F481327

General Info

Members Datasets Scaffolds Average Seq Length
799 337 1598 141

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10381247|Ga0105240_103812472
Length 170
Sequence LPPPGAREILEWTPDGVTNRQHSKEQTMPTRVATAVWEGGLQSGTGSFSGQSGKIGGAYSFGTRFGNTPGSNPEELLAAAEAACYSMALSLGLEQNGTPPQRVETKAACTIDKVGEGFKITTMVLTVRAKVPNVDAPTFRKIAEATKDGCPVSGALKGNVKIDLNASLDA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
309 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
310 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
311 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
312 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
319 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 16.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10381247 3300009093 Bacteria 1592
2 MBSR1b_contig_7847846 2162886012 Bacteria 1183
3 JGI24743J22301_10060699 3300001991 Bacteria 779
4 JGI25406J46586_10163224 3300003203 Bacteria 650
5 Ga0058863_11550363 3300004799 Unclassified 1202
6 Ga0058863_11558320 3300004799 Unclassified 1136
7 Ga0058861_10610375 3300004800 Bacteria 1213
8 Ga0058861_11284080 3300004800 Bacteria 690
9 Ga0058861_11408501 3300004800 Bacteria 973
10 Ga0058860_10752099 3300004801 Bacteria 531
11 Ga0058862_12180776 3300004803 Unclassified 1380
12 Ga0058862_12397805 3300004803 Unclassified 663
13 Ga0058862_12653458 3300004803 Bacteria 929
14 Ga0065712_10234666 3300005290 Archaea 1001
15 Ga0065715_10235195 3300005293 Archaea 1219
16 Ga0065715_10514040 3300005293 Bacteria 769
17 Ga0070658_10000597 3300005327 Bacteria 31272
18 Ga0070658_10079212 3300005327 Bacteria 2697
19 Ga0070658_10094934 3300005327 Bacteria 2461
20 Ga0070658_10258357 3300005327 Bacteria 1479
21 Ga0070658_10617383 3300005327 Unclassified 940
22 Ga0070683_100001684 3300005329 Bacteria 17172
23 Ga0070683_100009225 3300005329 Bacteria 8429
24 Ga0070683_100026017 3300005329 Bacteria 5263
25 Ga0070683_100035352 3300005329 Bacteria 4567
26 Ga0070683_100067883 3300005329 Bacteria 3321
27 Ga0070683_100145070 3300005329 Unclassified 2249
28 Ga0070683_100952737 3300005329 Bacteria 824
29 Ga0070683_101905555 3300005329 Unclassified 571
30 Ga0070690_100076729 3300005330 Bacteria 2181
31 Ga0070690_100464669 3300005330 Unclassified 941
32 Ga0070670_100111670 3300005331 Bacteria 2356
33 Ga0070670_100552176 3300005331 Bacteria 1028
34 Ga0070670_101300976 3300005331 Bacteria 665
35 Ga0070670_101584232 3300005331 Bacteria 602
36 Ga0070677_10019080 3300005333 Bacteria 2479
37 Ga0070666_10057844 3300005335 Bacteria 2621
38 Ga0070680_100000032 3300005336 Bacteria 72004
39 Ga0070680_100001592 3300005336 Bacteria 16578
40 Ga0070680_100002893 3300005336 Bacteria 12755
41 Ga0070680_100007829 3300005336 Bacteria 8145
42 Ga0070680_100138318 3300005336 Bacteria 2041
43 Ga0070680_100500666 3300005336 Bacteria 1039
44 Ga0070680_100958337 3300005336 Unclassified 739
45 Ga0070680_101125048 3300005336 Bacteria 679
46 Ga0068868_100073929 3300005338 Bacteria 2722
47 Ga0070660_100050108 3300005339 Bacteria 3212
48 Ga0070660_100066045 3300005339 Bacteria 2816
49 Ga0070660_100737113 3300005339 Bacteria 827
50 Ga0070660_101150700 3300005339 Bacteria 657
51 Ga0070689_100016472 3300005340 Bacteria 5409
52 Ga0070689_100985878 3300005340 Bacteria 749
53 Ga0070691_10015714 3300005341 Bacteria 3478
54 Ga0070691_10094455 3300005341 Bacteria 1478
55 Ga0070691_10117022 3300005341 Bacteria 1338
56 Ga0070687_100022445 3300005343 Bacteria 2984
57 Ga0070687_100112040 3300005343 Bacteria 1546
58 Ga0070661_100001846 3300005344 Bacteria 14670
59 Ga0070661_100007151 3300005344 Bacteria 7694
60 Ga0070661_100035891 3300005344 Bacteria 3603
61 Ga0070661_100210950 3300005344 Bacteria 1487
62 Ga0070661_100308767 3300005344 Bacteria 1233
63 Ga0070661_100432261 3300005344 Unclassified 1045
64 Ga0070661_100557856 3300005344 Unclassified 922
65 Ga0070692_10100987 3300005345 Bacteria 1581
66 Ga0070668_100006903 3300005347 Bacteria 8416
67 Ga0070668_100833587 3300005347 Unclassified 821
68 Ga0070669_100003884 3300005353 Bacteria 10810
69 Ga0070669_100098615 3300005353 Bacteria 2201
70 Ga0070669_100213936 3300005353 Bacteria 1522
71 Ga0070669_101335318 3300005353 Unclassified 621
72 Ga0070675_100003767 3300005354 Bacteria 11514
73 Ga0070675_100089686 3300005354 Unclassified 2575
74 Ga0070675_100800726 3300005354 Bacteria 861
75 Ga0070671_100076372 3300005355 Bacteria 2799
76 Ga0070671_100168051 3300005355 Unclassified 1855
77 Ga0070673_100010577 3300005364 Bacteria 6251
78 Ga0070688_100002375 3300005365 Bacteria 9507
79 Ga0070688_100428347 3300005365 Unclassified 985
80 Ga0070688_100507072 3300005365 Bacteria 911
81 Ga0070659_100003444 3300005366 Bacteria 11269
82 Ga0070659_100042038 3300005366 Bacteria 3574
83 Ga0070659_100067443 3300005366 Bacteria 2838
84 Ga0070659_100085280 3300005366 Bacteria 2526
85 Ga0070667_100022883 3300005367 Bacteria 5182
86 Ga0070703_10035037 3300005406 Bacteria 1535
87 Ga0070709_10058965 3300005434 Bacteria 2436
88 Ga0070714_100001266 3300005435 Bacteria 18255
89 Ga0070714_100007716 3300005435 Bacteria 8383
90 Ga0070714_100034862 3300005435 Bacteria 4215
91 Ga0070714_100861499 3300005435 Unclassified 879
92 Ga0070713_100000616 3300005436 Bacteria 22689
93 Ga0070701_10054540 3300005438 Bacteria 2085
94 Ga0070701_11087434 3300005438 Bacteria 562
95 Ga0070711_100065607 3300005439 Bacteria 2540
96 Ga0070711_100860099 3300005439 Unclassified 772
97 Ga0070708_100000017 3300005445 Bacteria 120364
98 Ga0070708_100505717 3300005445 Bacteria 1140
99 Ga0070663_100084160 3300005455 Bacteria 2344
100 Ga0070663_100125111 3300005455 Bacteria 1947
101 Ga0070663_100232237 3300005455 Bacteria 1453
102 Ga0070678_100599901 3300005456 Bacteria 983
103 Ga0070662_100000810 3300005457 Bacteria 19256
104 Ga0070662_100001212 3300005457 Bacteria 15827
105 Ga0070662_100148317 3300005457 Bacteria 1823
106 Ga0070662_100471814 3300005457 Bacteria 1044
107 Ga0070662_100561107 3300005457 Bacteria 957
108 Ga0070681_10010527 3300005458 Bacteria 9132
109 Ga0070681_10026842 3300005458 Bacteria 5789
110 Ga0070681_10034762 3300005458 Bacteria 5061
111 Ga0070681_10044635 3300005458 Bacteria 4437
112 Ga0070681_10222809 3300005458 Bacteria 1801
113 Ga0070681_10301373 3300005458 Bacteria 1512
114 Ga0070681_10477991 3300005458 Bacteria 1159
115 Ga0070681_10623870 3300005458 Bacteria 993
116 Ga0068867_100019095 3300005459 Bacteria 4881
117 Ga0068867_101848942 3300005459 Bacteria 569
118 Ga0070685_10005925 3300005466 Bacteria 6220
119 Ga0070685_10048757 3300005466 Bacteria 2441
120 Ga0070685_10153241 3300005466 Bacteria 1462
121 Ga0070706_100372035 3300005467 Unclassified 1331
122 Ga0070707_100136774 3300005468 Bacteria 2384
123 Ga0070707_101377042 3300005468 Bacteria 672
124 Ga0070699_100012253 3300005518 Bacteria 7398
125 Ga0070699_100042750 3300005518 Bacteria 3922
126 Ga0070679_100002347 3300005530 Bacteria 17134
127 Ga0070679_100004807 3300005530 Bacteria 12457
128 Ga0070679_100005845 3300005530 Bacteria 11415
129 Ga0070679_100016853 3300005530 Bacteria 7062
130 Ga0070679_100026764 3300005530 Bacteria 5672
131 Ga0070679_100041109 3300005530 Bacteria 4603
132 Ga0070679_100076003 3300005530 Bacteria 3348
133 Ga0070679_100103252 3300005530 Bacteria 2837
134 Ga0070679_100416183 3300005530 Bacteria 1289
135 Ga0070679_100449613 3300005530 Bacteria 1233
136 Ga0070679_100517765 3300005530 Bacteria 1137
137 Ga0070684_100007105 3300005535 Bacteria 8702
138 Ga0070684_100022816 3300005535 Bacteria 5225
139 Ga0070684_100023085 3300005535 Bacteria 5195
