F481171

General Info

Members Datasets Scaffolds Average Seq Length
796 351 1592 117

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10086846|Ga0070658_100868462
Length 119
Sequence MLTAHHTVAFLVLAATFGSALFAGWTYYRRAEPRGWLTHLLALAQTLVVAQVGIGLLLLSDHRRAPEHLHYLYGSLSLLAVLSPWLYAPAERRRRLAWFAGSTLVAGALAVRAYMTGVG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 8.92
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10086846 3300005327 Bacteria 2573
2 JGI24747J21853_1020963 3300001978 Unclassified 711
3 JGI24743J22301_10041700 3300001991 Bacteria 923
4 JGI24744J21845_10007363 3300002077 Bacteria 2273
5 JGI24742J22300_10014706 3300002244 Bacteria 1314
6 Ga0070658_10254974 3300005327 Bacteria 1489
7 Ga0070658_10267597 3300005327 Bacteria 1453
8 Ga0070658_10327617 3300005327 Bacteria 1308
9 Ga0070683_100002174 3300005329 Bacteria 15507
10 Ga0070683_100007005 3300005329 Bacteria 9488
11 Ga0070683_100027227 3300005329 Bacteria 5155
12 Ga0070683_100032081 3300005329 Bacteria 4781
13 Ga0070683_100153695 3300005329 Bacteria 2182
14 Ga0070683_100229830 3300005329 Bacteria 1763
15 Ga0070690_100018638 3300005330 Bacteria 4196
16 Ga0068869_100415966 3300005334 Unclassified 1108
17 Ga0070666_10015946 3300005335 Bacteria 4800
18 Ga0070680_100076774 3300005336 Bacteria 2750
19 Ga0070680_100724623 3300005336 Bacteria 856
20 Ga0070682_100591724 3300005337 Bacteria 874
21 Ga0068868_100040385 3300005338 Bacteria 3632
22 Ga0068868_100058300 3300005338 Bacteria 3051
23 Ga0068868_101149589 3300005338 Bacteria 716
24 Ga0070660_100024497 3300005339 Bacteria 4477
25 Ga0070660_100040297 3300005339 Bacteria 3554
26 Ga0070660_100093671 3300005339 Bacteria 2372
27 Ga0070660_100110698 3300005339 Bacteria 2184
28 Ga0070660_100127570 3300005339 Bacteria 2034
29 Ga0070689_100060981 3300005340 Bacteria 2933
30 Ga0070691_10033871 3300005341 Bacteria 2404
31 Ga0070691_10734106 3300005341 Bacteria 596
32 Ga0070687_100198602 3300005343 Bacteria 1214
33 Ga0070687_100307240 3300005343 Unclassified 1008
34 Ga0070661_100034760 3300005344 Bacteria 3657
35 Ga0070692_10016534 3300005345 Bacteria 3509
36 Ga0070675_100119459 3300005354 Bacteria 2239
37 Ga0070674_100470193 3300005356 Bacteria 1041
38 Ga0070673_100053736 3300005364 Bacteria 3166
39 Ga0070673_100251992 3300005364 Unclassified 1539
40 Ga0070688_100023058 3300005365 Bacteria 3656
41 Ga0070688_100339198 3300005365 Bacteria 1097
42 Ga0070659_100023849 3300005366 Bacteria 4685
43 Ga0070659_100751462 3300005366 Bacteria 846
44 Ga0070659_101379531 3300005366 Unclassified 626
45 Ga0070703_10047451 3300005406 Bacteria 1361
46 Ga0070709_10002248 3300005434 Bacteria 10466
47 Ga0070709_10059196 3300005434 Bacteria 2431
48 Ga0070709_10637473 3300005434 Unclassified 824
49 Ga0070709_11728933 3300005434 Unclassified 511
50 Ga0070714_100009381 3300005435 Bacteria 7689
51 Ga0070714_100017559 3300005435 Bacteria 5799
52 Ga0070714_100023254 3300005435 Bacteria 5088
53 Ga0070714_100043526 3300005435 Bacteria 3797
54 Ga0070714_100110604 3300005435 Bacteria 2432
55 Ga0070714_100198403 3300005435 Bacteria 1835
56 Ga0070714_100835271 3300005435 Bacteria 893
57 Ga0070714_101562835 3300005435 Bacteria 644
58 Ga0070713_100059847 3300005436 Bacteria 3183
59 Ga0070713_100250144 3300005436 Bacteria 1616
60 Ga0070713_100561474 3300005436 Bacteria 1082
61 Ga0070713_100808393 3300005436 Bacteria 899
62 Ga0070710_10003144 3300005437 Bacteria 7831
63 Ga0070710_10268244 3300005437 Bacteria 1103
64 Ga0070711_100113551 3300005439 Unclassified 1992
65 Ga0070711_100197543 3300005439 Unclassified 1550
66 Ga0070711_101095056 3300005439 Unclassified 686
67 Ga0070711_101976804 3300005439 Bacteria 513
68 Ga0070705_100181109 3300005440 Bacteria 1427
69 Ga0070705_101552027 3300005440 Unclassified 556
70 Ga0070705_101605144 3300005440 Unclassified 547
71 Ga0070700_100299137 3300005441 Bacteria 1174
72 Ga0070700_101121989 3300005441 Bacteria 653
73 Ga0070700_101750964 3300005441 Bacteria 534
74 Ga0070694_100210537 3300005444 Bacteria 1454
75 Ga0070708_100656523 3300005445 Bacteria 988
76 Ga0070708_100707711 3300005445 Bacteria 948
77 Ga0070708_101359754 3300005445 Bacteria 663
78 Ga0070663_100020415 3300005455 Bacteria 4387
79 Ga0070663_100314755 3300005455 Bacteria 1257
80 Ga0070663_101109398 3300005455 Bacteria 692
81 Ga0070678_100034089 3300005456 Bacteria 3542
82 Ga0070662_100448284 3300005457 Bacteria 1071
83 Ga0070662_100550383 3300005457 Unclassified 967
84 Ga0070662_100683817 3300005457 Bacteria 867
85 Ga0070681_10132845 3300005458 Bacteria 2421
86 Ga0070681_10262570 3300005458 Bacteria 1639
87 Ga0070681_10750277 3300005458 Bacteria 893
88 Ga0068867_100385338 3300005459 Bacteria 1178
89 Ga0070685_10019059 3300005466 Bacteria 3698
90 Ga0070706_100039349 3300005467 Bacteria 4365
91 Ga0070706_100586584 3300005467 Unclassified 1036
92 Ga0070707_100000611 3300005468 Bacteria 35834
93 Ga0070707_100574313 3300005468 Bacteria 1090
94 Ga0070707_100625971 3300005468 Bacteria 1039
95 Ga0070707_100680043 3300005468 Bacteria 992
96 Ga0070698_100019082 3300005471 Bacteria 7209
97 Ga0070698_100054768 3300005471 Bacteria 4049
98 Ga0070699_100006050 3300005518 Bacteria 10579
99 Ga0070699_100223147 3300005518 Bacteria 1680
100 Ga0070699_100292820 3300005518 Bacteria 1460
101 Ga0070699_100345956 3300005518 Bacteria 1339
102 Ga0070679_100054350 3300005530 Bacteria 3986
103 Ga0070679_100130752 3300005530 Bacteria 2492
104 Ga0070679_100194174 3300005530 Bacteria 1998
105 Ga0070679_100292201 3300005530 Bacteria 1581
106 Ga0070679_100525124 3300005530 Bacteria 1128
107 Ga0070679_100585840 3300005530 Bacteria 1059
108 Ga0070684_100003754 3300005535 Bacteria 11465
109 Ga0070684_100007102 3300005535 Bacteria 8703
110 Ga0070684_100009078 3300005535 Bacteria 7816
111 Ga0070684_100069289 3300005535 Bacteria 3102
112 Ga0070684_100138359 3300005535 Bacteria 2201
113 Ga0070684_100482908 3300005535 Bacteria 1147
114 Ga0070684_100697813 3300005535 Bacteria 946
115 Ga0070684_100747308 3300005535 Bacteria 913
116 Ga0070697_100135026 3300005536 Bacteria 2071
117 Ga0068853_100212140 3300005539 Bacteria 1765
118 Ga0070672_100100192 3300005543 Bacteria 2349
119 Ga0070686_100006071 3300005544 Bacteria 6702
120 Ga0070686_101718081 3300005544 Bacteria 533
121 Ga0070695_100130976 3300005545 Bacteria 1729
122 Ga0070696_101530166 3300005546 Bacteria 572
123 Ga0070693_100074129 3300005547 Bacteria 2012
124 Ga0070693_100168414 3300005547 Bacteria 1401
125 Ga0070693_100442769 3300005547 Bacteria 910
126 Ga0070665_100367376 3300005548 Bacteria 1445
127 Ga0070704_100103519 3300005549 Bacteria 2151
128 Ga0070704_100388550 3300005549 Bacteria 1188
129 Ga0070704_100719588 3300005549 Bacteria 887
130 Ga0068855_100002523 3300005563 Bacteria 22549
131 Ga0068855_100090415 3300005563 Bacteria 3533
132 Ga0068855_100252281 3300005563 Bacteria 1968
133 Ga0068855_100799153 3300005563 Bacteria 1003
134 Ga0068857_100005906 3300005577 Bacteria 10455
135 Ga0068857_100022277 3300005577 Bacteria 5573
136 Ga0068857_100255347 3300005577 Bacteria 1608
137 Ga0068854_100185423 3300005578 Bacteria 1627
138 Ga0068856_100031082 3300005614 Bacteria 5222
139 Ga0068856_100036455 3300005614 Bacteria 4821
140 Ga0068856_100293039 3300005614 Bacteria 1644
