291 | Ga0466972_0077755 | 3300044658 | Bacteria | 1580 |
| 292 | Ga0466963_0369659 | 3300044694 | Bacteria | 1010 |
| 293 | Ga0466968_0122672 | 3300044735 | Bacteria | 1177 |
| 294 | Ga0451576_0162985 | 3300045051 | Bacteria | 2327 |
| 295 | Ga0466967_1333764 | 3300045976 | Bacteria | 715 |
| 296 | Ga0495627_000363 | 3300046453 | Bacteria | 42174 |
| 297 | Ga0495590_0018238 | 3300046457 | Bacteria | 2514 |
| 298 | Ga0495638_0000021 | 3300046460 | Bacteria | 365602 |
| 299 | Ga0495638_0002018 | 3300046460 | Bacteria | 17314 |
| 300 | Ga0495638_0119057 | 3300046460 | Bacteria | 1562 |
| 301 | Ga0495638_0137808 | 3300046460 | Bacteria | 1427 |
| 302 | Ga0495605_0006188 | 3300046474 | Bacteria | 6903 |
| 303 | Ga0495584_0076721 | 3300046491 | Bacteria | 1680 |
| 304 | Ga0495585_0018239 | 3300046492 | Bacteria | 4050 |
| 305 | Ga0495607_0045477 | 3300046501 | Bacteria | 2582 |
| 306 | Ga0495583_0003016 | 3300046506 | Bacteria | 13440 |
| 307 | Ga0495583_0013674 | 3300046506 | Bacteria | 4512 |
| 308 | Ga0495606_0038253 | 3300046507 | Bacteria | 3248 |
| 309 | Ga0495610_0000072 | 3300046512 | Bacteria | 120618 |
| 310 | Ga0495616_0080367 | 3300046513 | Bacteria | 1561 |
| 311 | Ga0495620_0050277 | 3300046515 | Bacteria | 1779 |
| 312 | Ga0495632_0010389 | 3300046519 | Bacteria | 5519 |
| 313 | Ga0495632_0013002 | 3300046519 | Bacteria | 4771 |
| 314 | Ga0495643_0006542 | 3300046522 | Bacteria | 7666 |
| 315 | Ga0495648_0000071 | 3300046524 | Bacteria | 133473 |
| 316 | Ga0495648_0001207 | 3300046524 | Bacteria | 25895 |
| 317 | Ga0495648_0031456 | 3300046524 | Bacteria | 3493 |
| 318 | Ga0495654_0000305 | 3300046530 | Bacteria | 43461 |
| 319 | Ga0495609_0093554 | 3300046538 | Bacteria | 1306 |
| 320 | Ga0495621_0084288 | 3300046539 | Bacteria | 1189 |
| 321 | Ga0495633_0058461 | 3300046558 | Bacteria | 1810 |
| 322 | Ga0495633_0086162 | 3300046558 | Bacteria | 1461 |
| 323 | Ga0495633_0089905 | 3300046558 | Bacteria | 1427 |
| 324 | Ga0495656_0387398 | 3300046615 | Bacteria | 729 |
| 325 | Ga0495668_0006163 | 3300046616 | Bacteria | 7936 |
| 326 | Ga0495668_0149651 | 3300046616 | Bacteria | 1278 |
| 327 | Ga0495625_0456099 | 3300046660 | Bacteria | 789 |
| 328 | Ga0495635_0082080 | 3300046663 | Bacteria | 2206 |
| 329 | Ga0495588_0074987 | 3300046674 | Bacteria | 1762 |
| 330 | Ga0495670_0011840 | 3300046691 | Bacteria | 4294 |
| 331 | Ga0495671_0000046 | 3300046692 | Bacteria | 157975 |
| 332 | Ga0495649_0003186 | 3300046694 | Bacteria | 11216 |
| 333 | Ga0495649_0092400 | 3300046694 | Bacteria | 1612 |
| 334 | Ga0495660_0057083 | 3300046810 | Bacteria | 2107 |
| 335 | Ga0495604_0001490 | 3300047317 | Bacteria | 19310 |
| 336 | Ga0495683_0000007 | 3300047323 | Bacteria | 268546 |
| 337 | Ga0495673_0000066 | 3300047469 | Bacteria | 221478 |
| 338 | Ga0495681_0000043 | 3300047470 | Bacteria | 115514 |
| 339 | Ga0495681_0163088 | 3300047470 | Bacteria | 927 |
| 340 | Ga0495686_0116556 | 3300047472 | Bacteria | 1596 |
| 341 | Ga0496104_0145409 | 3300048907 | Bacteria | 2276 |
| 342 | Ga0496106_0000221 | 3300048909 | Bacteria | 39664 |
| 343 | Ga0496107_0034220 | 3300048910 | Bacteria | 3639 |
| 344 | Ga0496109_0081727 | 3300048912 | Bacteria | 2977 |
| 345 | Ga0496110_0046668 | 3300048913 | Bacteria | 3790 |
| 346 | Ga0496110_0311728 | 3300048913 | Bacteria | 1433 |
| 347 | Ga0496111_0009028 | 3300048914 | Bacteria | 6635 |
| 348 | Ga0496111_0585395 | 3300048914 | Bacteria | 818 |
| 349 | Ga0496113_0127825 | 3300048916 | Bacteria | 1992 |
| 350 | Ga0496113_0507767 | 3300048916 | Bacteria | 968 |
| 351 | Ga0496116_0002755 | 3300048919 | Bacteria | 18052 |
| 352 | Ga0496116_0006977 | 3300048919 | Bacteria | 10121 |
| 353 | Ga0496116_0040712 | 3300048919 | Bacteria | 3196 |
| 354 | Ga0496116_0042347 | 3300048919 | Bacteria | 3114 |
| 355 | Ga0496116_0062334 | 3300048919 | Bacteria | 2408 |
| 356 | Ga0496117_0005379 | 3300048920 | Bacteria | 13482 |
| 357 | Ga0496117_0019860 | 3300048920 | Bacteria | 5500 |
| 358 | Ga0496117_0086757 | 3300048920 | Bacteria | 2032 |
| 359 | Ga0496117_0091671 | 3300048920 | Bacteria | 1954 |
| 360 | Ga0496117_0105356 | 3300048920 | Bacteria | 1772 |
| 361 | Ga0496117_0237703 | 3300048920 | Bacteria | 1002 |
| 362 | Ga0496118_0027244 | 3300048921 | Bacteria | 4842 |
| 363 | Ga0496118_0062586 | 3300048921 | Bacteria | 2745 |
| 364 | Ga0496118_0070256 | 3300048921 | Bacteria | 2529 |
| 365 | Ga0496118_0080497 | 3300048921 | Bacteria | 2292 |
| 366 | Ga0496118_0131942 | 3300048921 | Bacteria | 1602 |
| 367 | Ga0496118_0157444 | 3300048921 | Bacteria | 1410 |
| 368 | Ga0496119_0263313 | 3300048922 | Bacteria | 864 |
| 369 | Ga0496120_0000435 | 3300048923 | Bacteria | 66035 |
| 370 | Ga0496120_0063014 | 3300048923 | Bacteria | 2064 |
| 371 | Ga0496120_0204840 | 3300048923 | Bacteria | 953 |
| 372 | Ga0496121_0005816 | 3300048924 | Bacteria | 15637 |
| 373 | Ga0496121_0013804 | 3300048924 | Bacteria | 8646 |
| 374 | Ga0496121_0019043 | 3300048924 | Bacteria | 6887 |
| 375 | Ga0496121_0057152 | 3300048924 | Bacteria | 3235 |
| 376 | Ga0496121_0075156 | 3300048924 | Bacteria | 2700 |
| 377 | Ga0496121_0144262 | 3300048924 | Bacteria | 1761 |
| 378 | Ga0496121_0430624 | 3300048924 | Bacteria | 856 |
| 379 | Ga0496122_0000106 | 3300048925 | Bacteria | 193672 |
| 380 | Ga0496122_0000238 | 3300048925 | Bacteria | 123588 |
| 381 | Ga0496122_0000606 | 3300048925 | Bacteria | 73602 |
| 382 | Ga0496122_0008697 | 3300048925 | Bacteria | 10873 |
| 383 | Ga0496122_0009349 | 3300048925 | Bacteria | 10350 |
| 384 | Ga0496122_0010098 | 3300048925 | Bacteria | 9799 |
| 385 | Ga0496122_0020278 | 3300048925 | Bacteria | 6017 |
| 386 | Ga0496122_0026617 | 3300048925 | Bacteria | 4978 |
| 387 | Ga0496122_0028755 | 3300048925 | Bacteria | 4705 |
| 388 | Ga0496122_0048439 | 3300048925 | Bacteria | 3267 |
| 389 | Ga0496122_0115100 | 3300048925 | Bacteria | 1753 |
| 390 | Ga0496122_0176778 | 3300048925 | Bacteria | 1278 |
| 391 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 392 | Ga0496123_0000262 | 3300048926 | Bacteria | 106366 |
| 393 | Ga0496123_0000450 | 3300048926 | Bacteria | 73652 |
| 394 | Ga0496123_0026040 | 3300048926 | Bacteria | 4394 |
| 395 | Ga0496123_0206454 | 3300048926 | Bacteria | 1002 |
| 396 | Ga0496124_0000153 | 3300048927 | Bacteria | 139859 |
| 397 | Ga0496124_0002161 | 3300048927 | Bacteria | 26367 |
| 398 | Ga0496124_0011736 | 3300048927 | Bacteria | 8738 |
| 399 | Ga0496124_0017079 | 3300048927 | Bacteria | 6861 |
| 400 | Ga0496124_0050747 | 3300048927 | Bacteria | 3533 |
| 401 | Ga0496124_0108789 | 3300048927 | Bacteria | 2235 |
| 402 | Ga0496124_0143408 | 3300048927 | Bacteria | 1882 |
| 403 | Ga0496124_0231221 | 3300048927 | Bacteria | 1382 |
| 404 | Ga0496124_0279629 | 3300048927 | Bacteria | 1217 |
| 405 | Ga0496124_0303216 | 3300048927 | Bacteria | 1152 |
| 406 | Ga0496125_0003083 | 3300048928 | Bacteria | 20804 |
| 407 | Ga0496125_0006530 | 3300048928 | Bacteria | 12574 |
| 408 | Ga0496125_0027217 | 3300048928 | Bacteria | 5187 |
| 409 | Ga0496125_0131552 | 3300048928 | Bacteria | 1760 |
| 410 | Ga0496125_0157425 | 3300048928 | Bacteria | 1549 |
| 411 | Ga0496125_0176396 | 3300048928 | Bacteria | 1429 |
| 412 | Ga0496126_0009081 | 3300048929 | Bacteria | 10625 |
| 413 | Ga0496126_0023157 | 3300048929 | Bacteria | 6021 |
| 414 | Ga0496126_0041231 | 3300048929 | Bacteria | 4274 |
| 415 | Ga0496126_0196024 | 3300048929 | Bacteria | 1708 |
| 416 | Ga0496126_0419398 | 3300048929 | Bacteria | 1082 |
| 417 | Ga0501322_000536 | 3300049538 | Bacteria | 1829 |
| 418 | Ga0501335_001379 | 3300049551 | Bacteria | 1860 |
| 419 | Ga0501031_0013477 | 3300049568 | Bacteria | 5328 |
| 420 | Ga0501032_0018503 | 3300049569 | Bacteria | 4879 |
| 421 | Ga0501033_0019187 | 3300049570 | Bacteria | 5170 |
| 422 | Ga0501034_0025864 | 3300049571 | Bacteria | 5977 |
| 423 | Ga0501036_0104780 | 3300049572 | Bacteria | 2391 |
| 424 | Ga0501037_0021179 | 3300049573 | Bacteria | 4803 |
| 425 | Ga0501038_0223447 | 3300049574 | Bacteria | 1501 |
| 426 | Ga0501039_0035281 | 3300049575 | Bacteria | 3859 |
| 427 | Ga0501042_0075686 | 3300049578 | Bacteria | 2409 |
| 428 | Ga0501043_0014731 | 3300049579 | Bacteria | 6122 |
| 429 | Ga0501046_0128085 | 3300049580 | Bacteria | 1927 |
| 430 | Ga0501046_0129379 | 3300049580 | Bacteria | 1915 |
| 431 | Ga0501047_0115538 | 3300049581 | Bacteria | 2565 |
| 432 | Ga0501048_0138979 | 3300049582 | Bacteria | 1717 |
| 433 | Ga0501068_0080606 | 3300049584 | Bacteria | 1997 |
| 434 | Ga0501070_0069974 | 3300049586 | Bacteria | 2905 |