140 Ga0070684_100071767 3300005535 Bacteria 3047
141 Ga0070684_100309560 3300005535 Bacteria 1450
142 Ga0070684_100384080 3300005535 Bacteria 1294
143 Ga0070684_101716425 3300005535 Unclassified 592
144 Ga0070697_100026491 3300005536 Bacteria 4632
145 Ga0070697_100995500 3300005536 Bacteria 745
146 Ga0070697_101431616 3300005536 Unclassified 617
147 Ga0068853_100330444 3300005539 Bacteria 1414
148 Ga0068853_100431503 3300005539 Unclassified 1237
149 Ga0068853_100824451 3300005539 Unclassified 889
150 Ga0068853_101696189 3300005539 Unclassified 612
151 Ga0070672_100046288 3300005543 Bacteria 3370
152 Ga0070686_100088962 3300005544 Bacteria 2062
153 Ga0070695_100777552 3300005545 Bacteria 765
154 Ga0070696_100001565 3300005546 Bacteria 14978
155 Ga0070696_100093258 3300005546 Bacteria 2147
156 Ga0070696_100169172 3300005546 Bacteria 1614
157 Ga0070696_101166590 3300005546 Bacteria 650
158 Ga0070693_100001583 3300005547 Bacteria 10249
159 Ga0070693_100831993 3300005547 Bacteria 687
160 Ga0070665_100254098 3300005548 Unclassified 1758
161 Ga0070704_100052970 3300005549 Bacteria 2866
162 Ga0068855_100008417 3300005563 Bacteria 12475
163 Ga0068855_100035328 3300005563 Bacteria 5954
164 Ga0068855_100060120 3300005563 Bacteria 4444
165 Ga0068855_100271160 3300005563 Bacteria 1887
166 Ga0068855_100816904 3300005563 Bacteria 990
167 Ga0068855_102082981 3300005563 Bacteria 572
168 Ga0070664_100157195 3300005564 Bacteria 2009
169 Ga0070664_100760938 3300005564 Bacteria 904
170 Ga0068857_100068887 3300005577 Bacteria 3149
171 Ga0068857_100334978 3300005577 Unclassified 1399
172 Ga0068854_100019455 3300005578 Bacteria 4576
173 Ga0068854_100179885 3300005578 Bacteria 1651
174 Ga0068854_100236361 3300005578 Unclassified 1453
175 Ga0068854_101080832 3300005578 Bacteria 714
176 Ga0068856_100003537 3300005614 Bacteria 15749
177 Ga0068856_100017312 3300005614 Bacteria 6987
178 Ga0068856_100109568 3300005614 Bacteria 2758
179 Ga0068856_101496020 3300005614 Unclassified 689
180 Ga0070702_100433334 3300005615 Bacteria 949
181 Ga0070702_101213377 3300005615 Bacteria 608
182 Ga0068852_100005656 3300005616 Bacteria 8966
183 Ga0068852_100049470 3300005616 Bacteria 3597
184 Ga0068852_100731394 3300005616 Bacteria 1001
185 Ga0068852_100848311 3300005616 Bacteria 929
186 Ga0068859_100009080 3300005617 Bacteria 10042
187 Ga0068859_100011857 3300005617 Bacteria 8755
188 Ga0068859_100631157 3300005617 Bacteria 1164
189 Ga0068859_100708843 3300005617 Bacteria 1097
190 Ga0068859_102420403 3300005617 Bacteria 578
191 Ga0068864_100110007 3300005618 Bacteria 2453
192 Ga0068864_100457578 3300005618 Bacteria 1221
193 Ga0068864_101107313 3300005618 Unclassified 788
194 Ga0068861_100115048 3300005719 Bacteria 2161
195 Ga0068870_10004415 3300005840 Bacteria 6055
196 Ga0068870_10666262 3300005840 Unclassified 714
197 Ga0068863_100355975 3300005841 Bacteria 1426
198 Ga0068863_100638785 3300005841 Bacteria 1055
199 Ga0068858_100042661 3300005842 Bacteria 4206
200 Ga0068858_100330536 3300005842 Bacteria 1458
201 Ga0068860_100182895 3300005843 Bacteria 2026
202 Ga0068860_100692498 3300005843 Bacteria 1028
203 Ga0068862_100061579 3300005844 Bacteria 3226
204 Ga0081539_10000131 3300005985 Bacteria 176467
205 Ga0081539_10011215 3300005985 Bacteria 7129
206 Ga0070717_10006564 3300006028 Bacteria 8569
207 Ga0070717_10190116 3300006028 Bacteria 1794
208 Ga0070717_10292071 3300006028 Bacteria 1448
209 Ga0070712_100039331 3300006175 Bacteria 3237
210 Ga0097621_101034588 3300006237 Bacteria 769
211 Ga0068871_100010847 3300006358 Bacteria 6670
212 Ga0068871_100978825 3300006358 Bacteria 787
213 Ga0075430_100005847 3300006846 Bacteria 10380
214 Ga0075430_100039391 3300006846 Bacteria 4001
215 Ga0075431_100045831 3300006847 Bacteria 4507
216 Ga0075433_10510302 3300006852 Bacteria 1058
217 Ga0075434_100191087 3300006871 Bacteria 2068
218 Ga0075429_100719510 3300006880 Bacteria 874
219 Ga0075429_100743747 3300006880 Unclassified 859
220 Ga0075436_100136519 3300006914 Bacteria 1722
221 Ga0075436_100464207 3300006914 Bacteria 923
222 Ga0075436_100859489 3300006914 Unclassified 677
223 Ga0097620_100009080 3300006931 Bacteria 10042
224 Ga0097620_100011857 3300006931 Bacteria 8755
225 Ga0097620_100631099 3300006931 Bacteria 1164
226 Ga0097620_100708929 3300006931 Bacteria 1097
227 Ga0097620_102420365 3300006931 Bacteria 578
228 Ga0105240_10029172 3300009093 Bacteria 7195
229 Ga0105240_10051769 3300009093 Bacteria 5165
230 Ga0105240_10289703 3300009093 Bacteria 1878
231 Ga0105240_10388441 3300009093 Bacteria 1575
232 Ga0105240_11712837 3300009093 Unclassified 656
233 Ga0111539_10355369 3300009094 Bacteria 1705
234 Ga0111539_10783301 3300009094 Unclassified 1110
235 Ga0105245_10022771 3300009098 Bacteria 5498
236 Ga0105245_10299196 3300009098 Bacteria 1578
237 Ga0105245_12437564 3300009098 Unclassified 577
238 Ga0105247_10095227 3300009101 Bacteria 1895
239 Ga0105247_11377670 3300009101 Bacteria 570
240 Ga0114129_10638584 3300009147 Bacteria 1375
241 Ga0105243_10170862 3300009148 Bacteria 1882
242 Ga0105243_10186194 3300009148 Bacteria 1809
243 Ga0105243_11918699 3300009148 Unclassified 625
244 Ga0105241_10085342 3300009174 Bacteria 2481
245 Ga0105241_11619970 3300009174 Unclassified 627
246 Ga0105242_10057948 3300009176 Bacteria 3174
247 Ga0105242_10232959 3300009176 Bacteria 1651
248 Ga0105248_10072401 3300009177 Bacteria 3873
249 Ga0105248_10224331 3300009177 Bacteria 2115
250 Ga0105248_10560703 3300009177 Bacteria 1289
251 Ga0105248_10578836 3300009177 Bacteria 1267
252 Ga0105237_10375655 3300009545 Bacteria 1426
253 Ga0105237_11604772 3300009545 Unclassified 657
254 Ga0105238_10000019 3300009551 Bacteria 212662
255 Ga0105238_10044378 3300009551 Bacteria 4495
256 Ga0105238_10048255 3300009551 Bacteria 4292
257 Ga0105238_10580443 3300009551 Unclassified 1127
258 Ga0105238_10656927 3300009551 Bacteria 1059
259 Ga0105249_10000182 3300009553 Bacteria 73467
260 Ga0105249_10174335 3300009553 Bacteria 2088
261 Ga0099796_10124055 3300010159 Bacteria 995
262 Ga0105239_10271158 3300010375 Bacteria 1909
263 Ga0105239_10745688 3300010375 Unclassified 1121
264 Ga0105239_10845990 3300010375 Bacteria 1049
265 Ga0105246_10005127 3300011119 Bacteria 7963
266 Ga0105246_10336731 3300011119 Bacteria 1232
267 Ga0157373_10005738 3300013100 Bacteria 9297
268 Ga0157373_10028865 3300013100 Bacteria 4000
269 Ga0157373_10101917 3300013100 Bacteria 2020
270 Ga0157371_10227410 3300013102 Bacteria 1340
271 Ga0157371_10908307 3300013102 Bacteria 668
272 Ga0157370_10028615 3300013104 Bacteria 5479
273 Ga0157370_10030566 3300013104 Bacteria 5277
274 Ga0157370_10034377 3300013104 Bacteria 4937
275 Ga0157370_10037495 3300013104 Bacteria 4699
276 Ga0157370_10124883 3300013104 Bacteria 2403
277 Ga0157370_10157897 3300013104 Bacteria 2110
278 Ga0157370_10319732 3300013104 Bacteria 1431
279 Ga0157370_10322766 3300013104 Unclassified 1424
280 Ga0157369_10008871 3300013105 Bacteria 11519
281 Ga0157369_10125423 3300013105 Bacteria 2723
282 Ga0157369_10250477 3300013105 Unclassified 1848
283 Ga0157369_11108409 3300013105 Unclassified 809
284 Ga0157369_11500118 3300013105 Bacteria 686
285 Ga0157374_11027207 3300013296 Bacteria 844
286 Ga0157374_11423991 3300013296 Bacteria 716
287 Ga0157378_10355919 3300013297 Unclassified 1431
288 Ga0163162_10337119 3300013306 Bacteria 1640
289 Ga0157372_10003036 3300013307 Bacteria 18091
290 Ga0157372_10011030 3300013307 Bacteria 9618
291 Ga0157372_10026051 3300013307 Bacteria 6360