141 Ga0070702_100051604 3300005615 Bacteria 2355
142 Ga0070702_100621321 3300005615 Bacteria 813
143 Ga0070702_101466168 3300005615 Unclassified 560
144 Ga0068852_100144161 3300005616 Bacteria 2207
145 Ga0068852_100431479 3300005616 Bacteria 1301
146 Ga0068859_100145872 3300005617 Bacteria 2442
147 Ga0068866_10002557 3300005718 Bacteria 7501
148 Ga0068861_100081226 3300005719 Bacteria 2538
149 Ga0068851_10347373 3300005834 Unclassified 862
150 Ga0068851_10866498 3300005834 Bacteria 564
151 Ga0068863_100059344 3300005841 Bacteria 3620
152 Ga0068863_100376650 3300005841 Bacteria 1385
153 Ga0068858_102371383 3300005842 Archaea 524
154 Ga0068860_100266501 3300005843 Bacteria 1671
155 Ga0068860_101399333 3300005843 Bacteria 721
156 Ga0081538_10000920 3300005981 Bacteria 31733
157 Ga0081540_1010557 3300005983 Bacteria 6239
158 Ga0070717_10018101 3300006028 Bacteria 5495
159 Ga0070717_10020688 3300006028 Bacteria 5180
160 Ga0070717_10045156 3300006028 Bacteria 3601
161 Ga0070717_10631060 3300006028 Bacteria 972
162 Ga0070717_10891460 3300006028 Bacteria 810
163 Ga0075365_10049665 3300006038 Bacteria 2764
164 Ga0070715_10016472 3300006163 Bacteria 2778
165 Ga0070715_10711901 3300006163 Bacteria 601
166 Ga0070716_100001423 3300006173 Bacteria 10637
167 Ga0070716_100294411 3300006173 Unclassified 1126
168 Ga0070716_100498003 3300006173 Bacteria 898
169 Ga0070716_100549027 3300006173 Bacteria 861
170 Ga0070712_100251794 3300006175 Bacteria 1412
171 Ga0070712_100565259 3300006175 Bacteria 959
172 Ga0070712_101356448 3300006175 Bacteria 620
173 Ga0097621_100041768 3300006237 Bacteria 3693
174 Ga0097621_101212290 3300006237 Bacteria 711
175 Ga0068871_100044336 3300006358 Bacteria 3576
176 Ga0075428_101920384 3300006844 Bacteria 615
177 Ga0075430_100160429 3300006846 Bacteria 1872
178 Ga0075433_10001459 3300006852 Bacteria 17478
179 Ga0075433_10565261 3300006852 Unclassified 999
180 Ga0075433_11783412 3300006852 Unclassified 529
181 Ga0075434_100002293 3300006871 Bacteria 16731
182 Ga0075434_100004585 3300006871 Bacteria 12478
183 Ga0075434_100216953 3300006871 Bacteria 1933
184 Ga0075429_100608184 3300006880 Bacteria 958
185 Ga0068865_100002869 3300006881 Bacteria 10269
186 Ga0068865_100076199 3300006881 Bacteria 2393
187 Ga0068865_100859993 3300006881 Bacteria 786
188 Ga0075436_100080478 3300006914 Unclassified 2257
189 Ga0075436_100100194 3300006914 Unclassified 2017
190 Ga0075436_100389179 3300006914 Unclassified 1009
191 Ga0097620_100145876 3300006931 Bacteria 2442
192 Ga0075435_100006390 3300007076 Bacteria 8330
193 Ga0105240_10044922 3300009093 Bacteria 5608
194 Ga0105240_10505459 3300009093 Bacteria 1343
195 Ga0105240_10541709 3300009093 Bacteria 1289
196 Ga0105240_10949588 3300009093 Bacteria 922
197 Ga0105240_11688069 3300009093 Unclassified 661
198 Ga0105240_12218077 3300009093 Bacteria 569
199 Ga0111539_10046429 3300009094 Bacteria 5195
200 Ga0111539_10182978 3300009094 Bacteria 2447
201 Ga0111539_10189190 3300009094 Bacteria 2402
202 Ga0111539_10633055 3300009094 Bacteria 1245
203 Ga0111539_11563666 3300009094 Bacteria 765
204 Ga0105245_10019390 3300009098 Bacteria 5957
205 Ga0105245_10084953 3300009098 Bacteria 2900
206 Ga0105245_10095370 3300009098 Bacteria 2744
207 Ga0105245_10166303 3300009098 Bacteria 2097
208 Ga0105245_10339121 3300009098 Bacteria 1486
209 Ga0105245_12808239 3300009098 Bacteria 540
210 Ga0114129_10042981 3300009147 Bacteria 6360
211 Ga0114129_10209028 3300009147 Bacteria 2639
212 Ga0114129_10360302 3300009147 Bacteria 1924
213 Ga0114129_10549799 3300009147 Bacteria 1501
214 Ga0114129_11585284 3300009147 Bacteria 802
215 Ga0105243_10048686 3300009148 Bacteria 3342
216 Ga0105243_10086057 3300009148 Bacteria 2577
217 Ga0105241_10064351 3300009174 Bacteria 2831
218 Ga0105241_10677662 3300009174 Bacteria 939
219 Ga0105242_10011188 3300009176 Bacteria 6894
220 Ga0105242_10774560 3300009176 Bacteria 947
221 Ga0105248_10153185 3300009177 Bacteria 2601
222 Ga0105237_10979576 3300009545 Unclassified 852
223 Ga0105238_10259322 3300009551 Bacteria 1718
224 Ga0105238_10472460 3300009551 Bacteria 1252
225 Ga0105238_12178389 3300009551 Bacteria 589
226 Ga0105249_10005879 3300009553 Bacteria 10619
227 Ga0105239_10020449 3300010375 Bacteria 7301
228 Ga0105239_10324903 3300010375 Bacteria 1735
229 Ga0105239_10463771 3300010375 Bacteria 1438
230 Ga0105246_10074477 3300011119 Bacteria 2400
231 Ga0105246_11231726 3300011119 Bacteria 690
232 Ga0157373_10198661 3300013100 Bacteria 1414
233 Ga0157371_10632478 3300013102 Bacteria 798
234 Ga0157371_11577018 3300013102 Bacteria 513
235 Ga0157370_10016007 3300013104 Bacteria 7607
236 Ga0157370_10742691 3300013104 Bacteria 894
237 Ga0157369_10001145 3300013105 Bacteria 33059
238 Ga0157369_10184569 3300013105 Bacteria 2194
239 Ga0157369_10241957 3300013105 Bacteria 1885
240 Ga0157369_10252806 3300013105 Bacteria 1839
241 Ga0157369_10416448 3300013105 Bacteria 1393
242 Ga0157369_11863010 3300013105 Unclassified 611
243 Ga0157369_12550029 3300013105 Unclassified 517
244 Ga0157374_10032132 3300013296 Bacteria 4777
245 Ga0157374_10064268 3300013296 Bacteria 3443
246 Ga0157374_10175811 3300013296 Bacteria 2090
247 Ga0157374_10311029 3300013296 Bacteria 1560
248 Ga0157378_10149082 3300013297 Bacteria 2178
249 Ga0163162_10003474 3300013306 Bacteria 15059
250 Ga0163162_10036942 3300013306 Bacteria 4872
251 Ga0157372_10475734 3300013307 Bacteria 1456
252 Ga0157372_10695029 3300013307 Bacteria 1184
253 Ga0157372_10714309 3300013307 Bacteria 1166
254 Ga0157372_11505380 3300013307 Bacteria 775
255 Ga0157375_10007441 3300013308 Bacteria 9583
256 Ga0157375_10145679 3300013308 Bacteria 2499
257 Ga0157375_10260642 3300013308 Bacteria 1895
258 Ga0163163_10446370 3300014325 Bacteria 1353
259 Ga0163163_11292143 3300014325 Unclassified 792
260 Ga0163163_11338414 3300014325 Bacteria 778
261 Ga0182008_10005010 3300014497 Bacteria 7623
262 Ga0182008_10109160 3300014497 Bacteria 1370
263 Ga0182008_10283426 3300014497 Bacteria 863
264 Ga0157377_10008543 3300014745 Bacteria 4998
265 Ga0157377_10274989 3300014745 Bacteria 1101
266 Ga0157379_10657673 3300014968 Bacteria 981
267 Ga0157379_10993588 3300014968 Unclassified 800
268 Ga0157376_10013902 3300014969 Bacteria 6019
269 Ga0157376_10067013 3300014969 Bacteria 3036
270 Ga0157376_10541533 3300014969 Bacteria 1151
271 Ga0182006_1020759 3300015261 Bacteria 2748
272 Ga0182007_10098037 3300015262 Bacteria 969
273 Ga0197907_11071902 3300020069 Bacteria 918
274 Ga0206356_10187915 3300020070 Bacteria 8163
275 Ga0206354_10237964 3300020081 Bacteria 2860
276 Ga0206354_10899858 3300020081 Bacteria 4397
277 Ga0206353_11705978 3300020082 Bacteria 4600
278 Ga0206353_11815803 3300020082 Bacteria 598
279 Ga0213873_10191647 3300021358 Bacteria 631
280 Ga0224712_10293829 3300022467 Bacteria 759
281 Ga0207656_10436895 3300025321 Unclassified 660
282 Ga0207653_10017213 3300025885 Bacteria 2273
283 Ga0207692_10037157 3300025898 Bacteria 2380
284 Ga0207692_10188022 3300025898 Bacteria 1207
285 Ga0207692_10702990 3300025898 Bacteria 656
286 Ga0207642_10013952 3300025899 Bacteria 2948
287 Ga0207680_10009969 3300025903 Bacteria 4734
288 Ga0207680_10790912 3300025903 Unclassified 680
289 Ga0207647_10035203 3300025904 Bacteria 3192