| 435 | Ga0501071_0273097 | 3300049587 | Bacteria | 1278 |
| 436 | Ga0501074_0251043 | 3300049590 | Bacteria | 1258 |
| 437 | Ga0501211_004148 | 3300049658 | Bacteria | 1482 |
| 438 | Ga0501223_000004 | 3300049663 | Bacteria | 141027 |
| 439 | Ga0501227_019145 | 3300049665 | Bacteria | 1559 |
| 440 | Ga0501235_002079 | 3300049669 | Bacteria | 4300 |
| 441 | Ga0501238_016729 | 3300049671 | Bacteria | 1018 |
| 442 | Ga0501246_000533 | 3300049676 | Bacteria | 2762 |
| 443 | Ga0501225_0000003 | 3300049705 | Bacteria | 141070 |
| 444 | Ga0501225_0009427 | 3300049705 | Bacteria | 2780 |
| 445 | Ga0501225_0020282 | 3300049705 | Bacteria | 1837 |
| 446 | Ga0501245_033902 | 3300049708 | Bacteria | 854 |
| 447 | Ga0501080_0222342 | 3300049742 | Bacteria | 1727 |
| 448 | Ga0501083_0046580 | 3300049744 | Bacteria | 2931 |
| 449 | Ga0501035_0149495 | 3300049822 | Bacteria | 2027 |
| 450 | Ga0501044_0043203 | 3300049823 | Bacteria | 4683 |
| 451 | Ga0501045_0146975 | 3300049824 | Bacteria | 1753 |
| 452 | nmdc:mga00v17_172932_c1 | 3300050491 | Bacteria | 1393 |
| 453 | nmdc:mga00v17_588_c1 | 3300050491 | Bacteria | 20251 |
| 454 | nmdc:mga00v17_70872_c1 | 3300050491 | Bacteria | 2160 |
| 455 | nmdc:mga0yw44_328923_c1 | 3300050492 | Bacteria | 1027 |
| 456 | nmdc:mga0yw44_48090_c1 | 3300050492 | Bacteria | 2571 |
| 457 | nmdc:mga0k408_61380_c1 | 3300050493 | Bacteria | 2185 |
| 458 | nmdc:mga06z11_64_c1 | 3300050494 | Bacteria | 44293 |
| 459 | nmdc:mga04h51_56_c1 | 3300050495 | Bacteria | 35784 |
| 460 | nmdc:mga07m45_15593_c1 | 3300050496 | Bacteria | 4058 |
| 461 | nmdc:mga07m45_17907_c1 | 3300050496 | Bacteria | 3812 |
| 462 | nmdc:mga07m45_30198_c1 | 3300050496 | Bacteria | 3000 |
| 463 | nmdc:mga0sz30_37484_c1 | 3300050516 | Bacteria | 1669 |
| 464 | nmdc:mga0sz30_57345_c1 | 3300050516 | Bacteria | 1660 |
| 465 | Ga0495601_0324768 | 3300053077 | Bacteria | 1002 |
| 466 | Ga0500578_0073555 | 3300053086 | Bacteria | 2177 |
| 467 | Ga0500643_001812 | 3300053087 | Bacteria | 11678 |
| 468 | Ga0500643_013168 | 3300053087 | Bacteria | 2932 |
| 469 | Ga0500651_0164858 | 3300053093 | Bacteria | 1323 |
| 470 | Ga0500566_0006293 | 3300053094 | Bacteria | 7054 |
| 471 | Ga0500641_0240519 | 3300053096 | Bacteria | 762 |
| 472 | Ga0500569_045282 | 3300053109 | Bacteria | 1306 |
| 473 | Ga0500594_0029356 | 3300053118 | Bacteria | 1438 |
| 474 | Ga0500607_013879 | 3300053121 | Bacteria | 4696 |
| 475 | Ga0500608_085643 | 3300053122 | Bacteria | 1480 |
| 476 | Ga0500618_001236 | 3300053125 | Bacteria | 11955 |
| 477 | Ga0500618_012564 | 3300053125 | Bacteria | 2214 |
| 478 | Ga0500658_0035794 | 3300053134 | Bacteria | 1967 |
| 479 | Ga0500559_0000180 | 3300053136 | Bacteria | 50042 |
| 480 | Ga0500559_0007386 | 3300053136 | Bacteria | 4874 |
| 481 | Ga0500559_0068519 | 3300053136 | Bacteria | 1594 |
| 482 | Ga0500586_019243 | 3300053145 | Bacteria | 2120 |
| 483 | Ga0500604_0131728 | 3300053151 | Bacteria | 841 |
| 484 | Ga0500616_0022506 | 3300053153 | Bacteria | 3517 |
| 485 | Ga0500616_0183750 | 3300053153 | Bacteria | 939 |
| 486 | Ga0500622_0000104 | 3300053156 | Bacteria | 85867 |
| 487 | Ga0500622_0139062 | 3300053156 | Bacteria | 1160 |
| 488 | Ga0500624_000405 | 3300053157 | Bacteria | 13383 |
| 489 | Ga0500627_0049177 | 3300053158 | Bacteria | 1834 |
| 490 | Ga0500627_0095729 | 3300053158 | Bacteria | 1331 |
| 491 | Ga0500636_0000526 | 3300053177 | Bacteria | 20787 |
| 492 | Ga0500636_0019536 | 3300053177 | Bacteria | 4009 |
| 493 | Ga0500636_0021668 | 3300053177 | Bacteria | 3804 |
| 494 | Ga0500637_0030710 | 3300053178 | Bacteria | 2992 |
| 495 | Ga0500567_118430 | 3300053723 | Bacteria | 1062 |
| 496 | Ga0587077_007056 | 3300059493 | Bacteria | 1620 |
| 497 | Ga0587077_038376 | 3300059493 | Bacteria | 949 |
| 498 | Ga0587080_036369 | 3300059503 | Bacteria | 880 |
| 499 | Ga0587068_013114 | 3300059641 | Bacteria | 1274 |
| 500 | Ga0587076_018853 | 3300059645 | Bacteria | 1116 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042015 | Ga0439462_0012282 | Ga0439462_0012282_1506_2135 | 178 |
| 2 | 3300001979 | JGI24740J21852_10059251 | JGI24740J21852_100592512 | 179 |
| 3 | 3300001989 | JGI24739J22299_10009520 | JGI24739J22299_100095203 | 179 |
| 4 | 3300003758 | Ga0055532_1011812 | Ga0055532_10118122 | 179 |
| 5 | 3300005539 | Ga0068853_100018368 | Ga0068853_1000183685 | 179 |
| 6 | 3300046453 | Ga0495627_000363 | Ga0495627_000363_1447_1989 | 179 |
| 7 | 3300046524 | Ga0495648_0031456 | Ga0495648_0031456_1886_2428 | 179 |
| 8 | 3300046660 | Ga0495625_0456099 | Ga0495625_0456099_218_760 | 179 |
| 9 | 3300049572 | Ga0501036_0104780 | Ga0501036_0104780_1816_2358 | 179 |
| 10 | 3300050494 | nmdc:mga06z11_64_c1 | nmdc:mga06z11_64_c1_16384_16926 | 179 |
| 11 | 3300050495 | nmdc:mga04h51_56_c1 | nmdc:mga04h51_56_c1_954_1496 | 179 |
| 12 | 3300050496 | nmdc:mga07m45_17907_c1 | nmdc:mga07m45_17907_c1_880_1422 | 179 |
| 13 | 3300039447 | Ga0436361_0428539 | Ga0436361_0428539_283_855 | 189 |
| 14 | 3300009011 | Ga0105251_10064097 | Ga0105251_100640973 | 194 |
| 15 | 3300009553 | Ga0105249_10528495 | Ga0105249_105284952 | 194 |
| 16 | 3300048925 | Ga0496122_0009349 | Ga0496122_0009349_8884_9486 | 194 |
| 17 | 3300048927 | Ga0496124_0011736 | Ga0496124_0011736_680_1282 | 194 |
| 18 | 3300048928 | Ga0496125_0006530 | Ga0496125_0006530_2529_3131 | 194 |
| 19 | 3300053093 | Ga0500651_0164858 | Ga0500651_0164858_692_1288 | 195 |
| 20 | 3300048920 | Ga0496117_0086757 | Ga0496117_0086757_1312_1914 | 197 |
| 21 | 3300048921 | Ga0496118_0157444 | Ga0496118_0157444_154_756 | 197 |
| 22 | iso_pu_bacteria | 2512564014 | 2512643939 | 197 |
| 23 | iso_pu_bacteria | 2886848708 | 2886850675 | 197 |
| 24 | 3300048916 | Ga0496113_0507767 | Ga0496113_0507767_351_953 | 198 |
| 25 | 3300028794 | Ga0307515_10101689 | Ga0307515_101016891 | 199 |
| 26 | 3300048923 | Ga0496120_0204840 | Ga0496120_0204840_306_914 | 199 |
| 27 | 3300053087 | Ga0500643_013168 | Ga0500643_013168_967_1578 | 199 |
| 28 | 3300053157 | Ga0500624_000405 | Ga0500624_000405_7247_7858 | 199 |
| 29 | 3300053177 | Ga0500636_0021668 | Ga0500636_0021668_826_1437 | 199 |
| 30 | iso_pu_bacteria | 2775507049 | 2776912369 | 199 |
| 31 | 3300015261 | Ga0182006_1039453 | Ga0182006_10394533 | 200 |
| 32 | 3300037466 | Ga0395898_0110600 | Ga0395898_0110600_11_613 | 200 |
| 33 | 3300053094 | Ga0500566_0006293 | Ga0500566_0006293_935_1546 | 200 |
| 34 | 3300053136 | Ga0500559_0000180 | Ga0500559_0000180_48157_48768 | 200 |
| 35 | iso_pu_bacteria | 2643221558 | 2643813430 | 200 |
| 36 | iso_pu_bacteria | 2791355048 | 2792460709 | 200 |
| 37 | iso_pu_bacteria | 2843744320 | 2843747991 | 200 |
| 38 | iso_pu_bacteria | 2849560528 | 2849561430 | 200 |
| 39 | iso_pu_bacteria | 2849573788 | 2849574677 | 200 |
| 40 | iso_pu_bacteria | 2851153111 | 2851153578 | 200 |
| 41 | iso_pu_bacteria | 2898329390 | 2898329884 | 200 |
| 42 | iso_pu_bacteria | 2928972540 | 2928974748 | 200 |
| 43 | iso_pu_bacteria | 2929199973 | 2929205264 | 200 |
| 44 | iso_pu_bacteria | 2977240413 | 2977242212 | 200 |
| 45 | iso_pu_bacteria | 8018150411 | 8018152300 | 200 |
| 46 | iso_pu_bacteria | 8055909800 | 8055913437 | 200 |
| 47 | 3300001915 | JGI24741J21665_1000064 | JGI24741J21665_100006419 | 201 |
| 48 | 3300001979 | JGI24740J21852_10002340 | JGI24740J21852_100023402 | 201 |
| 49 | 3300005455 | Ga0070663_100006514 | Ga0070663_1000065143 | 201 |
| 50 | 3300005564 | Ga0070664_100039149 | Ga0070664_1000391492 | 201 |
| 51 | 3300005614 | Ga0068856_100006903 | Ga0068856_1000069036 | 201 |
| 52 | 3300005616 | Ga0068852_100798937 | Ga0068852_1007989371 | 201 |
| 53 | 3300005834 | Ga0068851_10007544 | Ga0068851_100075443 | 201 |
| 54 | 3300006178 | Ga0075367_10184098 | Ga0075367_101840982 | 201 |
| 55 | 3300009093 | Ga0105240_10214657 | Ga0105240_102146573 | 201 |
| 56 | 3300009174 | Ga0105241_10000625 | Ga0105241_1000062515 | 201 |
| 57 | 3300009545 | Ga0105237_10049124 | Ga0105237_100491242 | 201 |
| 58 | 3300010375 | Ga0105239_10526029 | Ga0105239_105260292 | 201 |
| 59 | 3300013104 | Ga0157370_10066012 | Ga0157370_100660124 | 201 |
| 60 | 3300017792 | Ga0163161_10014283 | Ga0163161_100142834 | 201 |
| 61 | 3300025321 | Ga0207656_10018949 | Ga0207656_100189492 | 201 |
| 62 | 3300025735 | Ga0207713_1063826 | Ga0207713_10638262 | 201 |
| 63 | 3300025913 | Ga0207695_10081735 | Ga0207695_100817353 | 201 |
| 64 | 3300025919 | Ga0207657_10004548 | Ga0207657_100045489 | 201 |
| 65 | 3300025920 | Ga0207649_10053537 | Ga0207649_100535372 | 201 |
| 66 | 3300025945 | Ga0207679_10052647 | Ga0207679_100526473 | 201 |