292 Ga0157372_10063608 3300013307 Bacteria 4138
293 Ga0157372_10085405 3300013307 Bacteria 3579
294 Ga0157372_10090243 3300013307 Bacteria 3483
295 Ga0157372_10259636 3300013307 Bacteria 2017
296 Ga0157372_10320279 3300013307 Bacteria 1805
297 Ga0157372_10398273 3300013307 Bacteria 1604
298 Ga0157372_11131741 3300013307 Bacteria 905
299 Ga0157375_10012471 3300013308 Bacteria 7544
300 Ga0157375_10015456 3300013308 Bacteria 6835
301 Ga0157375_10044343 3300013308 Bacteria 4320
302 Ga0157375_10198142 3300013308 Unclassified 2163
303 Ga0163163_10351634 3300014325 Bacteria 1530
304 Ga0157380_10150174 3300014326 Bacteria 2013
305 Ga0157380_10414045 3300014326 Unclassified 1283
306 Ga0182008_10008208 3300014497 Bacteria 5713
307 Ga0157377_10174755 3300014745 Unclassified 1346
308 Ga0157379_10260273 3300014968 Bacteria 1576
309 Ga0157376_10018282 3300014969 Bacteria 5369
310 Ga0157376_10024971 3300014969 Bacteria 4701
311 Ga0157376_10045369 3300014969 Bacteria 3618
312 Ga0182007_10099177 3300015262 Bacteria 963
313 Ga0182005_1062583 3300015265 Unclassified 1017
314 Ga0197907_10638036 3300020069 Unclassified 1008
315 Ga0206356_11111770 3300020070 Bacteria 695
316 Ga0213876_10021758 3300021384 Bacteria 3392
317 Ga0224712_10174603 3300022467 Bacteria 965
318 Ga0207697_10181606 3300025315 Unclassified 922
319 Ga0207682_10023044 3300025893 Bacteria 2458
320 Ga0207642_10891902 3300025899 Bacteria 569
321 Ga0207710_10609003 3300025900 Bacteria 571
322 Ga0207688_10025315 3300025901 Bacteria 3258
323 Ga0207680_10061207 3300025903 Bacteria 2295
324 Ga0207680_10196508 3300025903 Unclassified 1372
325 Ga0207647_10294802 3300025904 Bacteria 924
326 Ga0207647_10307680 3300025904 Unclassified 902
327 Ga0207699_10050971 3300025906 Bacteria 2444
328 Ga0207699_10138691 3300025906 Bacteria 1596
329 Ga0207645_10156565 3300025907 Bacteria 1489
330 Ga0207645_10316768 3300025907 Bacteria 1040
331 Ga0207643_10002009 3300025908 Bacteria 11225
332 Ga0207643_10004243 3300025908 Bacteria 7716
333 Ga0207705_10019008 3300025909 Bacteria 4914
334 Ga0207705_10106830 3300025909 Bacteria 2065
335 Ga0207705_10546785 3300025909 Bacteria 900
336 Ga0207654_10032737 3300025911 Bacteria 2876
337 Ga0207654_10098898 3300025911 Bacteria 1793
338 Ga0207654_11046409 3300025911 Unclassified 594
339 Ga0207707_10003200 3300025912 Bacteria 14533
340 Ga0207707_10008984 3300025912 Bacteria 8680
341 Ga0207707_10010476 3300025912 Bacteria 8043
342 Ga0207707_10020549 3300025912 Bacteria 5766
343 Ga0207707_10055294 3300025912 Bacteria 3453
344 Ga0207707_10064057 3300025912 Bacteria 3199
345 Ga0207707_10089223 3300025912 Bacteria 2694
346 Ga0207707_10447587 3300025912 Bacteria 1105
347 Ga0207707_10586762 3300025912 Bacteria 944
348 Ga0207695_10002513 3300025913 Bacteria 26953
349 Ga0207695_10003263 3300025913 Bacteria 23062
350 Ga0207695_10005288 3300025913 Bacteria 17209
351 Ga0207695_10015752 3300025913 Bacteria 8887
352 Ga0207695_10049063 3300025913 Bacteria 4453
353 Ga0207695_10191841 3300025913 Bacteria 1961
354 Ga0207695_11150366 3300025913 Unclassified 656
355 Ga0207671_10281542 3300025914 Bacteria 1311
356 Ga0207693_10044553 3300025915 Bacteria 3487
357 Ga0207663_10051330 3300025916 Bacteria 2567
358 Ga0207663_10816101 3300025916 Unclassified 743
359 Ga0207660_10005735 3300025917 Bacteria 8054
360 Ga0207660_10023165 3300025917 Bacteria 4191
361 Ga0207660_10038695 3300025917 Bacteria 3330
362 Ga0207660_10088484 3300025917 Bacteria 2290
363 Ga0207660_10174402 3300025917 Bacteria 1666
364 Ga0207660_10186813 3300025917 Unclassified 1612
365 Ga0207660_10604469 3300025917 Unclassified 893
366 Ga0207662_10004398 3300025918 Bacteria 7405
367 Ga0207662_10010628 3300025918 Bacteria 5088
368 Ga0207657_10007873 3300025919 Bacteria 10875
369 Ga0207657_10013545 3300025919 Bacteria 7999
370 Ga0207657_10074670 3300025919 Bacteria 2862
371 Ga0207657_10100555 3300025919 Bacteria 2400
372 Ga0207657_10257288 3300025919 Bacteria 1390
373 Ga0207657_10594034 3300025919 Bacteria 864
374 Ga0207657_10943234 3300025919 Bacteria 664
375 Ga0207649_10057389 3300025920 Bacteria 2434
376 Ga0207649_10107306 3300025920 Bacteria 1859
377 Ga0207649_10317529 3300025920 Bacteria 1143
378 Ga0207649_10717089 3300025920 Unclassified 776
379 Ga0207652_10002043 3300025921 Bacteria 17362
380 Ga0207652_10008541 3300025921 Bacteria 8244
381 Ga0207652_10013788 3300025921 Bacteria 6537
382 Ga0207652_10018716 3300025921 Bacteria 5684
383 Ga0207652_10046947 3300025921 Bacteria 3688
384 Ga0207652_10072716 3300025921 Bacteria 2990
385 Ga0207652_10092127 3300025921 Bacteria 2665
386 Ga0207652_10136116 3300025921 Bacteria 2194
387 Ga0207652_10207153 3300025921 Unclassified 1765
388 Ga0207652_10367688 3300025921 Bacteria 1298
389 Ga0207652_10918369 3300025921 Unclassified 773
390 Ga0207652_10992178 3300025921 Unclassified 738
391 Ga0207646_10213993 3300025922 Bacteria 1740
392 Ga0207681_10010358 3300025923 Bacteria 5706
393 Ga0207681_10094360 3300025923 Unclassified 2144
394 Ga0207681_10173327 3300025923 Unclassified 1637
395 Ga0207681_11051927 3300025923 Unclassified 683
396 Ga0207694_10000032 3300025924 Bacteria 212686
397 Ga0207694_10062166 3300025924 Bacteria 2907
398 Ga0207694_10219140 3300025924 Bacteria 1551
399 Ga0207694_10290494 3300025924 Bacteria 1344
400 Ga0207650_10009030 3300025925 Bacteria 6816
401 Ga0207650_10276245 3300025925 Bacteria 1367
402 Ga0207650_10329199 3300025925 Bacteria 1252
403 Ga0207650_10785541 3300025925 Bacteria 807
404 Ga0207650_10799105 3300025925 Bacteria 799
405 Ga0207650_11217467 3300025925 Bacteria 641
406 Ga0207659_10000217 3300025926 Bacteria 34783
407 Ga0207659_10008100 3300025926 Bacteria 6504
408 Ga0207659_10925649 3300025926 Unclassified 750
409 Ga0207687_10009187 3300025927 Bacteria 6466
410 Ga0207687_10067559 3300025927 Bacteria 2543
411 Ga0207700_10003228 3300025928 Bacteria 9414
412 Ga0207700_10330201 3300025928 Unclassified 1324
413 Ga0207664_10004667 3300025929 Bacteria 9296
414 Ga0207664_10050992 3300025929 Bacteria 3266
415 Ga0207664_10344423 3300025929 Bacteria 1318
416 Ga0207644_10047962 3300025931 Bacteria 3051
417 Ga0207644_10132560 3300025931 Bacteria 1910
418 Ga0207644_10187130 3300025931 Bacteria 1626
419 Ga0207644_10213765 3300025931 Bacteria 1526
420 Ga0207690_10026142 3300025932 Bacteria 3674
421 Ga0207690_10079076 3300025932 Bacteria 2291
422 Ga0207690_10087734 3300025932 Bacteria 2190
423 Ga0207690_10108749 3300025932 Bacteria 1993
424 Ga0207690_10916574 3300025932 Bacteria 727
425 Ga0207706_10001515 3300025933 Bacteria 23027
426 Ga0207706_10010922 3300025933 Bacteria 8282
427 Ga0207706_10050605 3300025933 Bacteria 3671
428 Ga0207706_10051626 3300025933 Bacteria 3630
429 Ga0207706_10056117 3300025933 Bacteria 3473
430 Ga0207686_10495179 3300025934 Bacteria 947
431 Ga0207686_10543594 3300025934 Unclassified 907
432 Ga0207709_10149903 3300025935 Bacteria 1614
433 Ga0207670_10071101 3300025936 Bacteria 2405
434 Ga0207670_10549033 3300025936 Bacteria 944
435 Ga0207670_10737886 3300025936 Bacteria 817
436 Ga0207669_10359240 3300025937 Bacteria 1128
437 Ga0207691_10013468 3300025940 Bacteria 7825
438 Ga0207691_10030391 3300025940 Bacteria 5049
439 Ga0207711_10053466 3300025941 Bacteria 3463
440 Ga0207711_10071427 3300025941 Bacteria 3012
441 Ga0207711_10094899 3300025941 Bacteria 2630
442 Ga0207689_10001170 3300025942 Bacteria 25266
443 Ga0207689_10097712 3300025942 Bacteria 2412
444 Ga0207661_10044052 3300025944 Bacteria 3524
445 Ga0207661_10065872 3300025944 Bacteria 2941
