F481157
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 795 | 305 | 1590 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0720619|Ga0501036_0720619_68_460 |
| Length | 130 |
| Sequence | MHAVPAATGSDLTHSSIGIYNGGMARAATTSDPFNAIAEPRRRSILELLAGEERSVGEIAESLELNQRSVSKHLHVLLDVGLVSVRREGRRTMYRTNPEPLRGVHEWCGMFARYWRGQLRRIKAHAEGKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 104 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 188 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 214 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 217 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 218 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 219 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 225 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 226 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 227 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 277 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 278 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 299 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 302 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.26 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 94.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501036_0720619 | 3300049572 | Unclassified | 824 |
| 2 | JGI24751J29686_10131986 | 3300002459 | Unclassified | 527 |
| 3 | Ga0065714_10102457 | 3300005288 | Bacteria | 1622 |
| 4 | Ga0065704_10800817 | 3300005289 | Bacteria | 521 |
| 5 | Ga0065712_10000807 | 3300005290 | Bacteria | 8107 |
| 6 | Ga0065712_10006045 | 3300005290 | Unclassified | 2711 |
| 7 | Ga0065712_10122352 | 3300005290 | Unclassified | 1653 |
| 8 | Ga0065712_10432351 | 3300005290 | Bacteria | 689 |
| 9 | Ga0065715_10000845 | 3300005293 | Bacteria | 13711 |
| 10 | Ga0065715_10003716 | 3300005293 | Bacteria | 4102 |
| 11 | Ga0065715_10109450 | 3300005293 | Bacteria | 2668 |
| 12 | Ga0065707_10004336 | 3300005295 | Bacteria | 5412 |
| 13 | Ga0065707_10023054 | 3300005295 | Unclassified | 2007 |
| 14 | Ga0065707_10114302 | 3300005295 | Unclassified | 2301 |
| 15 | Ga0065707_10127931 | 3300005295 | Unclassified | 1974 |
| 16 | Ga0065707_10274329 | 3300005295 | Unclassified | 1037 |
| 17 | Ga0065707_11000503 | 3300005295 | Bacteria | 539 |
| 18 | Ga0070676_10035577 | 3300005328 | Bacteria | 2865 |
| 19 | Ga0070676_10244831 | 3300005328 | Unclassified | 1194 |
| 20 | Ga0070676_10843170 | 3300005328 | Bacteria | 679 |
| 21 | Ga0070690_100143722 | 3300005330 | Bacteria | 1621 |
| 22 | Ga0070670_100025561 | 3300005331 | Bacteria | 5080 |
| 23 | Ga0070670_100048009 | 3300005331 | Bacteria | 3674 |
| 24 | Ga0070677_10007025 | 3300005333 | Bacteria | 3746 |
| 25 | Ga0070677_10342862 | 3300005333 | Bacteria | 772 |
| 26 | Ga0068869_100014517 | 3300005334 | Bacteria | 5264 |
| 27 | Ga0068869_100020851 | 3300005334 | Bacteria | 4501 |
| 28 | Ga0068869_100021112 | 3300005334 | Bacteria | 4476 |
| 29 | Ga0070666_10001318 | 3300005335 | Bacteria | 15043 |
| 30 | Ga0070666_10160782 | 3300005335 | Bacteria | 1570 |
| 31 | Ga0070666_10200055 | 3300005335 | Unclassified | 1406 |
| 32 | Ga0070680_100032429 | 3300005336 | Bacteria | 4205 |
| 33 | Ga0070680_100607565 | 3300005336 | Bacteria | 939 |
| 34 | Ga0070682_100267645 | 3300005337 | Unclassified | 1240 |
| 35 | Ga0070682_101327243 | 3300005337 | Unclassified | 612 |
| 36 | Ga0068868_100012160 | 3300005338 | Bacteria | 6285 |
| 37 | Ga0068868_100021537 | 3300005338 | Bacteria | 4854 |
| 38 | Ga0068868_100145459 | 3300005338 | Bacteria | 1949 |
| 39 | Ga0068868_101990479 | 3300005338 | Unclassified | 551 |
| 40 | Ga0070660_100215708 | 3300005339 | Unclassified | 1559 |
| 41 | Ga0070660_100243614 | 3300005339 | Unclassified | 1465 |
| 42 | Ga0070687_100012129 | 3300005343 | Bacteria | 3794 |
| 43 | Ga0070687_100195485 | 3300005343 | Unclassified | 1222 |
| 44 | Ga0070661_100968244 | 3300005344 | Unclassified | 705 |
| 45 | Ga0070661_101477905 | 3300005344 | Unclassified | 573 |
| 46 | Ga0070692_10107878 | 3300005345 | Bacteria | 1536 |
| 47 | Ga0070692_10128682 | 3300005345 | Bacteria | 1421 |
| 48 | Ga0070668_100014091 | 3300005347 | Bacteria | 5976 |
| 49 | Ga0070668_101815988 | 3300005347 | Bacteria | 561 |
| 50 | Ga0070668_101974462 | 3300005347 | Unclassified | 538 |
| 51 | Ga0070669_100037579 | 3300005353 | Bacteria | 3512 |
| 52 | Ga0070669_100071682 | 3300005353 | Bacteria | 2564 |
| 53 | Ga0070669_100142270 | 3300005353 | Bacteria | 1850 |
| 54 | Ga0070669_100148759 | 3300005353 | Bacteria | 1811 |
| 55 | Ga0070669_100548220 | 3300005353 | Bacteria | 964 |
| 56 | Ga0070675_100001455 | 3300005354 | Bacteria | 17442 |
| 57 | Ga0070675_100003808 | 3300005354 | Bacteria | 11452 |
| 58 | Ga0070675_100023813 | 3300005354 | Bacteria | 4899 |
| 59 | Ga0070675_101604429 | 3300005354 | Bacteria | 600 |
| 60 | Ga0070671_100105863 | 3300005355 | Bacteria | 2361 |
| 61 | Ga0070671_101199450 | 3300005355 | Unclassified | 668 |
| 62 | Ga0070671_101499137 | 3300005355 | Bacteria | 597 |
| 63 | Ga0070674_100008740 | 3300005356 | Bacteria | 6041 |
| 64 | Ga0070674_100008932 | 3300005356 | Bacteria | 5986 |
| 65 | Ga0070674_100250943 | 3300005356 | Bacteria | 1390 |
| 66 | Ga0070674_100438002 | 3300005356 | Unclassified | 1076 |
| 67 | Ga0070674_100658662 | 3300005356 | Bacteria | 891 |
| 68 | Ga0070674_101574473 | 3300005356 | Bacteria | 592 |
| 69 | Ga0070674_101836809 | 3300005356 | Unclassified | 550 |
| 70 | Ga0070673_100037306 | 3300005364 | Bacteria | 3702 |
| 71 | Ga0070673_100049301 | 3300005364 | Bacteria | 3288 |
| 72 | Ga0070673_100388613 | 3300005364 | Unclassified | 1245 |
| 73 | Ga0070673_100395106 | 3300005364 | Unclassified | 1235 |
| 74 | Ga0070688_100003414 | 3300005365 | Bacteria | 8160 |
| 75 | Ga0070688_100021822 | 3300005365 | Bacteria | 3744 |
| 76 | Ga0070688_101681905 | 3300005365 | Unclassified | 519 |
| 77 | Ga0070659_100522781 | 3300005366 | Unclassified | 1013 |
| 78 | Ga0070667_100033587 | 3300005367 | Bacteria | 4289 |
| 79 | Ga0070667_101595818 | 3300005367 | Bacteria | 613 |
| 80 | Ga0070703_10165841 | 3300005406 | Bacteria | 842 |
| 81 | Ga0070709_10102195 | 3300005434 | Bacteria | 1912 |
| 82 | Ga0070714_100016099 | 3300005435 | Bacteria | 6029 |
| 83 | Ga0070713_100100856 | 3300005436 | Bacteria | 2500 |
| 84 | Ga0070701_10060487 | 3300005438 | Bacteria | 1995 |
| 85 | Ga0070701_10209769 | 3300005438 | Bacteria | 1156 |
| 86 | Ga0070701_10365871 | 3300005438 | Unclassified | 905 |
| 87 | Ga0070711_101580643 | 3300005439 | Bacteria | 573 |
| 88 | Ga0070705_100501766 | 3300005440 | Unclassified | 921 |
| 89 | Ga0070700_100021340 | 3300005441 | Bacteria | 3763 |
| 90 | Ga0070700_100024698 | 3300005441 | Bacteria | 3532 |
| 91 | Ga0070700_100175498 | 3300005441 | Bacteria | 1487 |
| 92 | Ga0070700_100247120 | 3300005441 | Unclassified | 1278 |
| 93 | Ga0070694_100303632 | 3300005444 | Bacteria | 1224 |
| 94 | Ga0070708_100201583 | 3300005445 | Bacteria | 1863 |
| 95 | Ga0070678_100117957 | 3300005456 | Unclassified | 2088 |
| 96 | Ga0070678_100226743 | 3300005456 | Bacteria | 1556 |
| 97 | Ga0070678_100234818 | 3300005456 | Bacteria | 1530 |
| 98 | Ga0070678_100267802 | 3300005456 | Bacteria | 1439 |
| 99 | Ga0070678_100316637 | 3300005456 | Bacteria | 1331 |
| 100 | Ga0070678_101231465 | 3300005456 | Unclassified | 695 |
| 101 | Ga0070662_100012810 | 3300005457 | Bacteria | 5569 |
| 102 | Ga0070662_100065790 | 3300005457 | Bacteria | 2658 |
| 103 | Ga0070662_100928995 | 3300005457 | Bacteria | 743 |
| 104 | Ga0070681_10041142 | 3300005458 | Bacteria | 4631 |
| 105 | Ga0070681_10045606 | 3300005458 | Bacteria | 4385 |
| 106 | Ga0068867_100248459 | 3300005459 | Unclassified | 1446 |
| 107 | Ga0068867_100518172 | 3300005459 | Unclassified | 1028 |
| 108 | Ga0068867_100624998 | 3300005459 | Unclassified | 942 |
| 109 | Ga0068867_100829565 | 3300005459 | Bacteria | 827 |
| 110 | Ga0068867_101338938 | 3300005459 | Unclassified | 662 |
| 111 | Ga0068867_101628427 | 3300005459 | Unclassified | 604 |
| 112 | Ga0068867_102418247 | 3300005459 | Unclassified | 500 |
| 113 | Ga0070685_10003871 | 3300005466 | Bacteria | 7570 |
| 114 | Ga0070685_10077859 | 3300005466 | Unclassified | 1981 |
| 115 | Ga0070685_10084394 | 3300005466 | Bacteria | 1910 |
| 116 | Ga0070685_11468515 | 3300005466 | Unclassified | 525 |
| 117 | Ga0070706_101479703 | 3300005467 | Unclassified | 621 |
| 118 | Ga0070707_100961447 | 3300005468 | Bacteria | 819 |
| 119 | Ga0070707_101856419 | 3300005468 | Unclassified | 570 |
| 120 | Ga0070707_102110483 | 3300005468 | Unclassified | 531 |
| 121 | Ga0070698_100049084 | 3300005471 | Bacteria | 4311 |
| 122 | Ga0070698_100615232 | 3300005471 | Bacteria | 1027 |
| 123 | Ga0070679_100195907 | 3300005530 | Unclassified | 1988 |
| 124 | Ga0070679_101096274 | 3300005530 | Bacteria | 741 |
| 125 | Ga0070697_100633256 | 3300005536 | Unclassified | 941 |
| 126 | Ga0068853_100760619 | 3300005539 | Unclassified | 926 |
| 127 | Ga0070672_100018221 | 3300005543 | Bacteria | 5071 |
| 128 | Ga0070672_100059390 | 3300005543 | Bacteria | 3008 |
| 129 | Ga0070672_100310121 | 3300005543 | Bacteria | 1339 |
| 130 | Ga0070672_100455909 | 3300005543 | Bacteria | 1102 |
| 131 | Ga0070686_100118127 | 3300005544 | Bacteria | 1817 |
| 132 | Ga0070686_100331878 | 3300005544 | Bacteria | 1137 |
| 133 | Ga0070686_101234419 | 3300005544 | Bacteria | 622 |
| 134 | Ga0070686_101668265 | 3300005544 | Unclassified | 540 |
| 135 | Ga0070695_100976658 | 3300005545 | Unclassified | 688 |
| 136 | Ga0070695_101115335 | 3300005545 | Unclassified | 646 |
| 137 | Ga0070696_100559791 | 3300005546 | Unclassified | 917 |
| 138 | Ga0070665_100004648 | 3300005548 | Bacteria | 14348 |
| 139 | Ga0070665_100126941 | 3300005548 | Bacteria | 2553 |
| 140 | Ga0070704_100095059 | 3300005549 | Bacteria | 2231 |