| 67 | 3300025949 | Ga0207667_10033763 | Ga0207667_100337633 | 201 |
| 68 | 3300025961 | Ga0207712_10356422 | Ga0207712_103564222 | 201 |
| 69 | 3300026041 | Ga0207639_10011254 | Ga0207639_100112542 | 201 |
| 70 | 3300026067 | Ga0207678_10000235 | Ga0207678_1000023540 | 201 |
| 71 | 3300026078 | Ga0207702_10074100 | Ga0207702_100741002 | 201 |
| 72 | 3300026116 | Ga0207674_10070129 | Ga0207674_100701292 | 201 |
| 73 | 3300026142 | Ga0207698_10147426 | Ga0207698_101474262 | 201 |
| 74 | 3300031731 | Ga0307405_10086394 | Ga0307405_100863942 | 201 |
| 75 | 3300031852 | Ga0307410_10052752 | Ga0307410_100527522 | 201 |
| 76 | 3300032004 | Ga0307414_10379083 | Ga0307414_103790832 | 201 |
| 77 | 3300050493 | nmdc:mga0k408_61380_c1 | nmdc:mga0k408_61380_c1_793_1401 | 201 |
| 78 | 3300050496 | nmdc:mga07m45_15593_c1 | nmdc:mga07m45_15593_c1_2679_3287 | 201 |
| 79 | 3300053087 | Ga0500643_001812 | Ga0500643_001812_1013_1639 | 201 |
| 80 | iso_pu_bacteria | 2508501123 | 2509116910 | 201 |
| 81 | iso_pu_bacteria | 2509276033 | 2509448131 | 201 |
| 82 | iso_pu_bacteria | 2510065019 | 2510136795 | 201 |
| 83 | iso_pu_bacteria | 2510917028 | 2511184173 | 201 |
| 84 | iso_pu_bacteria | 2510917030 | 2511198350 | 201 |
| 85 | iso_pu_bacteria | 2513237087 | 2513589886 | 201 |
| 86 | iso_pu_bacteria | 2513237088 | 2513598942 | 201 |
| 87 | iso_pu_bacteria | 2513237093 | 2513631679 | 201 |
| 88 | iso_pu_bacteria | 2513237103 | 2513713373 | 201 |
| 89 | iso_pu_bacteria | 2513237138 | 2513866444 | 201 |
| 90 | iso_pu_bacteria | 2515075009 | 2515115379 | 201 |
| 91 | iso_pu_bacteria | 2516653077 | 2517041621 | 201 |
| 92 | iso_pu_bacteria | 2516653085 | 2517080785 | 201 |
| 93 | iso_pu_bacteria | 2519899620 | 2520377367 | 201 |
| 94 | iso_pu_bacteria | 2529292951 | 2530644877 | 201 |
| 95 | iso_pu_bacteria | 2534681796 | 2535519939 | 201 |
| 96 | iso_pu_bacteria | 2582581294 | 2585202844 | 201 |
| 97 | iso_pu_bacteria | 2582581298 | 2585221715 | 201 |
| 98 | iso_pu_bacteria | 2582581299 | 2585228107 | 201 |
| 99 | iso_pu_bacteria | 2582581304 | 2585255404 | 201 |
| 100 | iso_pu_bacteria | 2582581867 | 2585401211 | 201 |
| 101 | iso_pu_bacteria | 2585427528 | 2585539067 | 201 |
| 102 | iso_pu_bacteria | 2585427529 | 2585544115 | 201 |
| 103 | iso_pu_bacteria | 2585427590 | 2585821640 | 201 |
| 104 | iso_pu_bacteria | 2585427593 | 2585837017 | 201 |
| 105 | iso_pu_bacteria | 2585427594 | 2585842543 | 201 |
| 106 | iso_pu_bacteria | 2599185236 | 2599718665 | 201 |
| 107 | iso_pu_bacteria | 2599185352 | 2600193683 | 201 |
| 108 | iso_pu_bacteria | 2600254933 | 2600377186 | 201 |
| 109 | iso_pu_bacteria | 2643221557 | 2643804983 | 201 |
| 110 | iso_pu_bacteria | 2643221599 | 2644006780 | 201 |
| 111 | iso_pu_bacteria | 2643221634 | 2644191689 | 201 |
| 112 | iso_pu_bacteria | 2643221668 | 2644379013 | 201 |
| 113 | iso_pu_bacteria | 2643221723 | 2644673235 | 201 |
| 114 | iso_pu_bacteria | 2718217927 | 2719388276 | 201 |
| 115 | iso_pu_bacteria | 2718217997 | 2719667897 | 201 |
| 116 | iso_pu_bacteria | 2718218199 | 2720494660 | 201 |
| 117 | iso_pu_bacteria | 2718218232 | 2720610995 | 201 |
| 118 | iso_pu_bacteria | 2718218233 | 2720616163 | 201 |
| 119 | iso_pu_bacteria | 2718218235 | 2720629244 | 201 |
| 120 | iso_pu_bacteria | 2718218269 | 2720771816 | 201 |
| 121 | iso_pu_bacteria | 2718218423 | 2721402899 | 201 |
| 122 | iso_pu_bacteria | 2721755556 | 2723029219 | 201 |
| 123 | iso_pu_bacteria | 2721755684 | 2723562853 | 201 |
| 124 | iso_pu_bacteria | 2721755685 | 2723570843 | 201 |
| 125 | iso_pu_bacteria | 2721755809 | 2724035256 | 201 |
| 126 | iso_pu_bacteria | 2721755819 | 2724086636 | 201 |
| 127 | iso_pu_bacteria | 2721755822 | 2724106794 | 201 |
| 128 | iso_pu_bacteria | 2721755823 | 2724107594 | 201 |
| 129 | iso_pu_bacteria | 2728369352 | 2730105533 | 201 |
| 130 | iso_pu_bacteria | 2738541293 | 2738801763 | 201 |
| 131 | iso_pu_bacteria | 2738541317 | 2738945940 | 201 |
| 132 | iso_pu_bacteria | 2738541333 | 2739033525 | 201 |
| 133 | iso_pu_bacteria | 2791355253 | 2793282734 | 201 |
| 134 | iso_pu_bacteria | 2791355259 | 2793314876 | 201 |
| 135 | iso_pu_bacteria | 2791355261 | 2793325899 | 201 |
| 136 | iso_pu_bacteria | 2791355262 | 2793332905 | 201 |
| 137 | iso_pu_bacteria | 2791355266 | 2793357951 | 201 |
| 138 | iso_pu_bacteria | 2802429605 | 2805927909 | 201 |
| 139 | iso_pu_bacteria | 2802429633 | 2806044980 | 201 |
| 140 | iso_pu_bacteria | 2802429634 | 2806053863 | 201 |
| 141 | iso_pu_bacteria | 2802429635 | 2806060045 | 201 |
| 142 | iso_pu_bacteria | 2802429636 | 2806065901 | 201 |
| 143 | iso_pu_bacteria | 2802429637 | 2806075429 | 201 |
| 144 | iso_pu_bacteria | 2821123053 | 2821123218 | 201 |
| 145 | iso_pu_bacteria | 2838016132 | 2838019313 | 201 |
| 146 | iso_pu_bacteria | 2838022645 | 2838024850 | 201 |
| 147 | iso_pu_bacteria | 2838042994 | 2838046467 | 201 |
| 148 | iso_pu_bacteria | 2838048938 | 2838050379 | 201 |
| 149 | iso_pu_bacteria | 2838061910 | 2838063082 | 201 |
| 150 | iso_pu_bacteria | 2838068647 | 2838071648 | 201 |
| 151 | iso_pu_bacteria | 2838668709 | 2838673713 | 201 |
| 152 | iso_pu_bacteria | 2838680041 | 2838684240 | 201 |
| 153 | iso_pu_bacteria | 2838686498 | 2838692246 | 201 |
| 154 | iso_pu_bacteria | 2838694306 | 2838699730 | 201 |
| 155 | iso_pu_bacteria | 2838701080 | 2838705254 | 201 |
| 156 | iso_pu_bacteria | 2838707686 | 2838711984 | 201 |
| 157 | iso_pu_bacteria | 2838729681 | 2838734335 | 201 |
| 158 | iso_pu_bacteria | 2838736955 | 2838739759 | 201 |
| 159 | iso_pu_bacteria | 2838742623 | 2838746787 | 201 |
| 160 | iso_pu_bacteria | 2841840854 | 2841844117 | 201 |
| 161 | iso_pu_bacteria | 2841851746 | 2841853477 | 201 |
| 162 | iso_pu_bacteria | 2841864319 | 2841869141 | 201 |
| 163 | iso_pu_bacteria | 2842077413 | 2842081706 | 201 |
| 164 | iso_pu_bacteria | 2842110456 | 2842114594 | 201 |
| 165 | iso_pu_bacteria | 2842118031 | 2842122282 | 201 |
| 166 | iso_pu_bacteria | 2842140634 | 2842143838 | 201 |
| 167 | iso_pu_bacteria | 2842146304 | 2842150256 | 201 |
| 168 | iso_pu_bacteria | 2842156927 | 2842161438 | 201 |
| 169 | iso_pu_bacteria | 2842163707 | 2842167357 | 201 |
| 170 | iso_pu_bacteria | 2842180545 | 2842185761 | 201 |
| 171 | iso_pu_bacteria | 2842192696 | 2842195499 | 201 |
| 172 | iso_pu_bacteria | 2842198810 | 2842201936 | 201 |
| 173 | iso_pu_bacteria | 2842205361 | 2842210509 | 201 |
| 174 | iso_pu_bacteria | 2842217011 | 2842223631 | 201 |
| 175 | iso_pu_bacteria | 2842229732 | 2842234067 | 201 |
| 176 | iso_pu_bacteria | 2842237096 | 2842241396 | 201 |
| 177 | iso_pu_bacteria | 2842243621 | 2842246368 | 201 |
| 178 | iso_pu_bacteria | 2842250916 | 2842254942 | 201 |
| 179 | iso_pu_bacteria | 2842257432 | 2842260771 | 201 |
| 180 | iso_pu_bacteria | 2842264693 | 2842267844 | 201 |
| 181 | iso_pu_bacteria | 2842271015 | 2842276061 | 201 |
| 182 | iso_pu_bacteria | 2842278818 | 2842283963 | 201 |
| 183 | iso_pu_bacteria | 2842285085 | 2842289840 | 201 |
| 184 | iso_pu_bacteria | 2842291075 | 2842295362 | 201 |
| 185 | iso_pu_bacteria | 2842304105 | 2842308621 | 201 |
| 186 | iso_pu_bacteria | 2842311132 | 2842311951 | 201 |
| 187 | iso_pu_bacteria | 2842317721 | 2842319261 | 201 |
| 188 | iso_pu_bacteria | 2842341865 | 2842343850 | 201 |
| 189 | iso_pu_bacteria | 2842363717 | 2842368223 | 201 |
| 190 | iso_pu_bacteria | 2842370503 | 2842375905 | 201 |
| 191 | iso_pu_bacteria | 2842377471 | 2842381863 | 201 |
| 192 | iso_pu_bacteria | 2842384541 | 2842388831 | 201 |
| 193 | iso_pu_bacteria | 2842395702 | 2842396710 | 201 |
| 194 | iso_pu_bacteria | 2842402390 | 2842407020 | 201 |
| 195 | iso_pu_bacteria | 2842409023 | 2842413912 | 201 |
| 196 | iso_pu_bacteria | 2842415677 | 2842420554 | 201 |
| 197 | iso_pu_bacteria | 2842422224 | 2842425281 | 201 |
| 198 | iso_pu_bacteria | 2842428310 | 2842432006 | 201 |
| 199 | iso_pu_bacteria | 2842434925 | 2842438119 | 201 |
| 200 | iso_pu_bacteria | 2842441272 | 2842443815 | 201 |
| 201 | iso_pu_bacteria | 2842447887 | 2842449923 | 201 |
| 202 | iso_pu_bacteria | 2842462802 | 2842469168 | 201 |
| 203 | iso_pu_bacteria | 2842469257 | 2842472911 | 201 |
| 204 | iso_pu_bacteria | 2842489311 | 2842491707 | 201 |
| 205 | iso_pu_bacteria | 2842495871 | 2842502073 | 201 |
| 206 | iso_pu_bacteria | 2844454524 | 2844461362 | 201 |
| 207 | iso_pu_bacteria | 2856320880 | 2856328126 | 201 |
| 208 | iso_pu_bacteria | 2856364286 | 2856367279 | 201 |
| 209 | iso_pu_bacteria | 2857516855 | 2857522280 | 201 |
| 210 | iso_pu_bacteria | 2857531043 | 2857533830 | 201 |