446 Ga0207661_10108768 3300025944 Bacteria 2341
447 Ga0207661_10136643 3300025944 Bacteria 2106
448 Ga0207661_10574973 3300025944 Unclassified 1033
449 Ga0207661_10785712 3300025944 Bacteria 876
450 Ga0207679_10069132 3300025945 Bacteria 2656
451 Ga0207679_10249064 3300025945 Unclassified 1509
452 Ga0207679_10304436 3300025945 Bacteria 1375
453 Ga0207679_11048579 3300025945 Bacteria 748
454 Ga0207679_11437395 3300025945 Bacteria 633
455 Ga0207667_10021842 3300025949 Bacteria 7083
456 Ga0207667_10024407 3300025949 Bacteria 6638
457 Ga0207667_10050992 3300025949 Bacteria 4364
458 Ga0207667_10092991 3300025949 Bacteria 3114
459 Ga0207667_10098647 3300025949 Bacteria 3014
460 Ga0207667_10205749 3300025949 Bacteria 2018
461 Ga0207667_10325647 3300025949 Bacteria 1569
462 Ga0207651_10027121 3300025960 Bacteria 3592
463 Ga0207651_10045426 3300025960 Bacteria 2946
464 Ga0207712_10000063 3300025961 Bacteria 133704
465 Ga0207668_10001620 3300025972 Bacteria 13148
466 Ga0207668_11023795 3300025972 Unclassified 739
467 Ga0207640_10003372 3300025981 Bacteria 8605
468 Ga0207640_10114601 3300025981 Bacteria 1918
469 Ga0207640_10199811 3300025981 Bacteria 1514
470 Ga0207640_10471609 3300025981 Unclassified 1039
471 Ga0207640_11015555 3300025981 Bacteria 730
472 Ga0207658_10009290 3300025986 Bacteria 6669
473 Ga0207658_10167118 3300025986 Bacteria 1808
474 Ga0207658_11089137 3300025986 Bacteria 730
475 Ga0207677_10013404 3300026023 Bacteria 4750
476 Ga0207677_10053242 3300026023 Bacteria 2754
477 Ga0207677_10633910 3300026023 Unclassified 941
478 Ga0207703_10066419 3300026035 Bacteria 2967
479 Ga0207703_10084694 3300026035 Bacteria 2652
480 Ga0207639_10003609 3300026041 Bacteria 10396
481 Ga0207639_10144181 3300026041 Bacteria 1988
482 Ga0207678_10003013 3300026067 Bacteria 15231
483 Ga0207678_10026670 3300026067 Bacteria 5040
484 Ga0207678_10078143 3300026067 Bacteria 2834
485 Ga0207708_10013636 3300026075 Bacteria 6071
486 Ga0207708_10213233 3300026075 Unclassified 1544
487 Ga0207702_10006559 3300026078 Bacteria 10014
488 Ga0207702_10050496 3300026078 Bacteria 3512
489 Ga0207702_11065264 3300026078 Bacteria 802
490 Ga0207702_11788934 3300026078 Unclassified 606
491 Ga0207648_10017777 3300026089 Bacteria 6456
492 Ga0207648_10030621 3300026089 Bacteria 4763
493 Ga0207676_10072734 3300026095 Bacteria 2764
494 Ga0207676_10389296 3300026095 Bacteria 1300
495 Ga0207674_10000795 3300026116 Bacteria 41153
496 Ga0207674_10026067 3300026116 Bacteria 6219
497 Ga0207675_100249242 3300026118 Bacteria 1718
498 Ga0207675_100710394 3300026118 Bacteria 1015
499 Ga0207683_10204349 3300026121 Bacteria 1796
500 Ga0207698_10013072 3300026142 Bacteria 5465
501 Ga0207698_10019004 3300026142 Bacteria 4693
502 Ga0207698_10059731 3300026142 Bacteria 2962
503 Ga0207698_10223325 3300026142 Unclassified 1704
504 Ga0210000_1001251 3300027462 Bacteria 3579
505 Ga0209995_1064531 3300027471 Unclassified 625
506 Ga0209999_1032857 3300027543 Bacteria 965
507 Ga0209974_10137970 3300027876 Bacteria 873
508 Ga0268266_10306065 3300028379 Unclassified 1484
509 Ga0268265_10221212 3300028380 Bacteria 1657
510 Ga0268265_11451746 3300028380 Bacteria 689
511 Ga0268264_10177144 3300028381 Bacteria 1933
512 Ga0268264_10240224 3300028381 Bacteria 1677
513 Ga0265316_11030549 3300031344 Unclassified 572
514 Ga0307408_100022559 3300031548 Bacteria 4279
515 Ga0307408_100095719 3300031548 Bacteria 2251
516 Ga0307408_100403587 3300031548 Bacteria 1174
517 Ga0307408_100451223 3300031548 Unclassified 1115
518 Ga0307408_101480305 3300031548 Unclassified 641
519 Ga0307408_102296945 3300031548 Bacteria 522
520 Ga0316576_10288772 3300031727 Bacteria 1227
521 Ga0307405_10057115 3300031731 Bacteria 2450
522 Ga0307405_10065205 3300031731 Unclassified 2317
523 Ga0307405_10090667 3300031731 Bacteria 2023
524 Ga0307405_10783205 3300031731 Bacteria 797
525 Ga0307413_10053877 3300031824 Bacteria 2437
526 Ga0307413_10230486 3300031824 Bacteria 1360
527 Ga0307413_10407973 3300031824 Unclassified 1067
528 Ga0307413_10430174 3300031824 Bacteria 1042
529 Ga0307413_10430721 3300031824 Unclassified 1041
530 Ga0307413_10701726 3300031824 Unclassified 840
531 Ga0307413_10876496 3300031824 Unclassified 760
532 Ga0307410_10022280 3300031852 Bacteria 3912
533 Ga0307410_10094620 3300031852 Unclassified 2128
534 Ga0307410_10114324 3300031852 Bacteria 1958
535 Ga0307410_10274606 3300031852 Bacteria 1320
536 Ga0307406_10014058 3300031901 Bacteria 4598
537 Ga0307406_11601111 3300031901 Bacteria 575
538 Ga0307407_10003979 3300031903 Bacteria 6175
539 Ga0307407_10064151 3300031903 Unclassified 2157
540 Ga0307407_10169895 3300031903 Bacteria 1435
541 Ga0307407_10176344 3300031903 Bacteria 1412
542 Ga0307407_11150782 3300031903 Bacteria 605
543 Ga0307412_10046654 3300031911 Unclassified 2840
544 Ga0307412_10124532 3300031911 Bacteria 1862
545 Ga0307412_10146059 3300031911 Bacteria 1739
546 Ga0307412_10276950 3300031911 Bacteria 1315
547 Ga0307412_10351085 3300031911 Bacteria 1184
548 Ga0307412_10984372 3300031911 Bacteria 744
549 Ga0307412_12011542 3300031911 Bacteria 535
550 Ga0307409_100025239 3300031995 Bacteria 4164
551 Ga0307409_100044384 3300031995 Bacteria 3347
552 Ga0307409_100075650 3300031995 Bacteria 2697
553 Ga0307409_100177866 3300031995 Bacteria 1880
554 Ga0307409_100490082 3300031995 Bacteria 1194
555 Ga0307409_100696462 3300031995 Bacteria 1015
556 Ga0307409_101775487 3300031995 Bacteria 646
557 Ga0307416_100032578 3300032002 Bacteria 3940
558 Ga0307416_100072819 3300032002 Bacteria 2862
559 Ga0307416_100114256 3300032002 Bacteria 2388
560 Ga0307416_100152208 3300032002 Bacteria 2123
561 Ga0307416_100175216 3300032002 Unclassified 2002
562 Ga0307416_100977575 3300032002 Bacteria 949
563 Ga0307416_101553183 3300032002 Bacteria 767
564 Ga0307416_101998081 3300032002 Unclassified 682
565 Ga0307414_10039854 3300032004 Bacteria 3168
566 Ga0307414_10408532 3300032004 Bacteria 1181
567 Ga0307414_10600559 3300032004 Bacteria 987
568 Ga0307414_11831075 3300032004 Unclassified 566
569 Ga0307411_10218926 3300032005 Bacteria 1476
570 Ga0307411_10314758 3300032005 Bacteria 1261
571 Ga0307411_10381060 3300032005 Bacteria 1160
572 Ga0307411_10416690 3300032005 Bacteria 1114
573 Ga0307411_10523270 3300032005 Bacteria 1007
574 Ga0307415_100004379 3300032126 Bacteria 7317
575 Ga0307415_100005483 3300032126 Bacteria 6741
576 Ga0307415_100069029 3300032126 Unclassified 2476
577 Ga0307415_100194774 3300032126 Bacteria 1602
578 Ga0307415_100453562 3300032126 Bacteria 1109
579 Ga0307415_101470888 3300032126 Bacteria 651
580 Ga0307415_101749714 3300032126 Unclassified 600
581 Ga0373923_0030106 3300035111 Bacteria 2181
582 Ga0373953_0014865 3300035117 Bacteria 2808
583 Ga0373956_0065807 3300035119 Bacteria 1647
584 Ga0373957_0028978 3300035120 Bacteria 2020
585 Ga0373946_0556250 3300035171 Bacteria 592
586 Ga0373955_0074390 3300035172 Bacteria 1906
587 Ga0373924_0116301 3300035410 Bacteria 1158
588 Ga0373931_0015839 3300035691 Bacteria 3702
589 Ga0373935_0423175 3300035692 Bacteria 959
590 Ga0373927_0112998 3300035695 Bacteria 1770
591 Ga0373927_0213281 3300035695 Unclassified 1268
592 Ga0373933_0013632 3300035724 Bacteria 4507
593 Ga0373937_0046947 3300036401 Bacteria 3950
594 Ga0373937_0510667 3300036401 Unclassified 1142
595 Ga0316584_0254450 3300036712 Bacteria 1282
596 Ga0316584_0477488 3300036712 Bacteria 879
597 Ga0395899_0042187 3300037312 Bacteria 3406
598 Ga0395899_0126437 3300037312 Bacteria 1828