290 Ga0207647_10095096 3300025904 Bacteria 1774
291 Ga0207685_10001078 3300025905 Bacteria 5377
292 Ga0207699_10003253 3300025906 Bacteria 7740
293 Ga0207699_10084519 3300025906 Bacteria 1977
294 Ga0207699_10652032 3300025906 Bacteria 769
295 Ga0207699_11058807 3300025906 Unclassified 600
296 Ga0207705_10105927 3300025909 Bacteria 2073
297 Ga0207705_10171817 3300025909 Bacteria 1632
298 Ga0207705_10211954 3300025909 Bacteria 1469
299 Ga0207705_11216301 3300025909 Bacteria 577
300 Ga0207684_10072987 3300025910 Bacteria 2915
301 Ga0207654_10140683 3300025911 Bacteria 1538
302 Ga0207707_10140333 3300025912 Bacteria 2113
303 Ga0207707_10238674 3300025912 Bacteria 1581
304 Ga0207707_10260419 3300025912 Bacteria 1505
305 Ga0207707_10428582 3300025912 Bacteria 1133
306 Ga0207707_10497927 3300025912 Bacteria 1039
307 Ga0207707_10824578 3300025912 Bacteria 771
308 Ga0207695_10210584 3300025913 Bacteria 1855
309 Ga0207695_11577279 3300025913 Bacteria 537
310 Ga0207693_10000814 3300025915 Bacteria 27803
311 Ga0207693_10003318 3300025915 Bacteria 13770
312 Ga0207693_10204618 3300025915 Bacteria 1552
313 Ga0207663_10063340 3300025916 Bacteria 2354
314 Ga0207663_10329325 3300025916 Bacteria 1150
315 Ga0207663_10649043 3300025916 Unclassified 833
316 Ga0207660_10026819 3300025917 Bacteria 3926
317 Ga0207662_10150052 3300025918 Bacteria 1482
318 Ga0207657_10002763 3300025919 Bacteria 18897
319 Ga0207657_10008349 3300025919 Bacteria 10518
320 Ga0207657_10017954 3300025919 Bacteria 6770
321 Ga0207657_10025794 3300025919 Bacteria 5413
322 Ga0207657_10147158 3300025919 Bacteria 1921
323 Ga0207657_10655569 3300025919 Bacteria 817
324 Ga0207649_10031406 3300025920 Bacteria 3156
325 Ga0207652_10176663 3300025921 Bacteria 1918
326 Ga0207652_10346143 3300025921 Bacteria 1342
327 Ga0207652_10802554 3300025921 Bacteria 836
328 Ga0207652_10877357 3300025921 Bacteria 793
329 Ga0207646_10004447 3300025922 Bacteria 15200
330 Ga0207646_10376193 3300025922 Bacteria 1283
331 Ga0207694_10379190 3300025924 Bacteria 1174
332 Ga0207694_10402406 3300025924 Bacteria 1138
333 Ga0207659_10701417 3300025926 Bacteria 867
334 Ga0207687_10018726 3300025927 Bacteria 4576
335 Ga0207687_10062421 3300025927 Bacteria 2635
336 Ga0207687_10105792 3300025927 Bacteria 2079
337 Ga0207700_10062715 3300025928 Bacteria 2824
338 Ga0207700_10101223 3300025928 Unclassified 2298
339 Ga0207664_10003856 3300025929 Bacteria 10075
340 Ga0207664_10006140 3300025929 Bacteria 8235
341 Ga0207664_10067108 3300025929 Bacteria 2878
342 Ga0207664_10085365 3300025929 Bacteria 2576
343 Ga0207664_10290446 3300025929 Bacteria 1437
344 Ga0207664_10433246 3300025929 Bacteria 1172
345 Ga0207664_10753412 3300025929 Bacteria 876
346 Ga0207664_10899075 3300025929 Unclassified 795
347 Ga0207664_11166739 3300025929 Bacteria 687
348 Ga0207644_10079831 3300025931 Bacteria 2415
349 Ga0207644_11407960 3300025931 Bacteria 586
350 Ga0207690_10096878 3300025932 Bacteria 2098
351 Ga0207706_10502973 3300025933 Bacteria 1046
352 Ga0207706_11720434 3300025933 Bacteria 504
353 Ga0207686_10007082 3300025934 Bacteria 6035
354 Ga0207686_10504296 3300025934 Bacteria 939
355 Ga0207709_10021221 3300025935 Bacteria 3674
356 Ga0207709_10063804 3300025935 Bacteria 2310
357 Ga0207670_10079919 3300025936 Bacteria 2284
358 Ga0207669_10012731 3300025937 Bacteria 4147
359 Ga0207669_10448723 3300025937 Unclassified 1022
360 Ga0207704_11069573 3300025938 Bacteria 685
361 Ga0207665_10000247 3300025939 Bacteria 37247
362 Ga0207665_10425665 3300025939 Unclassified 1015
363 Ga0207665_10497796 3300025939 Bacteria 941
364 Ga0207691_10008375 3300025940 Bacteria 9935
365 Ga0207691_10321524 3300025940 Bacteria 1327
366 Ga0207691_11430872 3300025940 Bacteria 567
367 Ga0207689_10140997 3300025942 Bacteria 1985
368 Ga0207661_10020009 3300025944 Bacteria 4997
369 Ga0207661_10152603 3300025944 Bacteria 1998
370 Ga0207667_10185472 3300025949 Bacteria 2136
371 Ga0207667_10299231 3300025949 Bacteria 1644
372 Ga0207667_10812713 3300025949 Bacteria 931
373 Ga0207667_11405682 3300025949 Bacteria 671
374 Ga0207651_10032679 3300025960 Bacteria 3346
375 Ga0207651_11261280 3300025960 Unclassified 664
376 Ga0207651_11445375 3300025960 Unclassified 619
377 Ga0207712_10063315 3300025961 Bacteria 2633
378 Ga0207668_10014975 3300025972 Bacteria 4811
379 Ga0207640_10254149 3300025981 Bacteria 1366
380 Ga0207640_11834036 3300025981 Unclassified 548
381 Ga0207677_10081056 3300026023 Bacteria 2327
382 Ga0207677_10290022 3300026023 Bacteria 1347
383 Ga0207677_11034051 3300026023 Bacteria 746
384 Ga0207677_11150615 3300026023 Bacteria 709
385 Ga0207703_10865107 3300026035 Bacteria 865
386 Ga0207703_11706024 3300026035 Unclassified 606
387 Ga0207639_10182870 3300026041 Bacteria 1784
388 Ga0207639_11439322 3300026041 Bacteria 647
389 Ga0207678_10004762 3300026067 Bacteria 12181
390 Ga0207708_10004475 3300026075 Bacteria 10297
391 Ga0207708_10423206 3300026075 Bacteria 1105
392 Ga0207702_10183642 3300026078 Bacteria 1928
393 Ga0207702_10553703 3300026078 Bacteria 1125
394 Ga0207702_11028696 3300026078 Bacteria 817
395 Ga0207641_10275956 3300026088 Bacteria 1579
396 Ga0207648_10001302 3300026089 Bacteria 27791
397 Ga0207648_11636855 3300026089 Bacteria 605
398 Ga0207674_10001533 3300026116 Bacteria 29751
399 Ga0207674_10034811 3300026116 Bacteria 5260
400 Ga0207674_10100647 3300026116 Bacteria 2871
401 Ga0207674_10753689 3300026116 Bacteria 940
402 Ga0207675_100296418 3300026118 Unclassified 1574
403 Ga0207675_100672645 3300026118 Bacteria 1042
404 Ga0207683_10007185 3300026121 Bacteria 9546
405 Ga0207698_10330138 3300026142 Bacteria 1432
406 Ga0207428_10750056 3300027907 Unclassified 696
407 Ga0207428_11172061 3300027907 Unclassified 535
408 Ga0268266_10036678 3300028379 Bacteria 4175
409 Ga0268264_10031903 3300028381 Bacteria 4322
410 Ga0268264_10264738 3300028381 Bacteria 1603
411 Ga0265326_10018189 3300028558 Bacteria 2024
412 Ga0265319_1001384 3300028563 Bacteria 14568
413 Ga0265319_1077458 3300028563 Bacteria 1059
414 Ga0265334_10021458 3300028573 Bacteria 2637
415 Ga0265318_10001537 3300028577 Bacteria 13437
416 Ga0265322_10076010 3300028654 Bacteria 953
417 Ga0265322_10109855 3300028654 Bacteria 785
418 Ga0265336_10056286 3300028666 Bacteria 1182
419 Ga0265338_10038481 3300028800 Bacteria 4531
420 Ga0265338_10068482 3300028800 Bacteria 3057
421 Ga0265338_10113659 3300028800 Bacteria 2175
422 Ga0265338_10160831 3300028800 Bacteria 1734
423 Ga0265338_10249115 3300028800 Bacteria 1311
424 Ga0265328_10069565 3300031239 Bacteria 1294
425 Ga0265320_10009710 3300031240 Bacteria 5776
426 Ga0265325_10228884 3300031241 Bacteria 848
427 Ga0265329_10042198 3300031242 Bacteria 1461
428 Ga0265340_10046505 3300031247 Bacteria 2117
429 Ga0265339_10146978 3300031249 Bacteria 1195
430 Ga0265327_10014563 3300031251 Bacteria 5134
431 Ga0265327_10035657 3300031251 Bacteria 2746
432 Ga0265327_10371050 3300031251 Bacteria 623
433 Ga0265316_10009220 3300031344 Bacteria 9089
434 Ga0265314_10017989 3300031711 Bacteria 5529
435 Ga0265342_10419204 3300031712 Bacteria 690
436 Ga0316583_10039828 3300032133 Bacteria 1664
437 Ga0373958_0109951 3300034819 Unclassified 656
438 Ga0373938_0160693 3300034957 Bacteria 603