| 141 | Ga0070704_100344009 | 3300005549 | Bacteria | 1257 |
| 142 | Ga0070704_101135500 | 3300005549 | Unclassified | 711 |
| 143 | Ga0068855_100819840 | 3300005563 | Unclassified | 988 |
| 144 | Ga0068855_101331127 | 3300005563 | Bacteria | 742 |
| 145 | Ga0068855_101955256 | 3300005563 | Bacteria | 593 |
| 146 | Ga0070664_100390397 | 3300005564 | Unclassified | 1272 |
| 147 | Ga0070664_101006081 | 3300005564 | Unclassified | 783 |
| 148 | Ga0068857_100095237 | 3300005577 | Bacteria | 2667 |
| 149 | Ga0068857_102159312 | 3300005577 | Unclassified | 547 |
| 150 | Ga0068857_102336998 | 3300005577 | Unclassified | 525 |
| 151 | Ga0068854_100069569 | 3300005578 | Unclassified | 2570 |
| 152 | Ga0068856_100586524 | 3300005614 | Unclassified | 1136 |
| 153 | Ga0068856_101944842 | 3300005614 | Bacteria | 599 |
| 154 | Ga0070702_100209120 | 3300005615 | Bacteria | 1297 |
| 155 | Ga0070702_100313280 | 3300005615 | Bacteria | 1090 |
| 156 | Ga0068852_101605368 | 3300005616 | Unclassified | 673 |
| 157 | Ga0068859_100001487 | 3300005617 | Bacteria | 23857 |
| 158 | Ga0068859_100211749 | 3300005617 | Unclassified | 2025 |
| 159 | Ga0068859_100509894 | 3300005617 | Bacteria | 1298 |
| 160 | Ga0068859_100857628 | 3300005617 | Unclassified | 994 |
| 161 | Ga0068859_101410971 | 3300005617 | Unclassified | 768 |
| 162 | Ga0068859_101512013 | 3300005617 | Unclassified | 741 |
| 163 | Ga0068859_102061428 | 3300005617 | Unclassified | 630 |
| 164 | Ga0068864_100003702 | 3300005618 | Bacteria | 12624 |
| 165 | Ga0068864_100155773 | 3300005618 | Bacteria | 2073 |
| 166 | Ga0068864_102100939 | 3300005618 | Unclassified | 571 |
| 167 | Ga0068866_10004903 | 3300005718 | Bacteria | 5498 |
| 168 | Ga0068866_10110518 | 3300005718 | Bacteria | 1532 |
| 169 | Ga0068861_100016584 | 3300005719 | Bacteria | 5214 |
| 170 | Ga0068861_100113448 | 3300005719 | Bacteria | 2174 |
| 171 | Ga0068861_100149931 | 3300005719 | Unclassified | 1912 |
| 172 | Ga0068861_100164648 | 3300005719 | Bacteria | 1832 |
| 173 | Ga0068861_100211424 | 3300005719 | Bacteria | 1634 |
| 174 | Ga0068861_100297944 | 3300005719 | Bacteria | 1395 |
| 175 | Ga0068861_102602970 | 3300005719 | Unclassified | 510 |
| 176 | Ga0068870_10003997 | 3300005840 | Bacteria | 6295 |
| 177 | Ga0068870_10162065 | 3300005840 | Unclassified | 1327 |
| 178 | Ga0068870_10383104 | 3300005840 | Bacteria | 911 |
| 179 | Ga0068863_100032426 | 3300005841 | Bacteria | 4980 |
| 180 | Ga0068863_100325308 | 3300005841 | Unclassified | 1494 |
| 181 | Ga0068858_100006957 | 3300005842 | Bacteria | 10989 |
| 182 | Ga0068858_100213656 | 3300005842 | Bacteria | 1825 |
| 183 | Ga0068858_101017836 | 3300005842 | Unclassified | 812 |
| 184 | Ga0068860_100070980 | 3300005843 | Bacteria | 3311 |
| 185 | Ga0068860_100709355 | 3300005843 | Unclassified | 1016 |
| 186 | Ga0068860_100964491 | 3300005843 | Viruses | 870 |
| 187 | Ga0068862_100012750 | 3300005844 | Bacteria | 6956 |
| 188 | Ga0068862_100168561 | 3300005844 | Bacteria | 1959 |
| 189 | Ga0068862_100375230 | 3300005844 | Bacteria | 1325 |
| 190 | Ga0075365_10062295 | 3300006038 | Bacteria | 2494 |
| 191 | Ga0075364_10885379 | 3300006051 | Unclassified | 608 |
| 192 | Ga0070716_100597923 | 3300006173 | Unclassified | 829 |
| 193 | Ga0075362_10509466 | 3300006177 | Unclassified | 616 |
| 194 | Ga0097621_100003561 | 3300006237 | Bacteria | 10761 |
| 195 | Ga0097621_100096709 | 3300006237 | Bacteria | 2478 |
| 196 | Ga0097621_100278642 | 3300006237 | Unclassified | 1471 |
| 197 | Ga0075370_10946670 | 3300006353 | Viruses | 527 |
| 198 | Ga0068871_100003227 | 3300006358 | Bacteria | 11176 |
| 199 | Ga0068871_100174791 | 3300006358 | Bacteria | 1843 |
| 200 | Ga0068871_100640419 | 3300006358 | Unclassified | 970 |
| 201 | Ga0068871_102156637 | 3300006358 | Bacteria | 531 |
| 202 | Ga0075428_100268826 | 3300006844 | Unclassified | 1835 |
| 203 | Ga0075428_100275370 | 3300006844 | Bacteria | 1811 |
| 204 | Ga0075428_100444042 | 3300006844 | Unclassified | 1390 |
| 205 | Ga0075428_100853823 | 3300006844 | Bacteria | 966 |
| 206 | Ga0075428_100988528 | 3300006844 | Unclassified | 891 |
| 207 | Ga0075428_101031590 | 3300006844 | Bacteria | 870 |
| 208 | Ga0075428_102360381 | 3300006844 | Unclassified | 547 |
| 209 | Ga0075430_100418091 | 3300006846 | Bacteria | 1107 |
| 210 | Ga0075431_100013240 | 3300006847 | Bacteria | 8331 |
| 211 | Ga0075431_101357740 | 3300006847 | Unclassified | 671 |
| 212 | Ga0075433_10000070 | 3300006852 | Bacteria | 45584 |
| 213 | Ga0075433_10012046 | 3300006852 | Bacteria | 6975 |
| 214 | Ga0075433_10032705 | 3300006852 | Bacteria | 4456 |
| 215 | Ga0075433_10164127 | 3300006852 | Unclassified | 1977 |
| 216 | Ga0075434_100000166 | 3300006871 | Bacteria | 41896 |
| 217 | Ga0075434_100006624 | 3300006871 | Bacteria | 10627 |
| 218 | Ga0075434_100064055 | 3300006871 | Bacteria | 3660 |
| 219 | Ga0075434_100393323 | 3300006871 | Bacteria | 1407 |
| 220 | Ga0075434_100851630 | 3300006871 | Bacteria | 927 |
| 221 | Ga0075429_100124400 | 3300006880 | Bacteria | 2255 |
| 222 | Ga0075429_100178211 | 3300006880 | Bacteria | 1862 |
| 223 | Ga0075429_100934719 | 3300006880 | Bacteria | 759 |
| 224 | Ga0075429_101677779 | 3300006880 | Unclassified | 552 |
| 225 | Ga0068865_100016378 | 3300006881 | Bacteria | 4743 |
| 226 | Ga0068865_100099915 | 3300006881 | Bacteria | 2122 |
| 227 | Ga0068865_100132528 | 3300006881 | Unclassified | 1869 |
| 228 | Ga0068865_100151936 | 3300006881 | Bacteria | 1757 |
| 229 | Ga0068865_100176846 | 3300006881 | Bacteria | 1641 |
| 230 | Ga0068865_100209992 | 3300006881 | Unclassified | 1516 |
| 231 | Ga0068865_101685373 | 3300006881 | Unclassified | 571 |
| 232 | Ga0075436_100000507 | 3300006914 | Bacteria | 25170 |
| 233 | Ga0075436_100002804 | 3300006914 | Bacteria | 11940 |
| 234 | Ga0075436_101158139 | 3300006914 | Unclassified | 583 |
| 235 | Ga0097620_100001487 | 3300006931 | Bacteria | 23857 |
| 236 | Ga0097620_100211740 | 3300006931 | Unclassified | 2025 |
| 237 | Ga0097620_100509885 | 3300006931 | Bacteria | 1298 |
| 238 | Ga0097620_100857762 | 3300006931 | Unclassified | 994 |
| 239 | Ga0097620_101410537 | 3300006931 | Unclassified | 768 |
| 240 | Ga0097620_101512333 | 3300006931 | Unclassified | 741 |
| 241 | Ga0097620_102061196 | 3300006931 | Unclassified | 630 |
| 242 | Ga0075435_100000005 | 3300007076 | Bacteria | 121698 |
| 243 | Ga0075435_100002968 | 3300007076 | Bacteria | 11399 |
| 244 | Ga0075435_100021231 | 3300007076 | Unclassified | 4991 |
| 245 | Ga0075435_100829903 | 3300007076 | Bacteria | 805 |
| 246 | Ga0105240_10155920 | 3300009093 | Bacteria | 2716 |
| 247 | Ga0105240_10288126 | 3300009093 | Bacteria | 1884 |
| 248 | Ga0105240_10363256 | 3300009093 | Bacteria | 1639 |
| 249 | Ga0105240_12622271 | 3300009093 | Unclassified | 521 |
| 250 | Ga0111539_10004461 | 3300009094 | Bacteria | 18298 |
| 251 | Ga0111539_10039012 | 3300009094 | Bacteria | 5727 |
| 252 | Ga0111539_10039823 | 3300009094 | Bacteria | 5661 |
| 253 | Ga0111539_10043354 | 3300009094 | Bacteria | 5393 |
| 254 | Ga0111539_10325302 | 3300009094 | Unclassified | 1789 |
| 255 | Ga0111539_10391284 | 3300009094 | Bacteria | 1619 |
| 256 | Ga0111539_10437143 | 3300009094 | Unclassified | 1524 |
| 257 | Ga0111539_10510420 | 3300009094 | Bacteria | 1400 |
| 258 | Ga0111539_10529181 | 3300009094 | Bacteria | 1373 |
| 259 | Ga0111539_11912177 | 3300009094 | Bacteria | 688 |
| 260 | Ga0105245_10006555 | 3300009098 | Bacteria | 10220 |
| 261 | Ga0105245_10344531 | 3300009098 | Unclassified | 1475 |
| 262 | Ga0105245_10992681 | 3300009098 | Bacteria | 884 |
| 263 | Ga0105245_11462379 | 3300009098 | Unclassified | 734 |
| 264 | Ga0105245_13148137 | 3300009098 | Unclassified | 511 |
| 265 | Ga0105247_10024075 | 3300009101 | Bacteria | 3667 |
| 266 | Ga0114129_10000022 | 3300009147 | Bacteria | 119291 |
| 267 | Ga0114129_10015151 | 3300009147 | Bacteria | 10975 |
| 268 | Ga0114129_10144721 | 3300009147 | Unclassified | 3256 |
| 269 | Ga0114129_10308484 | 3300009147 | Bacteria | 2107 |
| 270 | Ga0114129_11033787 | 3300009147 | Bacteria | 1032 |
| 271 | Ga0114129_11539808 | 3300009147 | Unclassified | 816 |
| 272 | Ga0105243_10037226 | 3300009148 | Bacteria | 3780 |
| 273 | Ga0105241_10557986 | 3300009174 | Bacteria | 1029 |
| 274 | Ga0105242_10092228 | 3300009176 | Unclassified | 2551 |
| 275 | Ga0105242_10099449 | 3300009176 | Bacteria | 2462 |
| 276 | Ga0105242_10124901 | 3300009176 | Bacteria | 2213 |
| 277 | Ga0105242_10182332 | 3300009176 | Bacteria | 1853 |
| 278 | Ga0105242_10676952 | 3300009176 | Bacteria | 1006 |
| 279 | Ga0105242_10859787 | 3300009176 | Bacteria | 903 |
| 280 | Ga0105242_11059746 | 3300009176 | Unclassified | 822 |
| 281 | Ga0105248_10020542 | 3300009177 | Bacteria | 7319 |
| 282 | Ga0105248_10038039 | 3300009177 | Bacteria | 5383 |
| 283 | Ga0105248_10079443 | 3300009177 | Bacteria | 3687 |
| 284 | Ga0105248_10088070 | 3300009177 | Bacteria | 3494 |
| 285 | Ga0105248_10602942 | 3300009177 | Bacteria | 1239 |
| 286 | Ga0105248_10714684 | 3300009177 | Unclassified | 1131 |
| 287 | Ga0105248_10748883 | 3300009177 | Bacteria | 1102 |
| 288 | Ga0105248_11094111 | 3300009177 | Bacteria | 901 |
| 289 | Ga0105248_13201328 | 3300009177 | Bacteria | 521 |
| 290 | Ga0105238_10062575 | 3300009551 | Bacteria | 3722 |
| 291 | Ga0105238_11455275 | 3300009551 | Bacteria | 713 |
| 292 | Ga0105249_10005474 | 3300009553 | Bacteria | 10964 |
| 293 | Ga0105249_10024158 | 3300009553 | Bacteria | 5461 |
| 294 | Ga0105249_10247584 | 3300009553 | Bacteria | 1765 |
| 295 | Ga0105249_10405080 | 3300009553 | Bacteria | 1395 |
| 296 | Ga0105249_11000045 | 3300009553 | Bacteria | 905 |
| 297 | Ga0105249_11594535 | 3300009553 | Bacteria | 725 |
| 298 | Ga0105239_12305656 | 3300010375 | Bacteria | 626 |
