F481270

General Info

Members Datasets Scaffolds Average Seq Length
797 233 1594 143

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0680050|Ga0496106_0680050_48_527
Length 159
Sequence MTGIPIEPAWLWLIGGVLLLIAELIAPGFFLIFIGAAGIATGLLALLLHLPLALQLAAFAVLAILAVRVGGRRFYASRYDFTPDPFLNDRAARLLGQVVVVVEPVDAHGGRVRVGDSEWSARGGPAAIGDRVRIMDIDGNCLKVEPEHTLPPRIVEIHA

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
191 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
192 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 4.52
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0680050 3300048909 Unclassified 821
2 JGI24741J21665_1010333 3300001915 Bacteria 1674
3 JGI24740J21852_10000513 3300001979 Bacteria 16647
4 JGI24740J21852_10093249 3300001979 Bacteria 775
5 JGI24739J22299_10003537 3300001989 Bacteria 5965
6 JGI24737J22298_10000015 3300001990 Bacteria 49821
7 JGI24737J22298_10001423 3300001990 Bacteria 8516
8 JGI24737J22298_10002471 3300001990 Bacteria 6586
9 JGI24737J22298_10048667 3300001990 Bacteria 1290
10 JGI24738J21930_10002760 3300002075 Bacteria 4517
11 rootL2_10364057 3300003322 Bacteria 1438
12 Ga0070658_10028083 3300005327 Bacteria 4516
13 Ga0070658_10031704 3300005327 Bacteria 4246
14 Ga0070658_10031732 3300005327 Bacteria 4244
15 Ga0070658_10066728 3300005327 Bacteria 2939
16 Ga0070658_10206579 3300005327 Bacteria 1658
17 Ga0070658_10247618 3300005327 Bacteria 1511
18 Ga0070658_10515672 3300005327 Bacteria 1033
19 Ga0070658_10552848 3300005327 Bacteria 996
20 Ga0070658_10811329 3300005327 Bacteria 813
21 Ga0070676_10118871 3300005328 Bacteria 1656
22 Ga0070676_10174918 3300005328 Bacteria 1391
23 Ga0070676_10963195 3300005328 Bacteria 639
24 Ga0070683_100006192 3300005329 Bacteria 10035
25 Ga0070683_100019016 3300005329 Bacteria 6095
26 Ga0070683_100139830 3300005329 Bacteria 2294
27 Ga0070683_100501593 3300005329 Bacteria 1159
28 Ga0070683_100851944 3300005329 Bacteria 874
29 Ga0070690_100018732 3300005330 Bacteria 4187
30 Ga0070670_100017279 3300005331 Bacteria 6188
31 Ga0070670_100104446 3300005331 Bacteria 2440
32 Ga0070670_101342865 3300005331 Bacteria 655
33 Ga0070677_10107147 3300005333 Bacteria 1242
34 Ga0070666_10007441 3300005335 Bacteria 6751
35 Ga0070666_10101232 3300005335 Bacteria 1986
36 Ga0070666_10308099 3300005335 Bacteria 1128
37 Ga0070666_10763197 3300005335 Bacteria 711
38 Ga0070680_100013386 3300005336 Bacteria 6388
39 Ga0070680_100088370 3300005336 Bacteria 2563
40 Ga0070680_100124446 3300005336 Bacteria 2154
41 Ga0070682_100016703 3300005337 Bacteria 4272
42 Ga0070682_100068241 3300005337 Bacteria 2267
43 Ga0070682_101047953 3300005337 Bacteria 680
44 Ga0068868_100011410 3300005338 Bacteria 6470
45 Ga0068868_100171923 3300005338 Bacteria 1794
46 Ga0068868_100172865 3300005338 Bacteria 1789
47 Ga0068868_100209934 3300005338 Bacteria 1627
48 Ga0068868_100219586 3300005338 Bacteria 1591
49 Ga0068868_100414162 3300005338 Bacteria 1165
50 Ga0070660_100004749 3300005339 Bacteria 9399
51 Ga0070660_100013833 3300005339 Bacteria 5804
52 Ga0070660_100022815 3300005339 Bacteria 4634
53 Ga0070660_100028332 3300005339 Bacteria 4189
54 Ga0070660_100128148 3300005339 Bacteria 2029
55 Ga0070660_100137915 3300005339 Bacteria 1955
56 Ga0070660_100174754 3300005339 Bacteria 1736
57 Ga0070660_100208899 3300005339 Bacteria 1584
58 Ga0070689_100810661 3300005340 Bacteria 824
59 Ga0070689_101440090 3300005340 Bacteria 623
60 Ga0070691_10001910 3300005341 Bacteria 9137
61 Ga0070691_10869661 3300005341 Bacteria 554
62 Ga0070687_100239614 3300005343 Bacteria 1121
63 Ga0070687_100685433 3300005343 Bacteria 714
64 Ga0070661_100010200 3300005344 Bacteria 6526
65 Ga0070661_100026265 3300005344 Bacteria 4187
66 Ga0070661_100032075 3300005344 Bacteria 3801
67 Ga0070661_100034069 3300005344 Bacteria 3693
68 Ga0070661_100057044 3300005344 Bacteria 2862
69 Ga0070661_100079090 3300005344 Bacteria 2426
70 Ga0070661_100195080 3300005344 Bacteria 1545
71 Ga0070661_100196662 3300005344 Bacteria 1539
72 Ga0070661_100254996 3300005344 Bacteria 1355
73 Ga0070661_100367322 3300005344 Bacteria 1132
74 Ga0070661_101105012 3300005344 Bacteria 661
75 Ga0070692_10000634 3300005345 Bacteria 11124
76 Ga0070692_10034759 3300005345 Bacteria 2548
77 Ga0070692_10088526 3300005345 Bacteria 1680
78 Ga0070668_100158035 3300005347 Bacteria 1838
79 Ga0070668_100889277 3300005347 Bacteria 796
80 Ga0070668_101013752 3300005347 Bacteria 746
81 Ga0070669_100030645 3300005353 Bacteria 3882
82 Ga0070669_100254437 3300005353 Bacteria 1399
83 Ga0070675_100262153 3300005354 Bacteria 1515
84 Ga0070675_101041694 3300005354 Bacteria 752
85 Ga0070671_100004664 3300005355 Bacteria 10873
86 Ga0070671_100026451 3300005355 Bacteria 4768
87 Ga0070671_100078632 3300005355 Bacteria 2757
88 Ga0070671_100087011 3300005355 Bacteria 2615
89 Ga0070671_100472873 3300005355 Bacteria 1076
90 Ga0070671_100481191 3300005355 Bacteria 1067
91 Ga0070671_100533226 3300005355 Bacteria 1011
92 Ga0070671_100989928 3300005355 Bacteria 736
93 Ga0070674_100052929 3300005356 Bacteria 2801
94 Ga0070674_100055057 3300005356 Bacteria 2753
95 Ga0070674_100224164 3300005356 Bacteria 1464
96 Ga0070674_101096267 3300005356 Bacteria 703
97 Ga0070673_100000926 3300005364 Bacteria 16587
98 Ga0070673_100079300 3300005364 Bacteria 2658
99 Ga0070673_100127052 3300005364 Bacteria 2135
100 Ga0070673_100283407 3300005364 Bacteria 1454
101 Ga0070673_101353596 3300005364 Unclassified 669
102 Ga0070659_100005736 3300005366 Bacteria 8939
103 Ga0070659_100011188 3300005366 Bacteria 6631
104 Ga0070659_100060699 3300005366 Bacteria 2987
105 Ga0070659_100062473 3300005366 Bacteria 2944
106 Ga0070659_100065418 3300005366 Bacteria 2879
107 Ga0070659_100106568 3300005366 Bacteria 2259
108 Ga0070659_100232863 3300005366 Bacteria 1522
109 Ga0070659_100641647 3300005366 Bacteria 915
110 Ga0070659_100819586 3300005366 Unclassified 810
111 Ga0070667_100011845 3300005367 Bacteria 7211
112 Ga0070667_100017139 3300005367 Bacteria 5999
113 Ga0070667_100196364 3300005367 Bacteria 1789
114 Ga0070667_100227671 3300005367 Bacteria 1661
115 Ga0070667_100258449 3300005367 Bacteria 1559
116 Ga0070667_100582862 3300005367 Bacteria 1030
117 Ga0070667_100954781 3300005367 Bacteria 799
118 Ga0070667_100970341 3300005367 Unclassified 792
119 Ga0070714_100015883 3300005435 Bacteria 6068
120 Ga0070714_100039028 3300005435 Bacteria 3996
121 Ga0070714_100338882 3300005435 Bacteria 1410
122 Ga0070713_100017382 3300005436 Bacteria 5437
123 Ga0070713_100068158 3300005436 Bacteria 2998
124 Ga0070700_100529307 3300005441 Bacteria 912
125 Ga0070694_100176110 3300005444 Bacteria 1579
126 Ga0070694_101532925 3300005444 Bacteria 564
127 Ga0070663_100012165 3300005455 Bacteria 5432
128 Ga0070663_100052164 3300005455 Bacteria 2916
129 Ga0070663_100054532 3300005455 Bacteria 2857
130 Ga0070663_100066590 3300005455 Bacteria 2610
131 Ga0070663_100081296 3300005455 Bacteria 2381
132 Ga0070663_100117282 3300005455 Bacteria 2007
133 Ga0070663_100172097 3300005455 Bacteria 1674
134 Ga0070663_100203045 3300005455 Bacteria 1548
135 Ga0070663_100266804 3300005455 Bacteria 1359
136 Ga0070663_100664760 3300005455 Bacteria 882
137 Ga0070663_100824813 3300005455 Bacteria 797
138 Ga0070678_100001329 3300005456 Bacteria 13125
139 Ga0070678_100175895 3300005456 Bacteria 1748