599 Ga0395899_0338893 3300037312 Bacteria 1009
600 Ga0395900_0043902 3300037418 Bacteria 4607
601 Ga0395900_0344363 3300037418 Bacteria 1465
602 Ga0395898_0164801 3300037466 Bacteria 2120
603 Ga0395898_0187813 3300037466 Bacteria 1975
604 Ga0395898_0231927 3300037466 Bacteria 1760
605 Ga0395905_0013160 3300037471 Bacteria 7940
606 Ga0395905_0053763 3300037471 Bacteria 3768
607 Ga0395905_0176024 3300037471 Bacteria 2009
608 Ga0436364_0379739 3300037853 Unclassified 714
609 Ga0436364_0473930 3300037853 Bacteria 1009
610 Ga0395901_0008096 3300038443 Bacteria 10616
611 Ga0436365_0102391 3300039437 Bacteria 3145
612 Ga0436365_0284913 3300039437 Bacteria 5238
613 Ga0436365_1408484 3300039437 Bacteria 1271
614 Ga0436362_0010966 3300039453 Bacteria 1298
615 Ga0439461_0029123 3300041410 Bacteria 1141
616 Ga0439461_0159323 3300041410 Unclassified 587
617 Ga0439465_0326214 3300041413 Bacteria 577
618 Ga0439434_0005503 3300042435 Unclassified 3701
619 Ga0466965_0876436 3300044683 Bacteria 522
620 Ga0466966_0104468 3300044684 Unclassified 1750
621 Ga0466961_0108347 3300044693 Bacteria 1749
622 Ga0466961_0134487 3300044693 Bacteria 1549
623 Ga0466961_0208766 3300044693 Unclassified 1206
624 Ga0466961_0942199 3300044693 Unclassified 514
625 Ga0466963_0901658 3300044694 Unclassified 623
626 Ga0453684_0858716 3300044712 Unclassified 975
627 Ga0466970_0350027 3300044765 Bacteria 838
628 Ga0466959_0137324 3300045049 Unclassified 1730
629 Ga0451576_0108441 3300045051 Unclassified 2889
630 Ga0466967_0496856 3300045976 Unclassified 1197
631 Ga0495592_0017790 3300046454 Bacteria 5403
632 Ga0495629_0012411 3300046459 Bacteria 6170
633 Ga0495629_0059806 3300046459 Bacteria 2663
634 Ga0495651_0011749 3300046462 Bacteria 6728
635 Ga0495653_0010680 3300046463 Bacteria 7518
636 Ga0495582_0013759 3300046473 Bacteria 4454
637 Ga0495662_0183483 3300046476 Bacteria 1031
638 Ga0495664_0263491 3300046477 Unclassified 1042
639 Ga0495664_0667656 3300046477 Bacteria 615
640 Ga0495594_0101007 3300046499 Bacteria 1623
641 Ga0495594_0373857 3300046499 Unclassified 811
642 Ga0495594_0416872 3300046499 Unclassified 764
643 Ga0495608_0021539 3300046511 Bacteria 4423
644 Ga0495618_0558784 3300046514 Bacteria 684
645 Ga0495643_0036149 3300046522 Bacteria 2715
646 Ga0495663_0042040 3300046525 Bacteria 1392
647 Ga0495663_0165147 3300046525 Bacteria 761
648 Ga0495642_0070234 3300046528 Unclassified 1464
649 Ga0495652_0095357 3300046529 Bacteria 2424
650 Ga0495586_0006643 3300046535 Bacteria 6176
651 Ga0495586_0265140 3300046535 Bacteria 981
652 Ga0495586_0560478 3300046535 Unclassified 660
653 Ga0495587_0002385 3300046536 Bacteria 12534
654 Ga0495587_0035162 3300046536 Bacteria 3019
655 Ga0495587_0464098 3300046536 Unclassified 701
656 Ga0495621_0026172 3300046539 Bacteria 1966
657 Ga0495621_0170662 3300046539 Bacteria 864
658 Ga0495645_0010848 3300046543 Bacteria 6401
659 Ga0495622_0127456 3300046557 Bacteria 1160
660 Ga0495622_0511083 3300046557 Bacteria 513
661 Ga0495667_0013916 3300046559 Bacteria 5433
662 Ga0495667_0111968 3300046559 Unclassified 1764
663 Ga0495667_0238079 3300046559 Bacteria 1160
664 Ga0495656_0205509 3300046615 Bacteria 979
665 Ga0495635_0001636 3300046663 Bacteria 15101
666 Ga0495588_0013090 3300046674 Bacteria 3944
667 Ga0495657_0002639 3300046675 Bacteria 15004
668 Ga0495657_0810605 3300046675 Unclassified 535
669 Ga0495599_0000866 3300046678 Bacteria 16950
670 Ga0495623_0002680 3300046679 Bacteria 11747
671 Ga0495646_0004172 3300046680 Bacteria 9080
672 Ga0495658_0333550 3300046683 Bacteria 962
673 Ga0495658_1032341 3300046683 Bacteria 525
674 Ga0495613_0029015 3300046689 Bacteria 4114
675 Ga0495613_0056400 3300046689 Bacteria 2885
676 Ga0495613_0294980 3300046689 Unclassified 1123
677 Ga0495613_0571635 3300046689 Bacteria 755
678 Ga0495600_0027695 3300046809 Bacteria 3663
679 Ga0495600_0292493 3300046809 Unclassified 1029
680 Ga0495581_0036041 3300047315 Bacteria 2862
681 Ga0495581_0443293 3300047315 Bacteria 756
682 Ga0495581_0468572 3300047315 Unclassified 733
683 Ga0495604_0047676 3300047317 Bacteria 3336
684 Ga0495674_0107039 3300047319 Bacteria 2374
685 Ga0495674_0349398 3300047319 Bacteria 1200
686 Ga0495672_0013645 3300047320 Bacteria 5593
687 Ga0495680_0002561 3300047322 Bacteria 18546
688 Ga0495675_0027115 3300047444 Bacteria 3651
689 Ga0495675_0033164 3300047444 Bacteria 3296
690 Ga0495675_0088613 3300047444 Bacteria 1943
691 Ga0495675_0381691 3300047444 Bacteria 824
692 Ga0495675_0515661 3300047444 Unclassified 685
693 Ga0495685_016447 3300047447 Bacteria 2526
694 Ga0495684_0028624 3300047471 Bacteria 4277
695 Ga0495602_0032585 3300048088 Bacteria 4904
696 Ga0496100_0892267 3300048903 Unclassified 698
697 Ga0496101_0267580 3300048904 Unclassified 1334
698 Ga0496101_0626706 3300048904 Bacteria 850
699 Ga0496102_0789724 3300048905 Bacteria 872
700 Ga0496104_1352208 3300048907 Unclassified 615
701 Ga0496106_0264346 3300048909 Bacteria 1377
702 Ga0496109_0591627 3300048912 Bacteria 1045
703 Ga0496112_0000517 3300048915 Bacteria 26259
704 Ga0496113_0077982 3300048916 Bacteria 2534
705 Ga0496114_0084995 3300048917 Bacteria 2680
706 Ga0496115_0077545 3300048918 Bacteria 2702
707 Ga0496115_0406908 3300048918 Bacteria 1103
708 Ga0501299_017573 3300049522 Bacteria 1278
709 Ga0501031_0080666 3300049568 Bacteria 2120
710 Ga0501031_0127404 3300049568 Bacteria 1663
711 Ga0501032_0024436 3300049569 Bacteria 4172
712 Ga0501032_0153624 3300049569 Bacteria 1513
713 Ga0501033_0006056 3300049570 Bacteria 9483
714 Ga0501033_0026314 3300049570 Bacteria 4379
715 Ga0501034_0551082 3300049571 Bacteria 1062
716 Ga0501036_0012347 3300049572 Bacteria 7073
717 Ga0501036_0055428 3300049572 Bacteria 3358
718 Ga0501036_0405377 3300049572 Bacteria 1137
719 Ga0501037_0023412 3300049573 Bacteria 4567
720 Ga0501037_0610234 3300049573 Bacteria 732
721 Ga0501038_0013294 3300049574 Bacteria 7506
722 Ga0501039_0109800 3300049575 Bacteria 2156
723 Ga0501039_0118102 3300049575 Bacteria 2077
724 Ga0501040_0030059 3300049576 Bacteria 3668
725 Ga0501040_0334622 3300049576 Bacteria 1084
726 Ga0501041_0051216 3300049577 Bacteria 2516
727 Ga0501042_0109979 3300049578 Bacteria 1984
728 Ga0501042_1117600 3300049578 Bacteria 574
729 Ga0501043_0090468 3300049579 Bacteria 2406
730 Ga0501043_0129681 3300049579 Bacteria 1976
731 Ga0501043_0196179 3300049579 Unclassified 1568
732 Ga0501046_0086322 3300049580 Bacteria 2419
733 Ga0501046_0246518 3300049580 Bacteria 1316
734 Ga0501046_0498821 3300049580 Bacteria 872
735 Ga0501046_0525841 3300049580 Bacteria 845
736 Ga0501047_0098676 3300049581 Bacteria 2799
737 Ga0501048_0622111 3300049582 Bacteria 775
738 Ga0501070_0294783 3300049586 Bacteria 1322
739 Ga0501071_0176563 3300049587 Bacteria 1600
740 Ga0501071_1486663 3300049587 Bacteria 523
741 Ga0501072_0368019 3300049588 Bacteria 1141
742 Ga0501072_0445734 3300049588 Bacteria 1025
743 Ga0501073_0080329 3300049589 Bacteria 2269
744 Ga0501074_0098764 3300049590 Bacteria 2090
745 Ga0501074_0927221 3300049590 Unclassified 613
746 Ga0501075_0020594 3300049591 Bacteria 4800
747 Ga0501075_0549679 3300049591 Bacteria 881
748 Ga0501075_1363091 3300049591 Bacteria 537
749 Ga0501077_0072033 3300049593 Bacteria 2190
750 Ga0501224_017959 3300049664 Unclassified 1053
751 Ga0501249_127069 3300049679 Unclassified 626
752 Ga0501257_133871 3300049686 Bacteria 673
753 Ga0501259_012234 3300049688 Unclassified 1429
754 Ga0501229_028050 3300049706 Unclassified 764
755 Ga0501079_0404148 3300049741 Bacteria 1071