| 299 | Ga0105246_10029007 | 3300011119 | Bacteria | 3639 |
| 300 | Ga0157345_1060804 | 3300012498 | Unclassified | 502 |
| 301 | Ga0157315_1005618 | 3300012508 | Unclassified | 949 |
| 302 | Ga0157371_10346515 | 3300013102 | Bacteria | 1081 |
| 303 | Ga0157370_10272675 | 3300013104 | Bacteria | 1563 |
| 304 | Ga0157369_12292903 | 3300013105 | Bacteria | 547 |
| 305 | Ga0157374_10062042 | 3300013296 | Bacteria | 3502 |
| 306 | Ga0157374_10182095 | 3300013296 | Unclassified | 2053 |
| 307 | Ga0157374_10333420 | 3300013296 | Bacteria | 1505 |
| 308 | Ga0157374_10385606 | 3300013296 | Bacteria | 1396 |
| 309 | Ga0157378_10304249 | 3300013297 | Bacteria | 1544 |
| 310 | Ga0163162_10039778 | 3300013306 | Bacteria | 4699 |
| 311 | Ga0163162_10109125 | 3300013306 | Bacteria | 2864 |
| 312 | Ga0163162_10250174 | 3300013306 | Unclassified | 1904 |
| 313 | Ga0163162_10468555 | 3300013306 | Bacteria | 1391 |
| 314 | Ga0157372_10294682 | 3300013307 | Unclassified | 1887 |
| 315 | Ga0157375_10126522 | 3300013308 | Bacteria | 2670 |
| 316 | Ga0157375_10241535 | 3300013308 | Bacteria | 1966 |
| 317 | Ga0157375_10331307 | 3300013308 | Unclassified | 1687 |
| 318 | Ga0157375_10653657 | 3300013308 | Unclassified | 1207 |
| 319 | Ga0157375_10955783 | 3300013308 | Unclassified | 998 |
| 320 | Ga0157375_11067227 | 3300013308 | Unclassified | 945 |
| 321 | Ga0163163_10036913 | 3300014325 | Bacteria | 4750 |
| 322 | Ga0163163_10422529 | 3300014325 | Bacteria | 1392 |
| 323 | Ga0163163_12439101 | 3300014325 | Bacteria | 581 |
| 324 | Ga0157380_10001081 | 3300014326 | Bacteria | 17506 |
| 325 | Ga0157380_10025613 | 3300014326 | Unclassified | 4474 |
| 326 | Ga0157380_10027451 | 3300014326 | Bacteria | 4330 |
| 327 | Ga0157380_10034765 | 3300014326 | Bacteria | 3889 |
| 328 | Ga0157380_10082068 | 3300014326 | Bacteria | 2638 |
| 329 | Ga0157380_10108279 | 3300014326 | Bacteria | 2329 |
| 330 | Ga0157380_10367304 | 3300014326 | Bacteria | 1353 |
| 331 | Ga0157380_10377890 | 3300014326 | Unclassified | 1336 |
| 332 | Ga0157380_10751252 | 3300014326 | Unclassified | 987 |
| 333 | Ga0157380_11060700 | 3300014326 | Unclassified | 847 |
| 334 | Ga0157380_11455112 | 3300014326 | Bacteria | 737 |
| 335 | Ga0157380_11617137 | 3300014326 | Unclassified | 704 |
| 336 | Ga0157380_11719375 | 3300014326 | Bacteria | 685 |
| 337 | Ga0157380_12817668 | 3300014326 | Unclassified | 553 |
| 338 | Ga0157377_10023404 | 3300014745 | Bacteria | 3273 |
| 339 | Ga0157377_10969212 | 3300014745 | Unclassified | 641 |
| 340 | Ga0157379_10039529 | 3300014968 | Bacteria | 4208 |
| 341 | Ga0157379_10088131 | 3300014968 | Bacteria | 2783 |
| 342 | Ga0157379_10577200 | 3300014968 | Bacteria | 1048 |
| 343 | Ga0157379_11507701 | 3300014968 | Unclassified | 654 |
| 344 | Ga0157376_10024742 | 3300014969 | Bacteria | 4720 |
| 345 | Ga0157376_10232074 | 3300014969 | Bacteria | 1715 |
| 346 | Ga0157376_12567368 | 3300014969 | Bacteria | 549 |
| 347 | Ga0163161_10041023 | 3300017792 | Bacteria | 3325 |
| 348 | Ga0163161_10225218 | 3300017792 | Unclassified | 1453 |
| 349 | Ga0163161_10248200 | 3300017792 | Bacteria | 1387 |
| 350 | Ga0163161_10538646 | 3300017792 | Bacteria | 955 |
| 351 | Ga0163161_10587685 | 3300017792 | Bacteria | 917 |
| 352 | Ga0207697_10004532 | 3300025315 | Bacteria | 6620 |
| 353 | Ga0207697_10061661 | 3300025315 | Bacteria | 1561 |
| 354 | Ga0207656_10248489 | 3300025321 | Unclassified | 871 |
| 355 | Ga0207653_10441467 | 3300025885 | Unclassified | 511 |
| 356 | Ga0207682_10000614 | 3300025893 | Bacteria | 16576 |
| 357 | Ga0207682_10194256 | 3300025893 | Bacteria | 931 |
| 358 | Ga0207682_10500275 | 3300025893 | Unclassified | 575 |
| 359 | Ga0207642_10031710 | 3300025899 | Bacteria | 2217 |
| 360 | Ga0207688_10007026 | 3300025901 | Bacteria | 6121 |
| 361 | Ga0207688_10122152 | 3300025901 | Bacteria | 1520 |
| 362 | Ga0207680_10421555 | 3300025903 | Unclassified | 945 |
| 363 | Ga0207645_10012347 | 3300025907 | Bacteria | 5797 |
| 364 | Ga0207645_10058019 | 3300025907 | Bacteria | 2472 |
| 365 | Ga0207645_10110386 | 3300025907 | Bacteria | 1780 |
| 366 | Ga0207645_10604432 | 3300025907 | Bacteria | 745 |
| 367 | Ga0207643_10000484 | 3300025908 | Bacteria | 25662 |
| 368 | Ga0207643_10163035 | 3300025908 | Unclassified | 1342 |
| 369 | Ga0207643_10323016 | 3300025908 | Bacteria | 964 |
| 370 | Ga0207705_11548721 | 3300025909 | Unclassified | 501 |
| 371 | Ga0207684_11037523 | 3300025910 | Unclassified | 685 |
| 372 | Ga0207707_10036044 | 3300025912 | Unclassified | 4326 |
| 373 | Ga0207707_10079583 | 3300025912 | Bacteria | 2862 |
| 374 | Ga0207695_10249187 | 3300025913 | Bacteria | 1676 |
| 375 | Ga0207695_10264965 | 3300025913 | Bacteria | 1615 |
| 376 | Ga0207663_10268543 | 3300025916 | Bacteria | 1263 |
| 377 | Ga0207660_10709702 | 3300025917 | Bacteria | 820 |
| 378 | Ga0207662_10009435 | 3300025918 | Bacteria | 5370 |
| 379 | Ga0207662_11114996 | 3300025918 | Unclassified | 561 |
| 380 | Ga0207657_10072984 | 3300025919 | Bacteria | 2901 |
| 381 | Ga0207657_10656942 | 3300025919 | Unclassified | 816 |
| 382 | Ga0207649_10510741 | 3300025920 | Unclassified | 915 |
| 383 | Ga0207649_10680202 | 3300025920 | Unclassified | 797 |
| 384 | Ga0207649_10815587 | 3300025920 | Unclassified | 729 |
| 385 | Ga0207652_10296618 | 3300025921 | Bacteria | 1459 |
| 386 | Ga0207652_10967333 | 3300025921 | Bacteria | 749 |
| 387 | Ga0207681_10017341 | 3300025923 | Unclassified | 4521 |
| 388 | Ga0207681_10045666 | 3300025923 | Bacteria | 2942 |
| 389 | Ga0207681_10071247 | 3300025923 | Bacteria | 2424 |
| 390 | Ga0207681_10097045 | 3300025923 | Bacteria | 2117 |
| 391 | Ga0207650_10006553 | 3300025925 | Bacteria | 7942 |
| 392 | Ga0207650_10040900 | 3300025925 | Bacteria | 3395 |
| 393 | Ga0207659_10000406 | 3300025926 | Bacteria | 25932 |
| 394 | Ga0207659_10030786 | 3300025926 | Unclassified | 3669 |
| 395 | Ga0207659_10095777 | 3300025926 | Unclassified | 2227 |
| 396 | Ga0207659_10157589 | 3300025926 | Unclassified | 1779 |
| 397 | Ga0207659_10710644 | 3300025926 | Unclassified | 861 |
| 398 | Ga0207687_10258271 | 3300025927 | Unclassified | 1388 |
| 399 | Ga0207687_10273464 | 3300025927 | Unclassified | 1351 |
| 400 | Ga0207687_10295402 | 3300025927 | Bacteria | 1303 |
| 401 | Ga0207687_10659769 | 3300025927 | Bacteria | 885 |
| 402 | Ga0207687_11885144 | 3300025927 | Unclassified | 511 |
| 403 | Ga0207664_11874412 | 3300025929 | Unclassified | 522 |
| 404 | Ga0207644_10095237 | 3300025931 | Bacteria | 2226 |
| 405 | Ga0207644_10505870 | 3300025931 | Bacteria | 997 |
| 406 | Ga0207644_10712346 | 3300025931 | Unclassified | 837 |
| 407 | Ga0207644_10970095 | 3300025931 | Bacteria | 713 |
| 408 | Ga0207644_11750925 | 3300025931 | Bacteria | 520 |
| 409 | Ga0207690_10389143 | 3300025932 | Unclassified | 1110 |
| 410 | Ga0207706_10001118 | 3300025933 | Bacteria | 27297 |
| 411 | Ga0207706_10804528 | 3300025933 | Bacteria | 798 |
| 412 | Ga0207686_10049380 | 3300025934 | Bacteria | 2611 |
| 413 | Ga0207686_10070629 | 3300025934 | Bacteria | 2244 |
| 414 | Ga0207686_10113059 | 3300025934 | Bacteria | 1835 |
| 415 | Ga0207686_10806936 | 3300025934 | Unclassified | 753 |
| 416 | Ga0207709_10029270 | 3300025935 | Bacteria | 3193 |
| 417 | Ga0207670_10060530 | 3300025936 | Bacteria | 2580 |
| 418 | Ga0207670_10502886 | 3300025936 | Unclassified | 984 |
| 419 | Ga0207669_10073508 | 3300025937 | Bacteria | 2157 |
| 420 | Ga0207669_10083164 | 3300025937 | Bacteria | 2058 |
| 421 | Ga0207669_10243436 | 3300025937 | Bacteria | 1335 |
| 422 | Ga0207669_10278071 | 3300025937 | Bacteria | 1261 |
| 423 | Ga0207669_10317842 | 3300025937 | Unclassified | 1190 |
| 424 | Ga0207669_10628500 | 3300025937 | Unclassified | 876 |
| 425 | Ga0207669_10822528 | 3300025937 | Bacteria | 771 |
| 426 | Ga0207669_11159327 | 3300025937 | Unclassified | 654 |
| 427 | Ga0207704_10043487 | 3300025938 | Bacteria | 2653 |
| 428 | Ga0207704_10049142 | 3300025938 | Bacteria | 2535 |
| 429 | Ga0207704_10103644 | 3300025938 | Bacteria | 1903 |
| 430 | Ga0207704_10929634 | 3300025938 | Unclassified | 733 |
| 431 | Ga0207665_10626446 | 3300025939 | Unclassified | 842 |
| 432 | Ga0207691_10004848 | 3300025940 | Bacteria | 13010 |
| 433 | Ga0207691_10021676 | 3300025940 | Bacteria | 6065 |
| 434 | Ga0207691_10084360 | 3300025940 | Unclassified | 2852 |
| 435 | Ga0207691_10262462 | 3300025940 | Bacteria | 1489 |
| 436 | Ga0207691_10470138 | 3300025940 | Bacteria | 1069 |
| 437 | Ga0207691_10567056 | 3300025940 | Bacteria | 962 |
| 438 | Ga0207711_10111909 | 3300025941 | Bacteria | 2429 |
| 439 | Ga0207711_10148976 | 3300025941 | Bacteria | 2110 |
| 440 | Ga0207711_10515621 | 3300025941 | Bacteria | 1115 |
| 441 | Ga0207711_10698060 | 3300025941 | Unclassified | 946 |
| 442 | Ga0207711_11863488 | 3300025941 | Bacteria | 544 |
| 443 | Ga0207689_10010510 | 3300025942 | Bacteria | 7970 |
| 444 | Ga0207689_10034547 | 3300025942 | Bacteria | 4199 |
| 445 | Ga0207689_10218775 | 3300025942 | Bacteria | 1573 |
| 446 | Ga0207689_10452155 | 3300025942 | Bacteria | 1074 |
| 447 | Ga0207689_10452497 | 3300025942 | Bacteria | 1073 |
| 448 | Ga0207689_10588056 | 3300025942 | Unclassified | 936 |
| 449 | Ga0207679_10033421 | 3300025945 | Bacteria | 3618 |
| 450 | Ga0207679_10141119 | 3300025945 | Unclassified | 1948 |
| 451 | Ga0207667_11187670 | 3300025949 | Bacteria | 743 |
| 452 | Ga0207667_11210306 | 3300025949 | Unclassified | 735 |
| 453 | Ga0207651_10081080 | 3300025960 | Bacteria | 2338 |
| 454 | Ga0207651_10090975 | 3300025960 | Bacteria | 2232 |
| 455 | Ga0207651_10150572 | 3300025960 | Bacteria | 1810 |
| 456 | Ga0207712_10045610 | 3300025961 | Unclassified | 3036 |
| 457 | Ga0207712_10163046 | 3300025961 | Bacteria | 1735 |
| 458 | Ga0207668_10042400 | 3300025972 | Bacteria | 3082 |