140 Ga0070678_101153377 3300005456 Bacteria 717
141 Ga0070662_100005390 3300005457 Bacteria 8167
142 Ga0070662_100006946 3300005457 Bacteria 7325
143 Ga0070662_100014487 3300005457 Bacteria 5270
144 Ga0070662_100033294 3300005457 Bacteria 3627
145 Ga0070662_100194865 3300005457 Bacteria 1604
146 Ga0070662_100217309 3300005457 Bacteria 1523
147 Ga0070662_100274115 3300005457 Bacteria 1363
148 Ga0070681_10065926 3300005458 Bacteria 3590
149 Ga0070681_10363437 3300005458 Bacteria 1358
150 Ga0070681_10379651 3300005458 Bacteria 1324
151 Ga0068867_100033924 3300005459 Bacteria 3699
152 Ga0068867_100076590 3300005459 Bacteria 2512
153 Ga0068867_100632153 3300005459 Bacteria 937
154 Ga0070679_100053451 3300005530 Bacteria 4021
155 Ga0070679_100124892 3300005530 Bacteria 2556
156 Ga0070679_100236739 3300005530 Bacteria 1784
157 Ga0070684_100004530 3300005535 Bacteria 10584
158 Ga0070684_100064576 3300005535 Bacteria 3212
159 Ga0070684_100582185 3300005535 Bacteria 1040
160 Ga0068853_100010256 3300005539 Bacteria 7578
161 Ga0068853_100203640 3300005539 Bacteria 1801
162 Ga0068853_100215213 3300005539 Bacteria 1753
163 Ga0068853_100282804 3300005539 Bacteria 1529
164 Ga0068853_100541777 3300005539 Bacteria 1102
165 Ga0068853_100571229 3300005539 Bacteria 1072
166 Ga0070672_100014660 3300005543 Bacteria 5560
167 Ga0070672_100037200 3300005543 Bacteria 3712
168 Ga0070672_100129350 3300005543 Bacteria 2074
169 Ga0070672_100199144 3300005543 Bacteria 1674
170 Ga0070672_100224599 3300005543 Bacteria 1576
171 Ga0070672_100292338 3300005543 Bacteria 1380
172 Ga0070672_100387098 3300005543 Bacteria 1197
173 Ga0070696_100047252 3300005546 Bacteria 2986
174 Ga0070696_100138452 3300005546 Bacteria 1776
175 Ga0070696_101107908 3300005546 Bacteria 666
176 Ga0070693_100104964 3300005547 Bacteria 1728
177 Ga0070693_100191247 3300005547 Bacteria 1324
178 Ga0070665_100028754 3300005548 Bacteria 5597
179 Ga0070665_100036456 3300005548 Bacteria 4946
180 Ga0070665_100075680 3300005548 Bacteria 3373
181 Ga0070704_100185711 3300005549 Bacteria 1667
182 Ga0070704_100240066 3300005549 Bacteria 1482
183 Ga0068855_100066751 3300005563 Bacteria 4194
184 Ga0068855_100102125 3300005563 Bacteria 3300
185 Ga0068855_100207228 3300005563 Bacteria 2205
186 Ga0068855_100293680 3300005563 Bacteria 1801
187 Ga0068855_100432641 3300005563 Bacteria 1438
188 Ga0068855_100464416 3300005563 Bacteria 1380
189 Ga0070664_100001286 3300005564 Bacteria 20075
190 Ga0070664_100009829 3300005564 Bacteria 7752
191 Ga0070664_100017282 3300005564 Bacteria 5923
192 Ga0070664_100033663 3300005564 Bacteria 4294
193 Ga0070664_100049442 3300005564 Bacteria 3556
194 Ga0070664_100095146 3300005564 Bacteria 2583
195 Ga0070664_100389926 3300005564 Bacteria 1272
196 Ga0070664_100514338 3300005564 Bacteria 1104
197 Ga0068857_100006326 3300005577 Bacteria 10141
198 Ga0068857_100007836 3300005577 Bacteria 9210
199 Ga0068857_100037394 3300005577 Bacteria 4300
200 Ga0068857_100051415 3300005577 Bacteria 3656
201 Ga0068857_100111399 3300005577 Bacteria 2460
202 Ga0068857_100123491 3300005577 Bacteria 2332
203 Ga0068857_101162719 3300005577 Bacteria 746
204 Ga0068854_100001118 3300005578 Bacteria 16123
205 Ga0068854_100009999 3300005578 Bacteria 6142
206 Ga0068854_100023362 3300005578 Bacteria 4222
207 Ga0068854_100024552 3300005578 Bacteria 4128
208 Ga0068854_100026484 3300005578 Bacteria 3986
209 Ga0068854_100131356 3300005578 Bacteria 1913
210 Ga0068854_100207150 3300005578 Bacteria 1545
211 Ga0068854_100251710 3300005578 Bacteria 1411
212 Ga0068854_100394567 3300005578 Bacteria 1143
213 Ga0068856_100031852 3300005614 Bacteria 5159
214 Ga0068856_100091268 3300005614 Bacteria 3030
215 Ga0068856_100234055 3300005614 Bacteria 1852
216 Ga0068856_100342456 3300005614 Bacteria 1513
217 Ga0068856_100352002 3300005614 Bacteria 1491
218 Ga0070702_100676652 3300005615 Bacteria 784
219 Ga0068852_100008667 3300005616 Bacteria 7514
220 Ga0068852_100025552 3300005616 Bacteria 4787
221 Ga0068852_100034932 3300005616 Bacteria 4187
222 Ga0068852_100130502 3300005616 Bacteria 2314
223 Ga0068852_100211350 3300005616 Bacteria 1841
224 Ga0068852_100328024 3300005616 Bacteria 1488
225 Ga0068852_100752266 3300005616 Bacteria 987
226 Ga0068859_100015279 3300005617 Bacteria 7710
227 Ga0068859_100021834 3300005617 Bacteria 6420
228 Ga0068859_100070180 3300005617 Bacteria 3539
229 Ga0068864_100011788 3300005618 Bacteria 7221
230 Ga0068864_100273485 3300005618 Bacteria 1575
231 Ga0068864_101068286 3300005618 Bacteria 802
232 Ga0068866_10013552 3300005718 Bacteria 3581
233 Ga0068861_100317955 3300005719 Bacteria 1355
234 Ga0068851_10033810 3300005834 Bacteria 2549
235 Ga0068851_10039267 3300005834 Bacteria 2377
236 Ga0068851_10054487 3300005834 Bacteria 2037
237 Ga0068851_10134240 3300005834 Bacteria 1341
238 Ga0068851_10282698 3300005834 Bacteria 949
239 Ga0068870_10370195 3300005840 Unclassified 924
240 Ga0068863_100003907 3300005841 Bacteria 14718
241 Ga0068863_100005757 3300005841 Bacteria 12163
242 Ga0068863_100006405 3300005841 Bacteria 11540
243 Ga0068863_100054689 3300005841 Bacteria 3781
244 Ga0068863_100097662 3300005841 Bacteria 2789
245 Ga0068863_100196180 3300005841 Bacteria 1941
246 Ga0068863_100625188 3300005841 Bacteria 1067
247 Ga0068858_100001843 3300005842 Bacteria 21605
248 Ga0068858_100012453 3300005842 Bacteria 8020
249 Ga0068858_100013136 3300005842 Bacteria 7809
250 Ga0068858_100071827 3300005842 Bacteria 3210
251 Ga0068858_100309773 3300005842 Bacteria 1507
252 Ga0068860_100093853 3300005843 Bacteria 2860
253 Ga0068860_100325321 3300005843 Bacteria 1509
254 Ga0068860_100404181 3300005843 Bacteria 1351
255 Ga0068860_100595651 3300005843 Bacteria 1110
256 Ga0068860_100742479 3300005843 Bacteria 993
257 Ga0068862_100004223 3300005844 Bacteria 12167
258 Ga0068862_100029595 3300005844 Bacteria 4615
259 Ga0068862_100177085 3300005844 Bacteria 1912
260 Ga0068862_101589778 3300005844 Bacteria 661
261 Ga0081539_10106616 3300005985 Bacteria 1418
262 Ga0070717_10002637 3300006028 Bacteria 12628
263 Ga0075364_10280287 3300006051 Bacteria 1134
264 Ga0075362_10047851 3300006177 Bacteria 1906
265 Ga0097621_101198478 3300006237 Unclassified 715
266 Ga0068871_100007948 3300006358 Bacteria 7605
267 Ga0075431_100298462 3300006847 Bacteria 1628
268 Ga0075433_10488172 3300006852 Bacteria 1085
269 Ga0075434_101236031 3300006871 Bacteria 759
270 Ga0075429_100530969 3300006880 Bacteria 1031
271 Ga0068865_100007601 3300006881 Bacteria 6673
272 Ga0068865_100173207 3300006881 Bacteria 1656
273 Ga0097620_100015280 3300006931 Bacteria 7710
274 Ga0097620_100021834 3300006931 Bacteria 6420
275 Ga0097620_100070177 3300006931 Bacteria 3539
276 Ga0075435_100708869 3300007076 Bacteria 875
277 Ga0105251_10047171 3300009011 Bacteria 2071
278 Ga0105240_10020539 3300009093 Bacteria 8804
279 Ga0105240_10083562 3300009093 Bacteria 3917
280 Ga0105245_10103200 3300009098 Bacteria 2642
281 Ga0105245_10117506 3300009098 Bacteria 2480
282 Ga0105243_10450900 3300009148 Bacteria 1207
283 Ga0105243_11425173 3300009148 Bacteria 714
284 Ga0105241_10236030 3300009174 Bacteria 1544
285 Ga0105241_10557014 3300009174 Bacteria 1030
286 Ga0105241_11615110 3300009174 Bacteria 627
287 Ga0105242_10014871 3300009176 Bacteria 6028