756 Ga0501079_1226501 3300049741 Bacteria 591
757 Ga0501080_0108557 3300049742 Bacteria 2572
758 Ga0501080_0167609 3300049742 Bacteria 2027
759 Ga0501081_0026940 3300049743 Bacteria 3878
760 Ga0501081_0884940 3300049743 Bacteria 673
761 Ga0501083_0242319 3300049744 Bacteria 1174
762 Ga0501268_056514 3300049765 Bacteria 770
763 Ga0501268_133708 3300049765 Bacteria 560
764 Ga0501270_007952 3300049767 Bacteria 1328
765 Ga0501273_042856 3300049770 Unclassified 674
766 Ga0501035_0017397 3300049822 Bacteria 6629
767 Ga0501035_0038122 3300049822 Bacteria 4352
768 Ga0501035_0253974 3300049822 Bacteria 1492
769 Ga0501044_0006536 3300049823 Bacteria 12872
770 Ga0501044_0027116 3300049823 Bacteria 6059
771 Ga0501044_0081228 3300049823 Bacteria 3282
772 Ga0501044_0394665 3300049823 Bacteria 1297
773 Ga0501044_0707636 3300049823 Bacteria 892
774 Ga0501044_1018386 3300049823 Bacteria 699
775 Ga0501045_0015775 3300049824 Bacteria 5359
776 Ga0501045_0027771 3300049824 Bacteria 4080
777 nmdc:mga05p37_210048_c1 3300050507 Bacteria 2353
778 nmdc:mga09592_1344701_c1 3300050508 Unclassified 586
779 nmdc:mga09592_816911_c1 3300050508 Unclassified 788
780 nmdc:mga0qj67_17290_c1 3300050509 Bacteria 5482
781 nmdc:mga0qj67_5060_c1 3300050509 Bacteria 9589
782 nmdc:mga06r32_481736_c1 3300050510 Unclassified 1219
783 nmdc:mga08y16_755675_c1 3300050511 Bacteria 968
784 nmdc:mga0n895_214376_c1 3300050512 Bacteria 1955
785 nmdc:mga0n895_597512_c1 3300050512 Bacteria 1106
786 nmdc:mga0rr50_1246857_c1 3300050513 Bacteria 631
787 nmdc:mga0rr50_1768214_c1 3300050513 Bacteria 520
788 nmdc:mga08x19_2153_c1 3300050514 Bacteria 12035
789 nmdc:mga08x19_251019_c1 3300050514 Bacteria 1221
790 nmdc:mga08x19_63539_c1 3300050514 Unclassified 2395
791 nmdc:mga0a205_63914_c1 3300050515 Bacteria 3555
792 Ga0495601_0016974 3300053077 Bacteria 4417
793 Ga0495612_0018858 3300053078 Bacteria 2762
794 Ga0495619_0037686 3300053085 Bacteria 3152
795 Ga0501084_0175358 3300054114 Unclassified 1809
796 Ga0501084_0596421 3300054114 Unclassified 933
797 Ga0501082_0110526 3300060353 Bacteria 2379
798 Ga0501082_0325946 3300060353 Bacteria 1338
799 Ga0530510_0343954 3300061734 Bacteria 1120
800 Ga0105240_10381247
801 MBSR1b_contig_7847846
802 JGI24743J22301_10060699
803 JGI25406J46586_10163224
804 Ga0058863_11550363
805 Ga0058863_11558320
806 Ga0058861_10610375
807 Ga0058861_11284080
808 Ga0058861_11408501
809 Ga0058860_10752099
810 Ga0058862_12180776
811 Ga0058862_12397805
812 Ga0058862_12653458
813 Ga0065712_10234666
814 Ga0065715_10235195
815 Ga0065715_10514040
816 Ga0070658_10000597
817 Ga0070658_10079212
818 Ga0070658_10094934
819 Ga0070658_10258357
820 Ga0070658_10617383
821 Ga0070683_100001684
822 Ga0070683_100009225
823 Ga0070683_100026017
824 Ga0070683_100035352
825 Ga0070683_100067883
826 Ga0070683_100145070
827 Ga0070683_100952737
828 Ga0070683_101905555
829 Ga0070690_100076729
830 Ga0070690_100464669
831 Ga0070670_100111670
832 Ga0070670_100552176
833 Ga0070670_101300976
834 Ga0070670_101584232
835 Ga0070677_10019080
836 Ga0070666_10057844
837 Ga0070680_100000032
838 Ga0070680_100001592
839 Ga0070680_100002893
840 Ga0070680_100007829
841 Ga0070680_100138318
842 Ga0070680_100500666
843 Ga0070680_100958337
844 Ga0070680_101125048
845 Ga0068868_100073929
846 Ga0070660_100050108
847 Ga0070660_100066045
848 Ga0070660_100737113
849 Ga0070660_101150700
850 Ga0070689_100016472
851 Ga0070689_100985878
852 Ga0070691_10015714
853 Ga0070691_10094455
854 Ga0070691_10117022
855 Ga0070687_100022445
856 Ga0070687_100112040
857 Ga0070661_100001846
858 Ga0070661_100007151
859 Ga0070661_100035891
860 Ga0070661_100210950
861 Ga0070661_100308767
862 Ga0070661_100432261
863 Ga0070661_100557856
864 Ga0070692_10100987
865 Ga0070668_100006903
866 Ga0070668_100833587
867 Ga0070669_100003884
868 Ga0070669_100098615
869 Ga0070669_100213936
870 Ga0070669_101335318
871 Ga0070675_100003767
872 Ga0070675_100089686
873 Ga0070675_100800726
874 Ga0070671_100076372
875 Ga0070671_100168051
876 Ga0070673_100010577
877 Ga0070688_100002375
878 Ga0070688_100428347
879 Ga0070688_100507072
880 Ga0070659_100003444
881 Ga0070659_100042038
882 Ga0070659_100067443
883 Ga0070659_100085280
884 Ga0070667_100022883
885 Ga0070703_10035037
886 Ga0070709_10058965
887 Ga0070714_100001266
888 Ga0070714_100007716
889 Ga0070714_100034862
890 Ga0070714_100861499
891 Ga0070713_100000616
892 Ga0070701_10054540
893 Ga0070701_11087434
894 Ga0070711_100065607
895 Ga0070711_100860099
896 Ga0070708_100000017
897 Ga0070708_100505717
898 Ga0070663_100084160
899 Ga0070663_100125111
900 Ga0070663_100232237
901 Ga0070678_100599901
902 Ga0070662_100000810
903 Ga0070662_100001212
904 Ga0070662_100148317
905 Ga0070662_100471814
906 Ga0070662_100561107
907 Ga0070681_10010527
908 Ga0070681_10026842
909 Ga0070681_10034762
910 Ga0070681_10044635
911 Ga0070681_10222809
912 Ga0070681_10301373
913 Ga0070681_10477991
914 Ga0070681_10623870
915 Ga0068867_100019095
916 Ga0068867_101848942
917 Ga0070685_10005925
918 Ga0070685_10048757
919 Ga0070685_10153241
920 Ga0070706_100372035
921 Ga0070707_100136774
922 Ga0070707_101377042
923 Ga0070699_100012253
924 Ga0070699_100042750
925 Ga0070679_100002347
926 Ga0070679_100004807
927 Ga0070679_100005845
928 Ga0070679_100016853
929 Ga0070679_100026764
930 Ga0070679_100041109
931 Ga0070679_100076003
932 Ga0070679_100103252
933 Ga0070679_100416183
934 Ga0070679_100449613
935 Ga0070679_100517765
936 Ga0070684_100007105
937 Ga0070684_100022816
938 Ga0070684_100023085
939 Ga0070684_100071767
940 Ga0070684_100309560
941 Ga0070684_100384080
942 Ga0070684_101716425
943 Ga0070697_100026491
944 Ga0070697_100995500
945 Ga0070697_101431616
946 Ga0068853_100330444
947 Ga0068853_100431503
948 Ga0068853_100824451
949 Ga0068853_101696189
950 Ga0070672_100046288
951 Ga0070686_100088962
952 Ga0070695_100777552
953 Ga0070696_100001565
954 Ga0070696_100093258
955 Ga0070696_100169172
956 Ga0070696_101166590
957 Ga0070693_100001583
958 Ga0070693_100831993
959 Ga0070665_100254098
960 Ga0070704_100052970
961 Ga0068855_100008417
962 Ga0068855_100035328
963 Ga0068855_100060120
964 Ga0068855_100271160
965 Ga0068855_100816904
966 Ga0068855_102082981
967 Ga0070664_100157195
968 Ga0070664_100760938
969 Ga0068857_100068887
970 Ga0068857_100334978
971 Ga0068854_100019455
972 Ga0068854_100179885
973 Ga0068854_100236361
974 Ga0068854_101080832
975 Ga0068856_100003537
976 Ga0068856_100017312
977 Ga0068856_100109568
978 Ga0068856_101496020
979 Ga0070702_100433334
980 Ga0070702_101213377
981 Ga0068852_100005656
982 Ga0068852_100049470
983 Ga0068852_100731394
984 Ga0068852_100848311
985 Ga0068859_100009080
986 Ga0068859_100011857
987 Ga0068859_100631157
988 Ga0068859_100708843
989 Ga0068859_102420403
990 Ga0068864_100110007
991 Ga0068864_100457578
992 Ga0068864_101107313
993 Ga0068861_100115048
994 Ga0068870_10004415
995 Ga0068870_10666262
996 Ga0068863_100355975
997 Ga0068863_100638785
998 Ga0068858_100042661
999 Ga0068858_100330536
1000 Ga0068860_100182895
1001 Ga0068860_100692498
1002 Ga0068862_100061579
1003 Ga0081539_10000131
1004 Ga0081539_10011215
1005 Ga0070717_10006564
1006 Ga0070717_10190116
1007 Ga0070717_10292071
1008 Ga0070712_100039331
1009 Ga0097621_101034588
1010 Ga0068871_100010847
1011 Ga0068871_100978825
1012 Ga0075430_100005847
1013 Ga0075430_100039391
1014 Ga0075431_100045831
1015 Ga0075433_10510302
1016 Ga0075434_100191087
1017 Ga0075429_100719510
1018 Ga0075429_100743747
1019 Ga0075436_100136519
1020 Ga0075436_100464207
1021 Ga0075436_100859489