| 459 | Ga0207668_10054204 | 3300025972 | Bacteria | 2783 |
| 460 | Ga0207668_10610246 | 3300025972 | Bacteria | 951 |
| 461 | Ga0207658_10077369 | 3300025986 | Unclassified | 2538 |
| 462 | Ga0207658_11908830 | 3300025986 | Bacteria | 541 |
| 463 | Ga0207677_10024443 | 3300026023 | Bacteria | 3754 |
| 464 | Ga0207677_10072569 | 3300026023 | Bacteria | 2434 |
| 465 | Ga0207677_10113773 | 3300026023 | Bacteria | 2020 |
| 466 | Ga0207677_10330270 | 3300026023 | Bacteria | 1270 |
| 467 | Ga0207677_11040390 | 3300026023 | Unclassified | 744 |
| 468 | Ga0207703_10044075 | 3300026035 | Bacteria | 3583 |
| 469 | Ga0207703_10094370 | 3300026035 | Bacteria | 2522 |
| 470 | Ga0207703_10102724 | 3300026035 | Bacteria | 2426 |
| 471 | Ga0207703_10268518 | 3300026035 | Bacteria | 1545 |
| 472 | Ga0207703_11141866 | 3300026035 | Bacteria | 749 |
| 473 | Ga0207708_10003960 | 3300026075 | Bacteria | 10898 |
| 474 | Ga0207708_10063790 | 3300026075 | Bacteria | 2815 |
| 475 | Ga0207708_10111345 | 3300026075 | Bacteria | 2125 |
| 476 | Ga0207708_10206090 | 3300026075 | Bacteria | 1570 |
| 477 | Ga0207708_10962178 | 3300026075 | Unclassified | 741 |
| 478 | Ga0207702_11787650 | 3300026078 | Bacteria | 607 |
| 479 | Ga0207702_11858598 | 3300026078 | Bacteria | 594 |
| 480 | Ga0207641_10164474 | 3300026088 | Bacteria | 2019 |
| 481 | Ga0207641_10341654 | 3300026088 | Bacteria | 1425 |
| 482 | Ga0207641_10847454 | 3300026088 | Unclassified | 906 |
| 483 | Ga0207648_10083822 | 3300026089 | Unclassified | 2780 |
| 484 | Ga0207648_10121641 | 3300026089 | Bacteria | 2295 |
| 485 | Ga0207648_10122030 | 3300026089 | Bacteria | 2291 |
| 486 | Ga0207648_10122736 | 3300026089 | Bacteria | 2284 |
| 487 | Ga0207648_10134674 | 3300026089 | Unclassified | 2176 |
| 488 | Ga0207648_10171257 | 3300026089 | Bacteria | 1919 |
| 489 | Ga0207648_10297715 | 3300026089 | Bacteria | 1446 |
| 490 | Ga0207648_10584597 | 3300026089 | Bacteria | 1028 |
| 491 | Ga0207648_11395139 | 3300026089 | Bacteria | 658 |
| 492 | Ga0207648_11949256 | 3300026089 | Unclassified | 549 |
| 493 | Ga0207676_10737710 | 3300026095 | Unclassified | 957 |
| 494 | Ga0207676_11241838 | 3300026095 | Unclassified | 739 |
| 495 | Ga0207674_10066721 | 3300026116 | Unclassified | 3623 |
| 496 | Ga0207674_10145830 | 3300026116 | Bacteria | 2326 |
| 497 | Ga0207674_12109543 | 3300026116 | Unclassified | 527 |
| 498 | Ga0207675_100014473 | 3300026118 | Bacteria | 7356 |
| 499 | Ga0207675_100029988 | 3300026118 | Bacteria | 5063 |
| 500 | Ga0207675_100066711 | 3300026118 | Bacteria | 3364 |
| 501 | Ga0207675_100243661 | 3300026118 | Bacteria | 1738 |
| 502 | Ga0207675_100254679 | 3300026118 | Bacteria | 1700 |
| 503 | Ga0207675_100309750 | 3300026118 | Unclassified | 1540 |
| 504 | Ga0207675_100699842 | 3300026118 | Bacteria | 1022 |
| 505 | Ga0207675_100715573 | 3300026118 | Bacteria | 1011 |
| 506 | Ga0207683_10044922 | 3300026121 | Unclassified | 3863 |
| 507 | Ga0207683_10067393 | 3300026121 | Bacteria | 3158 |
| 508 | Ga0207683_10253225 | 3300026121 | Bacteria | 1607 |
| 509 | Ga0207683_10265355 | 3300026121 | Bacteria | 1568 |
| 510 | Ga0207698_11248479 | 3300026142 | Unclassified | 757 |
| 511 | Ga0207428_10060918 | 3300027907 | Unclassified | 2989 |
| 512 | Ga0207428_10100198 | 3300027907 | Unclassified | 2239 |
| 513 | Ga0207428_10494337 | 3300027907 | Unclassified | 889 |
| 514 | Ga0207428_10769049 | 3300027907 | Unclassified | 686 |
| 515 | Ga0268266_10341158 | 3300028379 | Unclassified | 1406 |
| 516 | Ga0268266_10383969 | 3300028379 | Unclassified | 1325 |
| 517 | Ga0268265_10073560 | 3300028380 | Bacteria | 2669 |
| 518 | Ga0268265_10451419 | 3300028380 | Bacteria | 1201 |
| 519 | Ga0268264_10059168 | 3300028381 | Bacteria | 3210 |
| 520 | Ga0268264_10664193 | 3300028381 | Unclassified | 1033 |
| 521 | Ga0268264_10668472 | 3300028381 | Unclassified | 1029 |
| 522 | Ga0268264_12226244 | 3300028381 | Unclassified | 556 |
| 523 | Ga0307408_100112813 | 3300031548 | Bacteria | 2091 |
| 524 | Ga0307408_100352594 | 3300031548 | Unclassified | 1249 |
| 525 | Ga0307408_100468200 | 3300031548 | Bacteria | 1097 |
| 526 | Ga0307405_10056086 | 3300031731 | Unclassified | 2469 |
| 527 | Ga0307405_12146862 | 3300031731 | Unclassified | 502 |
| 528 | Ga0307413_10415967 | 3300031824 | Bacteria | 1057 |
| 529 | Ga0307410_10006846 | 3300031852 | Bacteria | 6191 |
| 530 | Ga0307410_10031075 | 3300031852 | Unclassified | 3422 |
| 531 | Ga0307410_10049644 | 3300031852 | Unclassified | 2818 |
| 532 | Ga0307410_11211912 | 3300031852 | Bacteria | 658 |
| 533 | Ga0307407_10071413 | 3300031903 | Bacteria | 2067 |
| 534 | Ga0307407_11458524 | 3300031903 | Unclassified | 540 |
| 535 | Ga0307407_11543209 | 3300031903 | Unclassified | 526 |
| 536 | Ga0307412_10129588 | 3300031911 | Bacteria | 1830 |
| 537 | Ga0307412_10697478 | 3300031911 | Unclassified | 871 |
| 538 | Ga0307409_100008311 | 3300031995 | Bacteria | 6291 |
| 539 | Ga0307409_100395565 | 3300031995 | Bacteria | 1318 |
| 540 | Ga0307416_100049811 | 3300032002 | Unclassified | 3333 |
| 541 | Ga0307416_100117139 | 3300032002 | Unclassified | 2364 |
| 542 | Ga0307416_100344320 | 3300032002 | Bacteria | 1505 |
| 543 | Ga0307416_100418031 | 3300032002 | Unclassified | 1384 |
| 544 | Ga0307416_101302715 | 3300032002 | Unclassified | 832 |
| 545 | Ga0307416_101495441 | 3300032002 | Unclassified | 781 |
| 546 | Ga0307416_103380328 | 3300032002 | Bacteria | 534 |
| 547 | Ga0307414_10099720 | 3300032004 | Unclassified | 2183 |
| 548 | Ga0307414_10494466 | 3300032004 | Bacteria | 1081 |
| 549 | Ga0307414_10589221 | 3300032004 | Bacteria | 996 |
| 550 | Ga0307411_10128049 | 3300032005 | Unclassified | 1850 |
| 551 | Ga0307411_10280201 | 3300032005 | Bacteria | 1326 |
| 552 | Ga0307411_10911141 | 3300032005 | Bacteria | 782 |
| 553 | Ga0307415_100532774 | 3300032126 | Unclassified | 1033 |
| 554 | Ga0307415_100996502 | 3300032126 | Unclassified | 778 |
| 555 | Ga0307415_102090778 | 3300032126 | Unclassified | 553 |
| 556 | Ga0373958_0000363 | 3300034819 | Bacteria | 5445 |
| 557 | Ga0373959_0001089 | 3300034820 | Bacteria | 4446 |
| 558 | Ga0373938_0000469 | 3300034957 | Bacteria | 6531 |
| 559 | Ga0373928_0003234 | 3300035084 | Bacteria | 3120 |
| 560 | Ga0373929_0000122 | 3300035085 | Bacteria | 12847 |
| 561 | Ga0373934_0083668 | 3300035086 | Bacteria | 1283 |
| 562 | Ga0373949_0000220 | 3300035090 | Bacteria | 21606 |
| 563 | Ga0373951_0017546 | 3300035091 | Bacteria | 1620 |
| 564 | Ga0373952_0002068 | 3300035092 | Bacteria | 3616 |
| 565 | Ga0373932_0040683 | 3300035112 | Bacteria | 1339 |
| 566 | Ga0373939_0001034 | 3300035114 | Bacteria | 6865 |
| 567 | Ga0373960_0000019 | 3300035121 | Bacteria | 20370 |
| 568 | Ga0373960_0195614 | 3300035121 | Unclassified | 713 |
| 569 | Ga0373942_0000799 | 3300035207 | Bacteria | 8673 |
| 570 | Ga0373961_0003623 | 3300035241 | Bacteria | 3799 |
| 571 | Ga0373961_0426695 | 3300035241 | Unclassified | 513 |
| 572 | Ga0373962_0004785 | 3300035242 | Bacteria | 3268 |
| 573 | Ga0373931_0004607 | 3300035691 | Bacteria | 6308 |
| 574 | Ga0373931_0337945 | 3300035691 | Unclassified | 940 |
| 575 | Ga0373937_0138776 | 3300036401 | Unclassified | 2274 |
| 576 | Ga0242420_067281 | 3300038996 | Bacteria | 723 |
| 577 | Ga0439439_0016621 | 3300041406 | Bacteria | 1804 |
| 578 | Ga0439453_0110858 | 3300041408 | Unclassified | 621 |
| 579 | Ga0451798_0570944 | 3300041458 | Bacteria | 635 |
| 580 | Ga0451800_0382848 | 3300041459 | Bacteria | 1083 |
| 581 | Ga0451807_1627663 | 3300041486 | Bacteria | 1098 |
| 582 | Ga0451841_0185251 | 3300041498 | Bacteria | 1063 |
| 583 | Ga0451853_0962947 | 3300041512 | Bacteria | 1177 |
| 584 | Ga0439431_0179779 | 3300041997 | Bacteria | 610 |
| 585 | Ga0439433_0139157 | 3300041999 | Unclassified | 620 |
| 586 | Ga0439450_136212 | 3300042008 | Bacteria | 639 |
| 587 | Ga0439455_0208311 | 3300042012 | Unclassified | 567 |
| 588 | Ga0439462_0005546 | 3300042015 | Bacteria | 3113 |
| 589 | Ga0450912_022125 | 3300042116 | Bacteria | 621 |
| 590 | Ga0450922_030904 | 3300042124 | Unclassified | 583 |
| 591 | Ga0450923_010492 | 3300042125 | Bacteria | 1646 |
| 592 | Ga0439446_0001569 | 3300042156 | Bacteria | 5249 |
| 593 | Ga0450908_073949 | 3300042184 | Unclassified | 607 |
| 594 | Ga0439434_0007256 | 3300042435 | Bacteria | 3248 |
| 595 | Ga0439435_0159368 | 3300042436 | Bacteria | 728 |
| 596 | Ga0439435_0162879 | 3300042436 | Bacteria | 721 |
| 597 | Ga0439435_0298260 | 3300042436 | Unclassified | 552 |
| 598 | Ga0439444_0018807 | 3300042437 | Unclassified | 1200 |
| 599 | Ga0439460_0352671 | 3300042461 | Unclassified | 519 |
| 600 | Ga0450916_008748 | 3300042530 | Bacteria | 1238 |
| 601 | Ga0453683_0162127 | 3300044673 | Bacteria | 1415 |
| 602 | Ga0451576_0018496 | 3300045051 | Bacteria | 7637 |
| 603 | Ga0451576_0149972 | 3300045051 | Bacteria | 2432 |
| 604 | Ga0451576_0160152 | 3300045051 | Bacteria | 2348 |
| 605 | Ga0495608_0579932 | 3300046511 | Unclassified | 674 |
| 606 | Ga0495644_0418032 | 3300046523 | Bacteria | 532 |
| 607 | Ga0495598_0246687 | 3300046537 | Unclassified | 660 |
| 608 | Ga0495621_0011279 | 3300046539 | Bacteria | 2760 |
| 609 | Ga0495621_0043150 | 3300046539 | Bacteria | 1590 |
| 610 | Ga0495633_0332291 | 3300046558 | Bacteria | 689 |
| 611 | Ga0495656_0021928 | 3300046615 | Unclassified | 2494 |
| 612 | Ga0495658_0281829 | 3300046683 | Bacteria | 1049 |
| 613 | Ga0495658_0677067 | 3300046683 | Unclassified | 661 |
| 614 | Ga0495669_0109664 | 3300046684 | Bacteria | 1288 |
| 615 | Ga0495670_0326804 | 3300046691 | Bacteria | 824 |
| 616 | Ga0495676_0305637 | 3300047321 | Bacteria | 1072 |
| 617 | Ga0496100_0840904 | 3300048903 | Unclassified | 720 |
| 618 | Ga0496101_0074483 | 3300048904 | Unclassified | 2497 |
| 619 | Ga0496102_1216579 | 3300048905 | Bacteria | 673 |