439 Ga0373928_0153139 3300035084 Unclassified 640
440 Ga0373934_0230680 3300035086 Bacteria 764
441 Ga0373953_0070444 3300035117 Bacteria 1442
442 Ga0373954_0426848 3300035118 Bacteria 656
443 Ga0373956_0343775 3300035119 Bacteria 711
444 Ga0373957_0441695 3300035120 Bacteria 563
445 Ga0373960_0021546 3300035121 Bacteria 1715
446 Ga0373955_0195257 3300035172 Bacteria 1204
447 Ga0373962_0084204 3300035242 Unclassified 970
448 Ga0373924_0186320 3300035410 Bacteria 914
449 Ga0373931_0004446 3300035691 Bacteria 6405
450 Ga0373935_0028717 3300035692 Bacteria 3438
451 Ga0373935_0186990 3300035692 Unclassified 1425
452 Ga0373933_0726899 3300035724 Bacteria 653
453 Ga0373937_0046778 3300036401 Bacteria 3957
454 Ga0373937_0839164 3300036401 Bacteria 867
455 Ga0395899_0002521 3300037312 Bacteria 14832
456 Ga0395899_0123867 3300037312 Bacteria 1849
457 Ga0395899_0174399 3300037312 Bacteria 1513
458 Ga0395899_0216246 3300037312 Unclassified 1329
459 Ga0395899_0293575 3300037312 Bacteria 1102
460 Ga0395899_0486466 3300037312 Bacteria 803
461 Ga0395900_0003640 3300037418 Bacteria 16567
462 Ga0395900_0007650 3300037418 Bacteria 11155
463 Ga0395900_0019764 3300037418 Bacteria 6865
464 Ga0395900_0063763 3300037418 Bacteria 3787
465 Ga0395900_0115973 3300037418 Bacteria 2748
466 Ga0395900_0155976 3300037418 Bacteria 2331
467 Ga0395900_0273030 3300037418 Bacteria 1685
468 Ga0395900_0492961 3300037418 Bacteria 1176
469 Ga0395900_0549314 3300037418 Bacteria 1100
470 Ga0395900_0802193 3300037418 Bacteria 869
471 Ga0395900_1061155 3300037418 Unclassified 728
472 Ga0395900_1214257 3300037418 Bacteria 669
473 Ga0395900_1264005 3300037418 Bacteria 653
474 Ga0395898_0005071 3300037466 Bacteria 14280
475 Ga0395898_0037166 3300037466 Bacteria 4832
476 Ga0395898_0040576 3300037466 Bacteria 4602
477 Ga0395898_0054295 3300037466 Bacteria 3910
478 Ga0395898_0093454 3300037466 Bacteria 2890
479 Ga0395898_0304034 3300037466 Bacteria 1521
480 Ga0395898_0464034 3300037466 Bacteria 1205
481 Ga0395898_0683968 3300037466 Bacteria 968
482 Ga0395898_0752685 3300037466 Bacteria 915
483 Ga0395898_0759652 3300037466 Bacteria 911
484 Ga0395898_0783390 3300037466 Bacteria 894
485 Ga0395898_1331158 3300037466 Unclassified 647
486 Ga0395905_0000656 3300037471 Bacteria 46034
487 Ga0395905_0007092 3300037471 Bacteria 11202
488 Ga0395905_0021662 3300037471 Bacteria 6080
489 Ga0395905_0031997 3300037471 Bacteria 4948
490 Ga0395905_0075586 3300037471 Bacteria 3157
491 Ga0395905_0123249 3300037471 Bacteria 2437
492 Ga0395905_0396281 3300037471 Bacteria 1275
493 Ga0395905_0464732 3300037471 Bacteria 1164
494 Ga0395905_0695101 3300037471 Bacteria 919
495 Ga0395905_0795835 3300037471 Bacteria 848
496 Ga0395905_1072542 3300037471 Bacteria 709
497 Ga0395901_0000720 3300038443 Bacteria 37616
498 Ga0395901_0007345 3300038443 Bacteria 11121
499 Ga0395901_0021765 3300038443 Bacteria 6570
500 Ga0395901_0039268 3300038443 Bacteria 4898
501 Ga0395901_0039473 3300038443 Bacteria 4885
502 Ga0395901_0105389 3300038443 Bacteria 2959
503 Ga0395901_0113266 3300038443 Bacteria 2848
504 Ga0395901_0114293 3300038443 Bacteria 2835
505 Ga0395901_0125111 3300038443 Bacteria 2701
506 Ga0395901_0160450 3300038443 Bacteria 2361
507 Ga0395901_0379409 3300038443 Bacteria 1455
508 Ga0395901_1188866 3300038443 Archaea 729
509 Ga0395901_1714104 3300038443 Bacteria 579
510 Ga0436360_0668708 3300039438 Bacteria 2048
511 Ga0436362_0287203 3300039453 Bacteria 653
512 Ga0451791_1721870 3300041451 Unclassified 534
513 Ga0451802_0362203 3300041460 Unclassified 539
514 Ga0451839_0053667 3300041496 Unclassified 687
515 Ga0451853_1864501 3300041512 Bacteria 2891
516 Ga0466965_0760100 3300044683 Bacteria 559
517 Ga0466966_0018954 3300044684 Bacteria 4534
518 Ga0466961_0106741 3300044693 Bacteria 1763
519 Ga0466963_0001342 3300044694 Bacteria 13125
520 Ga0466963_0014355 3300044694 Bacteria 4884
521 Ga0466963_0031609 3300044694 Bacteria 3423
522 Ga0466963_0161532 3300044694 Bacteria 1559
523 Ga0466963_0205833 3300044694 Bacteria 1376
524 Ga0466963_0400899 3300044694 Bacteria 967
525 Ga0466963_0948513 3300044694 Bacteria 606
526 Ga0466963_1003233 3300044694 Bacteria 588
527 Ga0466963_1347369 3300044694 Unclassified 501
528 Ga0466964_0594729 3300044706 Unclassified 606
529 Ga0466971_0001500 3300044719 Bacteria 9848
530 Ga0466971_0215513 3300044719 Bacteria 909
531 Ga0466971_0241610 3300044719 Bacteria 859
532 Ga0466957_0024931 3300044842 Bacteria 3543
533 Ga0466957_0055159 3300044842 Bacteria 2428
534 Ga0466957_0080697 3300044842 Bacteria 2025
535 Ga0466957_0325361 3300044842 Bacteria 1038
536 Ga0466957_1147329 3300044842 Bacteria 561
537 Ga0466959_0052831 3300045049 Bacteria 2974
538 Ga0466959_0265075 3300045049 Bacteria 1182
539 Ga0466959_0427263 3300045049 Bacteria 899
540 Ga0466959_0511997 3300045049 Bacteria 811
541 Ga0451576_2689072 3300045051 Bacteria 507
542 Ga0466958_0009017 3300045836 Bacteria 5539
543 Ga0466958_0030336 3300045836 Bacteria 3211
544 Ga0466958_0092501 3300045836 Bacteria 1872
545 Ga0466958_0183682 3300045836 Bacteria 1327
546 Ga0466967_0003278 3300045976 Bacteria 10495
547 Ga0466967_0070370 3300045976 Bacteria 3130
548 Ga0466967_0088975 3300045976 Bacteria 2803
549 Ga0466967_0099783 3300045976 Bacteria 2652
550 Ga0466967_0292790 3300045976 Bacteria 1564
551 Ga0466967_0505462 3300045976 Bacteria 1186
552 Ga0495627_135648 3300046453 Bacteria 691
553 Ga0495592_0439702 3300046454 Bacteria 819
554 Ga0495603_0007431 3300046455 Bacteria 6590
555 Ga0495603_0052438 3300046455 Bacteria 2422
556 Ga0495603_0169577 3300046455 Bacteria 1264
557 Ga0495641_0041463 3300046461 Bacteria 2138
558 Ga0495641_0044029 3300046461 Bacteria 2062
559 Ga0495641_0044682 3300046461 Unclassified 2042
560 Ga0495653_0067957 3300046463 Bacteria 2674
561 Ga0495582_0007333 3300046473 Bacteria 6111
562 Ga0495582_0102284 3300046473 Unclassified 1605
563 Ga0495582_0185083 3300046473 Bacteria 1187
564 Ga0495605_0065318 3300046474 Bacteria 1731
565 Ga0495639_0043029 3300046475 Bacteria 2039
566 Ga0495639_0087468 3300046475 Bacteria 1458
567 Ga0495584_0040584 3300046491 Bacteria 2350
568 Ga0495584_0113214 3300046491 Unclassified 1373
569 Ga0495594_0145019 3300046499 Bacteria 1347
570 Ga0495594_0566532 3300046499 Bacteria 644
571 Ga0495596_0015796 3300046500 Bacteria 3151
572 Ga0495596_0449657 3300046500 Bacteria 503
573 Ga0495607_0275025 3300046501 Unclassified 801
574 Ga0495608_0028929 3300046511 Bacteria 3764
575 Ga0495620_0248297 3300046515 Bacteria 679
576 Ga0495630_0487330 3300046517 Bacteria 945
577 Ga0495630_0625532 3300046517 Bacteria 825
578 Ga0495630_1391369 3300046517 Bacteria 528
579 Ga0495631_0072307 3300046518 Bacteria 1490
580 Ga0495643_0387422 3300046522 Unclassified 619
581 Ga0495644_0002013 3300046523 Bacteria 8174
582 Ga0495644_0034463 3300046523 Unclassified 1911
583 Ga0495644_0050500 3300046523 Bacteria 1561
584 Ga0495663_0045294 3300046525 Bacteria 1348
585 Ga0495652_0165994 3300046529 Bacteria 1709
586 Ga0495652_0221214 3300046529 Bacteria 1423
587 Ga0495586_0432422 3300046535 Bacteria 758
588 Ga0495609_0140876 3300046538 Bacteria 1029
589 Ga0495645_0445134 3300046543 Bacteria 818
590 Ga0495667_0809140 3300046559 Bacteria 577