288 Ga0105242_11189626 3300009176 Bacteria 781
289 Ga0105248_10004287 3300009177 Bacteria 15777
290 Ga0105248_10013575 3300009177 Bacteria 8969
291 Ga0105248_10018937 3300009177 Bacteria 7612
292 Ga0105248_10155845 3300009177 Bacteria 2577
293 Ga0105237_10080319 3300009545 Bacteria 3251
294 Ga0105237_10259451 3300009545 Bacteria 1740
295 Ga0105237_10295713 3300009545 Bacteria 1622
296 Ga0105238_10001777 3300009551 Bacteria 21567
297 Ga0105238_10067539 3300009551 Bacteria 3576
298 Ga0105249_10044682 3300009553 Bacteria 4028
299 Ga0105239_10017564 3300010375 Bacteria 7913
300 Ga0105239_10273085 3300010375 Bacteria 1902
301 Ga0105239_11211208 3300010375 Bacteria 870
302 Ga0105246_10044754 3300011119 Bacteria 3010
303 Ga0105246_10069027 3300011119 Bacteria 2481
304 Ga0105246_10146826 3300011119 Bacteria 1780
305 Ga0105246_10465213 3300011119 Bacteria 1066
306 Ga0157373_10024225 3300013100 Bacteria 4398
307 Ga0157373_10045835 3300013100 Bacteria 3121
308 Ga0157373_10055210 3300013100 Bacteria 2822
309 Ga0157373_10110649 3300013100 Bacteria 1931
310 Ga0157373_10113400 3300013100 Bacteria 1905
311 Ga0157373_10123975 3300013100 Bacteria 1817
312 Ga0157373_10209967 3300013100 Bacteria 1373
313 Ga0157371_10037493 3300013102 Bacteria 3468
314 Ga0157371_10173352 3300013102 Bacteria 1542
315 Ga0157371_10190994 3300013102 Bacteria 1466
316 Ga0157371_10300054 3300013102 Bacteria 1163
317 Ga0157371_10361754 3300013102 Bacteria 1057
318 Ga0157371_10374780 3300013102 Bacteria 1038
319 Ga0157371_10863906 3300013102 Bacteria 684
320 Ga0157370_10062554 3300013104 Bacteria 3529
321 Ga0157370_10080344 3300013104 Bacteria 3070
322 Ga0157370_10112423 3300013104 Bacteria 2546
323 Ga0157370_10230096 3300013104 Bacteria 1716
324 Ga0157369_10000833 3300013105 Bacteria 39452
325 Ga0157369_10189093 3300013105 Bacteria 2164
326 Ga0157369_10292093 3300013105 Bacteria 1697
327 Ga0157369_10806245 3300013105 Bacteria 965
328 Ga0157374_10008630 3300013296 Bacteria 8719
329 Ga0157374_10016812 3300013296 Bacteria 6437
330 Ga0157374_10064549 3300013296 Bacteria 3436
331 Ga0157374_10067792 3300013296 Bacteria 3356
332 Ga0157378_10065737 3300013297 Bacteria 3246
333 Ga0157378_10314643 3300013297 Bacteria 1519
334 Ga0157378_10612022 3300013297 Bacteria 1101
335 Ga0157378_10701991 3300013297 Unclassified 1031
336 Ga0163162_10004777 3300013306 Bacteria 13080
337 Ga0163162_10145799 3300013306 Bacteria 2484
338 Ga0163162_10249438 3300013306 Bacteria 1907
339 Ga0163162_10616085 3300013306 Bacteria 1211
340 Ga0157372_10047682 3300013307 Bacteria 4761
341 Ga0157372_10092941 3300013307 Bacteria 3432
342 Ga0157372_10123957 3300013307 Bacteria 2970
343 Ga0157372_10672669 3300013307 Bacteria 1205
344 Ga0157372_11142391 3300013307 Bacteria 901
345 Ga0157375_10020923 3300013308 Bacteria 5987
346 Ga0157375_10365636 3300013308 Bacteria 1609
347 Ga0157375_10516280 3300013308 Bacteria 1358
348 Ga0157375_12012880 3300013308 Bacteria 687
349 Ga0163163_10079069 3300014325 Bacteria 3286
350 Ga0163163_10231131 3300014325 Bacteria 1898
351 Ga0157380_10661534 3300014326 Bacteria 1044
352 Ga0182008_10052336 3300014497 Bacteria 2024
353 Ga0157377_10037735 3300014745 Bacteria 2663
354 Ga0157379_10055020 3300014968 Bacteria 3556
355 Ga0157379_10303899 3300014968 Bacteria 1454
356 Ga0157379_10422582 3300014968 Bacteria 1228
357 Ga0206356_10637938 3300020070 Bacteria 954
358 Ga0206353_11358299 3300020082 Bacteria 2112
359 Ga0213876_10010057 3300021384 Bacteria 5085
360 Ga0207656_10154281 3300025321 Bacteria 1089
361 Ga0207656_10201752 3300025321 Bacteria 961
362 Ga0207656_10470951 3300025321 Bacteria 636
363 Ga0207713_1089173 3300025735 Bacteria 1088
364 Ga0207642_10011945 3300025899 Bacteria 3118
365 Ga0207688_10190355 3300025901 Unclassified 1227
366 Ga0207680_10002057 3300025903 Bacteria 9422
367 Ga0207647_10000870 3300025904 Bacteria 23366
368 Ga0207647_10001330 3300025904 Bacteria 18984
369 Ga0207647_10003089 3300025904 Bacteria 12516
370 Ga0207647_10174755 3300025904 Bacteria 1250
371 Ga0207647_10445598 3300025904 Bacteria 726
372 Ga0207645_10010703 3300025907 Bacteria 6290
373 Ga0207645_10151177 3300025907 Bacteria 1515
374 Ga0207645_10193804 3300025907 Bacteria 1336
375 Ga0207645_10212162 3300025907 Bacteria 1275
376 Ga0207643_10224444 3300025908 Bacteria 1151
377 Ga0207705_10003226 3300025909 Bacteria 12416
378 Ga0207705_10003689 3300025909 Bacteria 11653
379 Ga0207705_10011705 3300025909 Bacteria 6338
380 Ga0207705_10018529 3300025909 Bacteria 4977
381 Ga0207705_10046545 3300025909 Bacteria 3117
382 Ga0207705_10063224 3300025909 Bacteria 2674
383 Ga0207705_10327272 3300025909 Bacteria 1178
384 Ga0207705_10627161 3300025909 Bacteria 836
385 Ga0207684_10638906 3300025910 Bacteria 907
386 Ga0207654_10112925 3300025911 Bacteria 1693
387 Ga0207654_10626896 3300025911 Bacteria 769
388 Ga0207654_10695368 3300025911 Bacteria 730
389 Ga0207707_10153461 3300025912 Bacteria 2013
390 Ga0207707_10304875 3300025912 Bacteria 1377
391 Ga0207695_10002617 3300025913 Bacteria 26348
392 Ga0207695_10006568 3300025913 Bacteria 15049
393 Ga0207671_10073174 3300025914 Bacteria 2559
394 Ga0207671_10636422 3300025914 Bacteria 849
395 Ga0207660_10111041 3300025917 Bacteria 2063
396 Ga0207660_10113532 3300025917 Bacteria 2042
397 Ga0207660_10962925 3300025917 Bacteria 696
398 Ga0207662_10222543 3300025918 Bacteria 1230
399 Ga0207662_10274512 3300025918 Bacteria 1113
400 Ga0207657_10000948 3300025919 Bacteria 30737
401 Ga0207657_10001484 3300025919 Bacteria 25105
402 Ga0207657_10003972 3300025919 Bacteria 15709
403 Ga0207657_10006930 3300025919 Bacteria 11679
404 Ga0207657_10028098 3300025919 Bacteria 5139
405 Ga0207657_10028283 3300025919 Bacteria 5116
406 Ga0207657_10029043 3300025919 Bacteria 5039
407 Ga0207657_10209176 3300025919 Bacteria 1566
408 Ga0207649_10001955 3300025920 Bacteria 11752
409 Ga0207649_10017843 3300025920 Bacteria 4025
410 Ga0207649_10033899 3300025920 Bacteria 3054
411 Ga0207649_10044606 3300025920 Bacteria 2715
412 Ga0207649_10107815 3300025920 Bacteria 1855
413 Ga0207649_10225054 3300025920 Bacteria 1338
414 Ga0207649_10333985 3300025920 Bacteria 1117
415 Ga0207649_10349977 3300025920 Bacteria 1093
416 Ga0207649_10649197 3300025920 Bacteria 815
417 Ga0207649_10725202 3300025920 Bacteria 772
418 Ga0207649_10767131 3300025920 Unclassified 751
419 Ga0207652_10011945 3300025921 Bacteria 7009
420 Ga0207652_10068366 3300025921 Bacteria 3082
421 Ga0207652_10697098 3300025921 Bacteria 906
422 Ga0207681_10060507 3300025923 Bacteria 2600
423 Ga0207681_10199981 3300025923 Bacteria 1534
424 Ga0207694_10019958 3300025924 Bacteria 5070
425 Ga0207694_10033574 3300025924 Bacteria 3931
426 Ga0207650_10002248 3300025925 Bacteria 13488
427 Ga0207650_10016428 3300025925 Bacteria 5172
428 Ga0207650_10026182 3300025925 Bacteria 4157
429 Ga0207650_10052487 3300025925 Bacteria 3020
430 Ga0207650_10089232 3300025925 Bacteria 2353
431 Ga0207650_10232884 3300025925 Bacteria 1486
432 Ga0207650_10952048 3300025925 Bacteria 730
433 Ga0207659_10238799 3300025926 Bacteria 1469
434 Ga0207687_10015992 3300025927 Bacteria 4923
435 Ga0207687_10396321 3300025927 Bacteria 1134
436 Ga0207700_10092732 3300025928 Bacteria 2388
437 Ga0207700_10235262 3300025928 Bacteria 1559
438 Ga0207664_10361317 3300025929 Bacteria 1286