| 620 | Ga0496104_0061060 | 3300048907 | Bacteria | 3572 |
| 621 | Ga0496104_0228089 | 3300048907 | Bacteria | 1775 |
| 622 | Ga0496104_0370323 | 3300048907 | Unclassified | 1345 |
| 623 | Ga0496104_1070886 | 3300048907 | Unclassified | 710 |
| 624 | Ga0496105_0425295 | 3300048908 | Unclassified | 1051 |
| 625 | Ga0496105_0675882 | 3300048908 | Bacteria | 795 |
| 626 | Ga0496106_0096359 | 3300048909 | Bacteria | 2289 |
| 627 | Ga0496106_0185777 | 3300048909 | Bacteria | 1651 |
| 628 | Ga0496106_0261570 | 3300048909 | Unclassified | 1385 |
| 629 | Ga0496106_0263276 | 3300048909 | Bacteria | 1380 |
| 630 | Ga0496106_1166676 | 3300048909 | Unclassified | 602 |
| 631 | Ga0496107_0194772 | 3300048910 | Unclassified | 1506 |
| 632 | Ga0496108_0050005 | 3300048911 | Unclassified | 3498 |
| 633 | Ga0496108_0191075 | 3300048911 | Bacteria | 1775 |
| 634 | Ga0496109_0056342 | 3300048912 | Bacteria | 3587 |
| 635 | Ga0496109_1954131 | 3300048912 | Unclassified | 519 |
| 636 | Ga0496110_0087287 | 3300048913 | Unclassified | 2786 |
| 637 | Ga0496110_0765169 | 3300048913 | Unclassified | 869 |
| 638 | Ga0496110_1559842 | 3300048913 | Unclassified | 570 |
| 639 | Ga0496110_1711353 | 3300048913 | Bacteria | 539 |
| 640 | Ga0496112_0003844 | 3300048915 | Bacteria | 12540 |
| 641 | Ga0496112_0126108 | 3300048915 | Unclassified | 2531 |
| 642 | Ga0496112_0550687 | 3300048915 | Bacteria | 1087 |
| 643 | Ga0496113_0204173 | 3300048916 | Unclassified | 1571 |
| 644 | Ga0496113_1501668 | 3300048916 | Unclassified | 520 |
| 645 | Ga0501031_0134902 | 3300049568 | Bacteria | 1612 |
| 646 | Ga0501031_0380741 | 3300049568 | Bacteria | 913 |
| 647 | Ga0501032_0027604 | 3300049569 | Bacteria | 3901 |
| 648 | Ga0501033_0237124 | 3300049570 | Unclassified | 1294 |
| 649 | Ga0501034_0324633 | 3300049571 | Unclassified | 1471 |
| 650 | Ga0501034_0421533 | 3300049571 | Bacteria | 1255 |
| 651 | Ga0501034_0520353 | 3300049571 | Bacteria | 1101 |
| 652 | Ga0501034_0825822 | 3300049571 | Unclassified | 818 |
| 653 | Ga0501036_0016973 | 3300049572 | Bacteria | 6082 |
| 654 | Ga0501036_0574043 | 3300049572 | Bacteria | 936 |
| 655 | Ga0501037_0066290 | 3300049573 | Bacteria | 2630 |
| 656 | Ga0501037_0196299 | 3300049573 | Unclassified | 1427 |
| 657 | Ga0501038_0014527 | 3300049574 | Bacteria | 7176 |
| 658 | Ga0501038_0539123 | 3300049574 | Bacteria | 888 |
| 659 | Ga0501039_0039567 | 3300049575 | Bacteria | 3641 |
| 660 | Ga0501039_0044090 | 3300049575 | Bacteria | 3444 |
| 661 | Ga0501039_0139705 | 3300049575 | Unclassified | 1903 |
| 662 | Ga0501040_0052621 | 3300049576 | Bacteria | 2788 |
| 663 | Ga0501040_0701408 | 3300049576 | Unclassified | 732 |
| 664 | Ga0501040_1108039 | 3300049576 | Bacteria | 574 |
| 665 | Ga0501041_0095739 | 3300049577 | Bacteria | 1835 |
| 666 | Ga0501042_0137505 | 3300049578 | Bacteria | 1761 |
| 667 | Ga0501042_0140934 | 3300049578 | Bacteria | 1738 |
| 668 | Ga0501042_0204244 | 3300049578 | Bacteria | 1425 |
| 669 | Ga0501042_0586078 | 3300049578 | Bacteria | 811 |
| 670 | Ga0501043_0009137 | 3300049579 | Bacteria | 7796 |
| 671 | Ga0501043_0398313 | 3300049579 | Unclassified | 1040 |
| 672 | Ga0501046_0105626 | 3300049580 | Bacteria | 2156 |
| 673 | Ga0501046_0210252 | 3300049580 | Bacteria | 1444 |
| 674 | Ga0501046_0337915 | 3300049580 | Bacteria | 1095 |
| 675 | Ga0501046_0785021 | 3300049580 | Bacteria | 668 |
| 676 | Ga0501047_0003455 | 3300049581 | Bacteria | 14928 |
| 677 | Ga0501047_0043057 | 3300049581 | Bacteria | 4362 |
| 678 | Ga0501047_0147321 | 3300049581 | Bacteria | 2230 |
| 679 | Ga0501047_0166637 | 3300049581 | Bacteria | 2073 |
| 680 | Ga0501048_0135735 | 3300049582 | Bacteria | 1739 |
| 681 | Ga0501048_0806456 | 3300049582 | Bacteria | 674 |
| 682 | Ga0501067_0204935 | 3300049583 | Bacteria | 1098 |
| 683 | Ga0501068_0012479 | 3300049584 | Bacteria | 4821 |
| 684 | Ga0501068_0131972 | 3300049584 | Bacteria | 1562 |
| 685 | Ga0501068_0825220 | 3300049584 | Bacteria | 608 |
| 686 | Ga0501069_0886615 | 3300049585 | Bacteria | 542 |
| 687 | Ga0501070_0087886 | 3300049586 | Bacteria | 2573 |
| 688 | Ga0501070_0950080 | 3300049586 | Unclassified | 668 |
| 689 | Ga0501071_0115309 | 3300049587 | Bacteria | 1988 |
| 690 | Ga0501071_1250853 | 3300049587 | Bacteria | 573 |
| 691 | Ga0501072_0011481 | 3300049588 | Bacteria | 6772 |
| 692 | Ga0501072_0041273 | 3300049588 | Unclassified | 3624 |
| 693 | Ga0501072_0132481 | 3300049588 | Unclassified | 1987 |
| 694 | Ga0501072_0637364 | 3300049588 | Unclassified | 839 |
| 695 | Ga0501072_1235659 | 3300049588 | Bacteria | 580 |
| 696 | Ga0501073_0029699 | 3300049589 | Bacteria | 3906 |
| 697 | Ga0501073_0052222 | 3300049589 | Bacteria | 2862 |
| 698 | Ga0501073_0053032 | 3300049589 | Bacteria | 2839 |
| 699 | Ga0501073_0158184 | 3300049589 | Bacteria | 1570 |
| 700 | Ga0501073_0186285 | 3300049589 | Unclassified | 1436 |
| 701 | Ga0501073_0863021 | 3300049589 | Bacteria | 623 |
| 702 | Ga0501074_0087092 | 3300049590 | Bacteria | 2237 |
| 703 | Ga0501074_0458798 | 3300049590 | Bacteria | 903 |
| 704 | Ga0501075_1183136 | 3300049591 | Unclassified | 580 |
| 705 | Ga0501076_0140316 | 3300049592 | Bacteria | 1963 |
| 706 | Ga0501076_0203837 | 3300049592 | Bacteria | 1616 |
| 707 | Ga0501076_0236787 | 3300049592 | Bacteria | 1493 |
| 708 | Ga0501076_0291078 | 3300049592 | Unclassified | 1338 |
| 709 | Ga0501076_0518990 | 3300049592 | Bacteria | 982 |
| 710 | Ga0501076_0600330 | 3300049592 | Bacteria | 908 |
| 711 | Ga0501077_0165747 | 3300049593 | Bacteria | 1404 |
| 712 | Ga0501077_0173675 | 3300049593 | Bacteria | 1369 |
| 713 | Ga0501077_0242146 | 3300049593 | Bacteria | 1147 |
| 714 | Ga0501077_0504417 | 3300049593 | Bacteria | 776 |
| 715 | Ga0501209_115908 | 3300049656 | Bacteria | 793 |
| 716 | Ga0501211_050034 | 3300049658 | Unclassified | 516 |
| 717 | Ga0501234_036452 | 3300049707 | Bacteria | 800 |
| 718 | Ga0501079_0171663 | 3300049741 | Bacteria | 1691 |
| 719 | Ga0501079_0437325 | 3300049741 | Bacteria | 1027 |
| 720 | Ga0501079_1267594 | 3300049741 | Unclassified | 580 |
| 721 | Ga0501080_0070575 | 3300049742 | Bacteria | 3249 |
| 722 | Ga0501080_0116751 | 3300049742 | Bacteria | 2473 |
| 723 | Ga0501080_0678146 | 3300049742 | Bacteria | 910 |
| 724 | Ga0501081_1529509 | 3300049743 | Unclassified | 507 |
| 725 | Ga0501081_1544061 | 3300049743 | Unclassified | 504 |
| 726 | Ga0501083_0001245 | 3300049744 | Bacteria | 17292 |
| 727 | Ga0501083_0023297 | 3300049744 | Bacteria | 4295 |
| 728 | Ga0501083_0626916 | 3300049744 | Unclassified | 699 |
| 729 | Ga0501279_106790 | 3300049775 | Unclassified | 510 |
| 730 | Ga0501035_0064275 | 3300049822 | Bacteria | 3261 |
| 731 | Ga0501035_0173055 | 3300049822 | Unclassified | 1864 |
| 732 | Ga0501035_0405978 | 3300049822 | Unclassified | 1133 |
| 733 | Ga0501044_0050570 | 3300049823 | Bacteria | 4287 |
| 734 | Ga0501044_0319471 | 3300049823 | Bacteria | 1477 |
| 735 | Ga0501044_0681721 | 3300049823 | Bacteria | 914 |
| 736 | nmdc:mga00v17_326562_c1 | 3300050491 | Bacteria | 997 |
| 737 | nmdc:mga00v17_610046_c1 | 3300050491 | Bacteria | 703 |
| 738 | nmdc:mga0yw44_2948_c1 | 3300050492 | Bacteria | 7412 |
| 739 | nmdc:mga0k408_395357_c1 | 3300050493 | Unclassified | 823 |
| 740 | nmdc:mga05p37_251387_c1 | 3300050507 | Bacteria | 2120 |
| 741 | nmdc:mga05p37_36168_c1 | 3300050507 | Bacteria | 6059 |
| 742 | nmdc:mga05p37_407531_c1 | 3300050507 | Unclassified | 1586 |
| 743 | nmdc:mga05p37_663193_c1 | 3300050507 | Bacteria | 1166 |
| 744 | nmdc:mga05p37_83_c1 | 3300050507 | Bacteria | 83944 |
| 745 | nmdc:mga09592_104665_c1 | 3300050508 | Bacteria | 2425 |
| 746 | nmdc:mga09592_347152_c1 | 3300050508 | Bacteria | 1284 |
| 747 | nmdc:mga09592_749825_c1 | 3300050508 | Unclassified | 828 |
| 748 | nmdc:mga0qj67_171986_c1 | 3300050509 | Unclassified | 1759 |
| 749 | nmdc:mga0qj67_852819_c1 | 3300050509 | Bacteria | 719 |
| 750 | nmdc:mga06r32_1742060_c1 | 3300050510 | Unclassified | 559 |
| 751 | nmdc:mga08y16_1009930_c1 | 3300050511 | Bacteria | 811 |
| 752 | nmdc:mga08y16_110695_c1 | 3300050511 | Bacteria | 2860 |
| 753 | nmdc:mga08y16_1166173_c1 | 3300050511 | Unclassified | 743 |
| 754 | nmdc:mga08y16_1181980_c1 | 3300050511 | Bacteria | 736 |
| 755 | nmdc:mga08y16_124696_c1 | 3300050511 | Bacteria | 2679 |
| 756 | nmdc:mga08y16_1298965_c1 | 3300050511 | Bacteria | 694 |
| 757 | nmdc:mga08y16_1689944_c1 | 3300050511 | Unclassified | 589 |
| 758 | nmdc:mga08y16_17209_c1 | 3300050511 | Bacteria | 7608 |
| 759 | nmdc:mga08y16_288984_c1 | 3300050511 | Bacteria | 1690 |
| 760 | nmdc:mga08y16_446074_c1 | 3300050511 | Bacteria | 1320 |
| 761 | nmdc:mga08y16_6792_c1 | 3300050511 | Bacteria | 12007 |
| 762 | nmdc:mga08y16_825409_c1 | 3300050511 | Unclassified | 918 |
| 763 | nmdc:mga0n895_11960_c1 | 3300050512 | Bacteria | 7764 |
| 764 | nmdc:mga0n895_15068_c1 | 3300050512 | Bacteria | 7045 |
| 765 | nmdc:mga0n895_1542124_c1 | 3300050512 | Unclassified | 630 |
| 766 | nmdc:mga0n895_17_c1 | 3300050512 | Bacteria | 97721 |
| 767 | nmdc:mga0n895_2039_c1 | 3300050512 | Bacteria | 15534 |
| 768 | nmdc:mga0rr50_144118_c1 | 3300050513 | Unclassified | 1919 |
| 769 | nmdc:mga0rr50_1608_c1 | 3300050513 | Bacteria | 12426 |
| 770 | nmdc:mga0rr50_24_c1 | 3300050513 | Bacteria | 115213 |
| 771 | nmdc:mga0rr50_702651_c1 | 3300050513 | Bacteria | 863 |
| 772 | nmdc:mga0rr50_804666_c1 | 3300050513 | Unclassified | 802 |
| 773 | nmdc:mga08x19_164_c1 | 3300050514 | Bacteria | 48608 |
| 774 | nmdc:mga08x19_517657_c1 | 3300050514 | Bacteria | 843 |
| 775 | nmdc:mga08x19_7373_c1 | 3300050514 | Bacteria | 6534 |
| 776 | nmdc:mga08x19_914790_c1 | 3300050514 | Unclassified | 623 |
| 777 | nmdc:mga0a205_11547_c1 | 3300050515 | Bacteria | 8137 |
| 778 | nmdc:mga0a205_17017_c1 | 3300050515 | Bacteria | 6806 |