591 Ga0495656_0022916 3300046615 Bacteria 2451
592 Ga0495656_0336132 3300046615 Bacteria 780
593 Ga0495656_0697842 3300046615 Unclassified 546
594 Ga0495668_0082487 3300046616 Bacteria 1764
595 Ga0495668_0263473 3300046616 Bacteria 944
596 Ga0495634_0099298 3300046642 Bacteria 1882
597 Ga0495635_0306922 3300046663 Bacteria 1063
598 Ga0495659_0422919 3300046664 Bacteria 577
599 Ga0495661_0578014 3300046665 Bacteria 530
600 Ga0495588_0018959 3300046674 Bacteria 3364
601 Ga0495588_0523981 3300046674 Bacteria 621
602 Ga0495657_0023514 3300046675 Bacteria 4402
603 Ga0495599_0366507 3300046678 Bacteria 862
604 Ga0495647_0035551 3300046681 Bacteria 1871
605 Ga0495647_0150831 3300046681 Bacteria 996
606 Ga0495647_0320587 3300046681 Bacteria 701
607 Ga0495658_0073014 3300046683 Unclassified 1996
608 Ga0495658_0171146 3300046683 Unclassified 1344
609 Ga0495658_0191065 3300046683 Bacteria 1273
610 Ga0495669_0084482 3300046684 Bacteria 1460
611 Ga0495624_0047707 3300046690 Bacteria 2721
612 Ga0495670_0075408 3300046691 Bacteria 1712
613 Ga0495670_0250123 3300046691 Unclassified 945
614 Ga0495671_0181015 3300046692 Bacteria 1024
615 Ga0495671_0182236 3300046692 Bacteria 1020
616 Ga0495589_0046798 3300046794 Bacteria 2145
617 Ga0495600_0234076 3300046809 Bacteria 1172
618 Ga0495660_0169775 3300046810 Bacteria 1063
619 Ga0495581_0000328 3300047315 Bacteria 23476
620 Ga0495581_0001587 3300047315 Bacteria 12684
621 Ga0495581_0040145 3300047315 Bacteria 2709
622 Ga0495604_0844069 3300047317 Bacteria 575
623 Ga0495676_0044874 3300047321 Bacteria 3603
624 Ga0495676_0219838 3300047321 Bacteria 1310
625 Ga0495676_0872655 3300047321 Unclassified 577
626 Ga0495680_0002404 3300047322 Bacteria 19198
627 Ga0495675_0371718 3300047444 Bacteria 838
628 Ga0495677_0386181 3300047445 Bacteria 554
629 Ga0495684_0043631 3300047471 Bacteria 3434
630 Ga0495686_0513476 3300047472 Bacteria 630
631 Ga0495614_0202124 3300048089 Bacteria 899
632 Ga0495615_0048660 3300048090 Bacteria 1085
633 Ga0495615_0275821 3300048090 Unclassified 539
634 Ga0495626_0268760 3300048091 Bacteria 680
635 Ga0495626_0436700 3300048091 Unclassified 504
636 Ga0496100_0026851 3300048903 Bacteria 3534
637 Ga0496100_0071290 3300048903 Bacteria 2319
638 Ga0496100_0112930 3300048903 Bacteria 1890
639 Ga0496101_0115551 3300048904 Bacteria 2024
640 Ga0496101_0190981 3300048904 Bacteria 1581
641 Ga0496101_0240736 3300048904 Unclassified 1408
642 Ga0496101_0315691 3300048904 Bacteria 1226
643 Ga0496101_0555398 3300048904 Bacteria 908
644 Ga0496102_0021874 3300048905 Bacteria 5661
645 Ga0496102_0147681 3300048905 Bacteria 2207
646 Ga0496102_0229801 3300048905 Bacteria 1749
647 Ga0496102_1913997 3300048905 Unclassified 510
648 Ga0496103_0005463 3300048906 Bacteria 7599
649 Ga0496103_0157806 3300048906 Bacteria 1455
650 Ga0496103_0557599 3300048906 Bacteria 731
651 Ga0496104_0005148 3300048907 Bacteria 11421
652 Ga0496104_0115387 3300048907 Bacteria 2577
653 Ga0496104_0121855 3300048907 Bacteria 2504
654 Ga0496105_0050445 3300048908 Bacteria 3437
655 Ga0496105_0113517 3300048908 Bacteria 2235
656 Ga0496105_0131979 3300048908 Bacteria 2059
657 Ga0496105_0161462 3300048908 Bacteria 1840
658 Ga0496106_0001693 3300048909 Bacteria 16484
659 Ga0496106_0017928 3300048909 Bacteria 5236
660 Ga0496106_0038387 3300048909 Bacteria 3584
661 Ga0496107_0005903 3300048910 Bacteria 8387
662 Ga0496107_0020933 3300048910 Bacteria 4623
663 Ga0496107_0437097 3300048910 Bacteria 972
664 Ga0496108_0011450 3300048911 Bacteria 7209
665 Ga0496108_0138513 3300048911 Bacteria 2096
666 Ga0496108_0329451 3300048911 Bacteria 1331
667 Ga0496108_0460799 3300048911 Unclassified 1110
668 Ga0496108_0804715 3300048911 Unclassified 811
669 Ga0496108_0886825 3300048911 Unclassified 766
670 Ga0496109_0008704 3300048912 Bacteria 8641
671 Ga0496109_0064091 3300048912 Bacteria 3362
672 Ga0496109_0465056 3300048912 Bacteria 1194
673 Ga0496109_0694962 3300048912 Unclassified 954
674 Ga0496109_1151262 3300048912 Unclassified 712
675 Ga0496110_0017320 3300048913 Bacteria 6027
676 Ga0496110_0036352 3300048913 Bacteria 4276
677 Ga0496110_0052835 3300048913 Bacteria 3570
678 Ga0496111_0000876 3300048914 Bacteria 16368
679 Ga0496111_0209165 3300048914 Bacteria 1449
680 Ga0496111_0698678 3300048914 Bacteria 738
681 Ga0496112_0003527 3300048915 Bacteria 12973
682 Ga0496112_0011241 3300048915 Bacteria 8166
683 Ga0496112_0031813 3300048915 Bacteria 5119
684 Ga0496112_0083407 3300048915 Bacteria 3161
685 Ga0496112_0132842 3300048915 Bacteria 2460
686 Ga0496112_0296556 3300048915 Bacteria 1562
687 Ga0496112_0297050 3300048915 Bacteria 1561
688 Ga0496112_0515689 3300048915 Bacteria 1130
689 Ga0496112_0704730 3300048915 Bacteria 937
690 Ga0496113_0005166 3300048916 Bacteria 8118
691 Ga0496113_0052275 3300048916 Bacteria 3051
692 Ga0496113_0145492 3300048916 Bacteria 1867
693 Ga0496113_0477000 3300048916 Bacteria 1002
694 Ga0496113_0487127 3300048916 Bacteria 990
695 Ga0496113_1345853 3300048916 Unclassified 554
696 Ga0496114_0002563 3300048917 Bacteria 13882
697 Ga0496114_0006434 3300048917 Bacteria 9246
698 Ga0496114_0037434 3300048917 Bacteria 4013
699 Ga0496114_0419579 3300048917 Bacteria 1185
700 Ga0496115_0007571 3300048918 Bacteria 7997
701 Ga0496115_0033270 3300048918 Bacteria 4069
702 Ga0496115_0485673 3300048918 Unclassified 994
703 Ga0496115_0689314 3300048918 Bacteria 804
704 Ga0496115_0740587 3300048918 Unclassified 769
705 Ga0501031_0004122 3300049568 Bacteria 9384
706 Ga0501031_0387724 3300049568 Bacteria 904
707 Ga0501031_0848706 3300049568 Bacteria 585
708 Ga0501032_0156926 3300049569 Bacteria 1494
709 Ga0501033_0092027 3300049570 Bacteria 2218
710 Ga0501034_0136755 3300049571 Bacteria 2431
711 Ga0501034_0643969 3300049571 Bacteria 962
712 Ga0501036_0011333 3300049572 Bacteria 7378
713 Ga0501037_0090144 3300049573 Bacteria 2218
714 Ga0501038_0010472 3300049574 Bacteria 8481
715 Ga0501039_0003838 3300049575 Bacteria 11285
716 Ga0501040_0058889 3300049576 Bacteria 2638
717 Ga0501041_0002088 3300049577 Bacteria 11244
718 Ga0501042_0009648 3300049578 Bacteria 6444
719 Ga0501043_0388669 3300049579 Bacteria 1055
720 Ga0501046_0024337 3300049580 Bacteria 4968
721 Ga0501047_0192221 3300049581 Bacteria 1904
722 Ga0501047_0303647 3300049581 Bacteria 1438
723 Ga0501048_0007104 3300049582 Bacteria 8506
724 Ga0501067_0040766 3300049583 Bacteria 2578
725 Ga0501067_0150337 3300049583 Bacteria 1297
726 Ga0501067_0154249 3300049583 Bacteria 1279
727 Ga0501068_0013374 3300049584 Bacteria 4668
728 Ga0501068_0496046 3300049584 Bacteria 792
729 Ga0501069_0002054 3300049585 Bacteria 10109
730 Ga0501069_0037238 3300049585 Bacteria 2684
731 Ga0501069_0079258 3300049585 Bacteria 1848
732 Ga0501070_0022151 3300049586 Bacteria 5322
733 Ga0501070_0096886 3300049586 Bacteria 2440
734 Ga0501070_0594610 3300049586 Bacteria 882
735 Ga0501070_1172087 3300049586 Bacteria 590
736 Ga0501071_0045765 3300049587 Bacteria 3141
737 Ga0501072_0511534 3300049588 Bacteria 949
738 Ga0501073_0008211 3300049589 Bacteria 7743
739 Ga0501073_0046169 3300049589 Bacteria 3065
740 Ga0501073_0379663 3300049589 Bacteria 976
741 Ga0501074_0018724 3300049590 Bacteria 5030
742 Ga0501074_0024761 3300049590 Bacteria 4361
743 Ga0501074_0309420 3300049590 Bacteria 1122