439 Ga0207644_10000389 3300025931 Bacteria 28599
440 Ga0207644_10004266 3300025931 Bacteria 9278
441 Ga0207644_10020160 3300025931 Bacteria 4530
442 Ga0207644_10032143 3300025931 Bacteria 3659
443 Ga0207644_10040467 3300025931 Bacteria 3294
444 Ga0207644_10536677 3300025931 Bacteria 967
445 Ga0207690_10011623 3300025932 Bacteria 5261
446 Ga0207690_10011829 3300025932 Bacteria 5219
447 Ga0207690_10012127 3300025932 Bacteria 5156
448 Ga0207690_10044464 3300025932 Bacteria 2927
449 Ga0207690_10058017 3300025932 Bacteria 2617
450 Ga0207690_10066720 3300025932 Bacteria 2466
451 Ga0207690_10079586 3300025932 Bacteria 2284
452 Ga0207690_10098607 3300025932 Bacteria 2082
453 Ga0207690_10227317 3300025932 Bacteria 1431
454 Ga0207690_10504156 3300025932 Bacteria 979
455 Ga0207706_10007703 3300025933 Bacteria 9943
456 Ga0207706_10011097 3300025933 Bacteria 8212
457 Ga0207706_10013591 3300025933 Bacteria 7396
458 Ga0207706_10014348 3300025933 Bacteria 7181
459 Ga0207706_10014981 3300025933 Bacteria 7020
460 Ga0207706_10019402 3300025933 Bacteria 6117
461 Ga0207706_10020422 3300025933 Bacteria 5955
462 Ga0207706_10024186 3300025933 Bacteria 5446
463 Ga0207706_10041571 3300025933 Bacteria 4075
464 Ga0207706_10169869 3300025933 Bacteria 1916
465 Ga0207706_10249762 3300025933 Bacteria 1550
466 Ga0207686_10060469 3300025934 Bacteria 2398
467 Ga0207709_10050417 3300025935 Bacteria 2545
468 Ga0207670_10706849 3300025936 Bacteria 835
469 Ga0207670_11031684 3300025936 Bacteria 693
470 Ga0207669_10094071 3300025937 Bacteria 1960
471 Ga0207669_10105280 3300025937 Bacteria 1876
472 Ga0207669_10244828 3300025937 Bacteria 1331
473 Ga0207704_10016948 3300025938 Bacteria 3762
474 Ga0207704_10252502 3300025938 Bacteria 1325
475 Ga0207691_10003366 3300025940 Bacteria 15559
476 Ga0207691_10062306 3300025940 Bacteria 3385
477 Ga0207691_10089871 3300025940 Bacteria 2753
478 Ga0207691_10233122 3300025940 Bacteria 1593
479 Ga0207691_10256567 3300025940 Bacteria 1508
480 Ga0207711_10004428 3300025941 Bacteria 11971
481 Ga0207711_10006372 3300025941 Bacteria 9944
482 Ga0207711_10017997 3300025941 Bacteria 5872
483 Ga0207689_10016255 3300025942 Bacteria 6303
484 Ga0207661_10002284 3300025944 Bacteria 13206
485 Ga0207661_10045480 3300025944 Bacteria 3475
486 Ga0207661_10081791 3300025944 Bacteria 2668
487 Ga0207661_11274547 3300025944 Bacteria 676
488 Ga0207679_10015487 3300025945 Bacteria 5041
489 Ga0207679_10186120 3300025945 Bacteria 1722
490 Ga0207679_10447103 3300025945 Bacteria 1145
491 Ga0207679_10563680 3300025945 Bacteria 1023
492 Ga0207679_10921549 3300025945 Bacteria 799
493 Ga0207667_10018328 3300025949 Bacteria 7853
494 Ga0207667_10055383 3300025949 Bacteria 4168
495 Ga0207667_10067280 3300025949 Bacteria 3732
496 Ga0207667_10071481 3300025949 Bacteria 3607
497 Ga0207667_10309867 3300025949 Bacteria 1612
498 Ga0207667_10331404 3300025949 Bacteria 1554
499 Ga0207667_10773957 3300025949 Bacteria 958
500 Ga0207651_10074802 3300025960 Bacteria 2414
501 Ga0207651_10178186 3300025960 Bacteria 1683
502 Ga0207651_10743966 3300025960 Bacteria 866
503 Ga0207651_10844554 3300025960 Bacteria 813
504 Ga0207651_11665787 3300025960 Unclassified 574
505 Ga0207712_10001687 3300025961 Bacteria 14829
506 Ga0207668_10083008 3300025972 Bacteria 2330
507 Ga0207668_10117791 3300025972 Bacteria 2005
508 Ga0207668_11284270 3300025972 Bacteria 659
509 Ga0207640_10000777 3300025981 Bacteria 18152
510 Ga0207640_10003847 3300025981 Bacteria 8100
511 Ga0207640_10014953 3300025981 Bacteria 4480
512 Ga0207640_10018888 3300025981 Bacteria 4060
513 Ga0207640_10047173 3300025981 Bacteria 2777
514 Ga0207640_10075668 3300025981 Bacteria 2283
515 Ga0207640_10134534 3300025981 Bacteria 1792
516 Ga0207640_10707330 3300025981 Bacteria 864
517 Ga0207640_10828784 3300025981 Bacteria 803
518 Ga0207658_10004794 3300025986 Bacteria 9360
519 Ga0207658_10006661 3300025986 Bacteria 7867
520 Ga0207658_10033185 3300025986 Bacteria 3680
521 Ga0207658_10101826 3300025986 Bacteria 2251
522 Ga0207658_10504650 3300025986 Bacteria 1078
523 Ga0207658_11165265 3300025986 Bacteria 704
524 Ga0207677_10013595 3300026023 Bacteria 4723
525 Ga0207677_10029288 3300026023 Bacteria 3497
526 Ga0207677_10141809 3300026023 Bacteria 1841
527 Ga0207703_10002629 3300026035 Bacteria 15501
528 Ga0207703_10011863 3300026035 Bacteria 6785
529 Ga0207703_10103744 3300026035 Bacteria 2414
530 Ga0207703_10166572 3300026035 Bacteria 1934
531 Ga0207703_10756080 3300026035 Bacteria 926
532 Ga0207639_10033890 3300026041 Bacteria 3770
533 Ga0207639_10062616 3300026041 Bacteria 2877
534 Ga0207639_10062997 3300026041 Bacteria 2869
535 Ga0207639_10136736 3300026041 Bacteria 2036
536 Ga0207639_10297875 3300026041 Bacteria 1424
537 Ga0207639_10902967 3300026041 Bacteria 826
538 Ga0207678_10000587 3300026067 Bacteria 33282
539 Ga0207678_10000938 3300026067 Bacteria 26581
540 Ga0207678_10004050 3300026067 Bacteria 13181
541 Ga0207678_10004806 3300026067 Bacteria 12134
542 Ga0207678_10006051 3300026067 Bacteria 10762
543 Ga0207678_10007492 3300026067 Bacteria 9646
544 Ga0207678_10056515 3300026067 Bacteria 3378
545 Ga0207678_10059157 3300026067 Bacteria 3297
546 Ga0207678_10105718 3300026067 Bacteria 2401
547 Ga0207678_10229885 3300026067 Bacteria 1588
548 Ga0207678_10543291 3300026067 Bacteria 1016
549 Ga0207678_10887628 3300026067 Bacteria 788
550 Ga0207708_10262753 3300026075 Bacteria 1394
551 Ga0207702_10012460 3300026078 Bacteria 7077
552 Ga0207702_10125158 3300026078 Bacteria 2306
553 Ga0207702_10126249 3300026078 Bacteria 2297
554 Ga0207702_10664075 3300026078 Bacteria 1026
555 Ga0207641_10015072 3300026088 Bacteria 6335
556 Ga0207641_10021784 3300026088 Bacteria 5268
557 Ga0207641_10022606 3300026088 Bacteria 5176
558 Ga0207641_10037366 3300026088 Bacteria 4055
559 Ga0207641_10214821 3300026088 Bacteria 1780
560 Ga0207641_10241491 3300026088 Bacteria 1683
561 Ga0207641_10348163 3300026088 Bacteria 1411
562 Ga0207641_10721953 3300026088 Bacteria 982
563 Ga0207641_10820305 3300026088 Bacteria 921
564 Ga0207648_10072288 3300026089 Bacteria 3006
565 Ga0207648_10118705 3300026089 Bacteria 2325
566 Ga0207648_10157291 3300026089 Bacteria 2006
567 Ga0207648_10500686 3300026089 Bacteria 1111
568 Ga0207676_10034030 3300026095 Bacteria 3855
569 Ga0207676_10035649 3300026095 Bacteria 3778
570 Ga0207676_10237333 3300026095 Bacteria 1633
571 Ga0207676_10239920 3300026095 Bacteria 1625
572 Ga0207676_11426199 3300026095 Bacteria 689
573 Ga0207676_12203533 3300026095 Unclassified 549
574 Ga0207674_10001057 3300026116 Bacteria 35856
575 Ga0207674_10001488 3300026116 Bacteria 30251
576 Ga0207674_10001949 3300026116 Bacteria 26188
577 Ga0207674_10001996 3300026116 Bacteria 25880
578 Ga0207674_10007062 3300026116 Bacteria 13125
579 Ga0207674_10034351 3300026116 Bacteria 5302
580 Ga0207674_10163880 3300026116 Bacteria 2177
581 Ga0207675_100965097 3300026118 Unclassified 870
582 Ga0207683_10000808 3300026121 Bacteria 28633
583 Ga0207683_10054815 3300026121 Bacteria 3496
584 Ga0207683_10275839 3300026121 Bacteria 1536
585 Ga0207683_11385980 3300026121 Bacteria 650
586 Ga0207698_10016399 3300026142 Bacteria 4991
587 Ga0207698_10039092 3300026142 Bacteria 3512
588 Ga0207698_10181404 3300026142 Bacteria 1865
589 Ga0207698_10297746 3300026142 Bacteria 1500