| 211 | iso_pu_bacteria | 2869285874 | 2869287562 | 201 |
| 212 | iso_pu_bacteria | 2871429161 | 2871431086 | 201 |
| 213 | iso_pu_bacteria | 2874139085 | 2874139198 | 201 |
| 214 | iso_pu_bacteria | 2874146452 | 2874150358 | 201 |
| 215 | iso_pu_bacteria | 2874155637 | 2874157413 | 201 |
| 216 | iso_pu_bacteria | 2876377896 | 2876378712 | 201 |
| 217 | iso_pu_bacteria | 2876413966 | 2876416509 | 201 |
| 218 | iso_pu_bacteria | 2878738818 | 2878740045 | 201 |
| 219 | iso_pu_bacteria | 2878745973 | 2878747699 | 201 |
| 220 | iso_pu_bacteria | 2888337043 | 2888342398 | 201 |
| 221 | iso_pu_bacteria | 2888350351 | 2888352104 | 201 |
| 222 | iso_pu_bacteria | 2891373044 | 2891376180 | 201 |
| 223 | iso_pu_bacteria | 2903492973 | 2903498815 | 201 |
| 224 | iso_pu_bacteria | 2906308376 | 2906310100 | 201 |
| 225 | iso_pu_bacteria | 2906321335 | 2906322972 | 201 |
| 226 | iso_pu_bacteria | 2906354277 | 2906357699 | 201 |
| 227 | iso_pu_bacteria | 2913308742 | 2913310374 | 201 |
| 228 | iso_pu_bacteria | 2919100787 | 2919103332 | 201 |
| 229 | iso_pu_bacteria | 2919709256 | 2919711054 | 201 |
| 230 | iso_pu_bacteria | 2920822456 | 2920826259 | 201 |
| 231 | iso_pu_bacteria | 2922130491 | 2922137050 | 201 |
| 232 | iso_pu_bacteria | 2922185730 | 2922187438 | 201 |
| 233 | iso_pu_bacteria | 2923556063 | 2923556638 | 201 |
| 234 | iso_pu_bacteria | 2924776078 | 2924777644 | 201 |
| 235 | iso_pu_bacteria | 2933570622 | 2933575248 | 201 |
| 236 | iso_pu_bacteria | 2933599457 | 2933602446 | 201 |
| 237 | iso_pu_bacteria | 2935894831 | 2935898419 | 201 |
| 238 | iso_pu_bacteria | 2936375103 | 2936378144 | 201 |
| 239 | iso_pu_bacteria | 2937813078 | 2937815386 | 201 |
| 240 | iso_pu_bacteria | 2937877337 | 2937883863 | 201 |
| 241 | iso_pu_bacteria | 2937972304 | 2937976613 | 201 |
| 242 | iso_pu_bacteria | 2938014810 | 2938021089 | 201 |
| 243 | iso_pu_bacteria | 2958041894 | 2958044401 | 201 |
| 244 | iso_pu_bacteria | 2958064165 | 2958069723 | 201 |
| 245 | iso_pu_bacteria | 2958084443 | 2958091141 | 201 |
| 246 | iso_pu_bacteria | 2958130278 | 2958131964 | 201 |
| 247 | iso_pu_bacteria | 2958179912 | 2958181767 | 201 |
| 248 | iso_pu_bacteria | 2961077736 | 2961079611 | 201 |
| 249 | iso_pu_bacteria | 2977843712 | 2977846614 | 201 |
| 250 | iso_pu_bacteria | 2977971508 | 2977972628 | 201 |
| 251 | iso_pu_bacteria | 2979742915 | 2979744591 | 201 |
| 252 | iso_pu_bacteria | 2987652177 | 2987657138 | 201 |
| 253 | iso_pu_bacteria | 3000865235 | 3000868079 | 201 |
| 254 | iso_pu_bacteria | 3005445848 | 3005451556 | 201 |
| 255 | iso_pu_bacteria | 3005452660 | 3005458148 | 201 |
| 256 | iso_pu_bacteria | 8004387939 | 8004390298 | 201 |
| 257 | iso_pu_bacteria | 8004640170 | 8004642303 | 201 |
| 258 | iso_pu_bacteria | 8004714634 | 8004716362 | 201 |
| 259 | iso_pu_bacteria | 8005275841 | 8005276991 | 201 |
| 260 | iso_pu_bacteria | 8005282627 | 8005287992 | 201 |
| 261 | iso_pu_bacteria | 8005289223 | 8005289462 | 201 |
| 262 | iso_pu_bacteria | 8005376324 | 8005382154 | 201 |
| 263 | iso_pu_bacteria | 8005382845 | 8005388604 | 201 |
| 264 | iso_pu_bacteria | 8005395548 | 8005398035 | 201 |
| 265 | iso_pu_bacteria | 8005430974 | 8005431310 | 201 |
| 266 | iso_pu_bacteria | 8005497431 | 8005503307 | 201 |
| 267 | iso_pu_bacteria | 8005542996 | 8005547665 | 201 |
| 268 | iso_pu_bacteria | 8005556819 | 8005561971 | 201 |
| 269 | iso_pu_bacteria | 8005563573 | 8005567289 | 201 |
| 270 | iso_pu_bacteria | 8005570704 | 8005576161 | 201 |
| 271 | iso_pu_bacteria | 8005619151 | 8005625448 | 201 |
| 272 | iso_pu_bacteria | 8005626139 | 8005630430 | 201 |
| 273 | iso_pu_bacteria | 8005668836 | 8005674825 | 201 |
| 274 | iso_pu_bacteria | 8018163183 | 8018165760 | 201 |
| 275 | iso_pu_bacteria | 8018176218 | 8018182904 | 201 |
| 276 | iso_pu_bacteria | 8023680758 | 8023688365 | 201 |
| 277 | iso_pu_bacteria | 8024501048 | 8024503965 | 201 |
| 278 | iso_pu_bacteria | 8054558443 | 8054558998 | 201 |
| 279 | iso_pu_bacteria | 8056382006 | 8056383137 | 201 |
| 280 | 3300046519 | Ga0495632_0010389 | Ga0495632_0010389_3215_3841 | 202 |
| 281 | 3300048919 | Ga0496116_0006977 | Ga0496116_0006977_2782_3411 | 202 |
| 282 | 3300048921 | Ga0496118_0027244 | Ga0496118_0027244_2608_3237 | 202 |
| 283 | 3300048925 | Ga0496122_0028755 | Ga0496122_0028755_2772_3401 | 202 |
| 284 | 3300048927 | Ga0496124_0002161 | Ga0496124_0002161_3424_4053 | 202 |
| 285 | iso_pu_bacteria | 2524023210 | 2524470033 | 202 |
| 286 | iso_pu_bacteria | 2582581283 | 2585167188 | 202 |
| 287 | iso_pu_bacteria | 2602042107 | 2603858702 | 202 |
| 288 | iso_pu_bacteria | 2643221607 | 2644049968 | 202 |
| 289 | iso_pu_bacteria | 2643221636 | 2644203077 | 202 |
| 290 | iso_pu_bacteria | 2643221637 | 2644209164 | 202 |
| 291 | iso_pu_bacteria | 2643221686 | 2644482834 | 202 |
| 292 | iso_pu_bacteria | 2643221718 | 2644652638 | 202 |
| 293 | iso_pu_bacteria | 2831864461 | 2831869206 | 202 |
| 294 | iso_pu_bacteria | 2854896431 | 2854899999 | 202 |
| 295 | iso_pu_bacteria | 2854916844 | 2854922551 | 202 |
| 296 | iso_pu_bacteria | 2885383462 | 2885386352 | 202 |
| 297 | iso_pu_bacteria | 2903768456 | 2903771410 | 202 |
| 298 | iso_pu_bacteria | 2928521798 | 2928525832 | 202 |
| 299 | iso_pu_bacteria | 2954011201 | 2954012079 | 202 |
| 300 | 3300005937 | Ga0081455_10167635 | Ga0081455_101676352 | 203 |
| 301 | 3300031901 | Ga0307406_10165084 | Ga0307406_101650842 | 203 |
| 302 | 3300049551 | Ga0501335_001379 | Ga0501335_001379_1093_1752 | 203 |
| 303 | 3300049658 | Ga0501211_004148 | Ga0501211_004148_573_1232 | 203 |
| 304 | 3300049669 | Ga0501235_002079 | Ga0501235_002079_672_1331 | 203 |
| 305 | 3300049705 | Ga0501225_0020282 | Ga0501225_0020282_403_1062 | 203 |
| 306 | 3300049708 | Ga0501245_033902 | Ga0501245_033902_38_697 | 203 |
| 307 | 3300053156 | Ga0500622_0139062 | Ga0500622_0139062_238_861 | 203 |
| 308 | iso_pu_bacteria | 2509276021 | 2509385811 | 203 |
| 309 | iso_pu_bacteria | 2510461076 | 2510899925 | 203 |
| 310 | iso_pu_bacteria | 2510461076 | 2510900521 | 203 |
| 311 | iso_pu_bacteria | 2513237162 | 2514021386 | 203 |
| 312 | iso_pu_bacteria | 2515154116 | 2515658031 | 203 |
| 313 | iso_pu_bacteria | 2515154134 | 2515742231 | 203 |
| 314 | iso_pu_bacteria | 2585427526 | 2585524466 | 203 |
| 315 | iso_pu_bacteria | 2615840624 | 2616295061 | 203 |
| 316 | iso_pu_bacteria | 2643221544 | 2643745646 | 203 |
| 317 | iso_pu_bacteria | 2718217882 | 2719183534 | 203 |
| 318 | iso_pu_bacteria | 2718218009 | 2719727975 | 203 |
| 319 | iso_pu_bacteria | 2718218363 | 2721144836 | 203 |
| 320 | iso_pu_bacteria | 2718218365 | 2721155575 | 203 |
| 321 | iso_pu_bacteria | 2718218366 | 2721166923 | 203 |
| 322 | iso_pu_bacteria | 2721755514 | 2722837901 | 203 |
| 323 | iso_pu_bacteria | 2721755810 | 2724042169 | 203 |
| 324 | iso_pu_bacteria | 2728369365 | 2730161674 | 203 |
| 325 | iso_pu_bacteria | 2728369397 | 2730300682 | 203 |
| 326 | iso_pu_bacteria | 2791355256 | 2793296596 | 203 |
| 327 | iso_pu_bacteria | 2791355260 | 2793321529 | 203 |
| 328 | iso_pu_bacteria | 2791355264 | 2793346008 | 203 |
| 329 | iso_pu_bacteria | 2791355265 | 2793355232 | 203 |
| 330 | iso_pu_bacteria | 2791355267 | 2793366712 | 203 |
| 331 | iso_pu_bacteria | 2838675328 | 2838677638 | 203 |
| 332 | iso_pu_bacteria | 2838714209 | 2838716527 | 203 |
| 333 | iso_pu_bacteria | 2838719591 | 2838719673 | 203 |
| 334 | iso_pu_bacteria | 2838724970 | 2838727278 | 203 |
| 335 | iso_pu_bacteria | 2841846520 | 2841846604 | 203 |
| 336 | iso_pu_bacteria | 2842124991 | 2842127367 | 203 |
| 337 | iso_pu_bacteria | 2842130223 | 2842132531 | 203 |
| 338 | iso_pu_bacteria | 2842152218 | 2842152300 | 203 |
| 339 | iso_pu_bacteria | 2842170452 | 2842172773 | 203 |
| 340 | iso_pu_bacteria | 2842175837 | 2842175919 | 203 |
| 341 | iso_pu_bacteria | 2842187318 | 2842189635 | 203 |
| 342 | iso_pu_bacteria | 2842211629 | 2842213949 | 203 |
| 343 | iso_pu_bacteria | 2842224351 | 2842224433 | 203 |
| 344 | iso_pu_bacteria | 2893066018 | 2893067546 | 203 |
| 345 | iso_pu_bacteria | 2919114240 | 2919116744 | 203 |
| 346 | iso_pu_bacteria | 2926754445 | 2926754754 | 203 |
| 347 | iso_pu_bacteria | 2933006813 | 2933006947 | 203 |
| 348 | iso_pu_bacteria | 2935901341 | 2935906859 | 203 |
| 349 | iso_pu_bacteria | 2968117919 | 2968120274 | 203 |
| 350 | iso_pu_bacteria | 2996893221 | 2996896718 | 203 |
| 351 | iso_pu_bacteria | 3004203850 | 3004210503 | 203 |
| 352 | iso_pu_bacteria | 8005301065 | 8005305206 | 203 |
| 353 | iso_pu_bacteria | 8005307578 | 8005313316 | 203 |