1022 Ga0097620_100009080
1023 Ga0097620_100011857
1024 Ga0097620_100631099
1025 Ga0097620_100708929
1026 Ga0097620_102420365
1027 Ga0105240_10029172
1028 Ga0105240_10051769
1029 Ga0105240_10289703
1030 Ga0105240_10388441
1031 Ga0105240_11712837
1032 Ga0111539_10355369
1033 Ga0111539_10783301
1034 Ga0105245_10022771
1035 Ga0105245_10299196
1036 Ga0105245_12437564
1037 Ga0105247_10095227
1038 Ga0105247_11377670
1039 Ga0114129_10638584
1040 Ga0105243_10170862
1041 Ga0105243_10186194
1042 Ga0105243_11918699
1043 Ga0105241_10085342
1044 Ga0105241_11619970
1045 Ga0105242_10057948
1046 Ga0105242_10232959
1047 Ga0105248_10072401
1048 Ga0105248_10224331
1049 Ga0105248_10560703
1050 Ga0105248_10578836
1051 Ga0105237_10375655
1052 Ga0105237_11604772
1053 Ga0105238_10000019
1054 Ga0105238_10044378
1055 Ga0105238_10048255
1056 Ga0105238_10580443
1057 Ga0105238_10656927
1058 Ga0105249_10000182
1059 Ga0105249_10174335
1060 Ga0099796_10124055
1061 Ga0105239_10271158
1062 Ga0105239_10745688
1063 Ga0105239_10845990
1064 Ga0105246_10005127
1065 Ga0105246_10336731
1066 Ga0157373_10005738
1067 Ga0157373_10028865
1068 Ga0157373_10101917
1069 Ga0157371_10227410
1070 Ga0157371_10908307
1071 Ga0157370_10028615
1072 Ga0157370_10030566
1073 Ga0157370_10034377
1074 Ga0157370_10037495
1075 Ga0157370_10124883
1076 Ga0157370_10157897
1077 Ga0157370_10319732
1078 Ga0157370_10322766
1079 Ga0157369_10008871
1080 Ga0157369_10125423
1081 Ga0157369_10250477
1082 Ga0157369_11108409
1083 Ga0157369_11500118
1084 Ga0157374_11027207
1085 Ga0157374_11423991
1086 Ga0157378_10355919
1087 Ga0163162_10337119
1088 Ga0157372_10003036
1089 Ga0157372_10011030
1090 Ga0157372_10026051
1091 Ga0157372_10063608
1092 Ga0157372_10085405
1093 Ga0157372_10090243
1094 Ga0157372_10259636
1095 Ga0157372_10320279
1096 Ga0157372_10398273
1097 Ga0157372_11131741
1098 Ga0157375_10012471
1099 Ga0157375_10015456
1100 Ga0157375_10044343
1101 Ga0157375_10198142
1102 Ga0163163_10351634
1103 Ga0157380_10150174
1104 Ga0157380_10414045
1105 Ga0182008_10008208
1106 Ga0157377_10174755
1107 Ga0157379_10260273
1108 Ga0157376_10018282
1109 Ga0157376_10024971
1110 Ga0157376_10045369
1111 Ga0182007_10099177
1112 Ga0182005_1062583
1113 Ga0197907_10638036
1114 Ga0206356_11111770
1115 Ga0213876_10021758
1116 Ga0224712_10174603
1117 Ga0207697_10181606
1118 Ga0207682_10023044
1119 Ga0207642_10891902
1120 Ga0207710_10609003
1121 Ga0207688_10025315
1122 Ga0207680_10061207
1123 Ga0207680_10196508
1124 Ga0207647_10294802
1125 Ga0207647_10307680
1126 Ga0207699_10050971
1127 Ga0207699_10138691
1128 Ga0207645_10156565
1129 Ga0207645_10316768
1130 Ga0207643_10002009
1131 Ga0207643_10004243
1132 Ga0207705_10019008
1133 Ga0207705_10106830
1134 Ga0207705_10546785
1135 Ga0207654_10032737
1136 Ga0207654_10098898
1137 Ga0207654_11046409
1138 Ga0207707_10003200
1139 Ga0207707_10008984
1140 Ga0207707_10010476
1141 Ga0207707_10020549
1142 Ga0207707_10055294
1143 Ga0207707_10064057
1144 Ga0207707_10089223
1145 Ga0207707_10447587
1146 Ga0207707_10586762
1147 Ga0207695_10002513
1148 Ga0207695_10003263
1149 Ga0207695_10005288
1150 Ga0207695_10015752
1151 Ga0207695_10049063
1152 Ga0207695_10191841
1153 Ga0207695_11150366
1154 Ga0207671_10281542
1155 Ga0207693_10044553
1156 Ga0207663_10051330
1157 Ga0207663_10816101
1158 Ga0207660_10005735
1159 Ga0207660_10023165
1160 Ga0207660_10038695
1161 Ga0207660_10088484
1162 Ga0207660_10174402
1163 Ga0207660_10186813
1164 Ga0207660_10604469
1165 Ga0207662_10004398
1166 Ga0207662_10010628
1167 Ga0207657_10007873
1168 Ga0207657_10013545
1169 Ga0207657_10074670
1170 Ga0207657_10100555
1171 Ga0207657_10257288
1172 Ga0207657_10594034
1173 Ga0207657_10943234
1174 Ga0207649_10057389
1175 Ga0207649_10107306
1176 Ga0207649_10317529
1177 Ga0207649_10717089
1178 Ga0207652_10002043
1179 Ga0207652_10008541
1180 Ga0207652_10013788
1181 Ga0207652_10018716
1182 Ga0207652_10046947
1183 Ga0207652_10072716
1184 Ga0207652_10092127
1185 Ga0207652_10136116
1186 Ga0207652_10207153
1187 Ga0207652_10367688
1188 Ga0207652_10918369
1189 Ga0207652_10992178
1190 Ga0207646_10213993
1191 Ga0207681_10010358
1192 Ga0207681_10094360
1193 Ga0207681_10173327
1194 Ga0207681_11051927
1195 Ga0207694_10000032
1196 Ga0207694_10062166
1197 Ga0207694_10219140
1198 Ga0207694_10290494
1199 Ga0207650_10009030
1200 Ga0207650_10276245
1201 Ga0207650_10329199
1202 Ga0207650_10785541
1203 Ga0207650_10799105
1204 Ga0207650_11217467
1205 Ga0207659_10000217
1206 Ga0207659_10008100
1207 Ga0207659_10925649
1208 Ga0207687_10009187
1209 Ga0207687_10067559
1210 Ga0207700_10003228
1211 Ga0207700_10330201
1212 Ga0207664_10004667
1213 Ga0207664_10050992
1214 Ga0207664_10344423
1215 Ga0207644_10047962
1216 Ga0207644_10132560
1217 Ga0207644_10187130
1218 Ga0207644_10213765
1219 Ga0207690_10026142
1220 Ga0207690_10079076
1221 Ga0207690_10087734
1222 Ga0207690_10108749
1223 Ga0207690_10916574
1224 Ga0207706_10001515
1225 Ga0207706_10010922
1226 Ga0207706_10050605
1227 Ga0207706_10051626
1228 Ga0207706_10056117
1229 Ga0207686_10495179
1230 Ga0207686_10543594
1231 Ga0207709_10149903
1232 Ga0207670_10071101
1233 Ga0207670_10549033
1234 Ga0207670_10737886
1235 Ga0207669_10359240
1236 Ga0207691_10013468
1237 Ga0207691_10030391
1238 Ga0207711_10053466
1239 Ga0207711_10071427
1240 Ga0207711_10094899
1241 Ga0207689_10001170
1242 Ga0207689_10097712
1243 Ga0207661_10044052
1244 Ga0207661_10065872
1245 Ga0207661_10108768
1246 Ga0207661_10136643
1247 Ga0207661_10574973
1248 Ga0207661_10785712
1249 Ga0207679_10069132
1250 Ga0207679_10249064
1251 Ga0207679_10304436
1252 Ga0207679_11048579
1253 Ga0207679_11437395
1254 Ga0207667_10021842
1255 Ga0207667_10024407
1256 Ga0207667_10050992
1257 Ga0207667_10092991
1258 Ga0207667_10098647
1259 Ga0207667_10205749
1260 Ga0207667_10325647
1261 Ga0207651_10027121
1262 Ga0207651_10045426
1263 Ga0207712_10000063
1264 Ga0207668_10001620
1265 Ga0207668_11023795
1266 Ga0207640_10003372
1267 Ga0207640_10114601
1268 Ga0207640_10199811
1269 Ga0207640_10471609
1270 Ga0207640_11015555
1271 Ga0207658_10009290
1272 Ga0207658_10167118
1273 Ga0207658_11089137
1274 Ga0207677_10013404
1275 Ga0207677_10053242
1276 Ga0207677_10633910
1277 Ga0207703_10066419
1278 Ga0207703_10084694
1279 Ga0207639_10003609
1280 Ga0207639_10144181
1281 Ga0207678_10003013
1282 Ga0207678_10026670
1283 Ga0207678_10078143
1284 Ga0207708_10013636
1285 Ga0207708_10213233
1286 Ga0207702_10006559
1287 Ga0207702_10050496
1288 Ga0207702_11065264
1289 Ga0207702_11788934
1290 Ga0207648_10017777
1291 Ga0207648_10030621
1292 Ga0207676_10072734
1293 Ga0207676_10389296
1294 Ga0207674_10000795
1295 Ga0207674_10026067
1296 Ga0207675_100249242
1297 Ga0207675_100710394
1298 Ga0207683_10204349
1299 Ga0207698_10013072
1300 Ga0207698_10019004
1301 Ga0207698_10059731
1302 Ga0207698_10223325
1303 Ga0210000_1001251
1304 Ga0209995_1064531
1305 Ga0209999_1032857
1306 Ga0209974_10137970
1307 Ga0268266_10306065
1308 Ga0268265_10221212
1309 Ga0268265_11451746
1310 Ga0268264_10177144
1311 Ga0268264_10240224
1312 Ga0265316_11030549
1313 Ga0307408_100022559
1314 Ga0307408_100095719
1315 Ga0307408_100403587
1316 Ga0307408_100451223
1317 Ga0307408_101480305
1318 Ga0307408_102296945
1319 Ga0316576_10288772
1320 Ga0307405_10057115
1321 Ga0307405_10065205
1322 Ga0307405_10090667
1323 Ga0307405_10783205
1324 Ga0307413_10053877
1325 Ga0307413_10230486
1326 Ga0307413_10407973
1327 Ga0307413_10430174
1328 Ga0307413_10430721
1329 Ga0307413_10701726
1330 Ga0307413_10876496
1331 Ga0307410_10022280
1332 Ga0307410_10094620