590 Ga0207698_10695654 3300026142 Bacteria 1011
591 Ga0207698_11210918 3300026142 Bacteria 769
592 Ga0268266_10038507 3300028379 Bacteria 4070
593 Ga0268266_10042731 3300028379 Bacteria 3872
594 Ga0268266_10095945 3300028379 Bacteria 2605
595 Ga0268266_10735433 3300028379 Bacteria 952
596 Ga0268266_11510284 3300028379 Bacteria 647
597 Ga0268266_11521401 3300028379 Bacteria 645
598 Ga0268265_10002914 3300028380 Bacteria 12557
599 Ga0268265_10025904 3300028380 Bacteria 4169
600 Ga0268265_10059583 3300028380 Bacteria 2921
601 Ga0268265_10121376 3300028380 Bacteria 2153
602 Ga0268264_10002210 3300028381 Bacteria 17265
603 Ga0268264_10011121 3300028381 Bacteria 7435
604 Ga0268264_10345545 3300028381 Bacteria 1414
605 Ga0268264_10983687 3300028381 Bacteria 850
606 Ga0268264_10998722 3300028381 Unclassified 843
607 Ga0307408_101181048 3300031548 Bacteria 713
608 Ga0307405_10003393 3300031731 Bacteria 7312
609 Ga0307405_10160424 3300031731 Bacteria 1592
610 Ga0307405_11160872 3300031731 Bacteria 666
611 Ga0307413_10022018 3300031824 Bacteria 3425
612 Ga0307410_10974401 3300031852 Bacteria 730
613 Ga0307410_11376575 3300031852 Bacteria 619
614 Ga0307406_10032217 3300031901 Bacteria 3199
615 Ga0307407_10216980 3300031903 Bacteria 1291
616 Ga0307409_100331393 3300031995 Bacteria 1428
617 Ga0307416_100625342 3300032002 Bacteria 1159
618 Ga0307414_10054367 3300032004 Bacteria 2798
619 Ga0307414_10424679 3300032004 Bacteria 1160
620 Ga0307414_10506880 3300032004 Bacteria 1069
621 Ga0307411_10457318 3300032005 Bacteria 1069
622 Ga0307411_10669114 3300032005 Bacteria 901
623 Ga0307411_10928302 3300032005 Bacteria 775
624 Ga0307411_10972440 3300032005 Bacteria 758
625 Ga0307415_100013852 3300032126 Bacteria 4721
626 Ga0307415_100158270 3300032126 Bacteria 1752
627 Ga0307415_100245304 3300032126 Bacteria 1452
628 Ga0307415_100440801 3300032126 Bacteria 1123
629 Ga0373962_0269948 3300035242 Bacteria 596
630 Ga0373931_0377763 3300035691 Bacteria 893
631 Ga0395899_0002090 3300037312 Bacteria 16385
632 Ga0395899_0003823 3300037312 Bacteria 11884
633 Ga0395899_0019556 3300037312 Bacteria 5142
634 Ga0395899_0023532 3300037312 Bacteria 4664
635 Ga0395899_0142326 3300037312 Bacteria 1705
636 Ga0395899_0144302 3300037312 Bacteria 1692
637 Ga0395899_0205852 3300037312 Bacteria 1369
638 Ga0395899_0220911 3300037312 Bacteria 1312
639 Ga0395899_0350727 3300037312 Bacteria 987
640 Ga0395899_0375999 3300037312 Bacteria 945
641 Ga0395899_0467264 3300037312 Bacteria 823
642 Ga0395900_0002298 3300037418 Bacteria 21230
643 Ga0395900_0004149 3300037418 Bacteria 15419
644 Ga0395900_0005898 3300037418 Bacteria 12791
645 Ga0395900_0014084 3300037418 Bacteria 8164
646 Ga0395900_0042328 3300037418 Bacteria 4693
647 Ga0395900_0042528 3300037418 Bacteria 4682
648 Ga0395900_0048017 3300037418 Bacteria 4396
649 Ga0395900_0053595 3300037418 Bacteria 4151
650 Ga0395900_0088201 3300037418 Bacteria 3189
651 Ga0395900_0110675 3300037418 Bacteria 2821
652 Ga0395900_0145916 3300037418 Bacteria 2419
653 Ga0395900_0191743 3300037418 Bacteria 2073
654 Ga0395900_0220775 3300037418 Bacteria 1910
655 Ga0395900_0400595 3300037418 Bacteria 1336
656 Ga0395900_0509849 3300037418 Bacteria 1152
657 Ga0395898_0008615 3300037466 Bacteria 10763
658 Ga0395898_0012526 3300037466 Bacteria 8771
659 Ga0395898_0017336 3300037466 Bacteria 7357
660 Ga0395898_0020036 3300037466 Bacteria 6799
661 Ga0395898_0030490 3300037466 Bacteria 5396
662 Ga0395898_0120515 3300037466 Bacteria 2513
663 Ga0395898_0309090 3300037466 Bacteria 1508
664 Ga0395898_0385458 3300037466 Bacteria 1336
665 Ga0395905_0000193 3300037471 Bacteria 96667
666 Ga0395905_0003425 3300037471 Bacteria 16973
667 Ga0395905_0003572 3300037471 Bacteria 16555
668 Ga0395905_0004969 3300037471 Bacteria 13697
669 Ga0395905_0005518 3300037471 Bacteria 12903
670 Ga0395905_0014176 3300037471 Bacteria 7616
671 Ga0395905_0015296 3300037471 Bacteria 7295
672 Ga0395905_0017911 3300037471 Bacteria 6729
673 Ga0395905_0025850 3300037471 Bacteria 5533
674 Ga0395905_0027553 3300037471 Bacteria 5358
675 Ga0395905_0028572 3300037471 Bacteria 5257
676 Ga0395905_0032893 3300037471 Bacteria 4875
677 Ga0395905_0048825 3300037471 Bacteria 3965
678 Ga0395905_0068616 3300037471 Bacteria 3320
679 Ga0395905_0069533 3300037471 Bacteria 3297
680 Ga0395905_0077523 3300037471 Bacteria 3114
681 Ga0395905_0090223 3300037471 Bacteria 2873
682 Ga0395905_0185565 3300037471 Bacteria 1952
683 Ga0395905_0210788 3300037471 Bacteria 1820
684 Ga0395905_0230331 3300037471 Bacteria 1732
685 Ga0395905_0278470 3300037471 Bacteria 1559
686 Ga0395905_0347611 3300037471 Bacteria 1375
687 Ga0395905_0831566 3300037471 Bacteria 826
688 Ga0395905_0925881 3300037471 Bacteria 774
689 Ga0395905_1340590 3300037471 Bacteria 619
690 Ga0395901_0002827 3300038443 Bacteria 17529
691 Ga0395901_0004785 3300038443 Bacteria 13663
692 Ga0395901_0009620 3300038443 Bacteria 9805
693 Ga0395901_0011981 3300038443 Bacteria 8796
694 Ga0395901_0042090 3300038443 Bacteria 4735
695 Ga0395901_0042248 3300038443 Bacteria 4726
696 Ga0395901_0056346 3300038443 Bacteria 4088
697 Ga0395901_0070159 3300038443 Bacteria 3650
698 Ga0395901_0085100 3300038443 Bacteria 3305
699 Ga0395901_0095988 3300038443 Bacteria 3107
700 Ga0395901_0134157 3300038443 Bacteria 2602
701 Ga0395901_0169409 3300038443 Bacteria 2291
702 Ga0395901_0230704 3300038443 Bacteria 1932
703 Ga0395901_1081170 3300038443 Bacteria 773
704 Ga0395901_1411154 3300038443 Unclassified 654
705 Ga0436365_0099116 3300039437 Bacteria 6637
706 Ga0439438_118473 3300041405 Bacteria 637
707 Ga0439439_0123786 3300041406 Bacteria 723
708 Ga0450903_026079 3300042138 Bacteria 892
709 Ga0450905_053993 3300042142 Bacteria 660
710 Ga0450889_000011 3300042144 Bacteria 16218
711 Ga0439458_0000238 3300042157 Bacteria 13176
712 Ga0439458_0008595 3300042157 Bacteria 2275
713 Ga0439434_0153356 3300042435 Bacteria 764
714 Ga0439464_0000629 3300042439 Bacteria 7486
715 Ga0466969_0001948 3300044656 Bacteria 11040
716 Ga0466969_0052191 3300044656 Bacteria 2009
717 Ga0466966_0001379 3300044684 Bacteria 15630
718 Ga0466966_0034950 3300044684 Bacteria 3249
719 Ga0466966_0407509 3300044684 Bacteria 817
720 Ga0466961_0014622 3300044693 Bacteria 5042
721 Ga0466961_0048058 3300044693 Bacteria 2727
722 Ga0466961_0110513 3300044693 Bacteria 1729
723 Ga0466961_0384887 3300044693 Bacteria 852
724 Ga0466963_0037852 3300044694 Bacteria 3153
725 Ga0466963_0058443 3300044694 Bacteria 2571
726 Ga0466963_0143370 3300044694 Bacteria 1656
727 Ga0466963_0187258 3300044694 Bacteria 1446
728 Ga0466963_1281220 3300044694 Bacteria 515
729 Ga0466964_0057887 3300044706 Bacteria 1605
730 Ga0466971_0007503 3300044719 Bacteria 4752
731 Ga0466968_0011238 3300044735 Bacteria 3487
732 Ga0466970_0001479 3300044765 Bacteria 11347
733 Ga0466970_0410330 3300044765 Bacteria 773
734 Ga0466957_0000606 3300044842 Bacteria 18172
735 Ga0466957_0091508 3300044842 Bacteria 1906
736 Ga0466957_0404679 3300044842 Bacteria 934
737 Ga0466960_0130218 3300044901 Bacteria 1327
738 Ga0466959_0005424 3300045049 Bacteria 8727
739 Ga0466959_0055065 3300045049 Bacteria 2904
740 Ga0466959_0219779 3300045049 Bacteria 1318
741 Ga0466958_0003340 3300045836 Bacteria 8311
742 Ga0466958_0024911 3300045836 Bacteria 3523