| 354 | iso_pu_bacteria | 8005688590 | 8005689228 | 203 |
| 355 | iso_pu_bacteria | 8018127388 | 8018127746 | 203 |
| 356 | iso_pu_bacteria | 8056375014 | 8056375334 | 203 |
| 357 | 3300003775 | Ga0055524_1042870 | Ga0055524_10428701 | 204 |
| 358 | 3300013102 | Ga0157371_10059812 | Ga0157371_100598124 | 204 |
| 359 | 3300013104 | Ga0157370_10353536 | Ga0157370_103535361 | 204 |
| 360 | 3300013105 | Ga0157369_10089228 | Ga0157369_100892284 | 204 |
| 361 | 3300025299 | Ga0209256_1003703 | Ga0209256_10037035 | 204 |
| 362 | 3300031548 | Ga0307408_100003096 | Ga0307408_10000309613 | 204 |
| 363 | 3300046457 | Ga0495590_0018238 | Ga0495590_0018238_163_780 | 204 |
| 364 | 3300046460 | Ga0495638_0000021 | Ga0495638_0000021_242695_243327 | 204 |
| 365 | 3300046506 | Ga0495583_0003016 | Ga0495583_0003016_735_1367 | 204 |
| 366 | 3300046519 | Ga0495632_0013002 | Ga0495632_0013002_823_1455 | 204 |
| 367 | 3300046524 | Ga0495648_0000071 | Ga0495648_0000071_122276_122908 | 204 |
| 368 | 3300046558 | Ga0495633_0058461 | Ga0495633_0058461_514_1146 | 204 |
| 369 | 3300046558 | Ga0495633_0086162 | Ga0495633_0086162_99_725 | 204 |
| 370 | 3300046692 | Ga0495671_0000046 | Ga0495671_0000046_122264_122896 | 204 |
| 371 | 3300046810 | Ga0495660_0057083 | Ga0495660_0057083_879_1496 | 204 |
| 372 | 3300047469 | Ga0495673_0000066 | Ga0495673_0000066_98583_99215 | 204 |
| 373 | 3300048925 | Ga0496122_0048439 | Ga0496122_0048439_1594_2217 | 204 |
| 374 | 3300048927 | Ga0496124_0143408 | Ga0496124_0143408_32_667 | 204 |
| 375 | 3300059493 | Ga0587077_007056 | Ga0587077_007056_532_1152 | 204 |
| 376 | iso_pu_bacteria | 2510917022 | 2511137224 | 204 |
| 377 | iso_pu_bacteria | 2511231027 | 2511388508 | 204 |
| 378 | iso_pu_bacteria | 2582581307 | 2585273386 | 204 |
| 379 | iso_pu_bacteria | 2585427531 | 2585564083 | 204 |
| 380 | iso_pu_bacteria | 2585427609 | 2585909190 | 204 |
| 381 | iso_pu_bacteria | 2585428125 | 2587984708 | 204 |
| 382 | iso_pu_bacteria | 2600255279 | 2601609579 | 204 |
| 383 | iso_pu_bacteria | 2600255308 | 2601746354 | 204 |
| 384 | iso_pu_bacteria | 2818991439 | 2819556902 | 204 |
| 385 | iso_pu_bacteria | 2842733646 | 2842734940 | 204 |
| 386 | iso_pu_bacteria | 2842747753 | 2842748020 | 204 |
| 387 | iso_pu_bacteria | 2842871566 | 2842875381 | 204 |
| 388 | iso_pu_bacteria | 2933594066 | 2933594150 | 204 |
| 389 | iso_pu_bacteria | 2979100975 | 2979104783 | 204 |
| 390 | iso_pu_bacteria | 2984509177 | 2984513417 | 204 |
| 391 | iso_pu_bacteria | 2984518228 | 2984520215 | 204 |
| 392 | iso_pu_bacteria | 2984537506 | 2984539511 | 204 |
| 393 | iso_pu_bacteria | 2984601300 | 2984601738 | 204 |
| 394 | iso_pu_bacteria | 3002141150 | 3002145568 | 204 |
| 395 | 3300002705 | JGI25156J39149_1010422 | JGI25156J39149_10104222 | 205 |
| 396 | 3300002739 | JGI25158J39367_1000021 | JGI25158J39367_100002111 | 205 |
| 397 | 3300002741 | JGI25157J39369_1000850 | JGI25157J39369_10008502 | 205 |
| 398 | 3300002773 | JGI25152J39213_1000418 | JGI25152J39213_100041826 | 205 |
| 399 | 3300002773 | JGI25152J39213_1002073 | JGI25152J39213_10020736 | 205 |
| 400 | 3300002773 | JGI25152J39213_1002786 | JGI25152J39213_10027866 | 205 |
| 401 | 3300002773 | JGI25152J39213_1011150 | JGI25152J39213_10111501 | 205 |
| 402 | 3300002773 | JGI25152J39213_1011152 | JGI25152J39213_10111521 | 205 |
| 403 | 3300002774 | JGI25150J39212_1000022 | JGI25150J39212_100002274 | 205 |
| 404 | 3300002774 | JGI25150J39212_1000218 | JGI25150J39212_100021820 | 205 |
| 405 | 3300002774 | JGI25150J39212_1023301 | JGI25150J39212_10233012 | 205 |
| 406 | 3300002774 | JGI25150J39212_1027816 | JGI25150J39212_10278162 | 205 |
| 407 | 3300002987 | JGI25159J45721_1000025 | JGI25159J45721_100002532 | 205 |
| 408 | 3300002987 | JGI25159J45721_1000423 | JGI25159J45721_10004235 | 205 |
| 409 | 3300002987 | JGI25159J45721_1036051 | JGI25159J45721_10360511 | 205 |
| 410 | 3300003187 | JGI25151J46595_10000023 | JGI25151J46595_1000002369 | 205 |
| 411 | 3300003187 | JGI25151J46595_10010809 | JGI25151J46595_100108094 | 205 |
| 412 | 3300003214 | JGI25165J46597_1000037 | JGI25165J46597_1000037230 | 205 |
| 413 | 3300003215 | JGI25153J46596_10000093 | JGI25153J46596_1000009348 | 205 |
| 414 | 3300003215 | JGI25153J46596_10011096 | JGI25153J46596_100110963 | 205 |
| 415 | 3300003215 | JGI25153J46596_10014572 | JGI25153J46596_100145722 | 205 |
| 416 | 3300003215 | JGI25153J46596_10027257 | JGI25153J46596_100272571 | 205 |
| 417 | 3300003215 | JGI25153J46596_10027258 | JGI25153J46596_100272581 | 205 |
| 418 | 3300003322 | rootL2_10084851 | rootL2_100848513 | 205 |
| 419 | 3300003354 | JGI25160J50197_1000065 | JGI25160J50197_100006531 | 205 |
| 420 | 3300003354 | JGI25160J50197_1002796 | JGI25160J50197_10027967 | 205 |
| 421 | 3300003354 | JGI25160J50197_1012806 | JGI25160J50197_10128063 | 205 |
| 422 | 3300003374 | JGI25161J50226_1000025 | JGI25161J50226_100002542 | 205 |
| 423 | 3300003374 | JGI25161J50226_1000083 | JGI25161J50226_10000836 | 205 |
| 424 | 3300003771 | Ga0055526_1002775 | Ga0055526_10027754 | 205 |
| 425 | 3300003771 | Ga0055526_1004470 | Ga0055526_10044704 | 205 |
| 426 | 3300003771 | Ga0055526_1027405 | Ga0055526_10274052 | 205 |
| 427 | 3300003775 | Ga0055524_1021274 | Ga0055524_10212742 | 205 |
| 428 | 3300003775 | Ga0055524_1038290 | Ga0055524_10382902 | 205 |
| 429 | 3300003781 | Ga0055536_1023198 | Ga0055536_10231982 | 205 |
| 430 | 3300003781 | Ga0055536_1040211 | Ga0055536_10402112 | 205 |
| 431 | 3300003790 | Ga0055528_1017639 | Ga0055528_10176393 | 205 |
| 432 | 3300003791 | Ga0055530_10009417 | Ga0055530_100094172 | 205 |
| 433 | 3300003791 | Ga0055530_10019233 | Ga0055530_100192332 | 205 |
| 434 | 3300003792 | Ga0055540_1001782 | Ga0055540_10017824 | 205 |
| 435 | 3300003792 | Ga0055540_1003016 | Ga0055540_10030163 | 205 |
| 436 | 3300003794 | Ga0055531_10016903 | Ga0055531_100169032 | 205 |
| 437 | 3300004625 | Ga0055543_1000134 | Ga0055543_100013427 | 205 |
| 438 | 3300004625 | Ga0055543_1000326 | Ga0055543_10003269 | 205 |
| 439 | 3300005262 | Ga0065165_1000090 | Ga0065165_100009084 | 205 |
| 440 | 3300005262 | Ga0065165_1005679 | Ga0065165_10056796 | 205 |
| 441 | 3300005331 | Ga0070670_100584965 | Ga0070670_1005849652 | 205 |
| 442 | 3300005344 | Ga0070661_100337915 | Ga0070661_1003379152 | 205 |
| 443 | 3300005353 | Ga0070669_100402627 | Ga0070669_1004026272 | 205 |
| 444 | 3300005355 | Ga0070671_100044834 | Ga0070671_1000448343 | 205 |
| 445 | 3300005548 | Ga0070665_100183096 | Ga0070665_1001830961 | 205 |
| 446 | 3300005578 | Ga0068854_100699751 | Ga0068854_1006997512 | 205 |
| 447 | 3300005616 | Ga0068852_100063844 | Ga0068852_1000638444 | 205 |
| 448 | 3300006038 | Ga0075365_10004326 | Ga0075365_100043266 | 205 |
| 449 | 3300006051 | Ga0075364_10013170 | Ga0075364_100131702 | 205 |
| 450 | 3300006177 | Ga0075362_10056005 | Ga0075362_100560052 | 205 |
| 451 | 3300006186 | Ga0075369_10001052 | Ga0075369_100010525 | 205 |
| 452 | 3300006186 | Ga0075369_10035220 | Ga0075369_100352202 | 205 |
| 453 | 3300006353 | Ga0075370_10013747 | Ga0075370_100137472 | 205 |
| 454 | 3300006353 | Ga0075370_10014662 | Ga0075370_100146622 | 205 |
| 455 | 3300006946 | Ga0079104_1000082 | Ga0079104_100008283 | 205 |
| 456 | 3300009011 | Ga0105251_10004594 | Ga0105251_100045948 | 205 |
| 457 | 3300009036 | Ga0105244_10200189 | Ga0105244_102001892 | 205 |
| 458 | 3300009092 | Ga0105250_10072174 | Ga0105250_100721742 | 205 |
| 459 | 3300009093 | Ga0105240_11111067 | Ga0105240_111110672 | 205 |
| 460 | 3300009545 | Ga0105237_10077887 | Ga0105237_100778872 | 205 |
| 461 | 3300009765 | Ga0123341_1085432 | Ga0123341_10854322 | 205 |
| 462 | 3300009766 | Ga0123342_1013095 | Ga0123342_10130952 | 205 |
| 463 | 3300010375 | Ga0105239_10370387 | Ga0105239_103703872 | 205 |
| 464 | 3300013100 | Ga0157373_10049232 | Ga0157373_100492322 | 205 |
| 465 | 3300013104 | Ga0157370_10045498 | Ga0157370_100454984 | 205 |
| 466 | 3300013105 | Ga0157369_10011473 | Ga0157369_100114737 | 205 |
| 467 | 3300013105 | Ga0157369_10643955 | Ga0157369_106439552 | 205 |
| 468 | 3300013296 | Ga0157374_11124512 | Ga0157374_111245122 | 205 |
| 469 | 3300014969 | Ga0157376_10704159 | Ga0157376_107041592 | 205 |
| 470 | 3300015690 | Ga0183363_1132 | Ga0183363_113219 | 205 |
| 471 | 3300025208 | Ga0209436_100017 | Ga0209436_10001797 | 205 |
| 472 | 3300025208 | Ga0209436_100087 | Ga0209436_10008715 | 205 |
| 473 | 3300025245 | Ga0207425_1000038 | Ga0207425_1000038159 | 205 |
| 474 | 3300025245 | Ga0207425_1000072 | Ga0207425_100007264 | 205 |
| 475 | 3300025245 | Ga0207425_1004423 | Ga0207425_10044234 | 205 |