| 779 | nmdc:mga0a205_212874_c1 | 3300050515 | Unclassified | 1820 |
| 780 | nmdc:mga0a205_599171_c1 | 3300050515 | Bacteria | 955 |
| 781 | nmdc:mga0a205_72607_c1 | 3300050515 | Bacteria | 3325 |
| 782 | nmdc:mga0a205_92_c1 | 3300050515 | Bacteria | 50403 |
| 783 | Ga0500646_0007759 | 3300053090 | Bacteria | 2743 |
| 784 | Ga0500656_045039 | 3300053732 | Bacteria | 628 |
| 785 | Ga0501084_0009505 | 3300054114 | Bacteria | 8044 |
| 786 | Ga0501084_0061658 | 3300054114 | Bacteria | 3140 |
| 787 | Ga0501084_0933784 | 3300054114 | Bacteria | 729 |
| 788 | Ga0501084_1693949 | 3300054114 | Unclassified | 528 |
| 789 | Ga0590071_002122 | 3300059421 | Bacteria | 5057 |
| 790 | Ga0590075_000750 | 3300059424 | Bacteria | 8601 |
| 791 | Ga0590077_001671 | 3300059426 | Bacteria | 5075 |
| 792 | Ga0501082_0074877 | 3300060353 | Unclassified | 2916 |
| 793 | Ga0501082_0285896 | 3300060353 | Unclassified | 1435 |
| 794 | Ga0530510_0036842 | 3300061734 | Bacteria | 3524 |
| 795 | Ga0530510_0636240 | 3300061734 | Bacteria | 812 |
| 796 | Ga0501036_0720619 | |||
| 797 | JGI24751J29686_10131986 | |||
| 798 | Ga0065714_10102457 | |||
| 799 | Ga0065704_10800817 | |||
| 800 | Ga0065712_10000807 | |||
| 801 | Ga0065712_10006045 | |||
| 802 | Ga0065712_10122352 | |||
| 803 | Ga0065712_10432351 | |||
| 804 | Ga0065715_10000845 | |||
| 805 | Ga0065715_10003716 | |||
| 806 | Ga0065715_10109450 | |||
| 807 | Ga0065707_10004336 | |||
| 808 | Ga0065707_10023054 | |||
| 809 | Ga0065707_10114302 | |||
| 810 | Ga0065707_10127931 | |||
| 811 | Ga0065707_10274329 | |||
| 812 | Ga0065707_11000503 | |||
| 813 | Ga0070676_10035577 | |||
| 814 | Ga0070676_10244831 | |||
| 815 | Ga0070676_10843170 | |||
| 816 | Ga0070690_100143722 | |||
| 817 | Ga0070670_100025561 | |||
| 818 | Ga0070670_100048009 | |||
| 819 | Ga0070677_10007025 | |||
| 820 | Ga0070677_10342862 | |||
| 821 | Ga0068869_100014517 | |||
| 822 | Ga0068869_100020851 | |||
| 823 | Ga0068869_100021112 | |||
| 824 | Ga0070666_10001318 | |||
| 825 | Ga0070666_10160782 | |||
| 826 | Ga0070666_10200055 | |||
| 827 | Ga0070680_100032429 | |||
| 828 | Ga0070680_100607565 | |||
| 829 | Ga0070682_100267645 | |||
| 830 | Ga0070682_101327243 | |||
| 831 | Ga0068868_100012160 | |||
| 832 | Ga0068868_100021537 | |||
| 833 | Ga0068868_100145459 | |||
| 834 | Ga0068868_101990479 | |||
| 835 | Ga0070660_100215708 | |||
| 836 | Ga0070660_100243614 | |||
| 837 | Ga0070687_100012129 | |||
| 838 | Ga0070687_100195485 | |||
| 839 | Ga0070661_100968244 | |||
| 840 | Ga0070661_101477905 | |||
| 841 | Ga0070692_10107878 | |||
| 842 | Ga0070692_10128682 | |||
| 843 | Ga0070668_100014091 | |||
| 844 | Ga0070668_101815988 | |||
| 845 | Ga0070668_101974462 | |||
| 846 | Ga0070669_100037579 | |||
| 847 | Ga0070669_100071682 | |||
| 848 | Ga0070669_100142270 | |||
| 849 | Ga0070669_100148759 | |||
| 850 | Ga0070669_100548220 | |||
| 851 | Ga0070675_100001455 | |||
| 852 | Ga0070675_100003808 | |||
| 853 | Ga0070675_100023813 | |||
| 854 | Ga0070675_101604429 | |||
| 855 | Ga0070671_100105863 | |||
| 856 | Ga0070671_101199450 | |||
| 857 | Ga0070671_101499137 | |||
| 858 | Ga0070674_100008740 | |||
| 859 | Ga0070674_100008932 | |||
| 860 | Ga0070674_100250943 | |||
| 861 | Ga0070674_100438002 | |||
| 862 | Ga0070674_100658662 | |||
| 863 | Ga0070674_101574473 | |||
| 864 | Ga0070674_101836809 | |||
| 865 | Ga0070673_100037306 | |||
| 866 | Ga0070673_100049301 | |||
| 867 | Ga0070673_100388613 | |||
| 868 | Ga0070673_100395106 | |||
| 869 | Ga0070688_100003414 | |||
| 870 | Ga0070688_100021822 | |||
| 871 | Ga0070688_101681905 | |||
| 872 | Ga0070659_100522781 | |||
| 873 | Ga0070667_100033587 | |||
| 874 | Ga0070667_101595818 | |||
| 875 | Ga0070703_10165841 | |||
| 876 | Ga0070709_10102195 | |||
| 877 | Ga0070714_100016099 | |||
| 878 | Ga0070713_100100856 | |||
| 879 | Ga0070701_10060487 | |||
| 880 | Ga0070701_10209769 | |||
| 881 | Ga0070701_10365871 | |||
| 882 | Ga0070711_101580643 | |||
| 883 | Ga0070705_100501766 | |||
| 884 | Ga0070700_100021340 | |||
| 885 | Ga0070700_100024698 | |||
| 886 | Ga0070700_100175498 | |||
| 887 | Ga0070700_100247120 | |||
| 888 | Ga0070694_100303632 | |||
| 889 | Ga0070708_100201583 | |||
| 890 | Ga0070678_100117957 | |||
| 891 | Ga0070678_100226743 | |||
| 892 | Ga0070678_100234818 | |||
| 893 | Ga0070678_100267802 | |||
| 894 | Ga0070678_100316637 | |||
| 895 | Ga0070678_101231465 | |||
| 896 | Ga0070662_100012810 | |||
| 897 | Ga0070662_100065790 | |||
| 898 | Ga0070662_100928995 | |||
| 899 | Ga0070681_10041142 | |||
| 900 | Ga0070681_10045606 | |||
| 901 | Ga0068867_100248459 | |||
| 902 | Ga0068867_100518172 | |||
| 903 | Ga0068867_100624998 | |||
| 904 | Ga0068867_100829565 | |||
| 905 | Ga0068867_101338938 | |||
| 906 | Ga0068867_101628427 | |||
| 907 | Ga0068867_102418247 | |||
| 908 | Ga0070685_10003871 | |||
| 909 | Ga0070685_10077859 | |||
| 910 | Ga0070685_10084394 | |||
| 911 | Ga0070685_11468515 | |||
| 912 | Ga0070706_101479703 | |||
| 913 | Ga0070707_100961447 | |||
| 914 | Ga0070707_101856419 | |||
| 915 | Ga0070707_102110483 | |||
| 916 | Ga0070698_100049084 | |||
| 917 | Ga0070698_100615232 | |||
| 918 | Ga0070679_100195907 | |||
| 919 | Ga0070679_101096274 | |||
| 920 | Ga0070697_100633256 | |||
| 921 | Ga0068853_100760619 | |||
| 922 | Ga0070672_100018221 | |||
| 923 | Ga0070672_100059390 | |||
| 924 | Ga0070672_100310121 | |||
| 925 | Ga0070672_100455909 | |||
| 926 | Ga0070686_100118127 | |||
| 927 | Ga0070686_100331878 | |||
| 928 | Ga0070686_101234419 | |||
| 929 | Ga0070686_101668265 | |||
| 930 | Ga0070695_100976658 | |||
| 931 | Ga0070695_101115335 | |||
| 932 | Ga0070696_100559791 | |||
| 933 | Ga0070665_100004648 | |||
| 934 | Ga0070665_100126941 | |||
| 935 | Ga0070704_100095059 | |||
| 936 | Ga0070704_100344009 | |||
| 937 | Ga0070704_101135500 | |||
| 938 | Ga0068855_100819840 | |||
| 939 | Ga0068855_101331127 | |||
| 940 | Ga0068855_101955256 | |||
| 941 | Ga0070664_100390397 | |||
| 942 | Ga0070664_101006081 | |||
| 943 | Ga0068857_100095237 | |||
| 944 | Ga0068857_102159312 | |||
| 945 | Ga0068857_102336998 | |||
| 946 | Ga0068854_100069569 | |||
| 947 | Ga0068856_100586524 | |||
| 948 | Ga0068856_101944842 | |||
| 949 | Ga0070702_100209120 | |||
| 950 | Ga0070702_100313280 | |||
| 951 | Ga0068852_101605368 | |||
| 952 | Ga0068859_100001487 | |||
| 953 | Ga0068859_100211749 | |||
| 954 | Ga0068859_100509894 | |||
| 955 | Ga0068859_100857628 | |||
| 956 | Ga0068859_101410971 | |||
| 957 | Ga0068859_101512013 | |||
| 958 | Ga0068859_102061428 | |||
| 959 | Ga0068864_100003702 | |||
| 960 | Ga0068864_100155773 | |||
| 961 | Ga0068864_102100939 | |||
| 962 | Ga0068866_10004903 | |||
| 963 | Ga0068866_10110518 | |||
| 964 | Ga0068861_100016584 | |||
| 965 | Ga0068861_100113448 | |||
| 966 | Ga0068861_100149931 | |||
| 967 | Ga0068861_100164648 | |||
| 968 | Ga0068861_100211424 | |||
| 969 | Ga0068861_100297944 | |||
| 970 | Ga0068861_102602970 | |||
| 971 | Ga0068870_10003997 | |||
| 972 | Ga0068870_10162065 | |||
| 973 | Ga0068870_10383104 | |||
| 974 | Ga0068863_100032426 | |||
| 975 | Ga0068863_100325308 | |||
| 976 | Ga0068858_100006957 | |||
| 977 | Ga0068858_100213656 | |||
| 978 | Ga0068858_101017836 | |||
| 979 | Ga0068860_100070980 | |||
| 980 | Ga0068860_100709355 | |||
| 981 | Ga0068860_100964491 | |||
| 982 | Ga0068862_100012750 | |||
| 983 | Ga0068862_100168561 | |||
| 984 | Ga0068862_100375230 | |||
| 985 | Ga0075365_10062295 | |||
| 986 | Ga0075364_10885379 | |||
| 987 | Ga0070716_100597923 | |||
| 988 | Ga0075362_10509466 | |||
| 989 | Ga0097621_100003561 | |||
| 990 | Ga0097621_100096709 | |||
| 991 | Ga0097621_100278642 | |||
| 992 | Ga0075370_10946670 | |||
| 993 | Ga0068871_100003227 | |||
| 994 | Ga0068871_100174791 | |||
| 995 | Ga0068871_100640419 | |||
| 996 | Ga0068871_102156637 | |||
| 997 | Ga0075428_100268826 | |||
| 998 | Ga0075428_100275370 | |||
| 999 | Ga0075428_100444042 | |||
| 1000 | Ga0075428_100853823 | |||
| 1001 | Ga0075428_100988528 | |||
| 1002 | Ga0075428_101031590 | |||
| 1003 | Ga0075428_102360381 | |||
| 1004 | Ga0075430_100418091 | |||
| 1005 | Ga0075431_100013240 | |||
| 1006 | Ga0075431_101357740 | |||
| 1007 | Ga0075433_10000070 | |||
| 1008 | Ga0075433_10012046 | |||
| 1009 | Ga0075433_10032705 | |||
| 1010 | Ga0075433_10164127 | |||
| 1011 | Ga0075434_100000166 | |||
| 1012 | Ga0075434_100006624 | |||
| 1013 | Ga0075434_100064055 | |||
| 1014 | Ga0075434_100393323 | |||
| 1015 | Ga0075434_100851630 | |||
| 1016 | Ga0075429_100124400 | |||
| 1017 | Ga0075429_100178211 | |||
| 1018 | Ga0075429_100934719 | |||
| 1019 | Ga0075429_101677779 | |||
| 1020 | Ga0068865_100016378 | |||
| 1021 | Ga0068865_100099915 | |||
| 1022 | Ga0068865_100132528 | |||
| 1023 | Ga0068865_100151936 | |||
| 1024 | Ga0068865_100176846 | |||
| 1025 | Ga0068865_100209992 | |||
| 1026 | Ga0068865_101685373 | |||
| 1027 | Ga0075436_100000507 | |||
| 1028 | Ga0075436_100002804 | |||
| 1029 | Ga0075436_101158139 | |||
| 1030 | Ga0097620_100001487 | |||
| 1031 | Ga0097620_100211740 | |||
| 1032 | Ga0097620_100509885 | |||
| 1033 | Ga0097620_100857762 | |||
| 1034 | Ga0097620_101410537 | |||
| 1035 | Ga0097620_101512333 | |||
| 1036 | Ga0097620_102061196 | |||
| 1037 | Ga0075435_100000005 | |||
| 1038 | Ga0075435_100002968 | |||
| 1039 | Ga0075435_100021231 | |||
| 1040 | Ga0075435_100829903 | |||
| 1041 | Ga0105240_10155920 | |||
| 1042 | Ga0105240_10288126 | |||
| 1043 | Ga0105240_10363256 | |||
| 1044 | Ga0105240_12622271 | |||
| 1045 | Ga0111539_10004461 | |||
| 1046 | Ga0111539_10039012 | |||
| 1047 | Ga0111539_10039823 | |||
| 1048 | Ga0111539_10043354 | |||
| 1049 | Ga0111539_10325302 | |||
| 1050 | Ga0111539_10391284 | |||
| 1051 | Ga0111539_10437143 | |||
| 1052 | Ga0111539_10510420 | |||
| 1053 | Ga0111539_10529181 | |||