743 Ga0466958_0100088 3300045836 Bacteria 1801
744 Ga0466967_0144631 3300045976 Bacteria 2217
745 Ga0466967_0234507 3300045976 Bacteria 1748
746 Ga0495580_0581863 3300046472 Bacteria 741
747 Ga0495669_0152793 3300046684 Bacteria 1093
748 Ga0495669_0309895 3300046684 Bacteria 761
749 Ga0495669_0338926 3300046684 Bacteria 726
750 Ga0495677_0043561 3300047445 Bacteria 1645
751 Ga0495677_0168359 3300047445 Unclassified 847
752 Ga0496100_0589218 3300048903 Bacteria 863
753 Ga0496101_0366956 3300048904 Bacteria 1132
754 Ga0496101_0835779 3300048904 Bacteria 726
755 Ga0496102_0186991 3300048905 Bacteria 1952
756 Ga0496102_0449275 3300048905 Bacteria 1209
757 Ga0496103_0040746 3300048906 Bacteria 2854
758 Ga0496105_0548839 3300048908 Bacteria 902
759 Ga0496106_0333824 3300048909 Bacteria 1217
760 Ga0496106_0370205 3300048909 Bacteria 1151
761 Ga0496107_0022023 3300048910 Bacteria 4501
762 Ga0496107_0036987 3300048910 Bacteria 3503
763 Ga0496107_0155379 3300048910 Bacteria 1694
764 Ga0496107_0478852 3300048910 Bacteria 924
765 Ga0496108_0009566 3300048911 Bacteria 7858
766 Ga0496108_0011991 3300048911 Bacteria 7053
767 Ga0496108_0034394 3300048911 Bacteria 4210
768 Ga0496108_0036687 3300048911 Bacteria 4079
769 Ga0496109_0004600 3300048912 Bacteria 11514
770 Ga0496109_0013490 3300048912 Bacteria 7089
771 Ga0496109_0037034 3300048912 Bacteria 4406
772 Ga0496109_0413594 3300048912 Bacteria 1274
773 Ga0496109_1028500 3300048912 Bacteria 761
774 Ga0496110_0030560 3300048913 Bacteria 4644
775 Ga0496110_0102139 3300048913 Bacteria 2571
776 Ga0496110_0463613 3300048913 Bacteria 1154
777 Ga0496111_0033148 3300048914 Bacteria 3683
778 Ga0496111_0321781 3300048914 Bacteria 1145
779 Ga0496112_0021605 3300048915 Bacteria 6122
780 Ga0496112_0098429 3300048915 Bacteria 2894
781 Ga0496112_0144434 3300048915 Bacteria 2348
782 Ga0496112_0846067 3300048915 Bacteria 838
783 Ga0496112_1568613 3300048915 Bacteria 572
784 Ga0496113_0124683 3300048916 Bacteria 2016
785 Ga0496113_0227350 3300048916 Bacteria 1487
786 Ga0496114_1583134 3300048917 Bacteria 543
787 Ga0501068_0088516 3300049584 Bacteria 1908
788 Ga0501069_0156594 3300049585 Bacteria 1311
789 nmdc:mga03683_188433_c1 3300050489 Bacteria 943
790 nmdc:mga00v17_274139_c1 3300050491 Bacteria 1095
791 nmdc:mga09592_219256_c1 3300050508 Bacteria 1648
792 nmdc:mga0n895_183268_c1 3300050512 Bacteria 2125
793 nmdc:mga08x19_1008302_c1 3300050514 Unclassified 591
794 nmdc:mga0a205_186702_c1 3300050515 Bacteria 1966
795 nmdc:mga0a205_612691_c1 3300050515 Bacteria 941
796 Ga0466962_0003924 3300061719 Bacteria 7116
797 Ga0466962_0066371 3300061719 Bacteria 1722
798 Ga0496106_0680050
799 JGI24741J21665_1010333
800 JGI24740J21852_10000513
801 JGI24740J21852_10093249
802 JGI24739J22299_10003537
803 JGI24737J22298_10000015
804 JGI24737J22298_10001423
805 JGI24737J22298_10002471
806 JGI24737J22298_10048667
807 JGI24738J21930_10002760
808 rootL2_10364057
809 Ga0070658_10028083
810 Ga0070658_10031704
811 Ga0070658_10031732
812 Ga0070658_10066728
813 Ga0070658_10206579
814 Ga0070658_10247618
815 Ga0070658_10515672
816 Ga0070658_10552848
817 Ga0070658_10811329
818 Ga0070676_10118871
819 Ga0070676_10174918
820 Ga0070676_10963195
821 Ga0070683_100006192
822 Ga0070683_100019016
823 Ga0070683_100139830
824 Ga0070683_100501593
825 Ga0070683_100851944
826 Ga0070690_100018732
827 Ga0070670_100017279
828 Ga0070670_100104446
829 Ga0070670_101342865
830 Ga0070677_10107147
831 Ga0070666_10007441
832 Ga0070666_10101232
833 Ga0070666_10308099
834 Ga0070666_10763197
835 Ga0070680_100013386
836 Ga0070680_100088370
837 Ga0070680_100124446
838 Ga0070682_100016703
839 Ga0070682_100068241
840 Ga0070682_101047953
841 Ga0068868_100011410
842 Ga0068868_100171923
843 Ga0068868_100172865
844 Ga0068868_100209934
845 Ga0068868_100219586
846 Ga0068868_100414162
847 Ga0070660_100004749
848 Ga0070660_100013833
849 Ga0070660_100022815
850 Ga0070660_100028332
851 Ga0070660_100128148
852 Ga0070660_100137915
853 Ga0070660_100174754
854 Ga0070660_100208899
855 Ga0070689_100810661
856 Ga0070689_101440090
857 Ga0070691_10001910
858 Ga0070691_10869661
859 Ga0070687_100239614
860 Ga0070687_100685433
861 Ga0070661_100010200
862 Ga0070661_100026265
863 Ga0070661_100032075
864 Ga0070661_100034069
865 Ga0070661_100057044
866 Ga0070661_100079090
867 Ga0070661_100195080
868 Ga0070661_100196662
869 Ga0070661_100254996
870 Ga0070661_100367322
871 Ga0070661_101105012
872 Ga0070692_10000634
873 Ga0070692_10034759
874 Ga0070692_10088526
875 Ga0070668_100158035
876 Ga0070668_100889277
877 Ga0070668_101013752
878 Ga0070669_100030645
879 Ga0070669_100254437
880 Ga0070675_100262153
881 Ga0070675_101041694
882 Ga0070671_100004664
883 Ga0070671_100026451
884 Ga0070671_100078632
885 Ga0070671_100087011
886 Ga0070671_100472873
887 Ga0070671_100481191
888 Ga0070671_100533226
889 Ga0070671_100989928
890 Ga0070674_100052929
891 Ga0070674_100055057
892 Ga0070674_100224164
893 Ga0070674_101096267
894 Ga0070673_100000926
895 Ga0070673_100079300
896 Ga0070673_100127052
897 Ga0070673_100283407
898 Ga0070673_101353596
899 Ga0070659_100005736
900 Ga0070659_100011188
901 Ga0070659_100060699
902 Ga0070659_100062473
903 Ga0070659_100065418
904 Ga0070659_100106568
905 Ga0070659_100232863
906 Ga0070659_100641647
907 Ga0070659_100819586
908 Ga0070667_100011845
909 Ga0070667_100017139
910 Ga0070667_100196364
911 Ga0070667_100227671
912 Ga0070667_100258449
913 Ga0070667_100582862
914 Ga0070667_100954781
915 Ga0070667_100970341
916 Ga0070714_100015883
917 Ga0070714_100039028
918 Ga0070714_100338882
919 Ga0070713_100017382
920 Ga0070713_100068158
921 Ga0070700_100529307
922 Ga0070694_100176110
923 Ga0070694_101532925
924 Ga0070663_100012165
925 Ga0070663_100052164
926 Ga0070663_100054532
927 Ga0070663_100066590
928 Ga0070663_100081296
929 Ga0070663_100117282
930 Ga0070663_100172097
931 Ga0070663_100203045
932 Ga0070663_100266804
933 Ga0070663_100664760
934 Ga0070663_100824813
935 Ga0070678_100001329
936 Ga0070678_100175895
937 Ga0070678_101153377
938 Ga0070662_100005390
939 Ga0070662_100006946
940 Ga0070662_100014487
941 Ga0070662_100033294
942 Ga0070662_100194865
943 Ga0070662_100217309
944 Ga0070662_100274115
945 Ga0070681_10065926
946 Ga0070681_10363437
947 Ga0070681_10379651
948 Ga0068867_100033924
949 Ga0068867_100076590
950 Ga0068867_100632153
951 Ga0070679_100053451
952 Ga0070679_100124892
953 Ga0070679_100236739
954 Ga0070684_100004530
955 Ga0070684_100064576
956 Ga0070684_100582185
957 Ga0068853_100010256
958 Ga0068853_100203640
959 Ga0068853_100215213
960 Ga0068853_100282804
961 Ga0068853_100541777
962 Ga0068853_100571229
963 Ga0070672_100014660
964 Ga0070672_100037200
965 Ga0070672_100129350
966 Ga0070672_100199144
967 Ga0070672_100224599
968 Ga0070672_100292338
969 Ga0070672_100387098
970 Ga0070696_100047252
971 Ga0070696_100138452
972 Ga0070696_101107908
973 Ga0070693_100104964
974 Ga0070693_100191247
975 Ga0070665_100028754
976 Ga0070665_100036456
977 Ga0070665_100075680
978 Ga0070704_100185711
979 Ga0070704_100240066
980 Ga0068855_100066751
981 Ga0068855_100102125
982 Ga0068855_100207228
983 Ga0068855_100293680
984 Ga0068855_100432641
985 Ga0068855_100464416
986 Ga0070664_100001286
987 Ga0070664_100009829
988 Ga0070664_100017282
989 Ga0070664_100033663
990 Ga0070664_100049442