| 476 | 3300025245 | Ga0207425_1008695 | Ga0207425_10086952 | 205 |
| 477 | 3300025245 | Ga0207425_1036744 | Ga0207425_10367442 | 205 |
| 478 | 3300025246 | Ga0209646_1005780 | Ga0209646_10057802 | 205 |
| 479 | 3300025250 | Ga0209026_1000013 | Ga0209026_100001313 | 205 |
| 480 | 3300025256 | Ga0209759_1000149 | Ga0209759_100014953 | 205 |
| 481 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016188 | 205 |
| 482 | 3300025258 | Ga0209129_1000036 | Ga0209129_1000036159 | 205 |
| 483 | 3300025258 | Ga0209129_1001358 | Ga0209129_10013588 | 205 |
| 484 | 3300025258 | Ga0209129_1004036 | Ga0209129_10040362 | 205 |
| 485 | 3300025258 | Ga0209129_1004638 | Ga0209129_10046382 | 205 |
| 486 | 3300025258 | Ga0209129_1011135 | Ga0209129_10111352 | 205 |
| 487 | 3300025261 | Ga0209233_1000102 | Ga0209233_1000102230 | 205 |
| 488 | 3300025263 | Ga0209565_1000132 | Ga0209565_10001322 | 205 |
| 489 | 3300025263 | Ga0209565_1013479 | Ga0209565_10134792 | 205 |
| 490 | 3300025273 | Ga0209673_1006166 | Ga0209673_10061662 | 205 |
| 491 | 3300025273 | Ga0209673_1021516 | Ga0209673_10215163 | 205 |
| 492 | 3300025273 | Ga0209673_1024633 | Ga0209673_10246332 | 205 |
| 493 | 3300025273 | Ga0209673_1052149 | Ga0209673_10521492 | 205 |
| 494 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001115 | 205 |
| 495 | 3300025284 | Ga0209130_1000079 | Ga0209130_100007984 | 205 |
| 496 | 3300025284 | Ga0209130_1021845 | Ga0209130_10218452 | 205 |
| 497 | 3300025292 | Ga0209676_1007320 | Ga0209676_10073202 | 205 |
| 498 | 3300025292 | Ga0209676_1044823 | Ga0209676_10448232 | 205 |
| 499 | 3300025294 | Ga0209025_1000108 | Ga0209025_1000108159 | 205 |
| 500 | 3300025294 | Ga0209025_1000177 | Ga0209025_1000177102 | 205 |
| 501 | 3300025294 | Ga0209025_1000469 | Ga0209025_100046963 | 205 |
| 502 | 3300025294 | Ga0209025_1002058 | Ga0209025_100205814 | 205 |
| 503 | 3300025294 | Ga0209025_1007023 | Ga0209025_10070233 | 205 |
| 504 | 3300025294 | Ga0209025_1013293 | Ga0209025_10132933 | 205 |
| 505 | 3300025294 | Ga0209025_1053533 | Ga0209025_10535332 | 205 |
| 506 | 3300025295 | Ga0209564_1000132 | Ga0209564_100013229 | 205 |
| 507 | 3300025295 | Ga0209564_1000551 | Ga0209564_100055164 | 205 |
| 508 | 3300025295 | Ga0209564_1001535 | Ga0209564_10015356 | 205 |
| 509 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009700 | 205 |
| 510 | 3300025297 | Ga0209758_1000104 | Ga0209758_100010468 | 205 |
| 511 | 3300025297 | Ga0209758_1001035 | Ga0209758_100103523 | 205 |
| 512 | 3300025297 | Ga0209758_1001245 | Ga0209758_100124522 | 205 |
| 513 | 3300025297 | Ga0209758_1016436 | Ga0209758_10164364 | 205 |
| 514 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005469 | 205 |
| 515 | 3300025298 | Ga0209050_1000195 | Ga0209050_100019515 | 205 |
| 516 | 3300025299 | Ga0209256_1007709 | Ga0209256_10077095 | 205 |
| 517 | 3300025299 | Ga0209256_1010343 | Ga0209256_10103433 | 205 |
| 518 | 3300025299 | Ga0209256_1039988 | Ga0209256_10399882 | 205 |
| 519 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005720 | 205 |
| 520 | 3300025302 | Ga0207426_1000167 | Ga0207426_100016743 | 205 |
| 521 | 3300025302 | Ga0207426_1003048 | Ga0207426_10030487 | 205 |
| 522 | 3300025302 | Ga0207426_1018980 | Ga0207426_10189804 | 205 |
| 523 | 3300025303 | Ga0209051_1000414 | Ga0209051_100041414 | 205 |
| 524 | 3300025303 | Ga0209051_1001577 | Ga0209051_100157710 | 205 |
| 525 | 3300025303 | Ga0209051_1020084 | Ga0209051_10200842 | 205 |
| 526 | 3300025304 | Ga0209257_1010894 | Ga0209257_10108943 | 205 |
| 527 | 3300025304 | Ga0209257_1011219 | Ga0209257_10112193 | 205 |
| 528 | 3300025304 | Ga0209257_1039143 | Ga0209257_10391433 | 205 |
| 529 | 3300025914 | Ga0207671_10031678 | Ga0207671_100316782 | 205 |
| 530 | 3300025923 | Ga0207681_10438974 | Ga0207681_104389742 | 205 |
| 531 | 3300025924 | Ga0207694_10054991 | Ga0207694_100549914 | 205 |
| 532 | 3300025949 | Ga0207667_10569986 | Ga0207667_105699862 | 205 |
| 533 | 3300025972 | Ga0207668_10247564 | Ga0207668_102475642 | 205 |
| 534 | 3300025981 | Ga0207640_10795821 | Ga0207640_107958211 | 205 |
| 535 | 3300026041 | Ga0207639_10002789 | Ga0207639_100027897 | 205 |
| 536 | 3300026041 | Ga0207639_10027766 | Ga0207639_100277663 | 205 |
| 537 | 3300026142 | Ga0207698_10372487 | Ga0207698_103724872 | 205 |
| 538 | 3300027111 | Ga0209281_1000043 | Ga0209281_100004380 | 205 |
| 539 | 3300028379 | Ga0268266_10088248 | Ga0268266_100882483 | 205 |
| 540 | 3300028379 | Ga0268266_11114753 | Ga0268266_111147532 | 205 |
| 541 | 3300028794 | Ga0307515_10023533 | Ga0307515_100235335 | 205 |
| 542 | 3300037466 | Ga0395898_1029572 | Ga0395898_1029572_32_658 | 205 |
| 543 | 3300037471 | Ga0395905_0101077 | Ga0395905_0101077_1085_1702 | 205 |
| 544 | 3300037471 | Ga0395905_0349493 | Ga0395905_0349493_449_1075 | 205 |
| 545 | 3300037471 | Ga0395905_0391955 | Ga0395905_0391955_577_1197 | 205 |
| 546 | 3300038443 | Ga0395901_0048436 | Ga0395901_0048436_2667_3293 | 205 |
| 547 | 3300041413 | Ga0439465_0139534 | Ga0439465_0139534_171_797 | 205 |
| 548 | 3300041492 | Ga0451835_0808235 | Ga0451835_0808235_195_821 | 205 |
| 549 | 3300041494 | Ga0451837_0256684 | Ga0451837_0256684_158_778 | 205 |
| 550 | 3300041511 | Ga0451855_0228500 | Ga0451855_0228500_845_1465 | 205 |
| 551 | 3300044658 | Ga0466972_0077755 | Ga0466972_0077755_552_1178 | 205 |
| 552 | 3300044735 | Ga0466968_0122672 | Ga0466968_0122672_496_1122 | 205 |
| 553 | 3300046460 | Ga0495638_0002018 | Ga0495638_0002018_8934_9563 | 205 |
| 554 | 3300046460 | Ga0495638_0137808 | Ga0495638_0137808_410_1039 | 205 |
| 555 | 3300046474 | Ga0495605_0006188 | Ga0495605_0006188_5301_5921 | 205 |
| 556 | 3300046492 | Ga0495585_0018239 | Ga0495585_0018239_913_1533 | 205 |
| 557 | 3300046506 | Ga0495583_0013674 | Ga0495583_0013674_724_1344 | 205 |
| 558 | 3300046507 | Ga0495606_0038253 | Ga0495606_0038253_2029_2649 | 205 |
| 559 | 3300046512 | Ga0495610_0000072 | Ga0495610_0000072_74591_75235 | 205 |
| 560 | 3300046515 | Ga0495620_0050277 | Ga0495620_0050277_85_705 | 205 |
| 561 | 3300046522 | Ga0495643_0006542 | Ga0495643_0006542_4778_5398 | 205 |
| 562 | 3300046524 | Ga0495648_0001207 | Ga0495648_0001207_22554_23189 | 205 |
| 563 | 3300046530 | Ga0495654_0000305 | Ga0495654_0000305_2737_3357 | 205 |
| 564 | 3300046615 | Ga0495656_0387398 | Ga0495656_0387398_46_666 | 205 |
| 565 | 3300046616 | Ga0495668_0149651 | Ga0495668_0149651_335_964 | 205 |
| 566 | 3300046663 | Ga0495635_0082080 | Ga0495635_0082080_53_673 | 205 |
| 567 | 3300046674 | Ga0495588_0074987 | Ga0495588_0074987_639_1262 | 205 |
| 568 | 3300046691 | Ga0495670_0011840 | Ga0495670_0011840_464_1093 | 205 |
| 569 | 3300046694 | Ga0495649_0092400 | Ga0495649_0092400_912_1532 | 205 |
| 570 | 3300047317 | Ga0495604_0001490 | Ga0495604_0001490_11995_12615 | 205 |
| 571 | 3300047470 | Ga0495681_0000043 | Ga0495681_0000043_83537_84181 | 205 |
| 572 | 3300047470 | Ga0495681_0163088 | Ga0495681_0163088_186_806 | 205 |
| 573 | 3300047472 | Ga0495686_0116556 | Ga0495686_0116556_582_1226 | 205 |
| 574 | 3300048909 | Ga0496106_0000221 | Ga0496106_0000221_38777_39397 | 205 |
| 575 | 3300048910 | Ga0496107_0034220 | Ga0496107_0034220_2187_2816 | 205 |
| 576 | 3300048912 | Ga0496109_0081727 | Ga0496109_0081727_1549_2193 | 205 |
| 577 | 3300048913 | Ga0496110_0046668 | Ga0496110_0046668_2865_3509 | 205 |
| 578 | 3300048913 | Ga0496110_0311728 | Ga0496110_0311728_148_768 | 205 |
| 579 | 3300048914 | Ga0496111_0009028 | Ga0496111_0009028_808_1428 | 205 |
| 580 | 3300048914 | Ga0496111_0585395 | Ga0496111_0585395_131_775 | 205 |
| 581 | 3300048916 | Ga0496113_0127825 | Ga0496113_0127825_471_1091 | 205 |
| 582 | 3300048919 | Ga0496116_0040712 | Ga0496116_0040712_1690_2310 | 205 |
| 583 | 3300048919 | Ga0496116_0062334 | Ga0496116_0062334_1068_1688 | 205 |
| 584 | 3300048920 | Ga0496117_0019860 | Ga0496117_0019860_4664_5284 | 205 |
| 585 | 3300048920 | Ga0496117_0105356 | Ga0496117_0105356_642_1262 | 205 |
| 586 | 3300048920 | Ga0496117_0237703 | Ga0496117_0237703_153_773 | 205 |
| 587 | 3300048921 | Ga0496118_0062586 | Ga0496118_0062586_890_1510 | 205 |
| 588 | 3300048922 | Ga0496119_0263313 | Ga0496119_0263313_86_715 | 205 |
| 589 | 3300048923 | Ga0496120_0000435 | Ga0496120_0000435_1200_1826 | 205 |
| 590 | 3300048924 | Ga0496121_0005816 | Ga0496121_0005816_1612_2241 | 205 |
| 591 | 3300048924 | Ga0496121_0013804 | Ga0496121_0013804_7130_7750 | 205 |
| 592 | 3300048924 | Ga0496121_0019043 | Ga0496121_0019043_597_1217 | 205 |
| 593 | 3300048924 | Ga0496121_0057152 | Ga0496121_0057152_876_1496 | 205 |