1333 Ga0307410_10114324
1334 Ga0307410_10274606
1335 Ga0307406_10014058
1336 Ga0307406_11601111
1337 Ga0307407_10003979
1338 Ga0307407_10064151
1339 Ga0307407_10169895
1340 Ga0307407_10176344
1341 Ga0307407_11150782
1342 Ga0307412_10046654
1343 Ga0307412_10124532
1344 Ga0307412_10146059
1345 Ga0307412_10276950
1346 Ga0307412_10351085
1347 Ga0307412_10984372
1348 Ga0307412_12011542
1349 Ga0307409_100025239
1350 Ga0307409_100044384
1351 Ga0307409_100075650
1352 Ga0307409_100177866
1353 Ga0307409_100490082
1354 Ga0307409_100696462
1355 Ga0307409_101775487
1356 Ga0307416_100032578
1357 Ga0307416_100072819
1358 Ga0307416_100114256
1359 Ga0307416_100152208
1360 Ga0307416_100175216
1361 Ga0307416_100977575
1362 Ga0307416_101553183
1363 Ga0307416_101998081
1364 Ga0307414_10039854
1365 Ga0307414_10408532
1366 Ga0307414_10600559
1367 Ga0307414_11831075
1368 Ga0307411_10218926
1369 Ga0307411_10314758
1370 Ga0307411_10381060
1371 Ga0307411_10416690
1372 Ga0307411_10523270
1373 Ga0307415_100004379
1374 Ga0307415_100005483
1375 Ga0307415_100069029
1376 Ga0307415_100194774
1377 Ga0307415_100453562
1378 Ga0307415_101470888
1379 Ga0307415_101749714
1380 Ga0373923_0030106
1381 Ga0373953_0014865
1382 Ga0373956_0065807
1383 Ga0373957_0028978
1384 Ga0373946_0556250
1385 Ga0373955_0074390
1386 Ga0373924_0116301
1387 Ga0373931_0015839
1388 Ga0373935_0423175
1389 Ga0373927_0112998
1390 Ga0373927_0213281
1391 Ga0373933_0013632
1392 Ga0373937_0046947
1393 Ga0373937_0510667
1394 Ga0316584_0254450
1395 Ga0316584_0477488
1396 Ga0395899_0042187
1397 Ga0395899_0126437
1398 Ga0395899_0338893
1399 Ga0395900_0043902
1400 Ga0395900_0344363
1401 Ga0395898_0164801
1402 Ga0395898_0187813
1403 Ga0395898_0231927
1404 Ga0395905_0013160
1405 Ga0395905_0053763
1406 Ga0395905_0176024
1407 Ga0436364_0379739
1408 Ga0436364_0473930
1409 Ga0395901_0008096
1410 Ga0436365_0102391
1411 Ga0436365_0284913
1412 Ga0436365_1408484
1413 Ga0436362_0010966
1414 Ga0439461_0029123
1415 Ga0439461_0159323
1416 Ga0439465_0326214
1417 Ga0439434_0005503
1418 Ga0466965_0876436
1419 Ga0466966_0104468
1420 Ga0466961_0108347
1421 Ga0466961_0134487
1422 Ga0466961_0208766
1423 Ga0466961_0942199
1424 Ga0466963_0901658
1425 Ga0453684_0858716
1426 Ga0466970_0350027
1427 Ga0466959_0137324
1428 Ga0451576_0108441
1429 Ga0466967_0496856
1430 Ga0495592_0017790
1431 Ga0495629_0012411
1432 Ga0495629_0059806
1433 Ga0495651_0011749
1434 Ga0495653_0010680
1435 Ga0495582_0013759
1436 Ga0495662_0183483
1437 Ga0495664_0263491
1438 Ga0495664_0667656
1439 Ga0495594_0101007
1440 Ga0495594_0373857
1441 Ga0495594_0416872
1442 Ga0495608_0021539
1443 Ga0495618_0558784
1444 Ga0495643_0036149
1445 Ga0495663_0042040
1446 Ga0495663_0165147
1447 Ga0495642_0070234
1448 Ga0495652_0095357
1449 Ga0495586_0006643
1450 Ga0495586_0265140
1451 Ga0495586_0560478
1452 Ga0495587_0002385
1453 Ga0495587_0035162
1454 Ga0495587_0464098
1455 Ga0495621_0026172
1456 Ga0495621_0170662
1457 Ga0495645_0010848
1458 Ga0495622_0127456
1459 Ga0495622_0511083
1460 Ga0495667_0013916
1461 Ga0495667_0111968
1462 Ga0495667_0238079
1463 Ga0495656_0205509
1464 Ga0495635_0001636
1465 Ga0495588_0013090
1466 Ga0495657_0002639
1467 Ga0495657_0810605
1468 Ga0495599_0000866
1469 Ga0495623_0002680
1470 Ga0495646_0004172
1471 Ga0495658_0333550
1472 Ga0495658_1032341
1473 Ga0495613_0029015
1474 Ga0495613_0056400
1475 Ga0495613_0294980
1476 Ga0495613_0571635
1477 Ga0495600_0027695
1478 Ga0495600_0292493
1479 Ga0495581_0036041
1480 Ga0495581_0443293
1481 Ga0495581_0468572
1482 Ga0495604_0047676
1483 Ga0495674_0107039
1484 Ga0495674_0349398
1485 Ga0495672_0013645
1486 Ga0495680_0002561
1487 Ga0495675_0027115
1488 Ga0495675_0033164
1489 Ga0495675_0088613
1490 Ga0495675_0381691
1491 Ga0495675_0515661
1492 Ga0495685_016447
1493 Ga0495684_0028624
1494 Ga0495602_0032585
1495 Ga0496100_0892267
1496 Ga0496101_0267580
1497 Ga0496101_0626706
1498 Ga0496102_0789724
1499 Ga0496104_1352208
1500 Ga0496106_0264346
1501 Ga0496109_0591627
1502 Ga0496112_0000517
1503 Ga0496113_0077982
1504 Ga0496114_0084995
1505 Ga0496115_0077545
1506 Ga0496115_0406908
1507 Ga0501299_017573
1508 Ga0501031_0080666
1509 Ga0501031_0127404
1510 Ga0501032_0024436
1511 Ga0501032_0153624
1512 Ga0501033_0006056
1513 Ga0501033_0026314
1514 Ga0501034_0551082
1515 Ga0501036_0012347
1516 Ga0501036_0055428
1517 Ga0501036_0405377
1518 Ga0501037_0023412
1519 Ga0501037_0610234
1520 Ga0501038_0013294
1521 Ga0501039_0109800
1522 Ga0501039_0118102
1523 Ga0501040_0030059
1524 Ga0501040_0334622
1525 Ga0501041_0051216
1526 Ga0501042_0109979
1527 Ga0501042_1117600
1528 Ga0501043_0090468
1529 Ga0501043_0129681
1530 Ga0501043_0196179
1531 Ga0501046_0086322
1532 Ga0501046_0246518
1533 Ga0501046_0498821
1534 Ga0501046_0525841
1535 Ga0501047_0098676
1536 Ga0501048_0622111
1537 Ga0501070_0294783
1538 Ga0501071_0176563
1539 Ga0501071_1486663
1540 Ga0501072_0368019
1541 Ga0501072_0445734
1542 Ga0501073_0080329
1543 Ga0501074_0098764
1544 Ga0501074_0927221
1545 Ga0501075_0020594
1546 Ga0501075_0549679
1547 Ga0501075_1363091
1548 Ga0501077_0072033
1549 Ga0501224_017959
1550 Ga0501249_127069
1551 Ga0501257_133871
1552 Ga0501259_012234
1553 Ga0501229_028050
1554 Ga0501079_0404148
1555 Ga0501079_1226501
1556 Ga0501080_0108557
1557 Ga0501080_0167609
1558 Ga0501081_0026940
1559 Ga0501081_0884940
1560 Ga0501083_0242319
1561 Ga0501268_056514
1562 Ga0501268_133708
1563 Ga0501270_007952
1564 Ga0501273_042856
1565 Ga0501035_0017397
1566 Ga0501035_0038122
1567 Ga0501035_0253974
1568 Ga0501044_0006536
1569 Ga0501044_0027116
1570 Ga0501044_0081228
1571 Ga0501044_0394665
1572 Ga0501044_0707636
1573 Ga0501044_1018386
1574 Ga0501045_0015775
1575 Ga0501045_0027771
1576 nmdc:mga05p37_210048_c1
1577 nmdc:mga09592_1344701_c1
1578 nmdc:mga09592_816911_c1
1579 nmdc:mga0qj67_17290_c1
1580 nmdc:mga0qj67_5060_c1
1581 nmdc:mga06r32_481736_c1
1582 nmdc:mga08y16_755675_c1
1583 nmdc:mga0n895_214376_c1
1584 nmdc:mga0n895_597512_c1
1585 nmdc:mga0rr50_1246857_c1
1586 nmdc:mga0rr50_1768214_c1
1587 nmdc:mga08x19_2153_c1
1588 nmdc:mga08x19_251019_c1
1589 nmdc:mga08x19_63539_c1
1590 nmdc:mga0a205_63914_c1
1591 Ga0495601_0016974
1592 Ga0495612_0018858
1593 Ga0495619_0037686
1594 Ga0501084_0175358
1595 Ga0501084_0596421
1596 Ga0501082_0110526
1597 Ga0501082_0325946
1598 Ga0530510_0343954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

65

165

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9678 2 142
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9612 2 142
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9551 1 142
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9537 1 142
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9531 1 141
ID Description Score Start End Superfamily
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9668 2 142 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.96 2 142 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.949 1 141 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.924 45 142 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9234 5 142 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A1Q7EBS6-F1-model_v4 Peroxiredoxin 0.9947 1 142 GO:0004601
GO:0006979
AF-A0A7C5FTN1-F1-model_v4 OsmC family peroxiredoxin 0.9928 1 142 GO:0004601
GO:0006979
AF-A0A2V7MW52-F1-model_v4 Peroxiredoxin 0.9926 1 142 GO:0004601
GO:0006979
AF-A0A538NGU0-F1-model_v4 OsmC family peroxiredoxin 0.9898 1 100 GO:0004601
GO:0006979
AF-A0A2V7RG28-F1-model_v4 Peroxiredoxin 0.9887 1 142 GO:0004601
GO:0006979

Map