991 Ga0070664_100095146
992 Ga0070664_100389926
993 Ga0070664_100514338
994 Ga0068857_100006326
995 Ga0068857_100007836
996 Ga0068857_100037394
997 Ga0068857_100051415
998 Ga0068857_100111399
999 Ga0068857_100123491
1000 Ga0068857_101162719
1001 Ga0068854_100001118
1002 Ga0068854_100009999
1003 Ga0068854_100023362
1004 Ga0068854_100024552
1005 Ga0068854_100026484
1006 Ga0068854_100131356
1007 Ga0068854_100207150
1008 Ga0068854_100251710
1009 Ga0068854_100394567
1010 Ga0068856_100031852
1011 Ga0068856_100091268
1012 Ga0068856_100234055
1013 Ga0068856_100342456
1014 Ga0068856_100352002
1015 Ga0070702_100676652
1016 Ga0068852_100008667
1017 Ga0068852_100025552
1018 Ga0068852_100034932
1019 Ga0068852_100130502
1020 Ga0068852_100211350
1021 Ga0068852_100328024
1022 Ga0068852_100752266
1023 Ga0068859_100015279
1024 Ga0068859_100021834
1025 Ga0068859_100070180
1026 Ga0068864_100011788
1027 Ga0068864_100273485
1028 Ga0068864_101068286
1029 Ga0068866_10013552
1030 Ga0068861_100317955
1031 Ga0068851_10033810
1032 Ga0068851_10039267
1033 Ga0068851_10054487
1034 Ga0068851_10134240
1035 Ga0068851_10282698
1036 Ga0068870_10370195
1037 Ga0068863_100003907
1038 Ga0068863_100005757
1039 Ga0068863_100006405
1040 Ga0068863_100054689
1041 Ga0068863_100097662
1042 Ga0068863_100196180
1043 Ga0068863_100625188
1044 Ga0068858_100001843
1045 Ga0068858_100012453
1046 Ga0068858_100013136
1047 Ga0068858_100071827
1048 Ga0068858_100309773
1049 Ga0068860_100093853
1050 Ga0068860_100325321
1051 Ga0068860_100404181
1052 Ga0068860_100595651
1053 Ga0068860_100742479
1054 Ga0068862_100004223
1055 Ga0068862_100029595
1056 Ga0068862_100177085
1057 Ga0068862_101589778
1058 Ga0081539_10106616
1059 Ga0070717_10002637
1060 Ga0075364_10280287
1061 Ga0075362_10047851
1062 Ga0097621_101198478
1063 Ga0068871_100007948
1064 Ga0075431_100298462
1065 Ga0075433_10488172
1066 Ga0075434_101236031
1067 Ga0075429_100530969
1068 Ga0068865_100007601
1069 Ga0068865_100173207
1070 Ga0097620_100015280
1071 Ga0097620_100021834
1072 Ga0097620_100070177
1073 Ga0075435_100708869
1074 Ga0105251_10047171
1075 Ga0105240_10020539
1076 Ga0105240_10083562
1077 Ga0105245_10103200
1078 Ga0105245_10117506
1079 Ga0105243_10450900
1080 Ga0105243_11425173
1081 Ga0105241_10236030
1082 Ga0105241_10557014
1083 Ga0105241_11615110
1084 Ga0105242_10014871
1085 Ga0105242_11189626
1086 Ga0105248_10004287
1087 Ga0105248_10013575
1088 Ga0105248_10018937
1089 Ga0105248_10155845
1090 Ga0105237_10080319
1091 Ga0105237_10259451
1092 Ga0105237_10295713
1093 Ga0105238_10001777
1094 Ga0105238_10067539
1095 Ga0105249_10044682
1096 Ga0105239_10017564
1097 Ga0105239_10273085
1098 Ga0105239_11211208
1099 Ga0105246_10044754
1100 Ga0105246_10069027
1101 Ga0105246_10146826
1102 Ga0105246_10465213
1103 Ga0157373_10024225
1104 Ga0157373_10045835
1105 Ga0157373_10055210
1106 Ga0157373_10110649
1107 Ga0157373_10113400
1108 Ga0157373_10123975
1109 Ga0157373_10209967
1110 Ga0157371_10037493
1111 Ga0157371_10173352
1112 Ga0157371_10190994
1113 Ga0157371_10300054
1114 Ga0157371_10361754
1115 Ga0157371_10374780
1116 Ga0157371_10863906
1117 Ga0157370_10062554
1118 Ga0157370_10080344
1119 Ga0157370_10112423
1120 Ga0157370_10230096
1121 Ga0157369_10000833
1122 Ga0157369_10189093
1123 Ga0157369_10292093
1124 Ga0157369_10806245
1125 Ga0157374_10008630
1126 Ga0157374_10016812
1127 Ga0157374_10064549
1128 Ga0157374_10067792
1129 Ga0157378_10065737
1130 Ga0157378_10314643
1131 Ga0157378_10612022
1132 Ga0157378_10701991
1133 Ga0163162_10004777
1134 Ga0163162_10145799
1135 Ga0163162_10249438
1136 Ga0163162_10616085
1137 Ga0157372_10047682
1138 Ga0157372_10092941
1139 Ga0157372_10123957
1140 Ga0157372_10672669
1141 Ga0157372_11142391
1142 Ga0157375_10020923
1143 Ga0157375_10365636
1144 Ga0157375_10516280
1145 Ga0157375_12012880
1146 Ga0163163_10079069
1147 Ga0163163_10231131
1148 Ga0157380_10661534
1149 Ga0182008_10052336
1150 Ga0157377_10037735
1151 Ga0157379_10055020
1152 Ga0157379_10303899
1153 Ga0157379_10422582
1154 Ga0206356_10637938
1155 Ga0206353_11358299
1156 Ga0213876_10010057
1157 Ga0207656_10154281
1158 Ga0207656_10201752
1159 Ga0207656_10470951
1160 Ga0207713_1089173
1161 Ga0207642_10011945
1162 Ga0207688_10190355
1163 Ga0207680_10002057
1164 Ga0207647_10000870
1165 Ga0207647_10001330
1166 Ga0207647_10003089
1167 Ga0207647_10174755
1168 Ga0207647_10445598
1169 Ga0207645_10010703
1170 Ga0207645_10151177
1171 Ga0207645_10193804
1172 Ga0207645_10212162
1173 Ga0207643_10224444
1174 Ga0207705_10003226
1175 Ga0207705_10003689
1176 Ga0207705_10011705
1177 Ga0207705_10018529
1178 Ga0207705_10046545
1179 Ga0207705_10063224
1180 Ga0207705_10327272
1181 Ga0207705_10627161
1182 Ga0207684_10638906
1183 Ga0207654_10112925
1184 Ga0207654_10626896
1185 Ga0207654_10695368
1186 Ga0207707_10153461
1187 Ga0207707_10304875
1188 Ga0207695_10002617
1189 Ga0207695_10006568
1190 Ga0207671_10073174
1191 Ga0207671_10636422
1192 Ga0207660_10111041
1193 Ga0207660_10113532
1194 Ga0207660_10962925
1195 Ga0207662_10222543
1196 Ga0207662_10274512
1197 Ga0207657_10000948
1198 Ga0207657_10001484
1199 Ga0207657_10003972
1200 Ga0207657_10006930
1201 Ga0207657_10028098
1202 Ga0207657_10028283
1203 Ga0207657_10029043
1204 Ga0207657_10209176
1205 Ga0207649_10001955
1206 Ga0207649_10017843
1207 Ga0207649_10033899
1208 Ga0207649_10044606
1209 Ga0207649_10107815
1210 Ga0207649_10225054
1211 Ga0207649_10333985
1212 Ga0207649_10349977
1213 Ga0207649_10649197
1214 Ga0207649_10725202
1215 Ga0207649_10767131
1216 Ga0207652_10011945
1217 Ga0207652_10068366
1218 Ga0207652_10697098
1219 Ga0207681_10060507
1220 Ga0207681_10199981
1221 Ga0207694_10019958
1222 Ga0207694_10033574
1223 Ga0207650_10002248
1224 Ga0207650_10016428
1225 Ga0207650_10026182
1226 Ga0207650_10052487
1227 Ga0207650_10089232
1228 Ga0207650_10232884
1229 Ga0207650_10952048
1230 Ga0207659_10238799
1231 Ga0207687_10015992
1232 Ga0207687_10396321
1233 Ga0207700_10092732
1234 Ga0207700_10235262
1235 Ga0207664_10361317
1236 Ga0207644_10000389
1237 Ga0207644_10004266
1238 Ga0207644_10020160
1239 Ga0207644_10032143
1240 Ga0207644_10040467
1241 Ga0207644_10536677
1242 Ga0207690_10011623
1243 Ga0207690_10011829
1244 Ga0207690_10012127
1245 Ga0207690_10044464
1246 Ga0207690_10058017
1247 Ga0207690_10066720
1248 Ga0207690_10079586
1249 Ga0207690_10098607
1250 Ga0207690_10227317
1251 Ga0207690_10504156
1252 Ga0207706_10007703
1253 Ga0207706_10011097
1254 Ga0207706_10013591
1255 Ga0207706_10014348
1256 Ga0207706_10014981
1257 Ga0207706_10019402
1258 Ga0207706_10020422
1259 Ga0207706_10024186
1260 Ga0207706_10041571
1261 Ga0207706_10169869
1262 Ga0207706_10249762
1263 Ga0207686_10060469
1264 Ga0207709_10050417
1265 Ga0207670_10706849
1266 Ga0207670_11031684
1267 Ga0207669_10094071
1268 Ga0207669_10105280
1269 Ga0207669_10244828
1270 Ga0207704_10016948
1271 Ga0207704_10252502
1272 Ga0207691_10003366
1273 Ga0207691_10062306
1274 Ga0207691_10089871
1275 Ga0207691_10233122
1276 Ga0207691_10256567
1277 Ga0207711_10004428
1278 Ga0207711_10006372
1279 Ga0207711_10017997
1280 Ga0207689_10016255
1281 Ga0207661_10002284
1282 Ga0207661_10045480
1283 Ga0207661_10081791
1284 Ga0207661_11274547
1285 Ga0207679_10015487
1286 Ga0207679_10186120
1287 Ga0207679_10447103
1288 Ga0207679_10563680
1289 Ga0207679_10921549
1290 Ga0207667_10018328