| 1054 | Ga0111539_11912177 | |||
| 1055 | Ga0105245_10006555 | |||
| 1056 | Ga0105245_10344531 | |||
| 1057 | Ga0105245_10992681 | |||
| 1058 | Ga0105245_11462379 | |||
| 1059 | Ga0105245_13148137 | |||
| 1060 | Ga0105247_10024075 | |||
| 1061 | Ga0114129_10000022 | |||
| 1062 | Ga0114129_10015151 | |||
| 1063 | Ga0114129_10144721 | |||
| 1064 | Ga0114129_10308484 | |||
| 1065 | Ga0114129_11033787 | |||
| 1066 | Ga0114129_11539808 | |||
| 1067 | Ga0105243_10037226 | |||
| 1068 | Ga0105241_10557986 | |||
| 1069 | Ga0105242_10092228 | |||
| 1070 | Ga0105242_10099449 | |||
| 1071 | Ga0105242_10124901 | |||
| 1072 | Ga0105242_10182332 | |||
| 1073 | Ga0105242_10676952 | |||
| 1074 | Ga0105242_10859787 | |||
| 1075 | Ga0105242_11059746 | |||
| 1076 | Ga0105248_10020542 | |||
| 1077 | Ga0105248_10038039 | |||
| 1078 | Ga0105248_10079443 | |||
| 1079 | Ga0105248_10088070 | |||
| 1080 | Ga0105248_10602942 | |||
| 1081 | Ga0105248_10714684 | |||
| 1082 | Ga0105248_10748883 | |||
| 1083 | Ga0105248_11094111 | |||
| 1084 | Ga0105248_13201328 | |||
| 1085 | Ga0105238_10062575 | |||
| 1086 | Ga0105238_11455275 | |||
| 1087 | Ga0105249_10005474 | |||
| 1088 | Ga0105249_10024158 | |||
| 1089 | Ga0105249_10247584 | |||
| 1090 | Ga0105249_10405080 | |||
| 1091 | Ga0105249_11000045 | |||
| 1092 | Ga0105249_11594535 | |||
| 1093 | Ga0105239_12305656 | |||
| 1094 | Ga0105246_10029007 | |||
| 1095 | Ga0157345_1060804 | |||
| 1096 | Ga0157315_1005618 | |||
| 1097 | Ga0157371_10346515 | |||
| 1098 | Ga0157370_10272675 | |||
| 1099 | Ga0157369_12292903 | |||
| 1100 | Ga0157374_10062042 | |||
| 1101 | Ga0157374_10182095 | |||
| 1102 | Ga0157374_10333420 | |||
| 1103 | Ga0157374_10385606 | |||
| 1104 | Ga0157378_10304249 | |||
| 1105 | Ga0163162_10039778 | |||
| 1106 | Ga0163162_10109125 | |||
| 1107 | Ga0163162_10250174 | |||
| 1108 | Ga0163162_10468555 | |||
| 1109 | Ga0157372_10294682 | |||
| 1110 | Ga0157375_10126522 | |||
| 1111 | Ga0157375_10241535 | |||
| 1112 | Ga0157375_10331307 | |||
| 1113 | Ga0157375_10653657 | |||
| 1114 | Ga0157375_10955783 | |||
| 1115 | Ga0157375_11067227 | |||
| 1116 | Ga0163163_10036913 | |||
| 1117 | Ga0163163_10422529 | |||
| 1118 | Ga0163163_12439101 | |||
| 1119 | Ga0157380_10001081 | |||
| 1120 | Ga0157380_10025613 | |||
| 1121 | Ga0157380_10027451 | |||
| 1122 | Ga0157380_10034765 | |||
| 1123 | Ga0157380_10082068 | |||
| 1124 | Ga0157380_10108279 | |||
| 1125 | Ga0157380_10367304 | |||
| 1126 | Ga0157380_10377890 | |||
| 1127 | Ga0157380_10751252 | |||
| 1128 | Ga0157380_11060700 | |||
| 1129 | Ga0157380_11455112 | |||
| 1130 | Ga0157380_11617137 | |||
| 1131 | Ga0157380_11719375 | |||
| 1132 | Ga0157380_12817668 | |||
| 1133 | Ga0157377_10023404 | |||
| 1134 | Ga0157377_10969212 | |||
| 1135 | Ga0157379_10039529 | |||
| 1136 | Ga0157379_10088131 | |||
| 1137 | Ga0157379_10577200 | |||
| 1138 | Ga0157379_11507701 | |||
| 1139 | Ga0157376_10024742 | |||
| 1140 | Ga0157376_10232074 | |||
| 1141 | Ga0157376_12567368 | |||
| 1142 | Ga0163161_10041023 | |||
| 1143 | Ga0163161_10225218 | |||
| 1144 | Ga0163161_10248200 | |||
| 1145 | Ga0163161_10538646 | |||
| 1146 | Ga0163161_10587685 | |||
| 1147 | Ga0207697_10004532 | |||
| 1148 | Ga0207697_10061661 | |||
| 1149 | Ga0207656_10248489 | |||
| 1150 | Ga0207653_10441467 | |||
| 1151 | Ga0207682_10000614 | |||
| 1152 | Ga0207682_10194256 | |||
| 1153 | Ga0207682_10500275 | |||
| 1154 | Ga0207642_10031710 | |||
| 1155 | Ga0207688_10007026 | |||
| 1156 | Ga0207688_10122152 | |||
| 1157 | Ga0207680_10421555 | |||
| 1158 | Ga0207645_10012347 | |||
| 1159 | Ga0207645_10058019 | |||
| 1160 | Ga0207645_10110386 | |||
| 1161 | Ga0207645_10604432 | |||
| 1162 | Ga0207643_10000484 | |||
| 1163 | Ga0207643_10163035 | |||
| 1164 | Ga0207643_10323016 | |||
| 1165 | Ga0207705_11548721 | |||
| 1166 | Ga0207684_11037523 | |||
| 1167 | Ga0207707_10036044 | |||
| 1168 | Ga0207707_10079583 | |||
| 1169 | Ga0207695_10249187 | |||
| 1170 | Ga0207695_10264965 | |||
| 1171 | Ga0207663_10268543 | |||
| 1172 | Ga0207660_10709702 | |||
| 1173 | Ga0207662_10009435 | |||
| 1174 | Ga0207662_11114996 | |||
| 1175 | Ga0207657_10072984 | |||
| 1176 | Ga0207657_10656942 | |||
| 1177 | Ga0207649_10510741 | |||
| 1178 | Ga0207649_10680202 | |||
| 1179 | Ga0207649_10815587 | |||
| 1180 | Ga0207652_10296618 | |||
| 1181 | Ga0207652_10967333 | |||
| 1182 | Ga0207681_10017341 | |||
| 1183 | Ga0207681_10045666 | |||
| 1184 | Ga0207681_10071247 | |||
| 1185 | Ga0207681_10097045 | |||
| 1186 | Ga0207650_10006553 | |||
| 1187 | Ga0207650_10040900 | |||
| 1188 | Ga0207659_10000406 | |||
| 1189 | Ga0207659_10030786 | |||
| 1190 | Ga0207659_10095777 | |||
| 1191 | Ga0207659_10157589 | |||
| 1192 | Ga0207659_10710644 | |||
| 1193 | Ga0207687_10258271 | |||
| 1194 | Ga0207687_10273464 | |||
| 1195 | Ga0207687_10295402 | |||
| 1196 | Ga0207687_10659769 | |||
| 1197 | Ga0207687_11885144 | |||
| 1198 | Ga0207664_11874412 | |||
| 1199 | Ga0207644_10095237 | |||
| 1200 | Ga0207644_10505870 | |||
| 1201 | Ga0207644_10712346 | |||
| 1202 | Ga0207644_10970095 | |||
| 1203 | Ga0207644_11750925 | |||
| 1204 | Ga0207690_10389143 | |||
| 1205 | Ga0207706_10001118 | |||
| 1206 | Ga0207706_10804528 | |||
| 1207 | Ga0207686_10049380 | |||
| 1208 | Ga0207686_10070629 | |||
| 1209 | Ga0207686_10113059 | |||
| 1210 | Ga0207686_10806936 | |||
| 1211 | Ga0207709_10029270 | |||
| 1212 | Ga0207670_10060530 | |||
| 1213 | Ga0207670_10502886 | |||
| 1214 | Ga0207669_10073508 | |||
| 1215 | Ga0207669_10083164 | |||
| 1216 | Ga0207669_10243436 | |||
| 1217 | Ga0207669_10278071 | |||
| 1218 | Ga0207669_10317842 | |||
| 1219 | Ga0207669_10628500 | |||
| 1220 | Ga0207669_10822528 | |||
| 1221 | Ga0207669_11159327 | |||
| 1222 | Ga0207704_10043487 | |||
| 1223 | Ga0207704_10049142 | |||
| 1224 | Ga0207704_10103644 | |||
| 1225 | Ga0207704_10929634 | |||
| 1226 | Ga0207665_10626446 | |||
| 1227 | Ga0207691_10004848 | |||
| 1228 | Ga0207691_10021676 | |||
| 1229 | Ga0207691_10084360 | |||
| 1230 | Ga0207691_10262462 | |||
| 1231 | Ga0207691_10470138 | |||
| 1232 | Ga0207691_10567056 | |||
| 1233 | Ga0207711_10111909 | |||
| 1234 | Ga0207711_10148976 | |||
| 1235 | Ga0207711_10515621 | |||
| 1236 | Ga0207711_10698060 | |||
| 1237 | Ga0207711_11863488 | |||
| 1238 | Ga0207689_10010510 | |||
| 1239 | Ga0207689_10034547 | |||
| 1240 | Ga0207689_10218775 | |||
| 1241 | Ga0207689_10452155 | |||
| 1242 | Ga0207689_10452497 | |||
| 1243 | Ga0207689_10588056 | |||
| 1244 | Ga0207679_10033421 | |||
| 1245 | Ga0207679_10141119 | |||
| 1246 | Ga0207667_11187670 | |||
| 1247 | Ga0207667_11210306 | |||
| 1248 | Ga0207651_10081080 | |||
| 1249 | Ga0207651_10090975 | |||
| 1250 | Ga0207651_10150572 | |||
| 1251 | Ga0207712_10045610 | |||
| 1252 | Ga0207712_10163046 | |||
| 1253 | Ga0207668_10042400 | |||
| 1254 | Ga0207668_10054204 | |||
| 1255 | Ga0207668_10610246 | |||
| 1256 | Ga0207658_10077369 | |||
| 1257 | Ga0207658_11908830 | |||
| 1258 | Ga0207677_10024443 | |||
| 1259 | Ga0207677_10072569 | |||
| 1260 | Ga0207677_10113773 | |||
| 1261 | Ga0207677_10330270 | |||
| 1262 | Ga0207677_11040390 | |||
| 1263 | Ga0207703_10044075 | |||
| 1264 | Ga0207703_10094370 | |||
| 1265 | Ga0207703_10102724 | |||
| 1266 | Ga0207703_10268518 | |||
| 1267 | Ga0207703_11141866 | |||
| 1268 | Ga0207708_10003960 | |||
| 1269 | Ga0207708_10063790 | |||
| 1270 | Ga0207708_10111345 | |||
| 1271 | Ga0207708_10206090 | |||
| 1272 | Ga0207708_10962178 | |||
| 1273 | Ga0207702_11787650 | |||
| 1274 | Ga0207702_11858598 | |||
| 1275 | Ga0207641_10164474 | |||
| 1276 | Ga0207641_10341654 | |||
| 1277 | Ga0207641_10847454 | |||
| 1278 | Ga0207648_10083822 | |||
| 1279 | Ga0207648_10121641 | |||
| 1280 | Ga0207648_10122030 | |||
| 1281 | Ga0207648_10122736 | |||
| 1282 | Ga0207648_10134674 | |||
| 1283 | Ga0207648_10171257 | |||
| 1284 | Ga0207648_10297715 | |||
| 1285 | Ga0207648_10584597 | |||
| 1286 | Ga0207648_11395139 | |||
| 1287 | Ga0207648_11949256 | |||
| 1288 | Ga0207676_10737710 | |||
| 1289 | Ga0207676_11241838 | |||
| 1290 | Ga0207674_10066721 | |||
| 1291 | Ga0207674_10145830 | |||
| 1292 | Ga0207674_12109543 | |||
| 1293 | Ga0207675_100014473 | |||
| 1294 | Ga0207675_100029988 | |||
| 1295 | Ga0207675_100066711 | |||
| 1296 | Ga0207675_100243661 | |||
| 1297 | Ga0207675_100254679 | |||
| 1298 | Ga0207675_100309750 | |||
| 1299 | Ga0207675_100699842 | |||
| 1300 | Ga0207675_100715573 | |||
| 1301 | Ga0207683_10044922 | |||
| 1302 | Ga0207683_10067393 | |||
| 1303 | Ga0207683_10253225 | |||
| 1304 | Ga0207683_10265355 | |||
| 1305 | Ga0207698_11248479 | |||
| 1306 | Ga0207428_10060918 | |||
| 1307 | Ga0207428_10100198 | |||
| 1308 | Ga0207428_10494337 | |||
| 1309 | Ga0207428_10769049 | |||
| 1310 | Ga0268266_10341158 | |||
| 1311 | Ga0268266_10383969 | |||
| 1312 | Ga0268265_10073560 | |||
| 1313 | Ga0268265_10451419 | |||
| 1314 | Ga0268264_10059168 | |||
| 1315 | Ga0268264_10664193 | |||
| 1316 | Ga0268264_10668472 | |||
| 1317 | Ga0268264_12226244 | |||
| 1318 | Ga0307408_100112813 | |||
| 1319 | Ga0307408_100352594 | |||
| 1320 | Ga0307408_100468200 | |||
| 1321 | Ga0307405_10056086 | |||
| 1322 | Ga0307405_12146862 | |||
| 1323 | Ga0307413_10415967 | |||
| 1324 | Ga0307410_10006846 | |||
| 1325 | Ga0307410_10031075 | |||
| 1326 | Ga0307410_10049644 | |||
| 1327 | Ga0307410_11211912 | |||
| 1328 | Ga0307407_10071413 | |||
| 1329 | Ga0307407_11458524 | |||
| 1330 | Ga0307407_11543209 | |||
| 1331 | Ga0307412_10129588 | |||
| 1332 | Ga0307412_10697478 | |||
| 1333 | Ga0307409_100008311 | |||
| 1334 | Ga0307409_100395565 | |||
| 1335 | Ga0307416_100049811 | |||
| 1336 | Ga0307416_100117139 | |||
| 1337 | Ga0307416_100344320 | |||
| 1338 | Ga0307416_100418031 | |||
| 1339 | Ga0307416_101302715 | |||
| 1340 | Ga0307416_101495441 | |||