| 594 | 3300048924 | Ga0496121_0075156 | Ga0496121_0075156_1995_2615 | 205 |
| 595 | 3300048924 | Ga0496121_0144262 | Ga0496121_0144262_457_1086 | 205 |
| 596 | 3300048924 | Ga0496121_0430624 | Ga0496121_0430624_108_734 | 205 |
| 597 | 3300048925 | Ga0496122_0000106 | Ga0496122_0000106_32471_33091 | 205 |
| 598 | 3300048925 | Ga0496122_0000606 | Ga0496122_0000606_17770_18390 | 205 |
| 599 | 3300048925 | Ga0496122_0008697 | Ga0496122_0008697_9615_10235 | 205 |
| 600 | 3300048925 | Ga0496122_0010098 | Ga0496122_0010098_948_1568 | 205 |
| 601 | 3300048925 | Ga0496122_0026617 | Ga0496122_0026617_1070_1690 | 205 |
| 602 | 3300048925 | Ga0496122_0176778 | Ga0496122_0176778_473_1093 | 205 |
| 603 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_329066_329686 | 205 |
| 604 | 3300048926 | Ga0496123_0000450 | Ga0496123_0000450_17820_18440 | 205 |
| 605 | 3300048926 | Ga0496123_0026040 | Ga0496123_0026040_2991_3611 | 205 |
| 606 | 3300048926 | Ga0496123_0206454 | Ga0496123_0206454_12_632 | 205 |
| 607 | 3300048927 | Ga0496124_0000153 | Ga0496124_0000153_121965_122585 | 205 |
| 608 | 3300048927 | Ga0496124_0017079 | Ga0496124_0017079_730_1350 | 205 |
| 609 | 3300048927 | Ga0496124_0050747 | Ga0496124_0050747_535_1155 | 205 |
| 610 | 3300048927 | Ga0496124_0231221 | Ga0496124_0231221_601_1221 | 205 |
| 611 | 3300048928 | Ga0496125_0003083 | Ga0496125_0003083_2432_3052 | 205 |
| 612 | 3300048928 | Ga0496125_0027217 | Ga0496125_0027217_2916_3536 | 205 |
| 613 | 3300048928 | Ga0496125_0131552 | Ga0496125_0131552_112_732 | 205 |
| 614 | 3300048928 | Ga0496125_0176396 | Ga0496125_0176396_196_840 | 205 |
| 615 | 3300048929 | Ga0496126_0009081 | Ga0496126_0009081_1204_1824 | 205 |
| 616 | 3300048929 | Ga0496126_0023157 | Ga0496126_0023157_1440_2069 | 205 |
| 617 | 3300048929 | Ga0496126_0041231 | Ga0496126_0041231_2978_3604 | 205 |
| 618 | 3300048929 | Ga0496126_0196024 | Ga0496126_0196024_767_1387 | 205 |
| 619 | 3300048929 | Ga0496126_0419398 | Ga0496126_0419398_144_773 | 205 |
| 620 | 3300049568 | Ga0501031_0013477 | Ga0501031_0013477_2378_3004 | 205 |
| 621 | 3300049569 | Ga0501032_0018503 | Ga0501032_0018503_3807_4433 | 205 |
| 622 | 3300049570 | Ga0501033_0019187 | Ga0501033_0019187_3765_4391 | 205 |
| 623 | 3300049571 | Ga0501034_0025864 | Ga0501034_0025864_1545_2171 | 205 |
| 624 | 3300049573 | Ga0501037_0021179 | Ga0501037_0021179_371_997 | 205 |
| 625 | 3300049574 | Ga0501038_0223447 | Ga0501038_0223447_133_759 | 205 |
| 626 | 3300049575 | Ga0501039_0035281 | Ga0501039_0035281_1451_2077 | 205 |
| 627 | 3300049578 | Ga0501042_0075686 | Ga0501042_0075686_743_1369 | 205 |
| 628 | 3300049579 | Ga0501043_0014731 | Ga0501043_0014731_1690_2316 | 205 |
| 629 | 3300049580 | Ga0501046_0128085 | Ga0501046_0128085_414_1034 | 205 |
| 630 | 3300049580 | Ga0501046_0129379 | Ga0501046_0129379_547_1173 | 205 |
| 631 | 3300049581 | Ga0501047_0115538 | Ga0501047_0115538_133_759 | 205 |
| 632 | 3300049582 | Ga0501048_0138979 | Ga0501048_0138979_719_1345 | 205 |
| 633 | 3300049584 | Ga0501068_0080606 | Ga0501068_0080606_742_1368 | 205 |
| 634 | 3300049586 | Ga0501070_0069974 | Ga0501070_0069974_565_1191 | 205 |
| 635 | 3300049587 | Ga0501071_0273097 | Ga0501071_0273097_70_696 | 205 |
| 636 | 3300049590 | Ga0501074_0251043 | Ga0501074_0251043_270_896 | 205 |
| 637 | 3300049663 | Ga0501223_000004 | Ga0501223_000004_83619_84263 | 205 |
| 638 | 3300049676 | Ga0501246_000533 | Ga0501246_000533_1898_2542 | 205 |
| 639 | 3300049705 | Ga0501225_0000003 | Ga0501225_0000003_56580_57224 | 205 |
| 640 | 3300049705 | Ga0501225_0009427 | Ga0501225_0009427_1168_1812 | 205 |
| 641 | 3300049742 | Ga0501080_0222342 | Ga0501080_0222342_465_1091 | 205 |
| 642 | 3300049744 | Ga0501083_0046580 | Ga0501083_0046580_775_1395 | 205 |
| 643 | 3300049822 | Ga0501035_0149495 | Ga0501035_0149495_780_1406 | 205 |
| 644 | 3300049823 | Ga0501044_0043203 | Ga0501044_0043203_750_1376 | 205 |
| 645 | 3300049824 | Ga0501045_0146975 | Ga0501045_0146975_413_1039 | 205 |
| 646 | 3300050491 | nmdc:mga00v17_588_c1 | nmdc:mga00v17_588_c1_4661_5281 | 205 |
| 647 | 3300050492 | nmdc:mga0yw44_328923_c1 | nmdc:mga0yw44_328923_c1_160_786 | 205 |
| 648 | 3300050496 | nmdc:mga07m45_30198_c1 | nmdc:mga07m45_30198_c1_1766_2395 | 205 |
| 649 | 3300053077 | Ga0495601_0324768 | Ga0495601_0324768_100_720 | 205 |
| 650 | 3300053086 | Ga0500578_0073555 | Ga0500578_0073555_101_721 | 205 |
| 651 | 3300053109 | Ga0500569_045282 | Ga0500569_045282_77_697 | 205 |
| 652 | 3300053118 | Ga0500594_0029356 | Ga0500594_0029356_31_657 | 205 |
| 653 | 3300053121 | Ga0500607_013879 | Ga0500607_013879_788_1417 | 205 |
| 654 | 3300053122 | Ga0500608_085643 | Ga0500608_085643_109_729 | 205 |
| 655 | 3300053125 | Ga0500618_001236 | Ga0500618_001236_1199_1819 | 205 |
| 656 | 3300053134 | Ga0500658_0035794 | Ga0500658_0035794_366_986 | 205 |
| 657 | 3300053136 | Ga0500559_0007386 | Ga0500559_0007386_3677_4306 | 205 |
| 658 | 3300053151 | Ga0500604_0131728 | Ga0500604_0131728_171_794 | 205 |
| 659 | 3300053153 | Ga0500616_0022506 | Ga0500616_0022506_2414_3034 | 205 |
| 660 | 3300053153 | Ga0500616_0183750 | Ga0500616_0183750_212_832 | 205 |
| 661 | 3300053156 | Ga0500622_0000104 | Ga0500622_0000104_4740_5360 | 205 |
| 662 | 3300053158 | Ga0500627_0049177 | Ga0500627_0049177_789_1409 | 205 |
| 663 | 3300053158 | Ga0500627_0095729 | Ga0500627_0095729_574_1194 | 205 |
| 664 | 3300053177 | Ga0500636_0000526 | Ga0500636_0000526_3371_4000 | 205 |
| 665 | 3300053178 | Ga0500637_0030710 | Ga0500637_0030710_605_1234 | 205 |
| 666 | 3300059503 | Ga0587080_036369 | Ga0587080_036369_241_861 | 205 |
| 667 | iso_pu_bacteria | 8054002106 | 8054007964 | 205 |
| 668 | 3300003322 | rootL2_10000310 | rootL2_100003107 | 206 |
| 669 | 3300003775 | Ga0055524_1000762 | Ga0055524_10007622 | 206 |
| 670 | 3300003775 | Ga0055524_1007093 | Ga0055524_10070932 | 206 |
| 671 | 3300003791 | Ga0055530_10016666 | Ga0055530_100166662 | 206 |
| 672 | 3300003792 | Ga0055540_1008873 | Ga0055540_10088732 | 206 |
| 673 | 3300003794 | Ga0055531_10000203 | Ga0055531_1000020350 | 206 |
| 674 | 3300003794 | Ga0055531_10011813 | Ga0055531_100118135 | 206 |
| 675 | 3300005337 | Ga0070682_100430668 | Ga0070682_1004306682 | 206 |
| 676 | 3300005356 | Ga0070674_100128781 | Ga0070674_1001287813 | 206 |
| 677 | 3300005548 | Ga0070665_100054885 | Ga0070665_1000548853 | 206 |
| 678 | 3300005614 | Ga0068856_100219009 | Ga0068856_1002190093 | 206 |
| 679 | 3300006051 | Ga0075364_10018250 | Ga0075364_100182505 | 206 |
| 680 | 3300006177 | Ga0075362_10192458 | Ga0075362_101924582 | 206 |
| 681 | 3300006178 | Ga0075367_10158360 | Ga0075367_101583602 | 206 |
| 682 | 3300006195 | Ga0075366_10018751 | Ga0075366_100187512 | 206 |
| 683 | 3300006353 | Ga0075370_10022652 | Ga0075370_100226525 | 206 |
| 684 | 3300006944 | Ga0099823_1000478 | Ga0099823_100047815 | 206 |
| 685 | 3300009176 | Ga0105242_11261179 | Ga0105242_112611791 | 206 |
| 686 | 3300012497 | Ga0157319_1000008 | Ga0157319_1000008169 | 206 |
| 687 | 3300025242 | Ga0209258_108353 | Ga0209258_1083532 | 206 |
| 688 | 3300025245 | Ga0207425_1029722 | Ga0207425_10297222 | 206 |
| 689 | 3300025273 | Ga0209673_1023214 | Ga0209673_10232142 | 206 |
| 690 | 3300025284 | Ga0209130_1033398 | Ga0209130_10333982 | 206 |
| 691 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008569 | 206 |
| 692 | 3300025295 | Ga0209564_1005534 | Ga0209564_10055343 | 206 |
| 693 | 3300025298 | Ga0209050_1002935 | Ga0209050_10029359 | 206 |
| 694 | 3300025298 | Ga0209050_1003178 | Ga0209050_10031786 | 206 |
| 695 | 3300025299 | Ga0209256_1001049 | Ga0209256_10010492 | 206 |
| 696 | 3300025303 | Ga0209051_1000960 | Ga0209051_100096021 | 206 |
| 697 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017648 | 206 |
| 698 | 3300025304 | Ga0209257_1002056 | Ga0209257_10020563 | 206 |
| 699 | 3300025304 | Ga0209257_1008974 | Ga0209257_10089742 | 206 |
| 700 | 3300025913 | Ga0207695_10218637 | Ga0207695_102186373 | 206 |
| 701 | 3300025926 | Ga0207659_10040742 | Ga0207659_100407422 | 206 |
| 702 | 3300025934 | Ga0207686_10722121 | Ga0207686_107221211 | 206 |
| 703 | 3300025937 | Ga0207669_10197804 | Ga0207669_101978041 | 206 |
| 704 | 3300026078 | Ga0207702_10081048 | Ga0207702_100810484 | 206 |
| 705 | 3300027296 | Ga0209389_1041846 | Ga0209389_10418462 | 206 |
| 706 | 3300027312 | Ga0209371_1011474 | Ga0209371_10114742 | 206 |
| 707 | 3300028379 | Ga0268266_10651588 | Ga0268266_106515882 | 206 |
| 708 | 3300028794 | Ga0307515_10338826 | Ga0307515_103388262 | 206 |