1291 Ga0207667_10055383
1292 Ga0207667_10067280
1293 Ga0207667_10071481
1294 Ga0207667_10309867
1295 Ga0207667_10331404
1296 Ga0207667_10773957
1297 Ga0207651_10074802
1298 Ga0207651_10178186
1299 Ga0207651_10743966
1300 Ga0207651_10844554
1301 Ga0207651_11665787
1302 Ga0207712_10001687
1303 Ga0207668_10083008
1304 Ga0207668_10117791
1305 Ga0207668_11284270
1306 Ga0207640_10000777
1307 Ga0207640_10003847
1308 Ga0207640_10014953
1309 Ga0207640_10018888
1310 Ga0207640_10047173
1311 Ga0207640_10075668
1312 Ga0207640_10134534
1313 Ga0207640_10707330
1314 Ga0207640_10828784
1315 Ga0207658_10004794
1316 Ga0207658_10006661
1317 Ga0207658_10033185
1318 Ga0207658_10101826
1319 Ga0207658_10504650
1320 Ga0207658_11165265
1321 Ga0207677_10013595
1322 Ga0207677_10029288
1323 Ga0207677_10141809
1324 Ga0207703_10002629
1325 Ga0207703_10011863
1326 Ga0207703_10103744
1327 Ga0207703_10166572
1328 Ga0207703_10756080
1329 Ga0207639_10033890
1330 Ga0207639_10062616
1331 Ga0207639_10062997
1332 Ga0207639_10136736
1333 Ga0207639_10297875
1334 Ga0207639_10902967
1335 Ga0207678_10000587
1336 Ga0207678_10000938
1337 Ga0207678_10004050
1338 Ga0207678_10004806
1339 Ga0207678_10006051
1340 Ga0207678_10007492
1341 Ga0207678_10056515
1342 Ga0207678_10059157
1343 Ga0207678_10105718
1344 Ga0207678_10229885
1345 Ga0207678_10543291
1346 Ga0207678_10887628
1347 Ga0207708_10262753
1348 Ga0207702_10012460
1349 Ga0207702_10125158
1350 Ga0207702_10126249
1351 Ga0207702_10664075
1352 Ga0207641_10015072
1353 Ga0207641_10021784
1354 Ga0207641_10022606
1355 Ga0207641_10037366
1356 Ga0207641_10214821
1357 Ga0207641_10241491
1358 Ga0207641_10348163
1359 Ga0207641_10721953
1360 Ga0207641_10820305
1361 Ga0207648_10072288
1362 Ga0207648_10118705
1363 Ga0207648_10157291
1364 Ga0207648_10500686
1365 Ga0207676_10034030
1366 Ga0207676_10035649
1367 Ga0207676_10237333
1368 Ga0207676_10239920
1369 Ga0207676_11426199
1370 Ga0207676_12203533
1371 Ga0207674_10001057
1372 Ga0207674_10001488
1373 Ga0207674_10001949
1374 Ga0207674_10001996
1375 Ga0207674_10007062
1376 Ga0207674_10034351
1377 Ga0207674_10163880
1378 Ga0207675_100965097
1379 Ga0207683_10000808
1380 Ga0207683_10054815
1381 Ga0207683_10275839
1382 Ga0207683_11385980
1383 Ga0207698_10016399
1384 Ga0207698_10039092
1385 Ga0207698_10181404
1386 Ga0207698_10297746
1387 Ga0207698_10695654
1388 Ga0207698_11210918
1389 Ga0268266_10038507
1390 Ga0268266_10042731
1391 Ga0268266_10095945
1392 Ga0268266_10735433
1393 Ga0268266_11510284
1394 Ga0268266_11521401
1395 Ga0268265_10002914
1396 Ga0268265_10025904
1397 Ga0268265_10059583
1398 Ga0268265_10121376
1399 Ga0268264_10002210
1400 Ga0268264_10011121
1401 Ga0268264_10345545
1402 Ga0268264_10983687
1403 Ga0268264_10998722
1404 Ga0307408_101181048
1405 Ga0307405_10003393
1406 Ga0307405_10160424
1407 Ga0307405_11160872
1408 Ga0307413_10022018
1409 Ga0307410_10974401
1410 Ga0307410_11376575
1411 Ga0307406_10032217
1412 Ga0307407_10216980
1413 Ga0307409_100331393
1414 Ga0307416_100625342
1415 Ga0307414_10054367
1416 Ga0307414_10424679
1417 Ga0307414_10506880
1418 Ga0307411_10457318
1419 Ga0307411_10669114
1420 Ga0307411_10928302
1421 Ga0307411_10972440
1422 Ga0307415_100013852
1423 Ga0307415_100158270
1424 Ga0307415_100245304
1425 Ga0307415_100440801
1426 Ga0373962_0269948
1427 Ga0373931_0377763
1428 Ga0395899_0002090
1429 Ga0395899_0003823
1430 Ga0395899_0019556
1431 Ga0395899_0023532
1432 Ga0395899_0142326
1433 Ga0395899_0144302
1434 Ga0395899_0205852
1435 Ga0395899_0220911
1436 Ga0395899_0350727
1437 Ga0395899_0375999
1438 Ga0395899_0467264
1439 Ga0395900_0002298
1440 Ga0395900_0004149
1441 Ga0395900_0005898
1442 Ga0395900_0014084
1443 Ga0395900_0042328
1444 Ga0395900_0042528
1445 Ga0395900_0048017
1446 Ga0395900_0053595
1447 Ga0395900_0088201
1448 Ga0395900_0110675
1449 Ga0395900_0145916
1450 Ga0395900_0191743
1451 Ga0395900_0220775
1452 Ga0395900_0400595
1453 Ga0395900_0509849
1454 Ga0395898_0008615
1455 Ga0395898_0012526
1456 Ga0395898_0017336
1457 Ga0395898_0020036
1458 Ga0395898_0030490
1459 Ga0395898_0120515
1460 Ga0395898_0309090
1461 Ga0395898_0385458
1462 Ga0395905_0000193
1463 Ga0395905_0003425
1464 Ga0395905_0003572
1465 Ga0395905_0004969
1466 Ga0395905_0005518
1467 Ga0395905_0014176
1468 Ga0395905_0015296
1469 Ga0395905_0017911
1470 Ga0395905_0025850
1471 Ga0395905_0027553
1472 Ga0395905_0028572
1473 Ga0395905_0032893
1474 Ga0395905_0048825
1475 Ga0395905_0068616
1476 Ga0395905_0069533
1477 Ga0395905_0077523
1478 Ga0395905_0090223
1479 Ga0395905_0185565
1480 Ga0395905_0210788
1481 Ga0395905_0230331
1482 Ga0395905_0278470
1483 Ga0395905_0347611
1484 Ga0395905_0831566
1485 Ga0395905_0925881
1486 Ga0395905_1340590
1487 Ga0395901_0002827
1488 Ga0395901_0004785
1489 Ga0395901_0009620
1490 Ga0395901_0011981
1491 Ga0395901_0042090
1492 Ga0395901_0042248
1493 Ga0395901_0056346
1494 Ga0395901_0070159
1495 Ga0395901_0085100
1496 Ga0395901_0095988
1497 Ga0395901_0134157
1498 Ga0395901_0169409
1499 Ga0395901_0230704
1500 Ga0395901_1081170
1501 Ga0395901_1411154
1502 Ga0436365_0099116
1503 Ga0439438_118473
1504 Ga0439439_0123786
1505 Ga0450903_026079
1506 Ga0450905_053993
1507 Ga0450889_000011
1508 Ga0439458_0000238
1509 Ga0439458_0008595
1510 Ga0439434_0153356
1511 Ga0439464_0000629
1512 Ga0466969_0001948
1513 Ga0466969_0052191
1514 Ga0466966_0001379
1515 Ga0466966_0034950
1516 Ga0466966_0407509
1517 Ga0466961_0014622
1518 Ga0466961_0048058
1519 Ga0466961_0110513
1520 Ga0466961_0384887
1521 Ga0466963_0037852
1522 Ga0466963_0058443
1523 Ga0466963_0143370
1524 Ga0466963_0187258
1525 Ga0466963_1281220
1526 Ga0466964_0057887
1527 Ga0466971_0007503
1528 Ga0466968_0011238
1529 Ga0466970_0001479
1530 Ga0466970_0410330
1531 Ga0466957_0000606
1532 Ga0466957_0091508
1533 Ga0466957_0404679
1534 Ga0466960_0130218
1535 Ga0466959_0005424
1536 Ga0466959_0055065
1537 Ga0466959_0219779
1538 Ga0466958_0003340
1539 Ga0466958_0024911
1540 Ga0466958_0100088
1541 Ga0466967_0144631
1542 Ga0466967_0234507
1543 Ga0495580_0581863
1544 Ga0495669_0152793
1545 Ga0495669_0309895
1546 Ga0495669_0338926
1547 Ga0495677_0043561
1548 Ga0495677_0168359
1549 Ga0496100_0589218
1550 Ga0496101_0366956
1551 Ga0496101_0835779
1552 Ga0496102_0186991
1553 Ga0496102_0449275
1554 Ga0496103_0040746
1555 Ga0496105_0548839
1556 Ga0496106_0333824
1557 Ga0496106_0370205
1558 Ga0496107_0022023
1559 Ga0496107_0036987
1560 Ga0496107_0155379
1561 Ga0496107_0478852
1562 Ga0496108_0009566
1563 Ga0496108_0011991
1564 Ga0496108_0034394
1565 Ga0496108_0036687
1566 Ga0496109_0004600
1567 Ga0496109_0013490
1568 Ga0496109_0037034
1569 Ga0496109_0413594
1570 Ga0496109_1028500
1571 Ga0496110_0030560
1572 Ga0496110_0102139
1573 Ga0496110_0463613
1574 Ga0496111_0033148
1575 Ga0496111_0321781
1576 Ga0496112_0021605
1577 Ga0496112_0098429
1578 Ga0496112_0144434
1579 Ga0496112_0846067
1580 Ga0496112_1568613
1581 Ga0496113_0124683
1582 Ga0496113_0227350
1583 Ga0496114_1583134
1584 Ga0501068_0088516
1585 Ga0501069_0156594
1586 nmdc:mga03683_188433_c1
1587 nmdc:mga00v17_274139_c1
1588 nmdc:mga09592_219256_c1
1589 nmdc:mga0n895_183268_c1
1590 nmdc:mga08x19_1008302_c1
1591 nmdc:mga0a205_186702_c1
1592 nmdc:mga0a205_612691_c1
1593 Ga0466962_0003924
1594 Ga0466962_0066371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

36

146

0.85

Map