744 Ga0501074_0406469 3300049590 Bacteria 966
745 Ga0501074_0879412 3300049590 Bacteria 631
746 Ga0501075_0034590 3300049591 Bacteria 3762
747 Ga0501075_1554695 3300049591 Bacteria 501
748 Ga0501076_0021363 3300049592 Bacteria 4964
749 Ga0501077_0012711 3300049593 Bacteria 5272
750 Ga0501079_0214760 3300049741 Bacteria 1502
751 Ga0501080_0026200 3300049742 Bacteria 5417
752 Ga0501080_0062377 3300049742 Bacteria 3469
753 Ga0501080_0336488 3300049742 Bacteria 1364
754 Ga0501080_0483661 3300049742 Bacteria 1107
755 Ga0501081_0293691 3300049743 Bacteria 1191
756 Ga0501081_0452490 3300049743 Bacteria 954
757 Ga0501083_0003673 3300049744 Bacteria 10773
758 Ga0501035_0030219 3300049822 Bacteria 4939
759 Ga0501044_0110815 3300049823 Bacteria 2753
760 Ga0501044_0158862 3300049823 Bacteria 2239
761 Ga0501045_0034996 3300049824 Bacteria 3646
762 nmdc:mga00v17_63963_c1 3300050491 Bacteria 2266
763 nmdc:mga05p37_1574779_c1 3300050507 Bacteria 649
764 nmdc:mga05p37_166966_c1 3300050507 Bacteria 2685
765 nmdc:mga05p37_2084484_c1 3300050507 Unclassified 532
766 nmdc:mga05p37_26799_c1 3300050507 Bacteria 7009
767 nmdc:mga05p37_302896_c1 3300050507 Bacteria 1898
768 nmdc:mga09592_178552_c1 3300050508 Bacteria 1836
769 nmdc:mga0qj67_136314_c1 3300050509 Bacteria 1989
770 nmdc:mga08y16_165613_c1 3300050511 Bacteria 2296
771 nmdc:mga08y16_709264_c1 3300050511 Bacteria 1005
772 nmdc:mga0n895_102977_c1 3300050512 Bacteria 2866
773 nmdc:mga0n895_114384_c1 3300050512 Bacteria 2716
774 nmdc:mga0n895_7167_c1 3300050512 Bacteria 9538
775 nmdc:mga0rr50_1621354_c1 3300050513 Unclassified 546
776 nmdc:mga0rr50_48037_c1 3300050513 Bacteria 3153
777 nmdc:mga0rr50_56099_c1 3300050513 Bacteria 2942
778 nmdc:mga08x19_363073_c1 3300050514 Unclassified 1012
779 nmdc:mga08x19_379297_c1 3300050514 Unclassified 990
780 nmdc:mga08x19_504441_c1 3300050514 Bacteria 854
781 nmdc:mga08x19_65013_c1 3300050514 Unclassified 2368
782 nmdc:mga0a205_1112627_c1 3300050515 Bacteria 637
783 nmdc:mga0a205_1425802_c1 3300050515 Bacteria 540
784 nmdc:mga0a205_452087_c1 3300050515 Bacteria 1144
785 nmdc:mga0a205_6067_c1 3300050515 Bacteria 10897
786 Ga0495595_0023893 3300053084 Bacteria 2696
787 Ga0495595_0318876 3300053084 Bacteria 783
788 Ga0495619_0034198 3300053085 Bacteria 3304
789 Ga0495619_0957804 3300053085 Bacteria 574
790 Ga0501084_0039742 3300054114 Bacteria 3934
791 Ga0501082_0060170 3300060353 Bacteria 3271
792 Ga0466962_0002181 3300061719 Bacteria 9260
793 Ga0466962_0108165 3300061719 Bacteria 1338
794 Ga0466962_0721175 3300061719 Bacteria 512
795 Ga0530510_0005656 3300061734 Bacteria 8664
796 Ga0530510_0273518 3300061734 Bacteria 1261
797 Ga0070658_10086846
798 JGI24747J21853_1020963
799 JGI24743J22301_10041700
800 JGI24744J21845_10007363
801 JGI24742J22300_10014706
802 Ga0070658_10254974
803 Ga0070658_10267597
804 Ga0070658_10327617
805 Ga0070683_100002174
806 Ga0070683_100007005
807 Ga0070683_100027227
808 Ga0070683_100032081
809 Ga0070683_100153695
810 Ga0070683_100229830
811 Ga0070690_100018638
812 Ga0068869_100415966
813 Ga0070666_10015946
814 Ga0070680_100076774
815 Ga0070680_100724623
816 Ga0070682_100591724
817 Ga0068868_100040385
818 Ga0068868_100058300
819 Ga0068868_101149589
820 Ga0070660_100024497
821 Ga0070660_100040297
822 Ga0070660_100093671
823 Ga0070660_100110698
824 Ga0070660_100127570
825 Ga0070689_100060981
826 Ga0070691_10033871
827 Ga0070691_10734106
828 Ga0070687_100198602
829 Ga0070687_100307240
830 Ga0070661_100034760
831 Ga0070692_10016534
832 Ga0070675_100119459
833 Ga0070674_100470193
834 Ga0070673_100053736
835 Ga0070673_100251992
836 Ga0070688_100023058
837 Ga0070688_100339198
838 Ga0070659_100023849
839 Ga0070659_100751462
840 Ga0070659_101379531
841 Ga0070703_10047451
842 Ga0070709_10002248
843 Ga0070709_10059196
844 Ga0070709_10637473
845 Ga0070709_11728933
846 Ga0070714_100009381
847 Ga0070714_100017559
848 Ga0070714_100023254
849 Ga0070714_100043526
850 Ga0070714_100110604
851 Ga0070714_100198403
852 Ga0070714_100835271
853 Ga0070714_101562835
854 Ga0070713_100059847
855 Ga0070713_100250144
856 Ga0070713_100561474
857 Ga0070713_100808393
858 Ga0070710_10003144
859 Ga0070710_10268244
860 Ga0070711_100113551
861 Ga0070711_100197543
862 Ga0070711_101095056
863 Ga0070711_101976804
864 Ga0070705_100181109
865 Ga0070705_101552027
866 Ga0070705_101605144
867 Ga0070700_100299137
868 Ga0070700_101121989
869 Ga0070700_101750964
870 Ga0070694_100210537
871 Ga0070708_100656523
872 Ga0070708_100707711
873 Ga0070708_101359754
874 Ga0070663_100020415
875 Ga0070663_100314755
876 Ga0070663_101109398
877 Ga0070678_100034089
878 Ga0070662_100448284
879 Ga0070662_100550383
880 Ga0070662_100683817
881 Ga0070681_10132845
882 Ga0070681_10262570
883 Ga0070681_10750277
884 Ga0068867_100385338
885 Ga0070685_10019059
886 Ga0070706_100039349
887 Ga0070706_100586584
888 Ga0070707_100000611
889 Ga0070707_100574313
890 Ga0070707_100625971
891 Ga0070707_100680043
892 Ga0070698_100019082
893 Ga0070698_100054768
894 Ga0070699_100006050
895 Ga0070699_100223147
896 Ga0070699_100292820
897 Ga0070699_100345956
898 Ga0070679_100054350
899 Ga0070679_100130752
900 Ga0070679_100194174
901 Ga0070679_100292201
902 Ga0070679_100525124
903 Ga0070679_100585840
904 Ga0070684_100003754
905 Ga0070684_100007102
906 Ga0070684_100009078
907 Ga0070684_100069289
908 Ga0070684_100138359
909 Ga0070684_100482908
910 Ga0070684_100697813
911 Ga0070684_100747308
912 Ga0070697_100135026
913 Ga0068853_100212140
914 Ga0070672_100100192
915 Ga0070686_100006071
916 Ga0070686_101718081
917 Ga0070695_100130976
918 Ga0070696_101530166
919 Ga0070693_100074129
920 Ga0070693_100168414
921 Ga0070693_100442769
922 Ga0070665_100367376
923 Ga0070704_100103519
924 Ga0070704_100388550
925 Ga0070704_100719588
926 Ga0068855_100002523
927 Ga0068855_100090415
928 Ga0068855_100252281
929 Ga0068855_100799153
930 Ga0068857_100005906
931 Ga0068857_100022277
932 Ga0068857_100255347
933 Ga0068854_100185423
934 Ga0068856_100031082
935 Ga0068856_100036455
936 Ga0068856_100293039
937 Ga0070702_100051604
938 Ga0070702_100621321
939 Ga0070702_101466168
940 Ga0068852_100144161
941 Ga0068852_100431479
942 Ga0068859_100145872
943 Ga0068866_10002557
944 Ga0068861_100081226
945 Ga0068851_10347373
946 Ga0068851_10866498
947 Ga0068863_100059344
948 Ga0068863_100376650
949 Ga0068858_102371383
950 Ga0068860_100266501
951 Ga0068860_101399333
952 Ga0081538_10000920
953 Ga0081540_1010557
954 Ga0070717_10018101
955 Ga0070717_10020688
956 Ga0070717_10045156
957 Ga0070717_10631060
958 Ga0070717_10891460
959 Ga0075365_10049665
960 Ga0070715_10016472
961 Ga0070715_10711901
962 Ga0070716_100001423
963 Ga0070716_100294411
964 Ga0070716_100498003
965 Ga0070716_100549027
966 Ga0070712_100251794
967 Ga0070712_100565259
968 Ga0070712_101356448
969 Ga0097621_100041768
970 Ga0097621_101212290
971 Ga0068871_100044336
972 Ga0075428_101920384
973 Ga0075430_100160429
974 Ga0075433_10001459
975 Ga0075433_10565261
976 Ga0075433_11783412
977 Ga0075434_100002293
978 Ga0075434_100004585
979 Ga0075434_100216953
980 Ga0075429_100608184
981 Ga0068865_100002869
982 Ga0068865_100076199
983 Ga0068865_100859993
984 Ga0075436_100080478
985 Ga0075436_100100194
986 Ga0075436_100389179
987 Ga0097620_100145876
988 Ga0075435_100006390
989 Ga0105240_10044922
990 Ga0105240_10505459
991 Ga0105240_10541709
992 Ga0105240_10949588
993 Ga0105240_11688069
994 Ga0105240_12218077
995 Ga0111539_10046429
996 Ga0111539_10182978
997 Ga0111539_10189190
998 Ga0111539_10633055
999 Ga0111539_11563666
1000 Ga0105245_10019390
1001 Ga0105245_10084953
1002 Ga0105245_10095370
1003 Ga0105245_10166303
1004 Ga0105245_10339121
1005 Ga0105245_12808239
1006 Ga0114129_10042981
1007 Ga0114129_10209028
1008 Ga0114129_10360302
1009 Ga0114129_10549799
1010 Ga0114129_11585284
1011 Ga0105243_10048686
1012 Ga0105243_10086057
1013 Ga0105241_10064351
1014 Ga0105241_10677662
1015 Ga0105242_10011188
1016 Ga0105242_10774560
1017 Ga0105248_10153185
1018 Ga0105237_10979576
1019 Ga0105238_10259322
1020 Ga0105238_10472460
1021 Ga0105238_12178389
1022 Ga0105249_10005879
1023 Ga0105239_10020449
1024 Ga0105239_10324903
1025 Ga0105239_10463771
1026 Ga0105246_10074477
1027 Ga0105246_11231726
1028 Ga0157373_10198661
1029 Ga0157371_10632478
1030 Ga0157371_11577018
1031 Ga0157370_10016007
1032 Ga0157370_10742691
1033 Ga0157369_10001145
1034 Ga0157369_10184569
1035 Ga0157369_10241957
1036 Ga0157369_10252806
1037 Ga0157369_10416448
1038 Ga0157369_11863010
1039 Ga0157369_12550029
1040 Ga0157374_10032132
1041 Ga0157374_10064268
1042 Ga0157374_10175811
1043 Ga0157374_10311029
1044 Ga0157378_10149082
1045 Ga0163162_10003474
1046 Ga0163162_10036942
1047 Ga0157372_10475734
1048 Ga0157372_10695029
1049 Ga0157372_10714309
1050 Ga0157372_11505380
1051 Ga0157375_10007441
1052 Ga0157375_10145679
1053 Ga0157375_10260642
1054 Ga0163163_10446370
1055 Ga0163163_11292143
1056 Ga0163163_11338414
1057 Ga0182008_10005010
1058 Ga0182008_10109160
1059 Ga0182008_10283426
1060 Ga0157377_10008543
1061 Ga0157377_10274989
1062 Ga0157379_10657673
1063 Ga0157379_10993588
1064 Ga0157376_10013902
1065 Ga0157376_10067013
1066 Ga0157376_10541533
1067 Ga0182006_1020759
1068 Ga0182007_10098037
1069 Ga0197907_11071902
1070 Ga0206356_10187915
1071 Ga0206354_10237964
1072 Ga0206354_10899858
1073 Ga0206353_11705978
1074 Ga0206353_11815803
1075 Ga0213873_10191647
1076 Ga0224712_10293829
1077 Ga0207656_10436895
1078 Ga0207653_10017213
1079 Ga0207692_10037157
1080 Ga0207692_10188022
1081 Ga0207692_10702990
1082 Ga0207642_10013952
1083 Ga0207680_10009969
1084 Ga0207680_10790912
1085 Ga0207647_10035203
1086 Ga0207647_10095096
1087 Ga0207685_10001078
1088 Ga0207699_10003253
1089 Ga0207699_10084519
1090 Ga0207699_10652032
1091 Ga0207699_11058807
1092 Ga0207705_10105927
1093 Ga0207705_10171817
1094 Ga0207705_10211954
1095 Ga0207705_11216301
1096 Ga0207684_10072987
1097 Ga0207654_10140683
1098 Ga0207707_10140333
1099 Ga0207707_10238674
1100 Ga0207707_10260419
1101 Ga0207707_10428582
1102 Ga0207707_10497927
1103 Ga0207707_10824578
1104 Ga0207695_10210584
1105 Ga0207695_11577279
1106 Ga0207693_10000814
1107 Ga0207693_10003318
1108 Ga0207693_10204618
1109 Ga0207663_10063340
1110 Ga0207663_10329325
1111 Ga0207663_10649043
1112 Ga0207660_10026819
1113 Ga0207662_10150052
1114 Ga0207657_10002763
1115 Ga0207657_10008349
1116 Ga0207657_10017954
1117 Ga0207657_10025794
1118 Ga0207657_10147158
1119 Ga0207657_10655569
1120 Ga0207649_10031406
1121 Ga0207652_10176663
1122 Ga0207652_10346143
1123 Ga0207652_10802554
1124 Ga0207652_10877357
1125 Ga0207646_10004447
1126 Ga0207646_10376193
1127 Ga0207694_10379190
1128 Ga0207694_10402406
1129 Ga0207659_10701417
1130 Ga0207687_10018726
1131 Ga0207687_10062421
1132 Ga0207687_10105792
1133 Ga0207700_10062715
1134 Ga0207700_10101223
1135 Ga0207664_10003856
1136 Ga0207664_10006140
1137 Ga0207664_10067108
1138 Ga0207664_10085365
1139 Ga0207664_10290446
1140 Ga0207664_10433246
1141 Ga0207664_10753412
1142 Ga0207664_10899075
1143 Ga0207664_11166739
1144 Ga0207644_10079831
1145 Ga0207644_11407960
1146 Ga0207690_10096878
1147 Ga0207706_10502973
1148 Ga0207706_11720434
1149 Ga0207686_10007082
1150 Ga0207686_10504296
1151 Ga0207709_10021221
1152 Ga0207709_10063804
1153 Ga0207670_10079919
1154 Ga0207669_10012731
1155 Ga0207669_10448723
1156 Ga0207704_11069573
1157 Ga0207665_10000247
1158 Ga0207665_10425665
1159 Ga0207665_10497796
1160 Ga0207691_10008375
1161 Ga0207691_10321524
1162 Ga0207691_11430872
1163 Ga0207689_10140997
1164 Ga0207661_10020009
1165 Ga0207661_10152603
1166 Ga0207667_10185472
1167 Ga0207667_10299231
1168 Ga0207667_10812713
1169 Ga0207667_11405682
1170 Ga0207651_10032679
1171 Ga0207651_11261280
1172 Ga0207651_11445375
1173 Ga0207712_10063315
1174 Ga0207668_10014975
1175 Ga0207640_10254149
1176 Ga0207640_11834036
1177 Ga0207677_10081056
1178 Ga0207677_10290022
1179 Ga0207677_11034051
1180 Ga0207677_11150615
1181 Ga0207703_10865107
1182 Ga0207703_11706024
1183 Ga0207639_10182870
1184 Ga0207639_11439322
1185 Ga0207678_10004762
1186 Ga0207708_10004475
1187 Ga0207708_10423206
1188 Ga0207702_10183642
1189 Ga0207702_10553703
1190 Ga0207702_11028696
1191 Ga0207641_10275956
1192 Ga0207648_10001302
1193 Ga0207648_11636855
1194 Ga0207674_10001533
1195 Ga0207674_10034811
1196 Ga0207674_10100647
1197 Ga0207674_10753689
1198 Ga0207675_100296418
1199 Ga0207675_100672645
1200 Ga0207683_10007185
1201 Ga0207698_10330138
1202 Ga0207428_10750056
1203 Ga0207428_11172061
1204 Ga0268266_10036678
1205 Ga0268264_10031903
1206 Ga0268264_10264738
1207 Ga0265326_10018189
1208 Ga0265319_1001384
1209 Ga0265319_1077458
1210 Ga0265334_10021458
1211 Ga0265318_10001537
1212 Ga0265322_10076010
1213 Ga0265322_10109855
1214 Ga0265336_10056286
1215 Ga0265338_10038481
1216 Ga0265338_10068482
1217 Ga0265338_10113659
1218 Ga0265338_10160831
1219 Ga0265338_10249115
1220 Ga0265328_10069565
1221 Ga0265320_10009710
1222 Ga0265325_10228884
1223 Ga0265329_10042198
1224 Ga0265340_10046505
1225 Ga0265339_10146978
1226 Ga0265327_10014563
1227 Ga0265327_10035657
1228 Ga0265327_10371050
1229 Ga0265316_10009220
1230 Ga0265314_10017989
1231 Ga0265342_10419204
1232 Ga0316583_10039828
1233 Ga0373958_0109951
1234 Ga0373938_0160693
1235 Ga0373928_0153139
1236 Ga0373934_0230680
1237 Ga0373953_0070444
1238 Ga0373954_0426848
1239 Ga0373956_0343775
1240 Ga0373957_0441695
1241 Ga0373960_0021546
1242 Ga0373955_0195257
1243 Ga0373962_0084204
1244 Ga0373924_0186320
1245 Ga0373931_0004446
1246 Ga0373935_0028717
1247 Ga0373935_0186990
1248 Ga0373933_0726899
1249 Ga0373937_0046778
1250 Ga0373937_0839164
1251 Ga0395899_0002521
1252 Ga0395899_0123867
1253 Ga0395899_0174399
1254 Ga0395899_0216246
1255 Ga0395899_0293575
1256 Ga0395899_0486466
1257 Ga0395900_0003640
1258 Ga0395900_0007650
1259 Ga0395900_0019764
1260 Ga0395900_0063763
1261 Ga0395900_0115973
1262 Ga0395900_0155976
1263 Ga0395900_0273030
1264 Ga0395900_0492961
1265 Ga0395900_0549314
1266 Ga0395900_0802193
1267 Ga0395900_1061155
1268 Ga0395900_1214257
1269 Ga0395900_1264005
1270 Ga0395898_0005071
1271 Ga0395898_0037166
1272 Ga0395898_0040576
1273 Ga0395898_0054295
1274 Ga0395898_0093454
1275 Ga0395898_0304034
1276 Ga0395898_0464034
1277 Ga0395898_0683968
1278 Ga0395898_0752685
1279 Ga0395898_0759652
1280 Ga0395898_0783390
1281 Ga0395898_1331158
1282 Ga0395905_0000656
1283 Ga0395905_0007092
1284 Ga0395905_0021662
1285 Ga0395905_0031997
1286 Ga0395905_0075586
1287 Ga0395905_0123249
1288 Ga0395905_0396281
1289 Ga0395905_0464732
1290 Ga0395905_0695101
1291 Ga0395905_0795835
1292 Ga0395905_1072542
1293 Ga0395901_0000720
1294 Ga0395901_0007345
1295 Ga0395901_0021765
1296 Ga0395901_0039268
1297 Ga0395901_0039473
1298 Ga0395901_0105389
1299 Ga0395901_0113266
1300 Ga0395901_0114293
1301 Ga0395901_0125111
1302 Ga0395901_0160450
1303 Ga0395901_0379409
1304 Ga0395901_1188866
1305 Ga0395901_1714104
1306 Ga0436360_0668708
1307 Ga0436362_0287203
1308 Ga0451791_1721870
1309 Ga0451802_0362203
1310 Ga0451839_0053667
1311 Ga0451853_1864501
1312 Ga0466965_0760100
1313 Ga0466966_0018954
1314 Ga0466961_0106741
1315 Ga0466963_0001342
1316 Ga0466963_0014355
1317 Ga0466963_0031609
1318 Ga0466963_0161532
1319 Ga0466963_0205833
1320 Ga0466963_0400899
1321 Ga0466963_0948513
1322 Ga0466963_1003233
1323 Ga0466963_1347369
1324 Ga0466964_0594729
1325 Ga0466971_0001500
1326 Ga0466971_0215513
1327 Ga0466971_0241610
1328 Ga0466957_0024931
1329 Ga0466957_0055159
1330 Ga0466957_0080697
1331 Ga0466957_0325361
1332 Ga0466957_1147329
1333 Ga0466959_0052831
1334 Ga0466959_0265075
1335 Ga0466959_0427263
1336 Ga0466959_0511997
1337 Ga0451576_2689072
1338 Ga0466958_0009017
1339 Ga0466958_0030336
1340 Ga0466958_0092501
1341 Ga0466958_0183682
1342 Ga0466967_0003278
1343 Ga0466967_0070370
1344 Ga0466967_0088975
1345 Ga0466967_0099783
1346 Ga0466967_0292790
1347 Ga0466967_0505462
1348 Ga0495627_135648
1349 Ga0495592_0439702
1350 Ga0495603_0007431
1351 Ga0495603_0052438
1352 Ga0495603_0169577
1353 Ga0495641_0041463
1354 Ga0495641_0044029
1355 Ga0495641_0044682
1356 Ga0495653_0067957
1357 Ga0495582_0007333
1358 Ga0495582_0102284
1359 Ga0495582_0185083
1360 Ga0495605_0065318
1361 Ga0495639_0043029
1362 Ga0495639_0087468
1363 Ga0495584_0040584
1364 Ga0495584_0113214
1365 Ga0495594_0145019
1366 Ga0495594_0566532
1367 Ga0495596_0015796
1368 Ga0495596_0449657
1369 Ga0495607_0275025
1370 Ga0495608_0028929
1371 Ga0495620_0248297
1372 Ga0495630_0487330
1373 Ga0495630_0625532
1374 Ga0495630_1391369
1375 Ga0495631_0072307
1376 Ga0495643_0387422
1377 Ga0495644_0002013
1378 Ga0495644_0034463
1379 Ga0495644_0050500
1380 Ga0495663_0045294
1381 Ga0495652_0165994
1382 Ga0495652_0221214
1383 Ga0495586_0432422
1384 Ga0495609_0140876
1385 Ga0495645_0445134
1386 Ga0495667_0809140
1387 Ga0495656_0022916
1388 Ga0495656_0336132
1389 Ga0495656_0697842
1390 Ga0495668_0082487
1391 Ga0495668_0263473
1392 Ga0495634_0099298
1393 Ga0495635_0306922
1394 Ga0495659_0422919
1395 Ga0495661_0578014
1396 Ga0495588_0018959
1397 Ga0495588_0523981
1398 Ga0495657_0023514
1399 Ga0495599_0366507
1400 Ga0495647_0035551
1401 Ga0495647_0150831
1402 Ga0495647_0320587
1403 Ga0495658_0073014
1404 Ga0495658_0171146
1405 Ga0495658_0191065
1406 Ga0495669_0084482
1407 Ga0495624_0047707
1408 Ga0495670_0075408
1409 Ga0495670_0250123
1410 Ga0495671_0181015
1411 Ga0495671_0182236
1412 Ga0495589_0046798
1413 Ga0495600_0234076
1414 Ga0495660_0169775
1415 Ga0495581_0000328
1416 Ga0495581_0001587
1417 Ga0495581_0040145
1418 Ga0495604_0844069
1419 Ga0495676_0044874
1420 Ga0495676_0219838
1421 Ga0495676_0872655
1422 Ga0495680_0002404
1423 Ga0495675_0371718
1424 Ga0495677_0386181
1425 Ga0495684_0043631
1426 Ga0495686_0513476
1427 Ga0495614_0202124
1428 Ga0495615_0048660
1429 Ga0495615_0275821
1430 Ga0495626_0268760
1431 Ga0495626_0436700
1432 Ga0496100_0026851
1433 Ga0496100_0071290
1434 Ga0496100_0112930
1435 Ga0496101_0115551
1436 Ga0496101_0190981
1437 Ga0496101_0240736
1438 Ga0496101_0315691
1439 Ga0496101_0555398
1440 Ga0496102_0021874
1441 Ga0496102_0147681
1442 Ga0496102_0229801
1443 Ga0496102_1913997
1444 Ga0496103_0005463
1445 Ga0496103_0157806
1446 Ga0496103_0557599
1447 Ga0496104_0005148
1448 Ga0496104_0115387
1449 Ga0496104_0121855
1450 Ga0496105_0050445
1451 Ga0496105_0113517
1452 Ga0496105_0131979
1453 Ga0496105_0161462
1454 Ga0496106_0001693
1455 Ga0496106_0017928
1456 Ga0496106_0038387
1457 Ga0496107_0005903
1458 Ga0496107_0020933
1459 Ga0496107_0437097
1460 Ga0496108_0011450
1461 Ga0496108_0138513
1462 Ga0496108_0329451
1463 Ga0496108_0460799
1464 Ga0496108_0804715
1465 Ga0496108_0886825
1466 Ga0496109_0008704
1467 Ga0496109_0064091
1468 Ga0496109_0465056
1469 Ga0496109_0694962
1470 Ga0496109_1151262
1471 Ga0496110_0017320
1472 Ga0496110_0036352
1473 Ga0496110_0052835
1474 Ga0496111_0000876
1475 Ga0496111_0209165
1476 Ga0496111_0698678
1477 Ga0496112_0003527
1478 Ga0496112_0011241
1479 Ga0496112_0031813
1480 Ga0496112_0083407
1481 Ga0496112_0132842
1482 Ga0496112_0296556
1483 Ga0496112_0297050
1484 Ga0496112_0515689
1485 Ga0496112_0704730
1486 Ga0496113_0005166
1487 Ga0496113_0052275
1488 Ga0496113_0145492
1489 Ga0496113_0477000
1490 Ga0496113_0487127
1491 Ga0496113_1345853
1492 Ga0496114_0002563
1493 Ga0496114_0006434
1494 Ga0496114_0037434
1495 Ga0496114_0419579
1496 Ga0496115_0007571
1497 Ga0496115_0033270
1498 Ga0496115_0485673
1499 Ga0496115_0689314
1500 Ga0496115_0740587
1501 Ga0501031_0004122
1502 Ga0501031_0387724
1503 Ga0501031_0848706
1504 Ga0501032_0156926
1505 Ga0501033_0092027
1506 Ga0501034_0136755
1507 Ga0501034_0643969
1508 Ga0501036_0011333
1509 Ga0501037_0090144
1510 Ga0501038_0010472
1511 Ga0501039_0003838
1512 Ga0501040_0058889
1513 Ga0501041_0002088
1514 Ga0501042_0009648
1515 Ga0501043_0388669
1516 Ga0501046_0024337
1517 Ga0501047_0192221
1518 Ga0501047_0303647
1519 Ga0501048_0007104
1520 Ga0501067_0040766
1521 Ga0501067_0150337
1522 Ga0501067_0154249
1523 Ga0501068_0013374
1524 Ga0501068_0496046
1525 Ga0501069_0002054
1526 Ga0501069_0037238
1527 Ga0501069_0079258
1528 Ga0501070_0022151
1529 Ga0501070_0096886
1530 Ga0501070_0594610
1531 Ga0501070_1172087
1532 Ga0501071_0045765
1533 Ga0501072_0511534
1534 Ga0501073_0008211
1535 Ga0501073_0046169
1536 Ga0501073_0379663
1537 Ga0501074_0018724
1538 Ga0501074_0024761
1539 Ga0501074_0309420
1540 Ga0501074_0406469
1541 Ga0501074_0879412
1542 Ga0501075_0034590
1543 Ga0501075_1554695
1544 Ga0501076_0021363
1545 Ga0501077_0012711
1546 Ga0501079_0214760
1547 Ga0501080_0026200
1548 Ga0501080_0062377
1549 Ga0501080_0336488
1550 Ga0501080_0483661
1551 Ga0501081_0293691
1552 Ga0501081_0452490
1553 Ga0501083_0003673
1554 Ga0501035_0030219
1555 Ga0501044_0110815
1556 Ga0501044_0158862
1557 Ga0501045_0034996
1558 nmdc:mga00v17_63963_c1
1559 nmdc:mga05p37_1574779_c1
1560 nmdc:mga05p37_166966_c1
1561 nmdc:mga05p37_2084484_c1
1562 nmdc:mga05p37_26799_c1
1563 nmdc:mga05p37_302896_c1
1564 nmdc:mga09592_178552_c1
1565 nmdc:mga0qj67_136314_c1
1566 nmdc:mga08y16_165613_c1
1567 nmdc:mga08y16_709264_c1
1568 nmdc:mga0n895_102977_c1
1569 nmdc:mga0n895_114384_c1
1570 nmdc:mga0n895_7167_c1
1571 nmdc:mga0rr50_1621354_c1
1572 nmdc:mga0rr50_48037_c1
1573 nmdc:mga0rr50_56099_c1
1574 nmdc:mga08x19_363073_c1
1575 nmdc:mga08x19_379297_c1
1576 nmdc:mga08x19_504441_c1
1577 nmdc:mga08x19_65013_c1
1578 nmdc:mga0a205_1112627_c1
1579 nmdc:mga0a205_1425802_c1
1580 nmdc:mga0a205_452087_c1
1581 nmdc:mga0a205_6067_c1
1582 Ga0495595_0023893
1583 Ga0495595_0318876
1584 Ga0495619_0034198
1585 Ga0495619_0957804
1586 Ga0501084_0039742
1587 Ga0501082_0060170
1588 Ga0466962_0002181
1589 Ga0466962_0108165
1590 Ga0466962_0721175
1591 Ga0530510_0005656
1592 Ga0530510_0273518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map