| 1341 | Ga0307416_103380328 | |||
| 1342 | Ga0307414_10099720 | |||
| 1343 | Ga0307414_10494466 | |||
| 1344 | Ga0307414_10589221 | |||
| 1345 | Ga0307411_10128049 | |||
| 1346 | Ga0307411_10280201 | |||
| 1347 | Ga0307411_10911141 | |||
| 1348 | Ga0307415_100532774 | |||
| 1349 | Ga0307415_100996502 | |||
| 1350 | Ga0307415_102090778 | |||
| 1351 | Ga0373958_0000363 | |||
| 1352 | Ga0373959_0001089 | |||
| 1353 | Ga0373938_0000469 | |||
| 1354 | Ga0373928_0003234 | |||
| 1355 | Ga0373929_0000122 | |||
| 1356 | Ga0373934_0083668 | |||
| 1357 | Ga0373949_0000220 | |||
| 1358 | Ga0373951_0017546 | |||
| 1359 | Ga0373952_0002068 | |||
| 1360 | Ga0373932_0040683 | |||
| 1361 | Ga0373939_0001034 | |||
| 1362 | Ga0373960_0000019 | |||
| 1363 | Ga0373960_0195614 | |||
| 1364 | Ga0373942_0000799 | |||
| 1365 | Ga0373961_0003623 | |||
| 1366 | Ga0373961_0426695 | |||
| 1367 | Ga0373962_0004785 | |||
| 1368 | Ga0373931_0004607 | |||
| 1369 | Ga0373931_0337945 | |||
| 1370 | Ga0373937_0138776 | |||
| 1371 | Ga0242420_067281 | |||
| 1372 | Ga0439439_0016621 | |||
| 1373 | Ga0439453_0110858 | |||
| 1374 | Ga0451798_0570944 | |||
| 1375 | Ga0451800_0382848 | |||
| 1376 | Ga0451807_1627663 | |||
| 1377 | Ga0451841_0185251 | |||
| 1378 | Ga0451853_0962947 | |||
| 1379 | Ga0439431_0179779 | |||
| 1380 | Ga0439433_0139157 | |||
| 1381 | Ga0439450_136212 | |||
| 1382 | Ga0439455_0208311 | |||
| 1383 | Ga0439462_0005546 | |||
| 1384 | Ga0450912_022125 | |||
| 1385 | Ga0450922_030904 | |||
| 1386 | Ga0450923_010492 | |||
| 1387 | Ga0439446_0001569 | |||
| 1388 | Ga0450908_073949 | |||
| 1389 | Ga0439434_0007256 | |||
| 1390 | Ga0439435_0159368 | |||
| 1391 | Ga0439435_0162879 | |||
| 1392 | Ga0439435_0298260 | |||
| 1393 | Ga0439444_0018807 | |||
| 1394 | Ga0439460_0352671 | |||
| 1395 | Ga0450916_008748 | |||
| 1396 | Ga0453683_0162127 | |||
| 1397 | Ga0451576_0018496 | |||
| 1398 | Ga0451576_0149972 | |||
| 1399 | Ga0451576_0160152 | |||
| 1400 | Ga0495608_0579932 | |||
| 1401 | Ga0495644_0418032 | |||
| 1402 | Ga0495598_0246687 | |||
| 1403 | Ga0495621_0011279 | |||
| 1404 | Ga0495621_0043150 | |||
| 1405 | Ga0495633_0332291 | |||
| 1406 | Ga0495656_0021928 | |||
| 1407 | Ga0495658_0281829 | |||
| 1408 | Ga0495658_0677067 | |||
| 1409 | Ga0495669_0109664 | |||
| 1410 | Ga0495670_0326804 | |||
| 1411 | Ga0495676_0305637 | |||
| 1412 | Ga0496100_0840904 | |||
| 1413 | Ga0496101_0074483 | |||
| 1414 | Ga0496102_1216579 | |||
| 1415 | Ga0496104_0061060 | |||
| 1416 | Ga0496104_0228089 | |||
| 1417 | Ga0496104_0370323 | |||
| 1418 | Ga0496104_1070886 | |||
| 1419 | Ga0496105_0425295 | |||
| 1420 | Ga0496105_0675882 | |||
| 1421 | Ga0496106_0096359 | |||
| 1422 | Ga0496106_0185777 | |||
| 1423 | Ga0496106_0261570 | |||
| 1424 | Ga0496106_0263276 | |||
| 1425 | Ga0496106_1166676 | |||
| 1426 | Ga0496107_0194772 | |||
| 1427 | Ga0496108_0050005 | |||
| 1428 | Ga0496108_0191075 | |||
| 1429 | Ga0496109_0056342 | |||
| 1430 | Ga0496109_1954131 | |||
| 1431 | Ga0496110_0087287 | |||
| 1432 | Ga0496110_0765169 | |||
| 1433 | Ga0496110_1559842 | |||
| 1434 | Ga0496110_1711353 | |||
| 1435 | Ga0496112_0003844 | |||
| 1436 | Ga0496112_0126108 | |||
| 1437 | Ga0496112_0550687 | |||
| 1438 | Ga0496113_0204173 | |||
| 1439 | Ga0496113_1501668 | |||
| 1440 | Ga0501031_0134902 | |||
| 1441 | Ga0501031_0380741 | |||
| 1442 | Ga0501032_0027604 | |||
| 1443 | Ga0501033_0237124 | |||
| 1444 | Ga0501034_0324633 | |||
| 1445 | Ga0501034_0421533 | |||
| 1446 | Ga0501034_0520353 | |||
| 1447 | Ga0501034_0825822 | |||
| 1448 | Ga0501036_0016973 | |||
| 1449 | Ga0501036_0574043 | |||
| 1450 | Ga0501037_0066290 | |||
| 1451 | Ga0501037_0196299 | |||
| 1452 | Ga0501038_0014527 | |||
| 1453 | Ga0501038_0539123 | |||
| 1454 | Ga0501039_0039567 | |||
| 1455 | Ga0501039_0044090 | |||
| 1456 | Ga0501039_0139705 | |||
| 1457 | Ga0501040_0052621 | |||
| 1458 | Ga0501040_0701408 | |||
| 1459 | Ga0501040_1108039 | |||
| 1460 | Ga0501041_0095739 | |||
| 1461 | Ga0501042_0137505 | |||
| 1462 | Ga0501042_0140934 | |||
| 1463 | Ga0501042_0204244 | |||
| 1464 | Ga0501042_0586078 | |||
| 1465 | Ga0501043_0009137 | |||
| 1466 | Ga0501043_0398313 | |||
| 1467 | Ga0501046_0105626 | |||
| 1468 | Ga0501046_0210252 | |||
| 1469 | Ga0501046_0337915 | |||
| 1470 | Ga0501046_0785021 | |||
| 1471 | Ga0501047_0003455 | |||
| 1472 | Ga0501047_0043057 | |||
| 1473 | Ga0501047_0147321 | |||
| 1474 | Ga0501047_0166637 | |||
| 1475 | Ga0501048_0135735 | |||
| 1476 | Ga0501048_0806456 | |||
| 1477 | Ga0501067_0204935 | |||
| 1478 | Ga0501068_0012479 | |||
| 1479 | Ga0501068_0131972 | |||
| 1480 | Ga0501068_0825220 | |||
| 1481 | Ga0501069_0886615 | |||
| 1482 | Ga0501070_0087886 | |||
| 1483 | Ga0501070_0950080 | |||
| 1484 | Ga0501071_0115309 | |||
| 1485 | Ga0501071_1250853 | |||
| 1486 | Ga0501072_0011481 | |||
| 1487 | Ga0501072_0041273 | |||
| 1488 | Ga0501072_0132481 | |||
| 1489 | Ga0501072_0637364 | |||
| 1490 | Ga0501072_1235659 | |||
| 1491 | Ga0501073_0029699 | |||
| 1492 | Ga0501073_0052222 | |||
| 1493 | Ga0501073_0053032 | |||
| 1494 | Ga0501073_0158184 | |||
| 1495 | Ga0501073_0186285 | |||
| 1496 | Ga0501073_0863021 | |||
| 1497 | Ga0501074_0087092 | |||
| 1498 | Ga0501074_0458798 | |||
| 1499 | Ga0501075_1183136 | |||
| 1500 | Ga0501076_0140316 | |||
| 1501 | Ga0501076_0203837 | |||
| 1502 | Ga0501076_0236787 | |||
| 1503 | Ga0501076_0291078 | |||
| 1504 | Ga0501076_0518990 | |||
| 1505 | Ga0501076_0600330 | |||
| 1506 | Ga0501077_0165747 | |||
| 1507 | Ga0501077_0173675 | |||
| 1508 | Ga0501077_0242146 | |||
| 1509 | Ga0501077_0504417 | |||
| 1510 | Ga0501209_115908 | |||
| 1511 | Ga0501211_050034 | |||
| 1512 | Ga0501234_036452 | |||
| 1513 | Ga0501079_0171663 | |||
| 1514 | Ga0501079_0437325 | |||
| 1515 | Ga0501079_1267594 | |||
| 1516 | Ga0501080_0070575 | |||
| 1517 | Ga0501080_0116751 | |||
| 1518 | Ga0501080_0678146 | |||
| 1519 | Ga0501081_1529509 | |||
| 1520 | Ga0501081_1544061 | |||
| 1521 | Ga0501083_0001245 | |||
| 1522 | Ga0501083_0023297 | |||
| 1523 | Ga0501083_0626916 | |||
| 1524 | Ga0501279_106790 | |||
| 1525 | Ga0501035_0064275 | |||
| 1526 | Ga0501035_0173055 | |||
| 1527 | Ga0501035_0405978 | |||
| 1528 | Ga0501044_0050570 | |||
| 1529 | Ga0501044_0319471 | |||
| 1530 | Ga0501044_0681721 | |||
| 1531 | nmdc:mga00v17_326562_c1 | |||
| 1532 | nmdc:mga00v17_610046_c1 | |||
| 1533 | nmdc:mga0yw44_2948_c1 | |||
| 1534 | nmdc:mga0k408_395357_c1 | |||
| 1535 | nmdc:mga05p37_251387_c1 | |||
| 1536 | nmdc:mga05p37_36168_c1 | |||
| 1537 | nmdc:mga05p37_407531_c1 | |||
| 1538 | nmdc:mga05p37_663193_c1 | |||
| 1539 | nmdc:mga05p37_83_c1 | |||
| 1540 | nmdc:mga09592_104665_c1 | |||
| 1541 | nmdc:mga09592_347152_c1 | |||
| 1542 | nmdc:mga09592_749825_c1 | |||
| 1543 | nmdc:mga0qj67_171986_c1 | |||
| 1544 | nmdc:mga0qj67_852819_c1 | |||
| 1545 | nmdc:mga06r32_1742060_c1 | |||
| 1546 | nmdc:mga08y16_1009930_c1 | |||
| 1547 | nmdc:mga08y16_110695_c1 | |||
| 1548 | nmdc:mga08y16_1166173_c1 | |||
| 1549 | nmdc:mga08y16_1181980_c1 | |||
| 1550 | nmdc:mga08y16_124696_c1 | |||
| 1551 | nmdc:mga08y16_1298965_c1 | |||
| 1552 | nmdc:mga08y16_1689944_c1 | |||
| 1553 | nmdc:mga08y16_17209_c1 | |||
| 1554 | nmdc:mga08y16_288984_c1 | |||
| 1555 | nmdc:mga08y16_446074_c1 | |||
| 1556 | nmdc:mga08y16_6792_c1 | |||
| 1557 | nmdc:mga08y16_825409_c1 | |||
| 1558 | nmdc:mga0n895_11960_c1 | |||
| 1559 | nmdc:mga0n895_15068_c1 | |||
| 1560 | nmdc:mga0n895_1542124_c1 | |||
| 1561 | nmdc:mga0n895_17_c1 | |||
| 1562 | nmdc:mga0n895_2039_c1 | |||
| 1563 | nmdc:mga0rr50_144118_c1 | |||
| 1564 | nmdc:mga0rr50_1608_c1 | |||
| 1565 | nmdc:mga0rr50_24_c1 | |||
| 1566 | nmdc:mga0rr50_702651_c1 | |||
| 1567 | nmdc:mga0rr50_804666_c1 | |||
| 1568 | nmdc:mga08x19_164_c1 | |||
| 1569 | nmdc:mga08x19_517657_c1 | |||
| 1570 | nmdc:mga08x19_7373_c1 | |||
| 1571 | nmdc:mga08x19_914790_c1 | |||
| 1572 | nmdc:mga0a205_11547_c1 | |||
| 1573 | nmdc:mga0a205_17017_c1 | |||
| 1574 | nmdc:mga0a205_212874_c1 | |||
| 1575 | nmdc:mga0a205_599171_c1 | |||
| 1576 | nmdc:mga0a205_72607_c1 | |||
| 1577 | nmdc:mga0a205_92_c1 | |||
| 1578 | Ga0500646_0007759 | |||
| 1579 | Ga0500656_045039 | |||
| 1580 | Ga0501084_0009505 | |||
| 1581 | Ga0501084_0061658 | |||
| 1582 | Ga0501084_0933784 | |||
| 1583 | Ga0501084_1693949 | |||
| 1584 | Ga0590071_002122 | |||
| 1585 | Ga0590075_000750 | |||
| 1586 | Ga0590077_001671 | |||
| 1587 | Ga0501082_0074877 | |||
| 1588 | Ga0501082_0285896 | |||
| 1589 | Ga0530510_0036842 | |||
| 1590 | Ga0530510_0636240 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9623 | 11 | 82 |
| 6j0e-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9439 | 11 | 82 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9419 | 19 | 74 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.933 | 19 | 73 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.932 | 7 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9765 | 11 | 81 | 1.10.10.10 |
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9764 | 18 | 73 | 1.10.10.10 |
| af_Q58184_329_408_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9564 | 16 | 76 | 1.10.10.10 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9552 | 30 | 72 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9514 | 16 | 73 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662S1R9-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9888 | 11 | 83 |
GO:0003700
|
| AF-A0A352A5I9-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9878 | 11 | 79 |
GO:0003700
|
| AF-F3Z0D3-F1-model_v4 | Regulatory protein ArsR | 0.9878 | 11 | 88 |
GO:0003700
|
| AF-A0A0S8DZL8-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9847 | 11 | 89 |
GO:0003700
|
| AF-A0A645H396-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9845 | 11 | 83 |
GO:0003700
|