| 709 | 3300030500 | Ga0268256_1016310 | Ga0268256_10163102 | 206 |
| 710 | 3300030744 | Ga0316181_1111885 | Ga0316181_11118852 | 206 |
| 711 | 3300032005 | Ga0307411_10002074 | Ga0307411_1000207411 | 206 |
| 712 | 3300034819 | Ga0373958_0008235 | Ga0373958_0008235_281_904 | 206 |
| 713 | 3300035088 | Ga0373940_0046997 | Ga0373940_0046997_297_920 | 206 |
| 714 | 3300035114 | Ga0373939_0000071 | Ga0373939_0000071_13674_14297 | 206 |
| 715 | 3300035121 | Ga0373960_0000615 | Ga0373960_0000615_6598_7221 | 206 |
| 716 | 3300035241 | Ga0373961_0025877 | Ga0373961_0025877_652_1275 | 206 |
| 717 | 3300035242 | Ga0373962_0055010 | Ga0373962_0055010_173_796 | 206 |
| 718 | 3300035691 | Ga0373931_0000591 | Ga0373931_0000591_6767_7390 | 206 |
| 719 | 3300037418 | Ga0395900_0327253 | Ga0395900_0327253_336_962 | 206 |
| 720 | 3300044694 | Ga0466963_0369659 | Ga0466963_0369659_245_868 | 206 |
| 721 | 3300045051 | Ga0451576_0162985 | Ga0451576_0162985_833_1453 | 206 |
| 722 | 3300046460 | Ga0495638_0119057 | Ga0495638_0119057_367_999 | 206 |
| 723 | 3300046501 | Ga0495607_0045477 | Ga0495607_0045477_1087_1719 | 206 |
| 724 | 3300046694 | Ga0495649_0003186 | Ga0495649_0003186_8923_9555 | 206 |
| 725 | 3300048919 | Ga0496116_0002755 | Ga0496116_0002755_16549_17178 | 206 |
| 726 | 3300048920 | Ga0496117_0005379 | Ga0496117_0005379_12184_12813 | 206 |
| 727 | 3300048921 | Ga0496118_0070256 | Ga0496118_0070256_1630_2259 | 206 |
| 728 | 3300048925 | Ga0496122_0115100 | Ga0496122_0115100_518_1147 | 206 |
| 729 | 3300048927 | Ga0496124_0108789 | Ga0496124_0108789_755_1384 | 206 |
| 730 | 3300048927 | Ga0496124_0303216 | Ga0496124_0303216_76_699 | 206 |
| 731 | 3300049538 | Ga0501322_000536 | Ga0501322_000536_601_1224 | 206 |
| 732 | 3300049665 | Ga0501227_019145 | Ga0501227_019145_912_1535 | 206 |
| 733 | 3300050491 | nmdc:mga00v17_172932_c1 | nmdc:mga00v17_172932_c1_34_657 | 206 |
| 734 | 3300050491 | nmdc:mga00v17_70872_c1 | nmdc:mga00v17_70872_c1_61_690 | 206 |
| 735 | 3300050492 | nmdc:mga0yw44_48090_c1 | nmdc:mga0yw44_48090_c1_419_1048 | 206 |
| 736 | 3300050516 | nmdc:mga0sz30_57345_c1 | nmdc:mga0sz30_57345_c1_621_1250 | 206 |
| 737 | 3300053136 | Ga0500559_0068519 | Ga0500559_0068519_606_1235 | 206 |
| 738 | 3300053145 | Ga0500586_019243 | Ga0500586_019243_921_1550 | 206 |
| 739 | 3300053177 | Ga0500636_0019536 | Ga0500636_0019536_2883_3530 | 206 |
| 740 | 3300053723 | Ga0500567_118430 | Ga0500567_118430_275_904 | 206 |
| 741 | 3300003794 | Ga0055531_10000322 | Ga0055531_1000032217 | 207 |
| 742 | 3300003856 | Ga0058692_1001200 | Ga0058692_10012005 | 207 |
| 743 | 3300005353 | Ga0070669_100011939 | Ga0070669_1000119394 | 207 |
| 744 | 3300005355 | Ga0070671_100540083 | Ga0070671_1005400831 | 207 |
| 745 | 3300005364 | Ga0070673_100137144 | Ga0070673_1001371442 | 207 |
| 746 | 3300005844 | Ga0068862_100363292 | Ga0068862_1003632922 | 207 |
| 747 | 3300006051 | Ga0075364_10141012 | Ga0075364_101410121 | 207 |
| 748 | 3300006948 | Ga0099826_10000533 | Ga0099826_1000053315 | 207 |
| 749 | 3300009177 | Ga0105248_10325654 | Ga0105248_103256543 | 207 |
| 750 | 3300014326 | Ga0157380_10126356 | Ga0157380_101263563 | 207 |
| 751 | 3300014497 | Ga0182008_10000625 | Ga0182008_1000062526 | 207 |
| 752 | 3300025273 | Ga0209673_1069612 | Ga0209673_10696122 | 207 |
| 753 | 3300025303 | Ga0209051_1000244 | Ga0209051_100024476 | 207 |
| 754 | 3300025304 | Ga0209257_1000144 | Ga0209257_1000144103 | 207 |
| 755 | 3300025923 | Ga0207681_10005851 | Ga0207681_100058514 | 207 |
| 756 | 3300025931 | Ga0207644_11089726 | Ga0207644_110897261 | 207 |
| 757 | 3300025941 | Ga0207711_10225102 | Ga0207711_102251023 | 207 |
| 758 | 3300025960 | Ga0207651_10015272 | Ga0207651_100152723 | 207 |
| 759 | 3300026116 | Ga0207674_11083226 | Ga0207674_110832261 | 207 |
| 760 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009916 | 207 |
| 761 | 3300027666 | Ga0209282_1001912 | Ga0209282_10019127 | 207 |
| 762 | 3300028794 | Ga0307515_10055417 | Ga0307515_100554175 | 207 |
| 763 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010915 | 207 |
| 764 | 3300042007 | Ga0439449_0086064 | Ga0439449_0086064_148_786 | 207 |
| 765 | 3300042134 | Ga0450898_034874 | Ga0450898_034874_275_898 | 207 |
| 766 | 3300045976 | Ga0466967_1333764 | Ga0466967_1333764_55_678 | 207 |
| 767 | 3300046539 | Ga0495621_0084288 | Ga0495621_0084288_259_885 | 207 |
| 768 | 3300048907 | Ga0496104_0145409 | Ga0496104_0145409_992_1618 | 207 |
| 769 | 3300048919 | Ga0496116_0042347 | Ga0496116_0042347_956_1582 | 207 |
| 770 | 3300048920 | Ga0496117_0091671 | Ga0496117_0091671_309_935 | 207 |
| 771 | 3300048921 | Ga0496118_0080497 | Ga0496118_0080497_1565_2197 | 207 |
| 772 | 3300048921 | Ga0496118_0131942 | Ga0496118_0131942_259_885 | 207 |
| 773 | 3300048923 | Ga0496120_0063014 | Ga0496120_0063014_579_1205 | 207 |
| 774 | 3300048928 | Ga0496125_0157425 | Ga0496125_0157425_776_1402 | 207 |
| 775 | 3300050516 | nmdc:mga0sz30_37484_c1 | nmdc:mga0sz30_37484_c1_336_962 | 207 |
| 776 | 3300053096 | Ga0500641_0240519 | Ga0500641_0240519_72_698 | 207 |
| 777 | 3300053125 | Ga0500618_012564 | Ga0500618_012564_834_1466 | 207 |
| 778 | 3300059641 | Ga0587068_013114 | Ga0587068_013114_257_883 | 207 |
| 779 | 3300059645 | Ga0587076_018853 | Ga0587076_018853_235_861 | 207 |
| 780 | 3300005353 | Ga0070669_100071077 | Ga0070669_1000710774 | 208 |
| 781 | 3300005563 | Ga0068855_100259943 | Ga0068855_1002599432 | 208 |
| 782 | 3300031731 | Ga0307405_10359122 | Ga0307405_103591222 | 208 |
| 783 | 3300037471 | Ga0395905_0053525 | Ga0395905_0053525_350_985 | 208 |
| 784 | 3300046491 | Ga0495584_0076721 | Ga0495584_0076721_766_1401 | 208 |
| 785 | 3300046513 | Ga0495616_0080367 | Ga0495616_0080367_862_1497 | 208 |
| 786 | 3300046538 | Ga0495609_0093554 | Ga0495609_0093554_22_657 | 208 |
| 787 | 3300046558 | Ga0495633_0089905 | Ga0495633_0089905_192_827 | 208 |
| 788 | 3300046616 | Ga0495668_0006163 | Ga0495668_0006163_817_1452 | 208 |
| 789 | 3300047323 | Ga0495683_0000007 | Ga0495683_0000007_168820_169482 | 208 |
| 790 | 3300048925 | Ga0496122_0000238 | Ga0496122_0000238_12529_13170 | 208 |
| 791 | 3300048926 | Ga0496123_0000262 | Ga0496123_0000262_3466_4107 | 208 |
| 792 | 3300048927 | Ga0496124_0279629 | Ga0496124_0279629_120_761 | 208 |
| 793 | 3300049671 | Ga0501238_016729 | Ga0501238_016729_159_797 | 208 |
| 794 | 3300037471 | Ga0395905_0163015 | Ga0395905_0163015_954_1631 | 209 |
| 795 | 3300037471 | Ga0395905_0624689 | Ga0395905_0624689_199_870 | 209 |
| 796 | 3300059493 | Ga0587077_038376 | Ga0587077_038376_68_742 | 209 |
| 797 | 2162886007 | SwRhRL2b_contig_1046040 | SwRhRL2b_0866.00002400 | 210 |
| 798 | 2162886007 | SwRhRL2b_contig_3838869 | SwRhRL2b_0610.00006260 | 210 |
| 799 | 3300048925 | Ga0496122_0020278 | Ga0496122_0020278_3669_4301 | 210 |
| 800 | iso_pu_bacteria | 2738543012 | 2739246566 | 210 |
| 801 | iso_pu_bacteria | 2816332133 | 2816476129 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yev-assembly2.cif.gz_A | structure of caa3-type cytochrome oxidase | 0.8793 | 46 | 202 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.8728 | 30 | 210 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.8554 | 30 | 210 |
| 8hcr-assembly1.cif.gz_S | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.8499 | 29 | 205 |
| 7e1v-assembly1.cif.gz_G | cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv | 0.829 | 26 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8589 | 26 | 210 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8584 | 29 | 205 | 1.20.120.80 |
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8505 | 26 | 210 | 1.20.120.80 |
| af_A0A0R0H600_74_264_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8401 | 31 | 205 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8239 | 29 | 205 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9TGN6-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9488 | 61 | 210 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 GO:0020037 |
| AF-X8DTB9-F1-model_v4 | Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.9432 | 79 | 205 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A6F8XYK9-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.94 | 68 | 207 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A316WCB9-F1-model_v4 | Cytochrome o ubiquinol oxidase subunit III | 0.9335 | 59 | 202 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A2D9N6L4-F1-model_v4 | Nitric oxide reductase | 0.9329 | 70 | 206 |
GO:0004129
GO:0005886 GO:0019646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar