F481213

General Info

Members Datasets Scaffolds Average Seq Length
796 284 1592 85

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0096588|Ga0501041_0096588_176_484
Length 102
Sequence VLGVRNQVPNFWCGTSVVNLPEQPPTFRQPTAAERPWSWRLEDASGAEVDVPAEYAGRRFASQADAESWVGEIWSDLLEFGVDAVTLLEADRVVYGPMSLHA

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2643221615 Nocardioides sp. Root224 Isolate Unclassified
282 2643221641 Nocardioides sp. Root122 Isolate Unclassified
283 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
284 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.13
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.82
Nodule 0
Rhizoplane 9.67
Rhizosphere 71.98
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0096588 3300049577 Bacteria 1827
2 LJQas_1003651 3300000549 Bacteria 2044
3 JGI24735J21928_10027864 3300002067 Bacteria 1690
4 Ga0070658_10013519 3300005327 Bacteria 6550
5 Ga0070658_10044764 3300005327 Bacteria 3577
6 Ga0070683_100002255 3300005329 Bacteria 15294
7 Ga0070683_100140380 3300005329 Bacteria 2289
8 Ga0070683_101289698 3300005329 Bacteria 702
9 Ga0070683_102165769 3300005329 Bacteria 534
10 Ga0070690_100880969 3300005330 Bacteria 699
11 Ga0068869_101293151 3300005334 Bacteria 643
12 Ga0070680_100265674 3300005336 Bacteria 1452
13 Ga0070682_100006917 3300005337 Bacteria 6380
14 Ga0070682_100287669 3300005337 Bacteria 1201
15 Ga0070682_100671852 3300005337 Bacteria 827
16 Ga0068868_100236428 3300005338 Bacteria 1534
17 Ga0068868_100761635 3300005338 Bacteria 871
18 Ga0068868_101521437 3300005338 Bacteria 627
19 Ga0070660_100029050 3300005339 Bacteria 4141
20 Ga0070660_100990684 3300005339 Bacteria 710
21 Ga0070689_100261805 3300005340 Bacteria 1430
22 Ga0070687_100465034 3300005343 Bacteria 844
23 Ga0070661_100257926 3300005344 Bacteria 1347
24 Ga0070661_101343980 3300005344 Bacteria 600
25 Ga0070692_10035964 3300005345 Bacteria 2511
26 Ga0070692_10154660 3300005345 Bacteria 1309
27 Ga0070668_100170958 3300005347 Bacteria 1769
28 Ga0070668_100379073 3300005347 Bacteria 1203
29 Ga0070669_100868796 3300005353 Bacteria 769
30 Ga0070675_100851979 3300005354 Bacteria 834
31 Ga0070671_101450382 3300005355 Bacteria 607
32 Ga0070674_100362404 3300005356 Bacteria 1174
33 Ga0070659_100013286 3300005366 Bacteria 6125
34 Ga0070659_101580654 3300005366 Bacteria 585
35 Ga0070659_102015489 3300005366 Bacteria 518
36 Ga0070667_100052315 3300005367 Bacteria 3446
37 Ga0070667_100124421 3300005367 Bacteria 2246
38 Ga0070667_100676439 3300005367 Bacteria 954
39 Ga0070667_102090860 3300005367 Bacteria 533
40 Ga0070701_10034960 3300005438 Bacteria 2521
41 Ga0070701_10536418 3300005438 Bacteria 765
42 Ga0070701_10981655 3300005438 Bacteria 588
43 Ga0070705_100093517 3300005440 Bacteria 1880
44 Ga0070700_100044264 3300005441 Bacteria 2741
45 Ga0070663_100151406 3300005455 Bacteria 1779
46 Ga0070678_100230921 3300005456 Bacteria 1542
47 Ga0070681_10314791 3300005458 Bacteria 1474
48 Ga0070681_10676534 3300005458 Bacteria 947
49 Ga0070681_10908122 3300005458 Unclassified 799
50 Ga0068867_100119085 3300005459 Bacteria 2038
51 Ga0068867_100410904 3300005459 Bacteria 1144
52 Ga0068867_101007201 3300005459 Bacteria 756
53 Ga0068867_102141650 3300005459 Bacteria 530
54 Ga0070685_10961469 3300005466 Bacteria 639
55 Ga0070685_11133439 3300005466 Bacteria 592
56 Ga0070679_100011544 3300005530 Bacteria 8421
57 Ga0070684_100000717 3300005535 Bacteria 22926
58 Ga0070684_100949790 3300005535 Bacteria 806
59 Ga0070684_101040359 3300005535 Bacteria 769
60 Ga0070684_102144428 3300005535 Bacteria 527
61 Ga0068853_100255320 3300005539 Bacteria 1610
62 Ga0068853_101558109 3300005539 Bacteria 640
63 Ga0070672_100273473 3300005543 Bacteria 1427
64 Ga0070672_100454720 3300005543 Bacteria 1103
65 Ga0070686_100420033 3300005544 Bacteria 1021
66 Ga0070686_100776694 3300005544 Bacteria 770
67 Ga0070686_101574966 3300005544 Bacteria 555
68 Ga0070686_101917519 3300005544 Bacteria 506
69 Ga0070665_100011527 3300005548 Bacteria 8938
70 Ga0070665_102208410 3300005548 Bacteria 554
71 Ga0068855_100042108 3300005563 Bacteria 5412
72 Ga0068855_100714646 3300005563 Bacteria 1071
73 Ga0070664_100664592 3300005564 Bacteria 969
74 Ga0070664_100854217 3300005564 Bacteria 852
75 Ga0070664_102253531 3300005564 Bacteria 517
76 Ga0068857_100005784 3300005577 Bacteria 10570
77 Ga0068857_100109934 3300005577 Bacteria 2477
78 Ga0068857_100285747 3300005577 Bacteria 1518
79 Ga0068857_101192537 3300005577 Bacteria 737
80 Ga0068854_101110524 3300005578 Bacteria 705
81 Ga0068854_101574930 3300005578 Bacteria 598
82 Ga0068856_100024612 3300005614 Bacteria 5861
83 Ga0068856_101611528 3300005614 Bacteria 662
84 Ga0068856_101938275 3300005614 Bacteria 600
85 Ga0070702_100134563 3300005615 Bacteria 1566
86 Ga0068852_100536122 3300005616 Bacteria 1169
87 Ga0068852_100610270 3300005616 Bacteria 1096
88 Ga0068852_100897709 3300005616 Bacteria 903
89 Ga0068859_102911540 3300005617 Bacteria 524
90 Ga0068864_100054798 3300005618 Bacteria 3442
91 Ga0068864_101044291 3300005618 Bacteria 812
92 Ga0068866_10567446 3300005718 Bacteria 761
93 Ga0068861_100249653 3300005719 Bacteria 1513
94 Ga0068861_100432084 3300005719 Bacteria 1176
95 Ga0068861_101431195 3300005719 Bacteria 676
96 Ga0068870_10303642 3300005840 Bacteria 1008
97 Ga0068870_10342319 3300005840 Bacteria 957
98 Ga0068870_10989663 3300005840 Bacteria 599
99 Ga0068863_100137003 3300005841 Bacteria 2339
100 Ga0068858_100480468 3300005842 Bacteria 1199
101 Ga0068860_100000321 3300005843 Bacteria 65077
102 Ga0068860_100112850 3300005843 Bacteria 2598
103 Ga0068860_100627413 3300005843 Bacteria 1082
104 Ga0068860_100631307 3300005843 Bacteria 1078
105 Ga0081539_10026890 3300005985 Bacteria 3657
106 Ga0075365_10004600 3300006038 Bacteria 7340
107 Ga0075365_10005485 3300006038 Bacteria 6845
108 Ga0075365_10010873 3300006038 Bacteria 5327
109 Ga0075365_10022323 3300006038 Bacteria 3964
110 Ga0075365_10037108 3300006038 Bacteria 3162
111 Ga0075365_10056009 3300006038 Bacteria 2620
112 Ga0075365_10059219 3300006038 Bacteria 2552
113 Ga0075365_10062917 3300006038 Bacteria 2483
114 Ga0075365_10076156 3300006038 Bacteria 2265
115 Ga0075365_10106529 3300006038 Bacteria 1924
116 Ga0075365_10126538 3300006038 Bacteria 1766
117 Ga0075365_10157297 3300006038 Bacteria 1582
118 Ga0075365_10179621 3300006038 Bacteria 1479
119 Ga0075365_10197259 3300006038 Bacteria 1410
120 Ga0075365_10239173 3300006038 Bacteria 1275
121 Ga0075365_10300487 3300006038 Bacteria 1130
122 Ga0075365_10377537 3300006038 Bacteria 1000
123 Ga0075365_10545021 3300006038 Bacteria 820
124 Ga0075365_10562113 3300006038 Bacteria 807
125 Ga0075365_10696190 3300006038 Bacteria 718
126 Ga0075365_10725355 3300006038 Bacteria 702
127 Ga0075365_10727438 3300006038 Bacteria 701
128 Ga0075365_11110800 3300006038 Bacteria 557
129 Ga0075368_10005534 3300006042 Bacteria 4352
130 Ga0075368_10014810 3300006042 Bacteria 2885
131 Ga0075368_10027182 3300006042 Bacteria 2205
132 Ga0075368_10168710 3300006042 Bacteria 919
133 Ga0075368_10250880 3300006042 Bacteria 756
134 Ga0075368_10282183 3300006042 Bacteria 714
135 Ga0075368_10406866 3300006042 Bacteria 598
136 Ga0075363_100002471 3300006048 Bacteria 7560
137 Ga0075363_100008893 3300006048 Bacteria 4699
138 Ga0075363_100024129 3300006048 Bacteria 3089
139 Ga0075363_100115249 3300006048 Bacteria 1496
140 Ga0075363_100226652 3300006048 Bacteria 1072
141 Ga0075363_100344349 3300006048 Bacteria 870
142 Ga0075363_100403443 3300006048 Bacteria 803
143 Ga0075363_100634269 3300006048 Bacteria 642
144 Ga0075364_10007665 3300006051 Bacteria 6420
145 Ga0075364_10047755 3300006051 Bacteria 2789
146 Ga0075364_10111109 3300006051 Bacteria 1829
147 Ga0075364_10119720 3300006051 Bacteria 1762
148 Ga0075364_10195073 3300006051 Bacteria 1372
149 Ga0075364_10197492 3300006051 Bacteria 1363
150 Ga0075364_10279194 3300006051 Bacteria 1136
151 Ga0075364_10314056 3300006051 Bacteria 1067
152 Ga0075364_10355531 3300006051 Bacteria 998
153 Ga0075364_10458778 3300006051 Bacteria 871
154 Ga0075362_10090711 3300006177 Bacteria 1418
155 Ga0075362_10198891 3300006177 Bacteria 975
156 Ga0075367_10006764 3300006178 Bacteria 5821
157 Ga0075367_10033184 3300006178 Bacteria 2974
158 Ga0075367_10181328 3300006178 Bacteria 1313
159 Ga0075367_10183253 3300006178 Bacteria 1306
160 Ga0075367_10514677 3300006178 Bacteria 759
161 Ga0075369_10440557 3300006186 Bacteria 616
162 Ga0097621_100979805 3300006237 Bacteria 790
163 Ga0075370_10029370 3300006353 Bacteria 3063
164 Ga0075370_10089978 3300006353 Bacteria 1770
165 Ga0075370_10374277 3300006353 Bacteria 853
166 Ga0075370_10436399 3300006353 Bacteria 787
167 Ga0075370_10731109 3300006353 Bacteria 602
168 Ga0075370_10941120 3300006353 Bacteria 529
169 Ga0068871_100470729 3300006358 Bacteria 1129
170 Ga0068871_101626689 3300006358 Bacteria 612
171 Ga0068865_100241600 3300006881 Bacteria 1421
172 Ga0068865_100727831 3300006881 Bacteria 850
173 Ga0068865_101213318 3300006881 Bacteria 668
174 Ga0068865_101674866 3300006881 Bacteria 573
175 Ga0105250_10191135 3300009092 Bacteria 861
176 Ga0111539_10418692 3300009094 Bacteria 1560
177 Ga0111539_11705866 3300009094 Bacteria 730
178 Ga0105245_10002720 3300009098 Bacteria 15913
179 Ga0105245_10186844 3300009098 Bacteria 1983
180 Ga0105245_10349756 3300009098 Bacteria 1464
181 Ga0105245_10822692 3300009098 Bacteria 968
182 Ga0105245_12433734 3300009098 Bacteria 577
183 Ga0105245_12947782 3300009098 Bacteria 527
184 Ga0105243_10091760 3300009148 Bacteria 2502
185 Ga0105243_10680813 3300009148 Bacteria 1000
186 Ga0105243_10708228 3300009148 Bacteria 982
187 Ga0105243_10986973 3300009148 Bacteria 844
188 Ga0105243_11559309 3300009148 Bacteria 686
189 Ga0105243_11596535 3300009148 Bacteria 679
190 Ga0105242_10715522 3300009176 Bacteria 981
191 Ga0105242_11153537 3300009176 Bacteria 792
192 Ga0105248_10410509 3300009177 Bacteria 1525
193 Ga0105248_11405276 3300009177 Bacteria 790
194 Ga0105237_10087682 3300009545 Bacteria 3101
195 Ga0105238_10128429 3300009551 Bacteria 2513
196 Ga0105238_11820979 3300009551 Bacteria 641
197 Ga0105249_10009329 3300009553 Bacteria 8582
198 Ga0105249_10443275 3300009553 Bacteria 1336
199 Ga0105249_10898188 3300009553 Bacteria 953
200 Ga0105249_12107274 3300009553 Bacteria 637
201 Ga0105239_10001640 3300010375 Bacteria 29511
202 Ga0105239_11167804 3300010375 Bacteria 887
203 Ga0105239_13591978 3300010375 Bacteria 504
204 Ga0105246_10036535 3300011119 Bacteria 3292
205 Ga0105246_10039823 3300011119 Bacteria 3168
206 Ga0105246_12082967 3300011119 Bacteria 549
207 Ga0157371_10510521 3300013102 Bacteria 888
208 Ga0157371_11460920 3300013102 Bacteria 532
209 Ga0157370_11182413 3300013104 Bacteria 690
210 Ga0157369_10014875 3300013105 Bacteria 8782
211 Ga0157369_11346878 3300013105 Bacteria 727
212 Ga0157369_11671742 3300013105 Bacteria 647
213 Ga0157374_12582872 3300013296 Bacteria 535
214 Ga0163162_10073248 3300013306 Bacteria 3481
215 Ga0157372_10001329 3300013307 Bacteria 26726
216 Ga0157372_10798228 3300013307 Bacteria 1097
217 Ga0157372_10855966 3300013307 Bacteria 1055
218 Ga0157372_12449420 3300013307 Bacteria 599
219 Ga0157372_13213336 3300013307 Bacteria 521
220 Ga0157375_10008417 3300013308 Bacteria 9034
221 Ga0157375_10061774 3300013308 Bacteria 3721
222 Ga0157375_10316322 3300013308 Unclassified 1725
223 Ga0157375_10424062 3300013308 Bacteria 1496
224 Ga0157375_10655922 3300013308 Bacteria 1205
225 Ga0157375_11298066 3300013308 Bacteria 856
226 Ga0163163_10048078 3300014325 Bacteria 4194
227 Ga0163163_10064676 3300014325 Bacteria 3629
228 Ga0163163_10968689 3300014325 Bacteria 914
229 Ga0163163_11793413 3300014325 Bacteria 674
230 Ga0157380_10548608 3300014326 Bacteria 1133
231 Ga0157380_11211318 3300014326 Bacteria 799
232 Ga0157380_11459312 3300014326 Bacteria 736
233 Ga0182008_10339574 3300014497 Bacteria 794
234 Ga0157377_10407554 3300014745 Bacteria 928
235 Ga0157377_10906279 3300014745 Bacteria 660
236 Ga0157379_10107066 3300014968 Bacteria 2510
237 Ga0157376_12264385 3300014969 Bacteria 582
238 Ga0163161_10018148 3300017792 Bacteria 4932
239 Ga0163161_11318035 3300017792 Bacteria 628
240 Ga0206354_10746660 3300020081 Bacteria 609
241 Ga0207697_10520029 3300025315 Bacteria 525
242 Ga0207682_10180212 3300025893 Bacteria 965
243 Ga0207688_10052859 3300025901 Bacteria 2277
244 Ga0207688_10585632 3300025901 Bacteria 702
245 Ga0207647_10014204 3300025904 Bacteria 5496
246 Ga0207647_10096641 3300025904 Bacteria 1758
247 Ga0207705_10005068 3300025909 Bacteria 9876
248 Ga0207707_10453242 3300025912 Bacteria 1097
249 Ga0207671_10462242 3300025914 Bacteria 1011
250 Ga0207660_10168083 3300025917 Bacteria 1696
251 Ga0207662_10086910 3300025918 Bacteria 1917
252 Ga0207662_10451707 3300025918 Bacteria 879
253 Ga0207657_10175362 3300025919 Bacteria 1735
254 Ga0207657_10611025 3300025919 Bacteria 850
255 Ga0207694_10408458 3300025924 Bacteria 1130
256 Ga0207659_10765078 3300025926 Bacteria 829
257 Ga0207687_10006696 3300025927 Bacteria 7599
258 Ga0207687_10891272 3300025927 Bacteria 761
259 Ga0207687_11191107 3300025927 Bacteria 655
260 Ga0207690_10020024 3300025932 Bacteria 4128
261 Ga0207709_10062461 3300025935 Bacteria 2331
262 Ga0207709_10101499 3300025935 Bacteria 1903
263 Ga0207709_10350357 3300025935 Bacteria 1114
264 Ga0207709_10398664 3300025935 Bacteria 1051
265 Ga0207709_10473868 3300025935 Bacteria 972
266 Ga0207670_10318442 3300025936 Bacteria 1223
267 Ga0207669_10761806 3300025937 Bacteria 800
268 Ga0207704_10015793 3300025938 Bacteria 3860
269 Ga0207704_10501128 3300025938 Bacteria 979
270 Ga0207704_10644695 3300025938 Bacteria 872
271 Ga0207704_11284021 3300025938 Bacteria 626
272 Ga0207704_11767002 3300025938 Bacteria 532
273 Ga0207665_10806162 3300025939 Bacteria 742
274 Ga0207691_10038980 3300025940 Bacteria 4397
275 Ga0207711_11374129 3300025941 Bacteria 649
276 Ga0207711_11769882 3300025941 Bacteria 561
277 Ga0207689_10395082 3300025942 Bacteria 1152
278 Ga0207661_10036837 3300025944 Bacteria 3821
279 Ga0207661_10746560 3300025944 Bacteria 901
280 Ga0207661_11820146 3300025944 Bacteria 554
281 Ga0207679_10494272 3300025945 Bacteria 1091
282 Ga0207679_10743093 3300025945 Bacteria 892
283 Ga0207667_10091686 3300025949 Bacteria 3139
284 Ga0207712_10048659 3300025961 Bacteria 2950
285 Ga0207712_10939116 3300025961 Bacteria 766
286 Ga0207712_11161487 3300025961 Bacteria 688
287 Ga0207668_10629441 3300025972 Bacteria 937
288 Ga0207640_11005843 3300025981 Bacteria 734
289 Ga0207640_11414285 3300025981 Bacteria 623
290 Ga0207658_10042691 3300025986 Bacteria 3291
291 Ga0207658_10150706 3300025986 Bacteria 1894
292 Ga0207677_10332400 3300026023 Bacteria 1267
293 Ga0207677_10611226 3300026023 Bacteria 958
294 Ga0207677_10917202 3300026023 Bacteria 790
295 Ga0207703_10364140 3300026035 Bacteria 1334
296 Ga0207703_12103075 3300026035 Bacteria 541
297 Ga0207639_10119241 3300026041 Bacteria 2165
298 Ga0207639_11085155 3300026041 Bacteria 751
299 Ga0207639_12074540 3300026041 Bacteria 530
300 Ga0207678_10250434 3300026067 Bacteria 1517
301 Ga0207708_10048321 3300026075 Bacteria 3239
302 Ga0207708_11129099 3300026075 Bacteria 684
303 Ga0207702_10017835 3300026078 Bacteria 5876
304 Ga0207702_11445242 3300026078 Bacteria 681
305 Ga0207641_10040390 3300026088 Bacteria 3907
306 Ga0207641_11544742 3300026088 Bacteria 666
307 Ga0207648_10142786 3300026089 Bacteria 2111
308 Ga0207648_11213291 3300026089 Bacteria 709
309 Ga0207648_11258470 3300026089 Bacteria 695
310 Ga0207648_12233845 3300026089 Bacteria 508
311 Ga0207676_10009332 3300026095 Bacteria 6981
312 Ga0207676_10312323 3300026095 Bacteria 1440
313 Ga0207676_10922309 3300026095 Bacteria 858
314 Ga0207674_10008524 3300026116 Bacteria 11833
315 Ga0207675_100089824 3300026118 Bacteria 2888
316 Ga0207675_100122332 3300026118 Bacteria 2463
317 Ga0207675_100297973 3300026118 Bacteria 1570
318 Ga0207675_100937694 3300026118 Bacteria 883
319 Ga0207683_10184590 3300026121 Bacteria 1892
320 Ga0207683_10659786 3300026121 Bacteria 969
321 Ga0207698_10547027 3300026142 Bacteria 1134
322 Ga0207698_10608911 3300026142 Bacteria 1078
323 Ga0209813_10125795 3300027866 Bacteria 897
324 Ga0209813_10281103 3300027866 Bacteria 641
325 Ga0207428_10916709 3300027907 Bacteria 618
326 Ga0268266_10002415 3300028379 Bacteria 20121
327 Ga0268266_10391731 3300028379 Bacteria 1312
328 Ga0268266_10897975 3300028379 Bacteria 857
329 Ga0268264_10000264 3300028381 Bacteria 93499
330 Ga0268264_10043057 3300028381 Bacteria 3740
331 Ga0268264_10280316 3300028381 Bacteria 1561
332 Ga0316182_1048777 3300030745 Bacteria 701
333 Ga0307408_101914274 3300031548 Bacteria 569
334 Ga0307405_10032384 3300031731 Bacteria 3090
335 Ga0307405_10630778 3300031731 Bacteria 879
336 Ga0307405_10685832 3300031731 Bacteria 847
337 Ga0307413_10256262 3300031824 Bacteria 1301
338 Ga0307413_10311091 3300031824 Bacteria 1199
339 Ga0307413_10374511 3300031824 Bacteria 1107
340 Ga0307413_10785981 3300031824 Bacteria 799
341 Ga0307413_10986897 3300031824 Bacteria 721
342 Ga0307413_11641540 3300031824 Bacteria 572
343 Ga0307413_11688749 3300031824 Bacteria 564
344 Ga0307413_11713256 3300031824 Bacteria 561
345 Ga0307410_10134819 3300031852 Bacteria 1819
346 Ga0307410_10896488 3300031852 Bacteria 759
347 Ga0307410_11132540 3300031852 Bacteria 679
348 Ga0307410_11706081 3300031852 Bacteria 558
349 Ga0307410_11961496 3300031852 Bacteria 522
350 Ga0307410_11964976 3300031852 Bacteria 521
351 Ga0307410_12078692 3300031852 Bacteria 508
352 Ga0307406_10098101 3300031901 Bacteria 1989
353 Ga0307407_10400734 3300031903 Bacteria 984
354 Ga0307407_10742796 3300031903 Bacteria 742
355 Ga0307407_11236146 3300031903 Bacteria 584
356 Ga0307412_10092970 3300031911 Bacteria 2115
357 Ga0307412_10309874 3300031911 Bacteria 1251
358 Ga0307412_10532037 3300031911 Bacteria 984
359 Ga0307412_11213336 3300031911 Bacteria 676
360 Ga0307412_11587961 3300031911 Bacteria 597
361 Ga0307412_11750579 3300031911 Bacteria 571
362 Ga0307409_100042804 3300031995 Bacteria 3394
363 Ga0307409_100297687 3300031995 Bacteria 1499
364 Ga0307409_100555193 3300031995 Bacteria 1128
365 Ga0307409_100569961 3300031995 Bacteria 1114
366 Ga0307409_100615872 3300031995 Bacteria 1075
367 Ga0307409_100872524 3300031995 Bacteria 912
368 Ga0307409_101070589 3300031995 Bacteria 827
369 Ga0307409_101089419 3300031995 Bacteria 820
370 Ga0307409_101237621 3300031995 Bacteria 770
371 Ga0307409_101508155 3300031995 Bacteria 700
372 Ga0307409_101857822 3300031995 Bacteria 632
373 Ga0307416_100044301 3300032002 Bacteria 3492
374 Ga0307416_100324149 3300032002 Bacteria 1544
375 Ga0307416_100870445 3300032002 Bacteria 1000
376 Ga0307416_101625803 3300032002 Bacteria 751
377 Ga0307416_102440396 3300032002 Bacteria 622
378 Ga0307416_102833472 3300032002 Bacteria 580
379 Ga0307414_10401207 3300032004 Bacteria 1191
380 Ga0307414_10678697 3300032004 Bacteria 931
381 Ga0307414_11668444 3300032004 Bacteria 594
382 Ga0307411_10071118 3300032005 Bacteria 2357
383 Ga0307411_10634473 3300032005 Bacteria 923
384 Ga0307411_11283208 3300032005 Bacteria 667
385 Ga0307411_11792340 3300032005 Bacteria 570
386 Ga0307415_100012029 3300032126 Bacteria 4986
387 Ga0307415_100087454 3300032126 Bacteria 2245
388 Ga0307415_100118629 3300032126 Bacteria 1979
389 Ga0307415_100224868 3300032126 Bacteria 1507
390 Ga0307415_100352216 3300032126 Bacteria 1240
391 Ga0307415_100791860 3300032126 Bacteria 864
392 Ga0307415_101334028 3300032126 Bacteria 681
393 Ga0307415_102270692 3300032126 Bacteria 532
394 Ga0373960_0355108 3300035121 Bacteria 557
395 Ga0373931_0845752 3300035691 Bacteria 612
396 Ga0373925_1156116 3300037068 Bacteria 636
397 Ga0395899_0450565 3300037312 Bacteria 843
398 Ga0395898_0402183 3300037466 Bacteria 1306
399 Ga0395898_0659460 3300037466 Bacteria 989
400 Ga0395901_0747709 3300038443 Bacteria 971
401 Ga0439436_0032424 3300041404 Bacteria 1515
402 Ga0439461_0016429 3300041410 Bacteria 1429
403 Ga0439465_0224490 3300041413 Bacteria 689
404 Ga0451789_1017998 3300041443 Bacteria 1836
405 Ga0451789_1302215 3300041443 Bacteria 625
406 Ga0451791_0752955 3300041451 Bacteria 714
407 Ga0451791_0992184 3300041451 Bacteria 678
408 Ga0451791_1654395 3300041451 Bacteria 760
409 Ga0451793_0775503 3300041452 Bacteria 521
410 Ga0451793_0966107 3300041452 Bacteria 533
411 Ga0451797_1286311 3300041453 Bacteria 641
412 Ga0451795_0584009 3300041456 Bacteria 692
413 Ga0451800_0172351 3300041459 Bacteria 707
414 Ga0451802_1443472 3300041460 Bacteria 506
415 Ga0451802_1478068 3300041460 Bacteria 692
416 Ga0451806_758141 3300041462 Bacteria 555
417 Ga0451804_1054048 3300041463 Bacteria 525
418 Ga0451833_0830571 3300041491 Bacteria 808
419 Ga0451835_0237574 3300041492 Bacteria 587
420 Ga0451835_0813332 3300041492 Bacteria 572
421 Ga0451837_0030419 3300041494 Bacteria 707
422 Ga0451837_0408577 3300041494 Bacteria 790
423 Ga0451837_1528821 3300041494 Bacteria 902
424 Ga0451837_1629967 3300041494 Bacteria 687
425 Ga0451839_1339130 3300041496 Bacteria 671
426 Ga0451841_0224019 3300041498 Bacteria 831
427 Ga0451841_0325125 3300041498 Bacteria 833
428 Ga0451849_1541953 3300041505 Bacteria 865
429 Ga0451851_0754583 3300041507 Bacteria 607
430 Ga0451843_0173584 3300041509 Bacteria 899
431 Ga0451843_0590841 3300041509 Bacteria 553
432 Ga0451843_1464872 3300041509 Bacteria 526
433 Ga0451843_1559160 3300041509 Unclassified 962
434 Ga0451843_1737459 3300041509 Bacteria 884
435 Ga0451855_1071527 3300041511 Bacteria 590
436 Ga0451853_0310096 3300041512 Bacteria 2587
437 Ga0451853_1454149 3300041512 Bacteria 967
438 Ga0451853_2235738 3300041512 Bacteria 645
439 Ga0451853_3189159 3300041512 Bacteria 1952
440 Ga0439431_0044496 3300041997 Bacteria 1138
441 Ga0439442_041461 3300042002 Unclassified 967
442 Ga0439457_013841 3300042014 Bacteria 1810
443 Ga0450907_011878 3300042146 Bacteria 1447
444 Ga0450907_065930 3300042146 Bacteria 626
445 Ga0439446_0117441 3300042156 Bacteria 853
446 Ga0439458_0100923 3300042157 Bacteria 749
447 Ga0439434_0003686 3300042435 Bacteria 4480
448 Ga0439434_0238234 3300042435 Unclassified 620
449 Ga0466972_0113920 3300044658 Bacteria 1277
450 Ga0466965_0275482 3300044683 Bacteria 907
451 Ga0466965_0381260 3300044683 Bacteria 776
452 Ga0466965_0534620 3300044683 Bacteria 660
453 Ga0466965_0827375 3300044683 Bacteria 537
454 Ga0466966_0036586 3300044684 Bacteria 3169
455 Ga0466966_0088512 3300044684 Bacteria 1924
456 Ga0466966_0360227 3300044684 Bacteria 874
457 Ga0466963_0013622 3300044694 Bacteria 4998
458 Ga0466963_0019841 3300044694 Bacteria 4222
459 Ga0466963_0080361 3300044694 Bacteria 2207
460 Ga0466963_0106713 3300044694 Bacteria 1921
461 Ga0466963_0216063 3300044694 Bacteria 1342
462 Ga0466963_0499202 3300044694 Bacteria 859
463 Ga0466963_0877244 3300044694 Bacteria 632
464 Ga0466964_0001607 3300044706 Bacteria 7795
465 Ga0466964_0011378 3300044706 Bacteria 3361
466 Ga0466964_0353828 3300044706 Bacteria 755
467 Ga0466964_0728499 3300044706 Bacteria 555
468 Ga0466971_0338626 3300044719 Bacteria 727
469 Ga0466968_0191647 3300044735 Bacteria 954
470 Ga0466968_0203120 3300044735 Bacteria 929
471 Ga0466968_0305421 3300044735 Bacteria 766
472 Ga0466970_0195075 3300044765 Bacteria 1126
473 Ga0466970_0198683 3300044765 Bacteria 1115
474 Ga0466970_0450199 3300044765 Bacteria 738
475 Ga0466970_0657979 3300044765 Bacteria 609
476 Ga0466970_0804299 3300044765 Bacteria 551
477 Ga0466957_0055848 3300044842 Bacteria 2413
478 Ga0466957_0062940 3300044842 Bacteria 2279
479 Ga0466957_0263601 3300044842 Bacteria 1149
480 Ga0466960_0002321 3300044901 Bacteria 7143
481 Ga0466960_0049562 3300044901 Bacteria 2022
482 Ga0466960_0053791 3300044901 Bacteria 1952
483 Ga0466960_0186247 3300044901 Bacteria 1128
484 Ga0466959_0148305 3300045049 Bacteria 1655
485 Ga0466959_1029059 3300045049 Bacteria 548
486 Ga0451576_0106143 3300045051 Bacteria 2923
487 Ga0466958_0017063 3300045836 Bacteria 4191
488 Ga0466958_0855445 3300045836 Bacteria 593
489 Ga0466967_0002267 3300045976 Bacteria 11859
490 Ga0466967_0076988 3300045976 Bacteria 3001
491 Ga0466967_0153666 3300045976 Bacteria 2153
492 Ga0466967_0207689 3300045976 Bacteria 1856
493 Ga0466967_0457053 3300045976 Bacteria 1248
494 Ga0466967_0523132 3300045976 Bacteria 1166
495 Ga0466967_1284645 3300045976 Bacteria 729
496 Ga0466967_1877751 3300045976 Bacteria 596
497 Ga0466967_2185472 3300045976 Bacteria 549
498 Ga0466967_2419663 3300045976 Bacteria 520
499 Ga0495629_0438555 3300046459 Bacteria 885
500 Ga0495641_0065721 3300046461 Bacteria 1633
501 Ga0495582_0441663 3300046473 Bacteria 751
502 Ga0495582_0666478 3300046473 Bacteria 602
503 Ga0495596_0102274 3300046500 Bacteria 1113
504 Ga0495608_0445616 3300046511 Bacteria 788
505 Ga0495631_0433356 3300046518 Bacteria 560
506 Ga0495656_0258396 3300046615 Bacteria 882
507 Ga0495635_0376007 3300046663 Bacteria 946
508 Ga0495657_0052685 3300046675 Bacteria 2727
509 Ga0495658_0507980 3300046683 Bacteria 771
510 Ga0495600_0609277 3300046809 Bacteria 663
511 Ga0495581_0878569 3300047315 Bacteria 512
512 Ga0495676_0302898 3300047321 Bacteria 1077
513 Ga0496100_0133303 3300048903 Bacteria 1752
514 Ga0496100_0138657 3300048903 Bacteria 1721
515 Ga0496101_0010516 3300048904 Bacteria 6111
516 Ga0496101_0131579 3300048904 Bacteria 1900
517 Ga0496101_0630330 3300048904 Bacteria 847
518 Ga0496101_1211677 3300048904 Bacteria 591
519 Ga0496102_0047639 3300048905 Bacteria 3896
520 Ga0496102_0117931 3300048905 Bacteria 2477
521 Ga0496102_0158166 3300048905 Bacteria 2131
522 Ga0496102_0182333 3300048905 Bacteria 1978
523 Ga0496102_0339761 3300048905 Bacteria 1414
524 Ga0496102_0477629 3300048905 Bacteria 1168
525 Ga0496103_0046478 3300048906 Bacteria 2680
526 Ga0496103_0080196 3300048906 Bacteria 2052
527 Ga0496103_0095413 3300048906 Bacteria 1879
528 Ga0496103_0156547 3300048906 Bacteria 1461
529 Ga0496103_0969261 3300048906 Bacteria 531
530 Ga0496103_0974438 3300048906 Bacteria 529
531 Ga0496104_0015536 3300048907 Bacteria 6896
532 Ga0496105_0001372 3300048908 Bacteria 17147
533 Ga0496106_0037109 3300048909 Bacteria 3645
534 Ga0496106_0245281 3300048909 Bacteria 1431
535 Ga0496106_0523594 3300048909 Bacteria 952
536 Ga0496106_1431731 3300048909 Bacteria 533
537 Ga0496107_0018649 3300048910 Bacteria 4888
538 Ga0496107_0210291 3300048910 Bacteria 1446
539 Ga0496107_0320267 3300048910 Bacteria 1154
540 Ga0496107_0330292 3300048910 Bacteria 1135
541 Ga0496107_0467765 3300048910 Bacteria 936
542 Ga0496107_0628225 3300048910 Bacteria 793
543 Ga0496108_0044211 3300048911 Bacteria 3719
544 Ga0496108_0085918 3300048911 Bacteria 2671
545 Ga0496108_0877526 3300048911 Bacteria 771
546 Ga0496108_1459728 3300048911 Bacteria 570
547 Ga0496109_0009807 3300048912 Bacteria 8175
548 Ga0496109_0493911 3300048912 Bacteria 1155
549 Ga0496109_0647311 3300048912 Bacteria 994
550 Ga0496109_0713308 3300048912 Bacteria 940
551 Ga0496109_1204482 3300048912 Bacteria 694
552 Ga0496110_0000747 3300048913 Bacteria 22458
553 Ga0496110_0239738 3300048913 Bacteria 1650
554 Ga0496110_0728226 3300048913 Bacteria 894
555 Ga0496110_1519308 3300048913 Bacteria 579
556 Ga0496111_0003044 3300048914 Bacteria 10286
557 Ga0496111_0228521 3300048914 Bacteria 1382
558 Ga0496111_0291613 3300048914 Bacteria 1210
559 Ga0496111_0367769 3300048914 Bacteria 1064
560 Ga0496112_0418022 3300048915 Bacteria 1280
561 Ga0496112_0648089 3300048915 Bacteria 986
562 Ga0496112_1820043 3300048915 Bacteria 521
563 Ga0496113_0592003 3300048916 Bacteria 888
564 Ga0496113_0597355 3300048916 Bacteria 884
565 Ga0496113_0959315 3300048916 Bacteria 675
566 Ga0496114_0006599 3300048917 Bacteria 9147
567 Ga0496114_0116926 3300048917 Bacteria 2290
568 Ga0496114_0164551 3300048917 Bacteria 1930
569 Ga0496114_0177394 3300048917 Bacteria 1859
570 Ga0496114_0179562 3300048917 Bacteria 1848
571 Ga0496114_0894875 3300048917 Bacteria 769
572 Ga0496114_1323883 3300048917 Bacteria 607
573 Ga0496115_0013046 3300048918 Bacteria 6273
574 Ga0496115_0082260 3300048918 Bacteria 2623
575 Ga0496115_0322796 3300048918 Bacteria 1262
576 Ga0496124_0614775 3300048927 Bacteria 704
577 Ga0496126_1279240 3300048929 Bacteria 535
578 Ga0501291_040945 3300049514 Bacteria 815
579 Ga0501031_0014519 3300049568 Bacteria 5121
580 Ga0501031_0022566 3300049568 Bacteria 4101
581 Ga0501031_0222795 3300049568 Bacteria 1228
582 Ga0501031_0290167 3300049568 Bacteria 1061
583 Ga0501031_0861454 3300049568 Bacteria 580
584 Ga0501032_0554631 3300049569 Bacteria 732
585 Ga0501032_0576942 3300049569 Bacteria 716
586 Ga0501033_0756081 3300049570 Bacteria 659
587 Ga0501033_1099077 3300049570 Bacteria 529
588 Ga0501034_0022507 3300049571 Bacteria 6422
589 Ga0501034_0296654 3300049571 Bacteria 1554
590 Ga0501034_1247121 3300049571 Bacteria 621
591 Ga0501036_0023158 3300049572 Bacteria 5229
592 Ga0501036_0026956 3300049572 Bacteria 4856
593 Ga0501036_0038644 3300049572 Bacteria 4039
594 Ga0501036_0096628 3300049572 Bacteria 2498
595 Ga0501036_0270362 3300049572 Bacteria 1423
596 Ga0501036_0794850 3300049572 Bacteria 779
597 Ga0501036_1043826 3300049572 Bacteria 668
598 Ga0501037_0037004 3300049573 Bacteria 3597
599 Ga0501037_0422695 3300049573 Bacteria 912
600 Ga0501037_0445052 3300049573 Bacteria 884
601 Ga0501038_0009788 3300049574 Bacteria 8780
602 Ga0501038_0188295 3300049574 Bacteria 1662
603 Ga0501038_0338406 3300049574 Bacteria 1174
604 Ga0501038_0899117 3300049574 Bacteria 654
605 Ga0501039_0049246 3300049575 Bacteria 3257
606 Ga0501039_0438566 3300049575 Bacteria 1026
607 Ga0501039_0527717 3300049575 Bacteria 927
608 Ga0501039_1394062 3300049575 Bacteria 540
609 Ga0501040_0029267 3300049576 Bacteria 3717
610 Ga0501040_0072175 3300049576 Bacteria 2384
611 Ga0501040_0263234 3300049576 Bacteria 1231
612 Ga0501040_0357388 3300049576 Bacteria 1047
613 Ga0501040_0791279 3300049576 Bacteria 686
614 Ga0501041_0021317 3300049577 Bacteria 3883
615 Ga0501041_0094069 3300049577 Bacteria 1851
616 Ga0501041_0126368 3300049577 Bacteria 1592
617 Ga0501041_1076874 3300049577 Bacteria 518
618 Ga0501042_0216389 3300049578 Bacteria 1382
619 Ga0501042_0380075 3300049578 Bacteria 1022
620 Ga0501042_0400565 3300049578 Bacteria 994
621 Ga0501042_0484452 3300049578 Bacteria 898
622 Ga0501042_0572322 3300049578 Bacteria 821
623 Ga0501042_0676430 3300049578 Bacteria 750
624 Ga0501042_1248300 3300049578 Bacteria 542
625 Ga0501046_0047180 3300049580 Bacteria 3416
626 Ga0501046_1239986 3300049580 Bacteria 511
627 Ga0501048_0005159 3300049582 Bacteria 9954
628 Ga0501048_0759756 3300049582 Bacteria 696
629 Ga0501048_1369068 3300049582 Bacteria 509
630 Ga0501067_0007175 3300049583 Bacteria 6191
631 Ga0501067_0097644 3300049583 Bacteria 1631
632 Ga0501067_0132157 3300049583 Bacteria 1389
633 Ga0501067_0214312 3300049583 Bacteria 1072
634 Ga0501067_0707985 3300049583 Bacteria 566
635 Ga0501068_0024393 3300049584 Bacteria 3551
636 Ga0501068_0029340 3300049584 Bacteria 3256
637 Ga0501068_0291060 3300049584 Bacteria 1044
638 Ga0501069_0060474 3300049585 Bacteria 2115
639 Ga0501069_0065944 3300049585 Bacteria 2025
640 Ga0501069_0109647 3300049585 Bacteria 1571
641 Ga0501069_0163308 3300049585 Bacteria 1283
642 Ga0501069_0239125 3300049585 Bacteria 1058
643 Ga0501069_0356643 3300049585 Bacteria 862
644 Ga0501069_0460824 3300049585 Bacteria 756
645 Ga0501069_1021388 3300049585 Bacteria 505
646 Ga0501070_0012553 3300049586 Bacteria 7144
647 Ga0501070_0017414 3300049586 Bacteria 6032
648 Ga0501070_0127754 3300049586 Bacteria 2100
649 Ga0501070_0434291 3300049586 Bacteria 1060
650 Ga0501070_0667154 3300049586 Bacteria 824
651 Ga0501070_0776979 3300049586 Bacteria 753
652 Ga0501070_1472155 3300049586 Bacteria 516
653 Ga0501070_1533306 3300049586 Bacteria 504
654 Ga0501071_0002481 3300049587 Bacteria 11209
655 Ga0501071_0005192 3300049587 Bacteria 8340
656 Ga0501071_0033147 3300049587 Bacteria 3671
657 Ga0501071_0256995 3300049587 Bacteria 1319
658 Ga0501071_0278843 3300049587 Bacteria 1265
659 Ga0501071_0445121 3300049587 Bacteria 991
660 Ga0501071_0548653 3300049587 Bacteria 888
661 Ga0501071_0647404 3300049587 Bacteria 813
662 Ga0501071_0945693 3300049587 Bacteria 665
663 Ga0501071_1038497 3300049587 Bacteria 633
664 Ga0501071_1391431 3300049587 Bacteria 542
665 Ga0501071_1475753 3300049587 Bacteria 525
666 Ga0501072_0009681 3300049588 Bacteria 7328
667 Ga0501072_0028197 3300049588 Bacteria 4383
668 Ga0501072_0076090 3300049588 Bacteria 2655
669 Ga0501072_0291639 3300049588 Bacteria 1297
670 Ga0501072_0392296 3300049588 Bacteria 1101
671 Ga0501073_0006115 3300049589 Bacteria 8983
672 Ga0501073_0141094 3300049589 Bacteria 1669
673 Ga0501073_0326488 3300049589 Bacteria 1059
674 Ga0501073_0458575 3300049589 Bacteria 881
675 Ga0501074_0002297 3300049590 Bacteria 13296
676 Ga0501074_0005614 3300049590 Bacteria 9030
677 Ga0501074_0006075 3300049590 Bacteria 8720
678 Ga0501074_0397602 3300049590 Bacteria 977
679 Ga0501074_0578924 3300049590 Bacteria 794
680 Ga0501074_0883759 3300049590 Bacteria 629
681 Ga0501075_0053454 3300049591 Bacteria 3038
682 Ga0501075_0267315 3300049591 Bacteria 1303
683 Ga0501075_1556794 3300049591 Bacteria 500
684 Ga0501076_0004804 3300049592 Bacteria 9645
685 Ga0501076_0024568 3300049592 Bacteria 4659
686 Ga0501076_0326910 3300049592 Bacteria 1258
687 Ga0501076_0615523 3300049592 Bacteria 896
688 Ga0501077_0002317 3300049593 Bacteria 11463
689 Ga0501077_0023537 3300049593 Bacteria 3906
690 Ga0501214_012298 3300049659 Bacteria 974
691 Ga0501079_0014730 3300049741 Bacteria 5960
692 Ga0501079_0061275 3300049741 Bacteria 2902
693 Ga0501079_0120515 3300049741 Bacteria 2040
694 Ga0501079_0315898 3300049741 Bacteria 1223
695 Ga0501079_0553715 3300049741 Bacteria 904
696 Ga0501079_1088754 3300049741 Bacteria 630
697 Ga0501080_0009817 3300049742 Bacteria 8747
698 Ga0501080_0012248 3300049742 Bacteria 7859
699 Ga0501080_0158296 3300049742 Bacteria 2092
700 Ga0501080_0241404 3300049742 Bacteria 1649
701 Ga0501080_0491474 3300049742 Bacteria 1097
702 Ga0501080_0799559 3300049742 Bacteria 827
703 Ga0501080_1385371 3300049742 Bacteria 600
704 Ga0501081_0022836 3300049743 Bacteria 4188
705 Ga0501081_0166763 3300049743 Bacteria 1589
706 Ga0501081_0255013 3300049743 Bacteria 1281
707 Ga0501081_0839905 3300049743 Bacteria 692
708 Ga0501083_0001774 3300049744 Bacteria 14732
709 Ga0501083_0020502 3300049744 Bacteria 4599
710 Ga0501083_0280664 3300049744 Bacteria 1084
711 Ga0501035_0295931 3300049822 Bacteria 1365
712 Ga0501035_0368678 3300049822 Bacteria 1199
713 Ga0501035_1061671 3300049822 Bacteria 634
714 Ga0501044_1047660 3300049823 Bacteria 686
715 Ga0501045_0045048 3300049824 Bacteria 3212
716 Ga0501045_0056203 3300049824 Bacteria 2878
717 Ga0501045_0090550 3300049824 Bacteria 2260
718 Ga0501045_0231032 3300049824 Bacteria 1377
719 Ga0501045_0356295 3300049824 Bacteria 1089
720 nmdc:mga03683_216350_c1 3300050489 Bacteria 883
721 nmdc:mga03683_602341_c1 3300050489 Bacteria 538
722 nmdc:mga03n38_136823_c1 3300050490 Bacteria 1220
723 nmdc:mga03n38_42813_c1 3300050490 Bacteria 1982
724 nmdc:mga03n38_80790_c1 3300050490 Bacteria 1527
725 nmdc:mga00v17_104346_c1 3300050491 Bacteria 1792
726 nmdc:mga00v17_117387_c1 3300050491 Bacteria 1692
727 nmdc:mga00v17_164313_c1 3300050491 Bacteria 1430
728 nmdc:mga00v17_390572_c1 3300050491 Bacteria 904
729 nmdc:mga00v17_4410_c1 3300050491 Bacteria 7318
730 nmdc:mga00v17_500553_c1 3300050491 Bacteria 788
731 nmdc:mga00v17_558853_c1 3300050491 Bacteria 740
732 nmdc:mga00v17_650472_c1 3300050491 Bacteria 678
733 nmdc:mga00v17_79518_c1 3300050491 Bacteria 2045
734 nmdc:mga0yw44_109226_c1 3300050492 Bacteria 1770
735 nmdc:mga0yw44_141979_c1 3300050492 Bacteria 919
736 nmdc:mga0yw44_174581_c1 3300050492 Bacteria 1412
737 nmdc:mga0yw44_228397_c1 3300050492 Bacteria 1235
738 nmdc:mga0yw44_246416_c1 3300050492 Bacteria 1188
739 nmdc:mga0yw44_26444_c1 3300050492 Bacteria 3315
740 nmdc:mga0yw44_27777_c1 3300050492 Bacteria 3246
741 nmdc:mga0yw44_331043_c1 3300050492 Bacteria 1023
742 nmdc:mga0yw44_340262_c1 3300050492 Bacteria 1009
743 nmdc:mga0yw44_35438_c1 3300050492 Bacteria 2932
744 nmdc:mga0yw44_380819_c1 3300050492 Bacteria 953
745 nmdc:mga0yw44_44121_c1 3300050492 Bacteria 2666
746 nmdc:mga0yw44_494670_c1 3300050492 Bacteria 830
747 nmdc:mga0yw44_501522_c1 3300050492 Bacteria 824
748 nmdc:mga0yw44_510583_c1 3300050492 Bacteria 816
749 nmdc:mga0yw44_530464_c1 3300050492 Bacteria 799
750 nmdc:mga0yw44_5329_c1 3300050492 Bacteria 6052
751 nmdc:mga0yw44_647409_c1 3300050492 Bacteria 718
752 nmdc:mga0yw44_671496_c1 3300050492 Bacteria 704
753 nmdc:mga0yw44_835113_c1 3300050492 Bacteria 625
754 nmdc:mga0yw44_8805_c1 3300050492 Bacteria 5052
755 nmdc:mga0yw44_93868_c1 3300050492 Bacteria 1901
756 nmdc:mga06z11_170886_c1 3300050494 Bacteria 1248
757 nmdc:mga06z11_27652_c1 3300050494 Bacteria 2713
758 nmdc:mga06z11_39590_c1 3300050494 Bacteria 2347
759 nmdc:mga06z11_402708_c1 3300050494 Bacteria 824
760 nmdc:mga06z11_464027_c1 3300050494 Bacteria 766
761 nmdc:mga06z11_540221_c1 3300050494 Bacteria 707
762 nmdc:mga04h51_534923_c1 3300050495 Bacteria 504
763 nmdc:mga04h51_9621_c1 3300050495 Bacteria 2629
764 nmdc:mga07m45_141685_c1 3300050496 Bacteria 1392
765 nmdc:mga07m45_36033_c1 3300050496 Bacteria 2754
766 nmdc:mga07m45_417082_c1 3300050496 Bacteria 779
767 nmdc:mga07m45_54873_c1 3300050496 Bacteria 2251
768 nmdc:mga07m45_7804_c1 3300050496 Bacteria 5477
769 nmdc:mga08y16_1576199_c1 3300050511 Bacteria 615
770 nmdc:mga08y16_368686_c1 3300050511 Bacteria 1473
771 Ga0495655_0281152 3300053083 Bacteria 567
772 Ga0495595_0196860 3300053084 Bacteria 1003
773 Ga0495595_0365349 3300053084 Bacteria 729
774 Ga0495595_0543009 3300053084 Bacteria 593
775 Ga0495619_0129123 3300053085 Bacteria 1736
776 Ga0495619_0530325 3300053085 Bacteria 809
777 Ga0500644_0033227 3300053088 Bacteria 1655
778 Ga0500554_132156 3300053102 Bacteria 843
779 Ga0500556_0000513 3300053104 Bacteria 26475
780 Ga0500593_000011 3300053117 Bacteria 62847
781 Ga0500573_0002317 3300053140 Bacteria 9471
782 Ga0501084_0022279 3300054114 Bacteria 5287
783 Ga0501084_0038788 3300054114 Bacteria 3983
784 Ga0501084_0078755 3300054114 Bacteria 2762
785 Ga0501084_0132331 3300054114 Bacteria 2100
786 Ga0501082_0006936 3300060353 Bacteria 9791
787 Ga0501082_0070033 3300060353 Bacteria 3020
788 Ga0501082_0255617 3300060353 Bacteria 1524
789 Ga0501082_0284484 3300060353 Bacteria 1439
790 Ga0501082_0565631 3300060353 Bacteria 995
791 Ga0466962_0601553 3300061719 Bacteria 560
792 Ga0530510_0069780 3300061734 Bacteria 2550
793 2644093629 2643221615 Bacteria 5487866
794 2644230093 2643221641 Bacteria 4490190
795 2644323471 2643221657 Bacteria 5490246
796 2857486139 2857481737 Bacteria 4761446
797 Ga0501041_0096588
798 LJQas_1003651
799 JGI24735J21928_10027864
800 Ga0070658_10013519
801 Ga0070658_10044764
802 Ga0070683_100002255
803 Ga0070683_100140380
804 Ga0070683_101289698
805 Ga0070683_102165769
806 Ga0070690_100880969
807 Ga0068869_101293151
808 Ga0070680_100265674
809 Ga0070682_100006917
810 Ga0070682_100287669
811 Ga0070682_100671852
812 Ga0068868_100236428
813 Ga0068868_100761635
814 Ga0068868_101521437
815 Ga0070660_100029050
816 Ga0070660_100990684
817 Ga0070689_100261805
818 Ga0070687_100465034
819 Ga0070661_100257926
820 Ga0070661_101343980
821 Ga0070692_10035964
822 Ga0070692_10154660
823 Ga0070668_100170958
824 Ga0070668_100379073
825 Ga0070669_100868796
826 Ga0070675_100851979
827 Ga0070671_101450382
828 Ga0070674_100362404
829 Ga0070659_100013286
830 Ga0070659_101580654
831 Ga0070659_102015489
832 Ga0070667_100052315
833 Ga0070667_100124421
834 Ga0070667_100676439
835 Ga0070667_102090860
836 Ga0070701_10034960
837 Ga0070701_10536418
838 Ga0070701_10981655
839 Ga0070705_100093517
840 Ga0070700_100044264
841 Ga0070663_100151406
842 Ga0070678_100230921
843 Ga0070681_10314791
844 Ga0070681_10676534
845 Ga0070681_10908122
846 Ga0068867_100119085
847 Ga0068867_100410904
848 Ga0068867_101007201
849 Ga0068867_102141650
850 Ga0070685_10961469
851 Ga0070685_11133439
852 Ga0070679_100011544
853 Ga0070684_100000717
854 Ga0070684_100949790
855 Ga0070684_101040359
856 Ga0070684_102144428
857 Ga0068853_100255320
858 Ga0068853_101558109
859 Ga0070672_100273473
860 Ga0070672_100454720
861 Ga0070686_100420033
862 Ga0070686_100776694
863 Ga0070686_101574966
864 Ga0070686_101917519
865 Ga0070665_100011527
866 Ga0070665_102208410
867 Ga0068855_100042108
868 Ga0068855_100714646
869 Ga0070664_100664592
870 Ga0070664_100854217
871 Ga0070664_102253531
872 Ga0068857_100005784
873 Ga0068857_100109934
874 Ga0068857_100285747
875 Ga0068857_101192537
876 Ga0068854_101110524
877 Ga0068854_101574930
878 Ga0068856_100024612
879 Ga0068856_101611528
880 Ga0068856_101938275
881 Ga0070702_100134563
882 Ga0068852_100536122
883 Ga0068852_100610270
884 Ga0068852_100897709
885 Ga0068859_102911540
886 Ga0068864_100054798
887 Ga0068864_101044291
888 Ga0068866_10567446
889 Ga0068861_100249653
890 Ga0068861_100432084
891 Ga0068861_101431195
892 Ga0068870_10303642
893 Ga0068870_10342319
894 Ga0068870_10989663
895 Ga0068863_100137003
896 Ga0068858_100480468
897 Ga0068860_100000321
898 Ga0068860_100112850
899 Ga0068860_100627413
900 Ga0068860_100631307
901 Ga0081539_10026890
902 Ga0075365_10004600
903 Ga0075365_10005485
904 Ga0075365_10010873
905 Ga0075365_10022323
906 Ga0075365_10037108
907 Ga0075365_10056009
908 Ga0075365_10059219
909 Ga0075365_10062917
910 Ga0075365_10076156
911 Ga0075365_10106529
912 Ga0075365_10126538
913 Ga0075365_10157297
914 Ga0075365_10179621
915 Ga0075365_10197259
916 Ga0075365_10239173
917 Ga0075365_10300487
918 Ga0075365_10377537
919 Ga0075365_10545021
920 Ga0075365_10562113
921 Ga0075365_10696190
922 Ga0075365_10725355
923 Ga0075365_10727438
924 Ga0075365_11110800
925 Ga0075368_10005534
926 Ga0075368_10014810
927 Ga0075368_10027182
928 Ga0075368_10168710
929 Ga0075368_10250880
930 Ga0075368_10282183
931 Ga0075368_10406866
932 Ga0075363_100002471
933 Ga0075363_100008893
934 Ga0075363_100024129
935 Ga0075363_100115249
936 Ga0075363_100226652
937 Ga0075363_100344349
938 Ga0075363_100403443
939 Ga0075363_100634269
940 Ga0075364_10007665
941 Ga0075364_10047755
942 Ga0075364_10111109
943 Ga0075364_10119720
944 Ga0075364_10195073
945 Ga0075364_10197492
946 Ga0075364_10279194
947 Ga0075364_10314056
948 Ga0075364_10355531
949 Ga0075364_10458778
950 Ga0075362_10090711
951 Ga0075362_10198891
952 Ga0075367_10006764
953 Ga0075367_10033184
954 Ga0075367_10181328
955 Ga0075367_10183253
956 Ga0075367_10514677
957 Ga0075369_10440557
958 Ga0097621_100979805
959 Ga0075370_10029370
960 Ga0075370_10089978
961 Ga0075370_10374277
962 Ga0075370_10436399
963 Ga0075370_10731109
964 Ga0075370_10941120
965 Ga0068871_100470729
966 Ga0068871_101626689
967 Ga0068865_100241600
968 Ga0068865_100727831
969 Ga0068865_101213318
970 Ga0068865_101674866
971 Ga0105250_10191135
972 Ga0111539_10418692
973 Ga0111539_11705866
974 Ga0105245_10002720
975 Ga0105245_10186844
976 Ga0105245_10349756
977 Ga0105245_10822692
978 Ga0105245_12433734
979 Ga0105245_12947782
980 Ga0105243_10091760
981 Ga0105243_10680813
982 Ga0105243_10708228
983 Ga0105243_10986973
984 Ga0105243_11559309
985 Ga0105243_11596535
986 Ga0105242_10715522
987 Ga0105242_11153537
988 Ga0105248_10410509
989 Ga0105248_11405276
990 Ga0105237_10087682
991 Ga0105238_10128429
992 Ga0105238_11820979
993 Ga0105249_10009329
994 Ga0105249_10443275
995 Ga0105249_10898188
996 Ga0105249_12107274
997 Ga0105239_10001640
998 Ga0105239_11167804
999 Ga0105239_13591978
1000 Ga0105246_10036535
1001 Ga0105246_10039823
1002 Ga0105246_12082967
1003 Ga0157371_10510521
1004 Ga0157371_11460920
1005 Ga0157370_11182413
1006 Ga0157369_10014875
1007 Ga0157369_11346878
1008 Ga0157369_11671742
1009 Ga0157374_12582872
1010 Ga0163162_10073248
1011 Ga0157372_10001329
1012 Ga0157372_10798228
1013 Ga0157372_10855966
1014 Ga0157372_12449420
1015 Ga0157372_13213336
1016 Ga0157375_10008417
1017 Ga0157375_10061774
1018 Ga0157375_10316322
1019 Ga0157375_10424062
1020 Ga0157375_10655922
1021 Ga0157375_11298066
1022 Ga0163163_10048078
1023 Ga0163163_10064676
1024 Ga0163163_10968689
1025 Ga0163163_11793413
1026 Ga0157380_10548608
1027 Ga0157380_11211318
1028 Ga0157380_11459312
1029 Ga0182008_10339574
1030 Ga0157377_10407554
1031 Ga0157377_10906279
1032 Ga0157379_10107066
1033 Ga0157376_12264385
1034 Ga0163161_10018148
1035 Ga0163161_11318035
1036 Ga0206354_10746660
1037 Ga0207697_10520029
1038 Ga0207682_10180212
1039 Ga0207688_10052859
1040 Ga0207688_10585632
1041 Ga0207647_10014204
1042 Ga0207647_10096641
1043 Ga0207705_10005068
1044 Ga0207707_10453242
1045 Ga0207671_10462242
1046 Ga0207660_10168083
1047 Ga0207662_10086910
1048 Ga0207662_10451707
1049 Ga0207657_10175362
1050 Ga0207657_10611025
1051 Ga0207694_10408458
1052 Ga0207659_10765078
1053 Ga0207687_10006696
1054 Ga0207687_10891272
1055 Ga0207687_11191107
1056 Ga0207690_10020024
1057 Ga0207709_10062461
1058 Ga0207709_10101499
1059 Ga0207709_10350357
1060 Ga0207709_10398664
1061 Ga0207709_10473868
1062 Ga0207670_10318442
1063 Ga0207669_10761806
1064 Ga0207704_10015793
1065 Ga0207704_10501128
1066 Ga0207704_10644695
1067 Ga0207704_11284021
1068 Ga0207704_11767002
1069 Ga0207665_10806162
1070 Ga0207691_10038980
1071 Ga0207711_11374129
1072 Ga0207711_11769882
1073 Ga0207689_10395082
1074 Ga0207661_10036837
1075 Ga0207661_10746560
1076 Ga0207661_11820146
1077 Ga0207679_10494272
1078 Ga0207679_10743093
1079 Ga0207667_10091686
1080 Ga0207712_10048659
1081 Ga0207712_10939116
1082 Ga0207712_11161487
1083 Ga0207668_10629441
1084 Ga0207640_11005843
1085 Ga0207640_11414285
1086 Ga0207658_10042691
1087 Ga0207658_10150706
1088 Ga0207677_10332400
1089 Ga0207677_10611226
1090 Ga0207677_10917202
1091 Ga0207703_10364140
1092 Ga0207703_12103075
1093 Ga0207639_10119241
1094 Ga0207639_11085155
1095 Ga0207639_12074540
1096 Ga0207678_10250434
1097 Ga0207708_10048321
1098 Ga0207708_11129099
1099 Ga0207702_10017835
1100 Ga0207702_11445242
1101 Ga0207641_10040390
1102 Ga0207641_11544742
1103 Ga0207648_10142786
1104 Ga0207648_11213291
1105 Ga0207648_11258470
1106 Ga0207648_12233845
1107 Ga0207676_10009332
1108 Ga0207676_10312323
1109 Ga0207676_10922309
1110 Ga0207674_10008524
1111 Ga0207675_100089824
1112 Ga0207675_100122332
1113 Ga0207675_100297973
1114 Ga0207675_100937694
1115 Ga0207683_10184590
1116 Ga0207683_10659786
1117 Ga0207698_10547027
1118 Ga0207698_10608911
1119 Ga0209813_10125795
1120 Ga0209813_10281103
1121 Ga0207428_10916709
1122 Ga0268266_10002415
1123 Ga0268266_10391731
1124 Ga0268266_10897975
1125 Ga0268264_10000264
1126 Ga0268264_10043057
1127 Ga0268264_10280316
1128 Ga0316182_1048777
1129 Ga0307408_101914274
1130 Ga0307405_10032384
1131 Ga0307405_10630778
1132 Ga0307405_10685832
1133 Ga0307413_10256262
1134 Ga0307413_10311091
1135 Ga0307413_10374511
1136 Ga0307413_10785981
1137 Ga0307413_10986897
1138 Ga0307413_11641540
1139 Ga0307413_11688749
1140 Ga0307413_11713256
1141 Ga0307410_10134819
1142 Ga0307410_10896488
1143 Ga0307410_11132540
1144 Ga0307410_11706081
1145 Ga0307410_11961496
1146 Ga0307410_11964976
1147 Ga0307410_12078692
1148 Ga0307406_10098101
1149 Ga0307407_10400734
1150 Ga0307407_10742796
1151 Ga0307407_11236146
1152 Ga0307412_10092970
1153 Ga0307412_10309874
1154 Ga0307412_10532037
1155 Ga0307412_11213336
1156 Ga0307412_11587961
1157 Ga0307412_11750579
1158 Ga0307409_100042804
1159 Ga0307409_100297687
1160 Ga0307409_100555193
1161 Ga0307409_100569961
1162 Ga0307409_100615872
1163 Ga0307409_100872524
1164 Ga0307409_101070589
1165 Ga0307409_101089419
1166 Ga0307409_101237621
1167 Ga0307409_101508155
1168 Ga0307409_101857822
1169 Ga0307416_100044301
1170 Ga0307416_100324149
1171 Ga0307416_100870445
1172 Ga0307416_101625803
1173 Ga0307416_102440396
1174 Ga0307416_102833472
1175 Ga0307414_10401207
1176 Ga0307414_10678697
1177 Ga0307414_11668444
1178 Ga0307411_10071118
1179 Ga0307411_10634473
1180 Ga0307411_11283208
1181 Ga0307411_11792340
1182 Ga0307415_100012029
1183 Ga0307415_100087454
1184 Ga0307415_100118629
1185 Ga0307415_100224868
1186 Ga0307415_100352216
1187 Ga0307415_100791860
1188 Ga0307415_101334028
1189 Ga0307415_102270692
1190 Ga0373960_0355108
1191 Ga0373931_0845752
1192 Ga0373925_1156116
1193 Ga0395899_0450565
1194 Ga0395898_0402183
1195 Ga0395898_0659460
1196 Ga0395901_0747709
1197 Ga0439436_0032424
1198 Ga0439461_0016429
1199 Ga0439465_0224490
1200 Ga0451789_1017998
1201 Ga0451789_1302215
1202 Ga0451791_0752955
1203 Ga0451791_0992184
1204 Ga0451791_1654395
1205 Ga0451793_0775503
1206 Ga0451793_0966107
1207 Ga0451797_1286311
1208 Ga0451795_0584009
1209 Ga0451800_0172351
1210 Ga0451802_1443472
1211 Ga0451802_1478068
1212 Ga0451806_758141
1213 Ga0451804_1054048
1214 Ga0451833_0830571
1215 Ga0451835_0237574
1216 Ga0451835_0813332
1217 Ga0451837_0030419
1218 Ga0451837_0408577
1219 Ga0451837_1528821
1220 Ga0451837_1629967
1221 Ga0451839_1339130
1222 Ga0451841_0224019
1223 Ga0451841_0325125
1224 Ga0451849_1541953
1225 Ga0451851_0754583
1226 Ga0451843_0173584
1227 Ga0451843_0590841
1228 Ga0451843_1464872
1229 Ga0451843_1559160
1230 Ga0451843_1737459
1231 Ga0451855_1071527
1232 Ga0451853_0310096
1233 Ga0451853_1454149
1234 Ga0451853_2235738
1235 Ga0451853_3189159
1236 Ga0439431_0044496
1237 Ga0439442_041461
1238 Ga0439457_013841
1239 Ga0450907_011878
1240 Ga0450907_065930
1241 Ga0439446_0117441
1242 Ga0439458_0100923
1243 Ga0439434_0003686
1244 Ga0439434_0238234
1245 Ga0466972_0113920
1246 Ga0466965_0275482
1247 Ga0466965_0381260
1248 Ga0466965_0534620
1249 Ga0466965_0827375
1250 Ga0466966_0036586
1251 Ga0466966_0088512
1252 Ga0466966_0360227
1253 Ga0466963_0013622
1254 Ga0466963_0019841
1255 Ga0466963_0080361
1256 Ga0466963_0106713
1257 Ga0466963_0216063
1258 Ga0466963_0499202
1259 Ga0466963_0877244
1260 Ga0466964_0001607
1261 Ga0466964_0011378
1262 Ga0466964_0353828
1263 Ga0466964_0728499
1264 Ga0466971_0338626
1265 Ga0466968_0191647
1266 Ga0466968_0203120
1267 Ga0466968_0305421
1268 Ga0466970_0195075
1269 Ga0466970_0198683
1270 Ga0466970_0450199
1271 Ga0466970_0657979
1272 Ga0466970_0804299
1273 Ga0466957_0055848
1274 Ga0466957_0062940
1275 Ga0466957_0263601
1276 Ga0466960_0002321
1277 Ga0466960_0049562
1278 Ga0466960_0053791
1279 Ga0466960_0186247
1280 Ga0466959_0148305
1281 Ga0466959_1029059
1282 Ga0451576_0106143
1283 Ga0466958_0017063
1284 Ga0466958_0855445
1285 Ga0466967_0002267
1286 Ga0466967_0076988
1287 Ga0466967_0153666
1288 Ga0466967_0207689
1289 Ga0466967_0457053
1290 Ga0466967_0523132
1291 Ga0466967_1284645
1292 Ga0466967_1877751
1293 Ga0466967_2185472
1294 Ga0466967_2419663
1295 Ga0495629_0438555
1296 Ga0495641_0065721
1297 Ga0495582_0441663
1298 Ga0495582_0666478
1299 Ga0495596_0102274
1300 Ga0495608_0445616
1301 Ga0495631_0433356
1302 Ga0495656_0258396
1303 Ga0495635_0376007
1304 Ga0495657_0052685
1305 Ga0495658_0507980
1306 Ga0495600_0609277
1307 Ga0495581_0878569
1308 Ga0495676_0302898
1309 Ga0496100_0133303
1310 Ga0496100_0138657
1311 Ga0496101_0010516
1312 Ga0496101_0131579
1313 Ga0496101_0630330
1314 Ga0496101_1211677
1315 Ga0496102_0047639
1316 Ga0496102_0117931
1317 Ga0496102_0158166
1318 Ga0496102_0182333
1319 Ga0496102_0339761
1320 Ga0496102_0477629
1321 Ga0496103_0046478
1322 Ga0496103_0080196
1323 Ga0496103_0095413
1324 Ga0496103_0156547
1325 Ga0496103_0969261
1326 Ga0496103_0974438
1327 Ga0496104_0015536
1328 Ga0496105_0001372
1329 Ga0496106_0037109
1330 Ga0496106_0245281
1331 Ga0496106_0523594
1332 Ga0496106_1431731
1333 Ga0496107_0018649
1334 Ga0496107_0210291
1335 Ga0496107_0320267
1336 Ga0496107_0330292
1337 Ga0496107_0467765
1338 Ga0496107_0628225
1339 Ga0496108_0044211
1340 Ga0496108_0085918
1341 Ga0496108_0877526
1342 Ga0496108_1459728
1343 Ga0496109_0009807
1344 Ga0496109_0493911
1345 Ga0496109_0647311
1346 Ga0496109_0713308
1347 Ga0496109_1204482
1348 Ga0496110_0000747
1349 Ga0496110_0239738
1350 Ga0496110_0728226
1351 Ga0496110_1519308
1352 Ga0496111_0003044
1353 Ga0496111_0228521
1354 Ga0496111_0291613
1355 Ga0496111_0367769
1356 Ga0496112_0418022
1357 Ga0496112_0648089
1358 Ga0496112_1820043
1359 Ga0496113_0592003
1360 Ga0496113_0597355
1361 Ga0496113_0959315
1362 Ga0496114_0006599
1363 Ga0496114_0116926
1364 Ga0496114_0164551
1365 Ga0496114_0177394
1366 Ga0496114_0179562
1367 Ga0496114_0894875
1368 Ga0496114_1323883
1369 Ga0496115_0013046
1370 Ga0496115_0082260
1371 Ga0496115_0322796
1372 Ga0496124_0614775
1373 Ga0496126_1279240
1374 Ga0501291_040945
1375 Ga0501031_0014519
1376 Ga0501031_0022566
1377 Ga0501031_0222795
1378 Ga0501031_0290167
1379 Ga0501031_0861454
1380 Ga0501032_0554631
1381 Ga0501032_0576942
1382 Ga0501033_0756081
1383 Ga0501033_1099077
1384 Ga0501034_0022507
1385 Ga0501034_0296654
1386 Ga0501034_1247121
1387 Ga0501036_0023158
1388 Ga0501036_0026956
1389 Ga0501036_0038644
1390 Ga0501036_0096628
1391 Ga0501036_0270362
1392 Ga0501036_0794850
1393 Ga0501036_1043826
1394 Ga0501037_0037004
1395 Ga0501037_0422695
1396 Ga0501037_0445052
1397 Ga0501038_0009788
1398 Ga0501038_0188295
1399 Ga0501038_0338406
1400 Ga0501038_0899117
1401 Ga0501039_0049246
1402 Ga0501039_0438566
1403 Ga0501039_0527717
1404 Ga0501039_1394062
1405 Ga0501040_0029267
1406 Ga0501040_0072175
1407 Ga0501040_0263234
1408 Ga0501040_0357388
1409 Ga0501040_0791279
1410 Ga0501041_0021317
1411 Ga0501041_0094069
1412 Ga0501041_0126368
1413 Ga0501041_1076874
1414 Ga0501042_0216389
1415 Ga0501042_0380075
1416 Ga0501042_0400565
1417 Ga0501042_0484452
1418 Ga0501042_0572322
1419 Ga0501042_0676430
1420 Ga0501042_1248300
1421 Ga0501046_0047180
1422 Ga0501046_1239986
1423 Ga0501048_0005159
1424 Ga0501048_0759756
1425 Ga0501048_1369068
1426 Ga0501067_0007175
1427 Ga0501067_0097644
1428 Ga0501067_0132157
1429 Ga0501067_0214312
1430 Ga0501067_0707985
1431 Ga0501068_0024393
1432 Ga0501068_0029340
1433 Ga0501068_0291060
1434 Ga0501069_0060474
1435 Ga0501069_0065944
1436 Ga0501069_0109647
1437 Ga0501069_0163308
1438 Ga0501069_0239125
1439 Ga0501069_0356643
1440 Ga0501069_0460824
1441 Ga0501069_1021388
1442 Ga0501070_0012553
1443 Ga0501070_0017414
1444 Ga0501070_0127754
1445 Ga0501070_0434291
1446 Ga0501070_0667154
1447 Ga0501070_0776979
1448 Ga0501070_1472155
1449 Ga0501070_1533306
1450 Ga0501071_0002481
1451 Ga0501071_0005192
1452 Ga0501071_0033147
1453 Ga0501071_0256995
1454 Ga0501071_0278843
1455 Ga0501071_0445121
1456 Ga0501071_0548653
1457 Ga0501071_0647404
1458 Ga0501071_0945693
1459 Ga0501071_1038497
1460 Ga0501071_1391431
1461 Ga0501071_1475753
1462 Ga0501072_0009681
1463 Ga0501072_0028197
1464 Ga0501072_0076090
1465 Ga0501072_0291639
1466 Ga0501072_0392296
1467 Ga0501073_0006115
1468 Ga0501073_0141094
1469 Ga0501073_0326488
1470 Ga0501073_0458575
1471 Ga0501074_0002297
1472 Ga0501074_0005614
1473 Ga0501074_0006075
1474 Ga0501074_0397602
1475 Ga0501074_0578924
1476 Ga0501074_0883759
1477 Ga0501075_0053454
1478 Ga0501075_0267315
1479 Ga0501075_1556794
1480 Ga0501076_0004804
1481 Ga0501076_0024568
1482 Ga0501076_0326910
1483 Ga0501076_0615523
1484 Ga0501077_0002317
1485 Ga0501077_0023537
1486 Ga0501214_012298
1487 Ga0501079_0014730
1488 Ga0501079_0061275
1489 Ga0501079_0120515
1490 Ga0501079_0315898
1491 Ga0501079_0553715
1492 Ga0501079_1088754
1493 Ga0501080_0009817
1494 Ga0501080_0012248
1495 Ga0501080_0158296
1496 Ga0501080_0241404
1497 Ga0501080_0491474
1498 Ga0501080_0799559
1499 Ga0501080_1385371
1500 Ga0501081_0022836
1501 Ga0501081_0166763
1502 Ga0501081_0255013
1503 Ga0501081_0839905
1504 Ga0501083_0001774
1505 Ga0501083_0020502
1506 Ga0501083_0280664
1507 Ga0501035_0295931
1508 Ga0501035_0368678
1509 Ga0501035_1061671
1510 Ga0501044_1047660
1511 Ga0501045_0045048
1512 Ga0501045_0056203
1513 Ga0501045_0090550
1514 Ga0501045_0231032
1515 Ga0501045_0356295
1516 nmdc:mga03683_216350_c1
1517 nmdc:mga03683_602341_c1
1518 nmdc:mga03n38_136823_c1
1519 nmdc:mga03n38_42813_c1
1520 nmdc:mga03n38_80790_c1
1521 nmdc:mga00v17_104346_c1
1522 nmdc:mga00v17_117387_c1
1523 nmdc:mga00v17_164313_c1
1524 nmdc:mga00v17_390572_c1
1525 nmdc:mga00v17_4410_c1
1526 nmdc:mga00v17_500553_c1
1527 nmdc:mga00v17_558853_c1
1528 nmdc:mga00v17_650472_c1
1529 nmdc:mga00v17_79518_c1
1530 nmdc:mga0yw44_109226_c1
1531 nmdc:mga0yw44_141979_c1
1532 nmdc:mga0yw44_174581_c1
1533 nmdc:mga0yw44_228397_c1
1534 nmdc:mga0yw44_246416_c1
1535 nmdc:mga0yw44_26444_c1
1536 nmdc:mga0yw44_27777_c1
1537 nmdc:mga0yw44_331043_c1
1538 nmdc:mga0yw44_340262_c1
1539 nmdc:mga0yw44_35438_c1
1540 nmdc:mga0yw44_380819_c1
1541 nmdc:mga0yw44_44121_c1
1542 nmdc:mga0yw44_494670_c1
1543 nmdc:mga0yw44_501522_c1
1544 nmdc:mga0yw44_510583_c1
1545 nmdc:mga0yw44_530464_c1
1546 nmdc:mga0yw44_5329_c1
1547 nmdc:mga0yw44_647409_c1
1548 nmdc:mga0yw44_671496_c1
1549 nmdc:mga0yw44_835113_c1
1550 nmdc:mga0yw44_8805_c1
1551 nmdc:mga0yw44_93868_c1
1552 nmdc:mga06z11_170886_c1
1553 nmdc:mga06z11_27652_c1
1554 nmdc:mga06z11_39590_c1
1555 nmdc:mga06z11_402708_c1
1556 nmdc:mga06z11_464027_c1
1557 nmdc:mga06z11_540221_c1
1558 nmdc:mga04h51_534923_c1
1559 nmdc:mga04h51_9621_c1
1560 nmdc:mga07m45_141685_c1
1561 nmdc:mga07m45_36033_c1
1562 nmdc:mga07m45_417082_c1
1563 nmdc:mga07m45_54873_c1
1564 nmdc:mga07m45_7804_c1
1565 nmdc:mga08y16_1576199_c1
1566 nmdc:mga08y16_368686_c1
1567 Ga0495655_0281152
1568 Ga0495595_0196860
1569 Ga0495595_0365349
1570 Ga0495595_0543009
1571 Ga0495619_0129123
1572 Ga0495619_0530325
1573 Ga0500644_0033227
1574 Ga0500554_132156
1575 Ga0500556_0000513
1576 Ga0500593_000011
1577 Ga0500573_0002317
1578 Ga0501084_0022279
1579 Ga0501084_0038788
1580 Ga0501084_0078755
1581 Ga0501084_0132331
1582 Ga0501082_0006936
1583 Ga0501082_0070033
1584 Ga0501082_0255617
1585 Ga0501082_0284484
1586 Ga0501082_0565631
1587 Ga0466962_0601553
1588 Ga0530510_0069780
1589 2644093629
1590 2644230093
1591 2644323471
1592 2857486139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kqv-assembly1.cif.gz_A topoisomerase iv atp binding domain of francisella tularensis in complex with a small molecule inhibitor 0.7259 67 82
1s14-assembly2.cif.gz_B crystal structure of escherichia coli topoisomerase iv pare 24kda subunit 0.6836 67 82
6ywc-assembly2.cif.gz_F de novo designed protein 4e1h_95 in complex with 101f antibody 0.6148 19 81
6ywc-assembly2.cif.gz_F de novo designed protein 4e1h_95 in complex with 101f antibody 0.6012 19 81
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.5342 20 84
ID Description Score Start End Superfamily
af_P9WQ61_9_386_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6781 19 33 3.40.50.12780
af_A0A0R0J2N0_16_130_2.90.10.30 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A; 0.6475 67 81 2.90.10.30
3lmlA03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5906 67 82 2.60.40.4290
af_A0A0R4IRZ4_38_132_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.578 67 83 2.60.40.10
af_Q2FYV6_1_191_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.5271 19 78 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A3D9V2C2-F1-model_v4 Uncharacterized protein 0.9737 20 85
AF-A0A6P0HF73-F1-model_v4 DUF2188 domain-containing protein 0.9733 20 85
AF-D2PYY3-F1-model_v4 Uncharacterized protein 0.9669 20 85
AF-A0A2G6HDG5-F1-model_v4 Uncharacterized protein 0.9657 17 85
AF-A0A2S6GVI7-F1-model_v4 Uncharacterized protein 0.9627 20 85

Map